4DLYA

Set 1 cacl2/dtt, ordered off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlyA00
1H65A 1T3HA 4JL8A 3A4MA 2QEQA 1G6OA 1Z6YA 4UNPA 1BS1A 2ZIAA 1G4AE 2ATXA 1Z3IX 3Q85A 2H5EA 3QJYA 2ZRFA 1YZTA 2GCNA 4TMTA 1U98A 2PLRA 2XXAB 1W4AA 4JKYA 1VPLA 4GP7A 1UKZA 1A5TA 1OXTA 1VCOA 1SKYB 1UDWA 2Q21A 5AJVB 4DB4A 3RS5A 1KYIA 4Q18A 1OB5A 2X19A 1IN7A 1L2TA 2EWVA 2V1XA 2PX0A 4IRUB 3QBTA 1TF2A 2VHUA 4LBYA 1BYUA 1SVKA 4B35A 5H68A 4C2TA 2CL0X 2R65A 3FHCB 4NCNA 5GJWC 5FOTA 1P7CA 5CB6A 1W36B 1I4LD 2FZLA 4JS0A 3Q7QA 4FI3C 4HAZA 4S2EA 2ZRDA 3OIUA 2FPLA 3ZDQA 4NH0A 3EZFA 4TMXA 1RRCA 1H8ED 3DOEA 3PUYA 5EJEA 3LLUA 3FFAA 2R9VA 5JS8A 5FPSA 4DB2A 3P1JA 1N6KA 2WSSA 1E9RA 4RVCA 1E9SA 1I4DD 2G0NA 1SXJC 4I99A 4C7OA 3R8FA 2UZ3A 1NY5A 5M04A 2G3YA 2DCUA 1NLYA 3BH0A 4RSGA 5AUQA 1R5BA 4CVNA 2CNWA 2QQEA 2R6FA 5C18A 1YR7A 3U60B 3K0SA 4QOSA 1SULA 4FCWA 3F3YA 4AC9A 4A0GA 4P4SB 2OAP1 4CEHB 1YE8A 4PC2A 5KPDA 3EIQA 4WIAA 3GLFB 1D2MA 4M2LA 3SDZA 4HAUA 1X8JA 1DO0A 4US2R 4PO9A 1G21E 3IPXA 5TVKA 5KOYA 3MJRA 1SKQA 2I1QA 3BE4A 5CB8A 3C7KA 2C9YA 2ZR7A 3CWQA 1ZCAA 1DAFA 3IHLA 2W2TA 4NKRA 2ZU6A 3LRPA 3SQWA 1E1QA 1W2GA 4MQBA 3TIFA 5JEDA 2HCBA 2WKRA 3L8ZA 1SVMA 1ZM3A 4PO8A 4OHZA 4AG6A 4KJZA 3B1ZA 3TKLA 2ZJ5A 3RS3A 1EFRA 2QMHA 3ZLJA 1JJ7A 1F6BA 1G18A 4W9MC 5HE8A 2EFGA 3U7GA 4LJ8A 4GNKA 2VQSA 1LF0A 4FXPA 3SJCA 4HAVA 4TT3A 4DUGA 5FBQB 3REFA 3Q9LA 5JS7A 3LX8A 2VSOA 2NO7A 5CYOA 4E22A 2QSZA 1FTNA 3TW8B 3WMFA 5J4LA 2DFLA 2D4HA 3W6OA 4KITB 1U2RA 5AJXA 4W5WA 2JIZA 4NTZA 3BB4A 2G1KA 5DH9A 2XZOA 2OBMA 1F3OA 4XVQA 2C99A 3ZIAA 4FD2A 5BYKA 4O2RA 2ZJOA 5JCZA 1KI1A 1C9KA 3A1VA 1JECA 3QKSB 3K0AA 3QKRA 1NG1A 3RHFA 4WXRA 4EFMA 4I1UA 3JVVA 1HT2E 1N6HA 4KHZA 3BFKA 4KSBA 5IDVA 2VA8A 3GFOA 5A0FA 4A8JB 4CEIB 3O8RA 2ORVA 4ESVA 4OHVA 5E7IA 2WM9B 2GEVA 3F8TA 2HT6A 4HZUB 4G0NA 4OQXA 5BN4A 1ZNZA 2GBLA 4MYTA 3T1OA 1WBDA 1ZU5A 3ZYCA 2IX3A 3IBGA 4UNSA 3KQUA 4KFTA 4AYWA 2XTZA 2XEXA 5KYKA 2DHRA 2XAUA 2ZRKA 3MSXA 3OHMA 3SEAA 2J7PA 1XMVA 4PZLA 1MT0A 4W7SA 2XZLA 3EARA 1UAAA 1P9NA 5DN6D 3Q7PA 1T6NA 1AKYA 2RGAA 4HI0E 1J2JA 4NDZA 5BQ5A 3GEIA 2BKEA 4DSUA 5EXXA 2AN9A 4Q7KA 4L9SA 2VP5A 3FTQA 3I5XA 3LBNA 2RGNC 4D80A 121PA 2BCGY 4UJ3A 4IEEA 4L8GA 5J4HA 1P2VA 5JZVA 3GFPA 3TSOA 5KTYA 1IONA 5HR5A 1HE8B 3B82A 5CLQA 1GIAA 3GD7A 3AF3A 2GAAA 1KZ7B 2GK7A 4DCSA 2FE4A 1UKVY 1LVGA 3T35A 4NMMA 1QHHA 3OIVA 3SS8A 3NWJA 1E79D 3M4YA 5B64A 2CJWA 1OIWA 2PL3A 2YOHA 4LI0A 1SVIA 3E2IA 3L0IB 3WXMA 4Z1MA 1U99A 3IIKA 3GLIE 4DLVA 5FUWA 1M7GA 2WWIA 1GL6A 2Z0MA 4LHXA 4Q4HB 2D7CA 4US0R 1UKEA 3U4QA 3ZVMA 4MUBA 4RD2A 1N6NA 2WWHA 4EPWA 2D7DA 2JJ2D 3FWYA 1OV4A 2HLDD 2C77A 3BJIC 4PAOA 4F91B 1LNZA 1M7BA 2AX4A 1VCNA 3FMIA 4IOJA 3KJHA 2GHIA 1JR3A 4N3NA 2ZVQX 4Q9JA 4B43A 4U5XA 4DDTA 2F1IA 1OXSC 4JLVA 5GJCA 5C2JB 4RY2A 3CH4B 5CLLA 1VCMA 1EFCA 1XD2A 2WJHA 3TUIC 1KI7A 4EJSA 2YKGA 1S9HA 3PFIA 1N5KA 1R4AA 2FSHA 3CNNA 4YXWD 2ZJZA 4YMTA 4ACAA 3PCRB 4Q4JB 2C98A 5TB5A 2WIAA 1FPMA 4MGZR 2FV8A 521PA 3OF5A 2F6RA 4JBXA 3TH5A 4TYQA 1JAIA 3TAUA 2PT5A 2B8TA 2DYKA 3RLFA 1CJKC 1D9ZA 1W2HA 3TAHA 2R6GA 4LPKA 1RJ9A 2BBTA 3NXSA 2Q3MA 1NBMA 5GVSA 3AP1A 1GNPA 1QF9A 2XB2A 1W5TA 5DYIA 3FVQA 5DGXA 4M53A 1E6CA 1Z83A 2BIFA 2KB0A 3ZD7A 1ZUNB 2PMKA 4AY2A 2XITA 3KDSE 1E0SA 4RFVA 1M1YE 2RGBA 2YWHA 3OEED 2YV5A 1VTKA 3AVWA 3GQBA 3ZS9A 3HP1A 2J1LA 3EG5A 2C78A 3K70C 5AUPB 4PQFA 1R6BX 4BLQA 1GZSA 1KSGA 4Q9KA 1SXJB 2HUPA 1VG8A 4OQNA 3U6KA 2F3RA 1NN5A 4CT4B 2Z43A 4MITA 1T4GA 1RPZA 1P5ZB 1GP2A 1N5LA 1EWRA 1ZCBA 1JI0A 2CMKA 3K9NA 1T8TA 4OL0A 1F2UB 1JR3E 2V7QA 3A4LA 3TNFA 5KSPA 3ZZTA 1Z47A 4BEBA 4M1YA 2WPDD 4LHYA 5EP1A 3SHFA 1E2IA 3SBDA 1XEWX 2ZE6A 4TQAA 1W47A 3QOFA 1GAJA 4QHYA 4R98A 1XWIA 3MGCA 1JPNA 5AUOB 4FMCB 3EZ6A 4LHZA 5E7MA 1BH2A 3X1DA 3NBXX 3AF4A 3VQTA 4U7DA 1QG4A 1W0JD 3QXHA 3RVBA 5L3VA 4LYHA 4PPQA 3D3QA 4C0JA 2LKDA 1KMQA 1GRRA 1G7TA 2B92A 3AVQA 4XTRA 4LY6A 1E9AA 5GVRA 5D3QA 3K9LA 4X8LA 5DIFA 4G5GA 1P75A 1G7RA 2NZ8A 3NEJA 2UZIR 4DDVA 1LY1A 1OYWA 1KK2A 1MABB 4EDHA 3OIWA 3WRYC 3AUXA 1E32A 1ZW6A 2HV8A 4M4SA 1RVDA 3FYHA 1W7AA 1ETUA 2PCLA 2YYZA 4IDHA 5F3WB 4UQOA 2DR3A 1GITA 2AL7A 1J90A 2IC5A 4GRAA 3L0OA 3VHXA 3RYTC 4C3ZA 1W4BA 1GKIA 4BFZA 1ONBA 1Z6AA 1KI3A 2BEJA 2V6IA 4TL8A 4YONB 4ASUA 3FHOA 4PQYA 2O52A 3OESA 1AQUA 3VKHA 2HCJB 3I8SA 2OILA 3L82B 3AB3A 4Q48A 4PHFA 4EPYA 4XD7D 1R0XA 1VDZA 4C0KA 4X8HA 2D2FA 2OXCA 2V6JA 3FFBA 2EFEB 4EFLA 1II9A 2OUKA 4AKEA 3DVLA 1B23P 1XDBA 5AJWA 1XTKA 2H7VA 2ZYVX 4MKFA 4DSTA 1E96A 1KI4A 1Y3AA 2WAXA 2GXUA 1T91A 3AVPA 1G4UR 2AK2A 5DHAA 1E2PA 2QAGA 1BOFA 3QVUA 1DPFA 1E9EA 4TSFD 1WA5A 4A15A 3T1TA 5JRZA 1N6PA 1QVRA 2NMVA 3M0EA 2ZSDA 2CEAA 3BFVA 1YR9A 3CWZA 2WJJA 4URZR 3GJ4A 1W4CA 3GCGA 2IYLD 3ZJYA 1ZINA 5JWOA 2NGRA 3K0CA 3QXJA 3K9HA 3RNLA 4TYNA 2Z4RA 1U90A 3IKJA 4N0DA 3U6BA 1G8HA 1Q1BA 1SVOA 5FOUA 3QE0A 4GFDA 1ZU4A 2ZUBA 2DWOA 4TTQA 2BJVA 3WP0A 2QT1A 2QZ4A 4Q1DA 2JATA 3ZD6A 2NO1A 1H8HD 1GILA 1SVWA 2YJTD 4XVUA 3UK6A 3JVUA 1X8LA 1TTTA 2RB4A 1AGRA 1BMFD 1KGDA 2ZYWX 3W34A 1QHYA 1KIMA 3K09C 1Q21A 2D3WA 4KBFA 4BFVA 4IDQA 3AVYA 1D9XA 2J46A 1UADA 4TTRA 1NI3A 1XMSA 1HURA 4CF7A 4YLGA 1VMAA 4NBSA 2IWRA 2HXSA 1QHXA 4BASA 3CRMA 4MKHA 1KDOA 3M1IA 1II8A 2IS6A 1W0JA 4I1SA 1X1SA 4IEIA 3RDPA 4CRWB 1ZNXA 4BWYA 3K8YA 4OQFA 3QXCA 1T3LA 3T06B 2P6UA 4KVGA 2CVFA 1XEFA 3C41J 4LGMA 3VR4A 4A92A 3EASA 1RRGA 3LVRE 3W3ZB 5DHFA 3IQXA 3V00A 1KMHA 3RABA 3IEVA 3EXAA 4PZYA 4AWXA 1IN5A 1J8YF 1OXXK 3UKDA 3U44A 5L3QB 3C14C 1BO6A 3KQKA 2IYVA 2DFTA 1CR2A 2VP4A 1G5PA 3BD9A 1OKKD 4IOMA 5LB2A 4D4JA 4AKGA 1RFLA 1DG1G 2ERXA 1DAGA 2IYSA 4CZ2A 5HE9A 4DCUA 4ZIRA 4Z51A 2BOVA 4TL6A 1Q0UA 4Q5IA 2ONKA 4A9AA 4B76A 2MMGA 1E1RA 3AGPA 4PSKA 4NZYA 1KKLA 2V4ZA 3I32A 2W6IA 2QPTA 2ZR0A 3MWLA 1NLFA 2W6JA 4PQRA 3NVAA 4MGYR 1Q57A 4C0HA 1XRJA 3FGNA 4WXPA 1U9IC 1Z0FA 1FZQA 5FI1B 5IK2A 5KO2A 2AHOA 1HUQA 4Q03A 4LYFA 4A36A 4A0FA 2ZQ5A 4TZ0A 3HR7A 4OK3A 3AV0B 2DY1A 4GP6A 2V8OA 3FMFA 4XWAA 4PX9A 1NN0A 4HB2A 1OH6A 1I4TD 4FWIB 3P26A 2OG2A 3OAAD 3DMNA 5FR2A 3RANA 3W8RA 2HJVA 4MGIR 3OZXA 3C8UA 2G6BA 3ADDA 1I2MA 5H70A 4IJMA 1XJQA 4C9BA 1E2QA 1ZYUA 4QXAA 4B3BA 4GL2A 1TUEA 4M8NE 3HJNA 3OFND 5G41A 1E2GA 1UPTA 2J45A 4IW3B 3CO5A 1KY3A 2R2AA 4XOIA 3T15A 3CUEF 4J0QA 2YVUA 1DTSA 3HU1A 4RKFA 3TE6A 2J0UA 4WZ6A 3U7EB 3CLVA 3RS7A 3OEHD 2ZJYA 4HYYA 3QPUA 1MRSA 1J99A 2ZRLA 1KAGA 3A8TA 4C2UA 1ODFA 1FL9A 5F9FA 2WWYA 4OJQA 2KBFA 2ZE5A 4MKGA 2I4IA 5FUYA 4MRRA 3W6PA 2ZM5A 2OV2A 3ECCA 1OH7A 4OK5A 4URXR 3ICQB 1KSJA 1OXVA 2FA9A 3AQ4A 1X3SA 3QG1A 3MWJA 1PJRA 3MAAC 4YDHB 3T5DA 1CJTC 1GDDA 1F2TA 4RKEA 2XB4A 1N25A 2ZUDA 3K0AB 3X1YA 3AF0A 4M9XA 4YC7A 1W44A 3KUCA 3RSOA 3T61A 4B6FA 4JMPA 3SU8A 1JXMA 1U0LA 4G5RA 4U00A 2BV3A 2OEPA 3GJ8A 5FL7D 1JR6A 2A5JA 3QF7A 1KTVA 4XWOA 1C4OA 1KDPA 4BQSA 1IM2A 1W0KD 4B2IA 4PC3A 4A8JC 4M9ZA 4KODA 4OI0A 2IA5A 1OT3A 2FEMA 2AK3A 1ESMA 2RHMA 2Q9CA 3DL0A 3IPYA 4ON9A 2ZI3A 2QNRA 3B1XA 2Z83A 2E1RA 1NVUQ 3WNBA 2GESA 4RD6A 5CITA 1GWNA 3BB3A 4QL3A 1E2MA 4OHXA 3KKOA 5L3RA 3BXZA 2ORWA 2DFNA 5EE3A 4V0OA 4O0MA 2GEUA 3QSYA 5EUQB 3VR2A 5DE3A 4JT2A 2Q3FA 3QIAA 3CRW1 2VEDA 2XZPA 2I3BA 3GEHA 3QF4A 4Q9HA 1S2MA 2J3EA 4GOJA 4YQFA 3EIEA 5LDDC 1XCMA 4HLUC 4DKXA 4FWTA 4JLNA 3K53A 1UDXA 2H18A 4BEJA 3CX7A 2IXEA 1YZQA 5H1YA 4E07A 5JLJA 2WJYA 4B74A 4BLTA 2G83A 3PVSA 4QBFA 2GF0A 5KSOA 1CULC 4ACBA 3SHWA 4JJKA 4UNRA 3F0TA 4YMSA 3SJBA 1QHHB 1KOFA 1R10A 1WBBA 1US8B 2A5YB 2CJWB 3WHKA 3TSWA 3U3KA 3LW8A 2FG5A 3TBKA 3THWA 1GNRA 2ZANA 3BB1A 1DAHA 1N2CE 1FOEB 1P2TA 3H1TA 3U4QB 3IO5A 2ZSBA 1U8AA 2HYDA 2N46A 2IT1A 4MRPA 1WB9A 3ZZUA 1PLLA 2XOKA 2EVWX 3R20A 1Z63A 2BCJQ 4XJXA 4D4KA 3NKVA 2PJZA 1XTRA 1P9WA 4B3CA 3A1UA 2JJ1D 2ZI7A 4JYBA 4KI0A 4DBLC 4QJ3A 3SQXA 4EUNA 6Q21A 3LBIA 1Z29A 4B47A 1M74A 3TVTA 1KAOA 4MRVA 3K70D 3B5JA 3DO6A 4F4IA 3Q3JB 4N0EA 3ASYA 1KO8A 1VYTA 3WYGA 4Q4AB 3NH9A 3QI2A 3KJIA 2YNMA 3EA5A 2X2FA 4R2IA 2A9KA 3A4NA 2BM0A 1R8SA 2QMEA 5F2EA 1GSIA 1X1RA 1JQLB 2FSIA 2GXAA 3RWOA 4DCNA 1RJ9B 5J4YA 4JVLA 2C9CA 1E9FA 4M9SA 4EPVA 2QTFA 2O8EB 3AUYA 3FPAA 4HAYA 4TYPA 1P6XA 2ZRCA 3WMGA 1Z6XA 2ZI9A 4KSCA 1OLOA 3MCAA 1CR1A 3LO5A 1UFQA 3BGWA 2GJ8A 4PO1A 2HF8A 2IUSA 1PVOA 5JHGB 3KTAA 3KJEA 5SZIA 4LBZA 1SZPA 3HPRA 5HKKD 1K5DA 3KX2A 4FCTA 2B7CA 5G40A 3KFVA 2IBMA 3AF1A 2IHBA 1G8YA 1Q3TA 1L8QA 4DIDA 2GK6A 3PENA 1DELA 4RZ2A 4F7WA 2OT3B 5E95A 5KDDA 1OW3B 2O0HA 1OFTA 4ZI2A 2VO1A 1RC8A 2RHDA 4LRWA 3R7WB 3IIJA 1JQJC 1E2LA 2QP3A 4L16A 1MV5A 4P33A 3THXA 3TK1A 3MD0A 2BWJA 3ZQ6A 4RD1A 1G3MA 3DOFA 2ZITA 2XX3A 3E70C 3X1XA 2ZXUA 2RGXA 4L9WA 2KBEA 5CIWA 2GCOB 2Q0HA 2GZAA 3PEUA 2IYWA 4BLPA 4BUJA 2F9MA 5G3ZA 1UM8A 4FCVA 3I62A 2ZSFA 3I92A 1OB2A 2ZI5A 4RZUA 2JDIA 5EXSA 1Q20A 1EX7A 4DWJA 3ADKA 5LB4A 1S9DA 4P3YA 4B3XA 1HEIA 4MKIA 4LK2A 5LD2B 4Z54A 1U94A 1WF3A 1Z28A 5DSZA 5BW8A 5JJKA 4O25A 1W1WA 4G1UC 2GF9A 1T5LA 3PEWA 1IQPA 1EESA 2W83A 3SC3A 2B21A 1XTSA 4ZDKA 1CJUC 1M34E 4KFSA 5FR1A 4IVRA 1IHUA 1HT1E 1JPJA 4AIIA 2AWOA 2NO0A 2QN6A 1QVAA 3PG5A 3LVQE 4HDOB 3A58B 4NCJA 3ZVRA 3HWSA 3QXSA 5DI9A 4R7ZA 1EG7A 2ODEA 5HTKA 4AKHA 2J0QA 1XFAA 4RD0A 3TR0A 3WNDA 2WWFA 4Q1CA 2OFOA 3QEOA 2XNDD 3MG9A 2QBYA 4JBYA 5C4MA 4B33A 1IY1A 1CU1A 3CX6A 3EC2A 4A4DA 4M22A 5F9HA 1AIPA 1NN3A 3B2EA 3GLIA 3MMPA 2O8FA 1XMJA 2CDNA 1FMJA 1S96A 2NO9A 1G1MA 4G5SA 3JZAA 3CM0A 1FUKA 4FN5A 1NMZA 4NYIR 4DXAA 2FSFA 3HYRA 3WYAA 2C04A 1CEEA 5DLQC 4CT5A 4ZDWA 2JEOA 3KKPA 1J8MF 2FGKA 3WHLA 1DVRA 4DCVA 2PZGA 1KY2A 4WOPA 2QMUA 3VFDA 1H8EA 3E5HA 5K8LA 1D2EA 3X1ZA 1ZD8A 3H86A 2D06A 2QUZA 2JLVA 5JBQA 1JEEA 5J40A 3P27A 4KFRA 4RCZA 4S35A 1E0JA 4M1MA 3VAAA 2ZRNA 1NMXA 1DO2A 1YZLA 2VLIA 3N2IA 4A0RA 1CRPA 4X8MA 2P5SA 2YOGA 4ZV4A 2VSXA 3AKEA 4JKIA 3P4YA 3BAFA 4LSGA 5EE0A 5JWHA 4CEJA 1XEXA 2NIPA 5EQTA 1TNDA 1Q1QA 3O8DA 4M9QA 5SZJA 3EC1A 1XP8A 1DS6A 1AN0A 2WKPA 1N0WA 1UEIA 4OQMA 1W36D 1AK2A 1XF9A 5C4GB 5TY0A 2EYQA 1FNMA 1IN8A 4RJLA 1CJVC 1ZC4A 4TWZA 5IRCD 1XNJA 2HYIC 1WCV1 2OLJA 2WICA 4B3FX 5JJLA 1GOTA 2FF7A 3CZPA 2O8DB 3BFXA 4AYXA 1WQ1R 4CW7A 1YR6A 2A78A 4QJ4A 2J0VA 4BPBA 1KI6A 3GEEA 1II8B 2ONJA 4ZDJA 3QUSA 2FFAA 1NLZA 4POAA 3C5HA 2CE2X 2PZEA 2VSFA 3CZQA 4LJYA 4TLAA 3MFYA 5L3SB 1ZMXA 5AUNB 1P60A 4EQ6A 5J47A 4V0LA 1KMHB 3X1WA 4AD8A 1PV4A 1ZJ6A 3NH6A 1Q12A 2OCYC 5A4JA 2FH5B 5KU1A 4D25A 1MO4A 4HDCA 4Q4LA 4Q9LA 4BFUA 1XXHA 4EPXA 1U81A 4KCGA 2AWNA 4FINA 4M1WA 1TMKA 2ZUCA 2WMOB 3GLHE 4TL9A 2BVNA 5SZKB 2VYFA 1N6LA 2QPOA 3TR5A 1M8PA 1YVDA 4TQ9A 3T1VA 4ZIRB 2C2HA 4W5JA 5FH9A 4V0KA 2SHKA 3VNUA 4OKSA 4NCHA 1LW7A 5HZKA 1CF4A 2G9NA 4Q1BA 4Q7LA 2F9LA 4JLOA 2DBYA 5JFGA 3THYA 4PANA 4RCYA 3H84A 3T5GA 1OFUX 2CCKA 4LPSA 1T0HB 1Z0IA 2PCJA 1EGAA 2OZEA 4HB0A 4YDSA 2O8BB 2WJIA 1GG2A 4LDJA 2O0KA 4UXIA 1SHZA 4K8OA 4LOAA 5BYJA 3LV8A 4R2HA 3JZMA 3W5JA 1R8QA 4TMWA 1IAQA 5A5GA 3LQRA 1D5CA 1IXSB 2B7BA 4URYR 1E4VA 4LWZA 1OH5A 2PLFA 5ELXA 1P72A 2ZPTX 4LV8B 1Q1EA 3ZS8A 3G82C 2O8CB 3NC1C 1QHGA 5CK5A 3IIMA 1E99A 2IUUA 2WWGA 3DHWC 1E2NA 1XCPA 5TARA 3SYNA 2YC2C 3RC3A 3MLEA 1E2FA 4UXJA 5DN6A 4IFEA 4DHEA 4IOKA 1COWD 3UMRA 2GCPA 4PC6A 1W4RA 3RSLA 2J7KA 1KK0A 1XX6A 2QRZA 4URUR 1CR0A 2ZJAA 4OI1A 4LJ5A 2WSMA 5GADl 1LS6A 1GUAA 1RYHA 2GJAA 2TMKA 1JXOA 2GJ9A 2JLRA 821PA 5EP2A 1N0VC 1XXHE 2PZFA 2WIBA 1DADA 2FZ4A 1EWQA 3GLGE 1CIPA 3RAPR 4LBVA 2F1HA 1OHHD 1G8GA 1S0UA 2A7QA 4G3XA 3GJ5A 4B32A 1E9BA 4BRUA 3AM1A 1DEKA 2PT7A 2G1JA 5E3HA 3AVUA 3I72A 1E79A 1T5IA 1UBCA 3UIEA 1KZGB 4FW9A 3NC0C 3CF6R 2CLSA 4ARZB 1A7JA 3B1YA 2YZ2A 2UKDA 4ZI3A 2AFHE 4YMWA 5DISB 1G3RA 4ERNA 1AQYA 4GBMA 4HAXA 1F2TB 2JJ2A 1WMSA 2HLDA 3GLFA 1TQ2A 3V9PA 3TGPA 5CJ2A 1SVSA 3NG1A 2A3RA 3NIBA 4II7A 3WBJA 4NE2A 4DSNA 4JJZA 4TTPA 2KJQA 2PX3A 4TLDA 4DLYA 2CK3D 2VIIA 3ASZA 4Q7JB 1ZUIA 4B3GA 2OHFA 1KO7A 4FMDB 5EZ5A 2DB3A 4LJ4A 4Q19A 1QDEA 2GBLC 3BORA 4YXWA 1ZNWA 3SYLA 3VR1A 3I4LA 4OQLA 1NIPA 3ZH9B 3M6AA 1SKYE 3DDCA 1NMYA 2Z6VA 5FBVB 2QPAA 3DEFA 3I8XA 2ZJBA 4GMDA 2G0TA 1K6MA 1E2DA 2CCJA 3EW9A 2RMKA 4B48A 2AXPA 2RGEA 2V54A 3LXRA 1YZUA 3QG5A 1ZIOA 1OXUA 2D74A 2W2VA 5KUTA 2OO7A 2WOJA 4ZKEA 1FUUA 1HE1C 3Q5EA 4QM6A 4Q00A 2BMJA 2H92A 4B2PA 1ZM7A 1FW6A 5P21A 3A36A 5FOXA 1MR3F 2NO6A 2JLSA 2IYRA 4A82A 3OEEA 4NYMR 1KI2A 2OFXA 1AGPA 4MUAA 3SYKA 1N6IA 2OBNA 2VBCA 3S1AB 4AK9A 4JSYA 2VP9A 4NYMQ 3LWNA 3QKTA 4PSVA 3J81k 2PJRA 1ELOA 2EW1A 4PXAA 2C03A 3C5CA 3THWB 4I1VA 2HDNB 4BFYA 1DAEA 4AURA 1EK0A 2OCAA 2WZQA 1JJVA 2MSEB 3GLFE 4QG7A 4LHVA 2AKAB 2GZDA 3QXXA 3VKWA 3QNUA 1IJEA 3VMFA 4DEXA 4YMVA 4CEIA 3VX4A 5FOWA 3GFTA 3MUFA 2WPDA 4OI2A 1UF9A 1YZNA 1G5RA 2QROA 4EJSC 2ZREA 2XJ4A 1NY6A 1WP9A 1O87A 1LS1A 2ATVA 2EYUA 4TLBA 3K9GA 1XZQA 3D7MA 2RCNA 2B6HA 2ZRPA 3QBVA 3TUJC 5AJYA 3NHAA 2YOFA 3I61A 5B2ZA 3QVVA 4G5QA 1KDRA 2QE7D 1SXJD 4IXMA 4DSOA 1XJ0A 4NHOA 3WYFA 4C4PA 1Z08A 5EP4A 1UJ2A 3KB2A 4K81B 4BFXA 8OHMA 1AS2A 1GKUB 1MO5A 1E2JA 3EPJA 1TU4A 2H57A 1RKBA 2C5LA 5C46F 3V4RA 4D26A 1TU3A 4Q01A 3OE7D 4KLZA 4BZPA 2KSQA 4DDUA 3BH6A 5JJIA 2GETA 1D8TA 1N0UA 4Y0AA 1CXZA 4R71A 1G8PA 4D4LA 4E09A 4GZMA 4ZKDA 1KO5A 4DLRA 2KWIA 3AGQA 2FFQA 2R6CA 2FN4A 4JYCA 4Q9IA 3KTAB 4B73A 3CR8A 4C0AC 1A2BA 3MJHA 1OH8A 2Q9AA 5JCPA 4AI6A 5KHOC 2ZYTX 3TQFA 3BRWD 1TPZA 3HDTA 4XD7A 4C7OB 4ZCLA 2F1RA 3CR7A 3FB4A 1X86B 3IQWA 4WA7A 1SHKA 1T3SA 3A6PC 1ANKA 1IY0A 2ZR9A 3MWYW 4GPTA 4TYWA 2X1VA 1YZKA 3HU2A 4D2IA 2QL6A 4UNQA 5LBIA 1IN6A 1TEVA 1ZNYA 2PBRA 2QY9A 4O2LA 4TSFA 1EFUA 1X8KA 3CX8A 3PUVA 1GNQA 4GMXA 4U02A 5FUVA 3UMFA 2AR7A 2BKUA 1OPXA 2A5DA 2BJWA 3SJZA 4B75A 3AEZA 1GL9B 3BC1A 5UKDA 3LH5A 3WP1B 4BFTA 5FPTA 3A37A 4V0ME 1J7KA 4CIDA 1R0WA 2OCBA 1HY3A 1N5JA 2R6AA 3B1VA 5ANRB 3R9IA 3RRMA 4D0GA 1WDTA 2P2LA 4OK6A 3PEVA 5LD2C 3FKSD 4WAUA 1IY2A 1GKYA 1RYFA 4US1R 2QRNA 2FMXA 2RGGA 2RKOA 2Z4SA 3BH7A 2HJGA 4PHHA 1G20E 1H8HA 1G3UA 1A82A 1JALA 4PAMA 1TAGA 4QGAA 3BK7A 1ZM4A 1YKSA 1BMFA 2IL1A 1MKYA 2QA5A 1XBTA 1ZD1A 4A2QA 4IHQA 2GAOA 4LC1A 3KUDA 2O0JA 3THOA 3IILA 3VU9A 1GTVA 4DEYA 1SXJA 4IDPA 1JAHA 3KB1A 4QHTA 2ANBA 1GRQA 2GJKA 4JSTA 1Z2CA 4OBEA 2QBYB 1E3MA 1E2KA 1TQDA 1Z6TA 3L0PA 4Q7MB 3BWDD 1NP6A 4F92B 4URWR 3UATA 4GI7A 421PA 1HV8A 1R7RA 3GLIB 3KQLA 2F1JA 2REBA 2NTYC 2BBSA 3B6EA 4HLCA 4HEJA 3QKRB 2BC9A 2XSZD 3PV0A 3GJ0A 2ZRAA 4NL4H 4PTLA 2QAGC 4P0TA 2OSBA 3HU3A 3CONA 2IYYA 3K1JA 4F38A 2IF0A 2ZJ8A 1IJFA 1OKKA 4W5HA 2AFIE 4M1TA 4M1SA 1JBKA 2VP6A 3K0CC 4EKDA 1JNYA 1BYIA 2QENA 4LYAA 5TMPA 2L0XA 3NEYA 5J4VA 4WW0A 4JLDA 4BRWA 1N6OA 3IO3A 3B85A 1SQ5A 4Z8XA 1NG9A 1FFHA 1WXQA 4CEJB 1ZP6A 1XEXB 4V02A 2J41A 1YRAA 1MABA 2FOLA 2QP4A 3U61B 1XD8A 1S4QA 1YRBA 3G5UA 1RZ3A 2P3SA 4DT1A 4KFUA 5DYGA 3W90A 2GDJA 3DPUA 1RW4A 2IYQA 2J59A 3WMEA 2FSGA 3MWKA 4HUQA 4HZIA 5D3MA 4MRNA 3OAAA 4PPFA 4KV9A 2A5FA 2RH5A 4E03A 2AXNA 2WSSD 1JEDA 2GRJA 3B9PA 4C30A 1KI6B 1SXJE 1GL7A 3MRSA 5J5CA 1WE2A 5TXGA 2QGZA 2QI9C 2CNWD 1LFDB 2W0SA 2ANCA 2P67A 5KNBA 4JIMA 3LX5A 4TZ6A 2J9RA 3TRFA 1NVVR 1N3BA 3OFNA 3EZ2A 4NU0A 1A1VA 3N2EA 4IDOA 4EQ6B 4MDEA 1VCIA 2XGJA 1SVLA 2A5GA 2VF8A 2Z5FA 2OCPA 2VL7A 1TF7A 3AP3A 3EZ9A 1E2HA 1MO6A 1P62B 2FJUA 4FMCF 1P2SA 2JAQA 4MH0R 1XD9A 4A2PA 4PC1A 4DZZA 2V1UA 3OEHA 5IF9A 1PZNA 5EUMA 3W6NA 3L2OB 1E9DA 4QHSA 3ZQJA 1UBEA 1XD2B 5BN3A 1E98A 1C1YA 4EJSB 2VP2A 3TSZA 1P73A 3B60A 3E1SA 1S8FA 3BOSA 3UXMA 2XTMA 3FKQA 4DVGA 1NKSA 1E1QD 1E9CA 4NYJR 1FQKA 3UG6A 2JASA 4KYIB 2HT1A 1IOZA 1NIJA 4LUCA 2QTHA 3PIRA 1KJYA 3BBPA 4TMZA 5JECA 2E87A 1EFRD 1M6NA 1F5NA 4RD3A 2JLYA 4BFWA 3B9QA 1TL7C 5EE5B 4HUTA 3THYB 4FMDF 2P5TB 3AH8A 3PITA 4TT3D 1K8RA 2CHGA 4DUGD 3TMKA 2B8WA 3IDQA 5FL7A 2G88A 3U3JA 5FTJA 4YMUA 4L5BA 3I1FA 4UNNA 1EXMA 1XB2A 4B3DA 1W0KA 2CLCX 2ODNA 4A6PA 5B30A 2JLUA 1KHTA 3L8YA 1ZIPA 1DAMA 3HR8A 3P4XA 4I1OA 2QG6A 4IOLA 2JIZD 1CKEA 2GKSA 2EQBA 621PA 1TF5A 4DLTA 4MDFA 4I4LA 1Z2AA 2NPFA 2EFCB 3ONWA 1ZD9A 3CRQA 3TLXA 2DWPA 4MYHA 1Z6GA 1NF3A 2JJ8A 4HATA 1TUIA 3Q5DA 4MGKR 1G41A 5E4FA 3ZIAD 1D6JA 5CJPA 1PLKA 2OBLA 1CLUA 2WWXA 4D4MA 4WVFA 4D0LB 2CL7X 1N5IA 4OYHA 2QU8A 3CNOA 2RAPA 1ZBDA 2ZRGA 2ECKA 5L3QA 3FHTA 3CH5A 2RGDA 1QHNA 4RFSA 5BWMA 2ZROA 2NZJA 1U0JA 1L4UA 2ZRMA 2P6RA 4QGHA 2WV9A 4WZBE 3EX7C 3G0HA 3DM5A 4ILEA 4NONA 3B7GA 1Z06A 3D6TB 2Q6TA 5L8VA 4CYMA 4KBGA 1NJFA 3A1WA 4Q1EA 4Q47A 5JI3E 3QQ5A 1T8UA 1V5WA 2IYTA 4Z8YA 2JLZA 1ZAKA 1E4YA 4FIDA 1DARA 3I3SR 4D6PA 721PA 2J7PD 1KK3A 4G5OA 5CDFA 3U7FB 1LF5A 3O47A 4B34A 2W0MA 5FL3A 4B71A 1KK1A 1OF1A 2IF2A 1XPOA 4PPNA 4IVPA 1Z0KA 1UBFA 4XTCS 4IVQA 1YJ5A 1QG2A 3FMOB 2IXFA 2HEIA 2PMDA 1CRQA 4TLEA 1IBRA 1QBKC 4BGDA 2YWGA 2H16A 2JJ1A 2YHSA 2AD5A 2ZYUX 4IKEA 4JBWA 4WZAE 1A2KC 1ZRHA 3BS4A 4DJTA 2IS4A 1VIAA 3SFVA 3EWAA 3AKYA 2JGNA 3REGA 4H1UA 2D2EA 3GJXC 1FX0A 2G77B 2PH1A 3SFZA 2F43A 2OM2A 1DOAA 4Z1MD 4LHWA 5LPNA 2GXSA 3U3OA 4P31A 1Z22A 4RD4A 4XSGA 2YWFA 2H1LA 3QPWA 1Z0JA 2P65A 4X8OA 4BZXA 4DLSA 5BXQC 2VPPA 3CPJB 2IS2A 1OFHA 2H17A 3FOZA 4Q66C 3CPEA 2FPMA 3EPHA 1AS0A 3ADCA 2DFKB 1DBSA 1CR4A 1JR3D 2OE2A 3GPLA 1RIFA 4IXNA 3VX3A 5G53C 5CK4A 5B57C 2FGJA 3DMDA 4LZZA 5KNDA 3PR1A 4QC2A 1G9XA 3KQNA 3CB4A 5FOSA 2GXQA 2QAGB 1NRJB 3PEYA 1NN1A 5GJBA 2ZS7A 4NYIQ 2XTNA 5E7JA 1Q44A 4PZZA 3GLHA 1LV7A 2YINC 4Y0VA 3AKDA 4C0LA 1X6VA 4P4TA 3TJZA 1HQCA 1UKYA 5HKKA 2ODBA 5CDFE 1Z0AA 2BMDA 1ESNA 2VTKA 3DM9B 4M21A 5GJVC 4O3MA 1AZTA 1N6RA 5EP3A 1OJLA 4G01B 3VKGA 1KKMA 1G7SA 2JA1A 1NBMD 4I81A 5DI3A 2PEZA 2QGNA 4OI4A 3EPKA 3EA0A 4NCKA 1ZM2A 1W5SA 4PC7A 4BE7B 2BMFA 2IYXA 3NBFA 1TQ4A 4H9GA 3KKMA 4HLQB 3PXGA 3SN6A 3SOPA 3V4FA 2FWRA 3B1WA 1F48A 3ZZ0A 4NCIA 4HSEA 5TDHA 5JSZA 2ZU0C 3SBEA 1XCGB 1EFTA 1MOZA 1YU9A 1HYQA 4D82A 1XU4A 1G17A 3KJGA 1G8FA 2W58A 2Y8EA 1S3GA 3GJ7A 2ZI4A 1S3SA 4MRSA 1XPUA 3A1SA 2X8AA 2ZE7A 2ZETA 5AK0A 5HZHA 1XJCA 4N1AA 2E9SA 4M0LA 3KL4A 3KXKA 4L15A 4Q1FA 1FTSA 1HH4A 2OESA 3L43A 1S1MA 3W3AA 1YZGA 2CE7A 4LV5B 4QBHA 4KXFB 2V7QD 5K8UA 1G3QA 4B44A 2VH5R 1CS4C 4B2LA 3LNCA 3CIOA 3QPVA 1MRNA 1R5NA 3HYTA 3R9WA 1HA3A 3U44B 2P6NA 5K8TA 3GLGA 5EXPA 3CRRA 1HTWA 1US8A 5JMTA 3IUYA 4IDNA 4MYCA 2IK8A 4LC0A 2C9OA 4F4CA 3K0FA 2KI5A 2XNDA 3AKCA 1MH1A 3ND8A 2IUTA 4QNMA 3AVVA 5FTKA 3VHLB 2CHQA 4XH9B 1F60A 1JB1A 4DDWA 5DNYB 4GZLA 2HXYA 4LYJA 1AZSC 1VIYA 1VYVA 4JLPA 3SR0A 2J87A 2ZS8A 1DE0A 1NKTA 4JL5A 4Q21A 1VECA 1VYUA 3VR5A 2ZRJA 1NNEA 2CL6X 2N42A 3UANA 1J70A 3VR3A 1BKDR 2QQ0A 4QKQA 3K09A 1P2UA 1W49A 4XIGS 2ZAMA 1KJZA 2QT0A 4JLAA 3OIYA 4ASUD 3QKUA 4DLUA 1Q3HA 4Q4AA 2XXAA 4KVAA 1CBUA 3AF2A 1KJWA 1R0ZA 3CF2A 2FDCA 5C1BA 2QSYA 4OHWA 3I73A 3LAWA 3T1QA 4R9UC 4MA4A 1XZPA 2LCFA 2GVDC 4GT1A 1GFIA 1NSTA 4OJKA 3LA6A 3WNCA 4BZQA 4BLRA 3KXLA 1PLJA 2O8EA 2OFWA 2P0EA 1P9RA 2BHRA 2GILA 1G19A 2ZRBA 1IN4A 3T12A 3SJAA 3GJ6A 1TADA 3LBHA 2IYZA 1U0HC 5CM9C 2A30A 2J0UB 2OXRA 4KU4A 4L4UA 2BM1A 2QMOA 4C0BA 5TV2A 1G5TA 5AWFC 1UEJA 3NDPA 3TVDA 1OFIA 3T34A 5HCNA 1PUJA 1DAIA 2VRWA 4EAQA 3VU9B 2GWHA 3N70A 4QBIA 3IBYA 2V3CC 2BBWA 3LQQA 2PEYA 2J5XA 4DLXA 3RC8A 1KO1A 1A4RA 2IEZA 5DO9A 2UVQA 3HPQA 4F93B 1U9IA 3R7WA 5HPYB 2GNOA 4P4SA 2FFHA 5FPKA 4CEHA 1QHSA 5EE9A 4EPTA 1OSNA 2QTVB 1K5GA 2CHVA 2GCOA 1FMLA 2D62A 3AP2A 4LJ6A 1G6HA 1W48A 2VHTA 5BN5A 1Z5ZA 1L4YA 3ETLA 5AJZA 1W46A 3H0KA 3NTUA 2LWIA 2YC4C 4TYYA 2EFDB 1KNXA 2IHYA 1OYYA 4TMKA 2A2ZA 4QRHA 3D31A 2FU5C 1WRBA 3K0EA 3O8CA 3UWOA 4PR0A 2ZSAA 3AVOA 1FQJA 1QZXA 1R2QA 3DZ8A 3RRYA 1NBME 1HQYE 3LD9A 2W00A 2VP0A 1G3IA 3C4JA 4JVNA 3H2YA 4KO8A 1B0UA 3CKLA 2WTUA 4A0HA 4DT1B 1Y63A 3QF4B 4TN1A 4DC9A 1CJMA 4QM7A 4LJ9A 2GEDA 2BMEA 1NL3A 1VG9B 2F7SA 2ZAOA 4Q1AA 4HUQB 2CXXA 1AJEA 5D3MB 3O8BA 2F55A 3U5ZB 1P4SA 3LY5A 1ZVQA 3UMSA 4KLNA 4JVMA 4ABYA 1E1RD 3L0SA 3C16C 3EPLA 3ZVNA 3ZVLA 2IYUA 2W6ID 1TQ6A 2W6JD 4CDGA 4UJ5A 1Q22A 4HB4A 1V43A 1G64A 1M7HA 3B78A 3QKSA 4JT4A 5IK2D 1KSHA 2ZRHA 1AM4D 3QENA 3IGFA 1DAKA 4A6XA 1COWA 4AKIA 1YQTA 3W5IA 2MMCA 1SGWA 2CCGA 3WY9A 1VG1A 3B13B 3RS4A 4QGGA 2JLXA 4H1VA 2X77A 4ZCMA 2MSDB 1E0AA 2FPKA 2BBOA 4A8JA 3KQHA 1AKEA 4ESHA 1RRFA 4QJ5A 3D8BA 2WHXA 2ZEJA 4HLDA 4B6EA 3W8NA 2WMNB 5FFMA 4HZUA 5SZHB 2Q9BA 5FBWB 1OHHA 4PPGA 2WWWA 4HDQB 1XTJA 4URVR 3WBKA 5KPJA 3LXXA 5JRJA 3ND9A 1QHIA 1KI8A 3Q72A 3VNVA 4V0MA 2H8KA 4LJAA 5CYPA 1ZM9A 4PSAA 2R62A 5JHHB 2DPXA 3KFXA 3P20A 2WBLC 3SE0A 1YHNA 4TQUS 1EFHA 3BIFA 3Q8XB 3U3MA 4DCTA 1E0KA 1OE0A 2REOA 2X2EA 4UKDA 2CLDX 4BECA 1EX6A 4HLUA 1XMIA 2GTPA 2O8DA 1KO4A 4OHYA 4KAXA 1RRPA 2VHCA 2CK3A 2ZJ2A 3PJRA 1T0JB 4PFSA 3GMTA 4NP6A 2QP9X 5F98A 2VHQA 3EAQA 3AVTA 2MSCB 1ZUHA 1XPRA 3U2QA 2W2XA 3CBQA 4C0SA 1NSFA 1RE0A 1LB1B 1XEWY 2WJGA 4MYUA 2JLQA 5JWRA 2IEYA 5AR1A 1OIXA 3U3RA 5L3SA 5FUXA 4E5UA 4M1KA 2HF9A 3C15C 4Q4HA 2C8VA 2VHJA 4V0NA 2KE5A 1NJGA 1II0A 5FOVA 5FTNA 5KNCA 1XTIA 3DKPA 3RRZA 1GRNA 2OLKA 1W36C 1D2NA 2WAYA 4GOKA 4P32A 2V9PA 4ZPXA 4RFSB 2GA8A 5HCIA 2C96A 3THXB 3I5YA 2J0SA 2ZTSA 4A1FA 5EXTA 4LCBA 3ICEA 2QM7A 4D0NA 2ZS9A 3SI7A 2ORIA 2DWQA 3UPUA 4Q4JA 3RWMB 4AG5A 5KSYA 1LTQA 4JLKA 4K46A 3EZ7A 1QRAA 4QNRA 1R0YA 2XJ9A 4JL6A 4C0QC 1AA9A 2RGCA 2BEKA 2R6DA 2O8BA 3LDAA 2IW3A 1FP7A 2IXGA 4JZKA 1VHLA 5JEEA 1U8YA 2GJSA 5KDOA 4RZXA 2ZRIA 2ZSEA 3TUZC 1E2EA 4EFNA 1FNNA 3PUZA 4BLSA 4BFSA 2C95A 2WJVA 2NPIA 2EFHB 3B8HA 4LJ7A 5KSZA 3CPHA 2O8CA 3NBYC 4TLCA 1P61B 4DRZA 1PUIA 2WVJA 1KNQA 3K70B 5FTMA 3GP8A 2JCSA 2QE7A 1FX0B 5G3YA 4JLMA 1YR8A 2F43B 3IEUA 4WBSA 4GDFA 3FE2A 4ZO4A 4DIEA 5FPYA 1Z07A 4A2WA 4ITRC 2ERYA 3FMPB 1E69A 2GZHA 1F2UA 2O8FB 4M1OA 2XOKD 2ZI6A 3LLMA 3TQCA 2BDTA 3OE7A 2NQ2C 221PA 2FX3A 3A1TA 2I1VB 3F5FA 4RZ3A 4JLBA 1FP6A 3PUWA 4DLWA 2QM8A 2VF7A 4QGFA 3SNHA 2YWEA 3PUXA 1IXRC 4UXHA 4XVRA 2WKQA 5IT5A 4D81A 1E94E 4LV6A 5EZ6B 1CTQA 3GLHB 4PHTA 1G7CA 2EU8A 4ARZA 2OAQ1 4XSHA 4XWKA 3KXIA 4GOXA 4P4UA 3RS2A 2WOOA 5IHPA 3AVXA 4EIWA 3ADBA 1M2OB 1R5OA 1KDTA 5JI2E 2FFBA 2NG1A 3VTKA 4Q02A 4TL7A 1MO3A 4EPRA 3EIHA 3N5CA 2IWHA 3KZ1E 4QBGB 4NPHA 1TX4B 4ZDIA 2REXB 5DI3B 1KSFX 2GVZC 2AKYA 3R8CA 3BERA 2FNAA 5J4KA 3UWKA 3RRNA 1Z0DA 4BLOA 3SZRA 3PQCA 3H4MA 4GSYA 5FBRB 4F4JA 5K8IA 3CNLA 2IS1A 3GJ3A 5B58C 5JSZB 4LBWA 1O3YA 5CM8B 1CP2A 5FBLB 1GM5A 3QY0A 4JVSB 1UBGA 2QORA 3P32A 2V55B 2AD1A 4QFMA 2EWWA 5H8WA 3KKNA 2ZVPX 2N1BA 1Z8FA 5KDLA 5CIQA 2R8RA 3EWSA 3TW4A 2NOAA 1G16A 3DKVA 1L7VC 3FKSA 4CGZA 1OIVA 4KYUA 1U8ZA 3VR6A 2FEOA 4TMVA 3IHWA 4AYTA 2CVHA 2JLWA 2LKCA 1Q1ZA 3W9YA 1ZC3A 4IFBA 2Q3HA 4DLZA 4HB3A 3RS0A 4V03A 1NVVQ 4JLJA 1P3JA 3FDIA 5FTLA 4HAWA 3LFUA 1XXHB 3LW7A 4LX0A 1VG0B 1TEXA 2CBZA 2K5UA 5FPHA 3R9XA 3GLGB 1KI9A 1G291 3NDBB 1GVNB 1DG3A 3NBZC 2XNSA 3S1AA 3ZGXA 2ODWA 3KKQA 3NHBA 4FMBB 5EE1A 3UG7A 2JDID 2O5VA 2QAJA 3U7HB 1XTQA 3K0FB 3X2SA 3QEJA 1NVWQ 1VKJA 1IXZA 2R44A 4PHGA 3CW2A 3WRXC 3CRVA 3DZDA 1S1CA 1NVXQ 2ASEA 1I2DA 1T9HA 4NYJQ 2F3TA 4ZCIA 5FI0B 2ZE8A 4PAQA 1BIFA 1VHTA 2RGNA 2XSZA 1AS3A 3CF0A
chains in the Genus database with same CATH superfamily
1H65A 3CLKA 3QW2A 3ZVMA 3SR4A 4YBRA 2ONZA 1ONNA 2QEQA 3JY6A 2XR1A 2JH9A 4TN5A 4UNPA 4D41A 4GR9A 4AZVA 1WB4A 1DV1A 1Z3IX 2XRFA 3Q85A 2AOTA 4YMGA 3VKFA 2GCNA 3DE6X 4FQ8A 4TMTA 1U98A 1IMOA 1I30A 1Q0SA 1VPLA 1TGVA 4GP7A 1FJHA 1DKMA 4ARCA 1OXTA 5ERYA 1I3CA 5BW4A 4FFBA 1R6VA 1WW2A 4P7JA 2FQ1A 1OB5A 3AJEA 2EWVA 3AX6A 1TGYA 1RYEA 3FF4A 3GV0A 1M1UA 1YHYA 1BYUA 1M54A 2C3PA 2V7UA 4G0XA 4LBYA 1X1DA 4XB6B 2R65A 4Y2GA 5GJWC 3QE9Y 4ZT3A 4M9UA 5CB6A 2OCLA 1ZJYA 3G5LA 1W36B 3COPA 2L17A 2FZLA 4FI3C 1KWGA 3OIUA 2FPLA 4F2GA 3ZDQA 2O2CA 4ALNA 3LUFA 3CCCA 3E9MA 4HNAA 3DOEA 4TRNA 4I9FA 2FOIA 1M5TA 2O4UX 3KLPX 3JAKA 4XSVA 4YALA 1SG0A 3DAYA 4QPJC 3I05A 2QTRA 4XEUA 4EOGA 4XUCA 4R71A 1E9RA 2CNLA 4YH1A 1EA7A 1I4DD 1QQ7A 1C0EA 3PQ3A 2X8WA 4I99A 4WL0A 3KQQA 4DA0A 3FR8A 5M04A 2G3YA 4YFYA 1NYRA 2PSFA 4R2LA 3NKFA 1NLUA 4BMVA 5AUQA 4CVNA 4DMHA 2VQEB 2CNWA 2R6FA 4OOFA 2O6HA 5C18A 4WLEA 3WLIA 1ZGJA 5ALTA 3OUUA 2WYUA 4QOSA 4UREA 3K0SA 4FCWA 3L84A 1ZOOA 3O3NB 3ZQ4A 4A0GA 4I3GA 2CYBA 3DMRA 2H1HA 2ZDHA 1YE8A 4IVNA 2IXDA 2XUKA 1V26A 3IQHX 1PW5A 4IZOA 4H1HA 4BJ3A 5AVUA 3U31A 5KVAA 1PI3A 4HAUA 3V1NA 3PNKA 2R7AA 1CY1A 5CGQB 4JI7B 3UVEA 2ST1A 3H1AA 1P1KA 2RHOA 1O9BA 1DT5A 2XYGA 2ZBUA 4HWRA 1OYOA 3NFRA 3TLCA 2RHLA 4E4TA 5A5EA 1D2GA 2CN1A 1SKQA 1IIBA 2EC5A 4FLFA 3PF9A 4MJ7A 4TV8A 4CR6A 5CB8A 1I14A 4F4UA 4WY8A 2W2TA 2ZU6A 1UK7A 4IJUA 2LTAA 4TWAA 4MQBA 2W90A 1NGSA 5CLIA 3EDQA 1ZM3A 4PO8A 2NUTA 3DTVB 2D2VA 4ZTBA 4N7RA 2QMHA 1N9KA 1LDMA 2PU5A 1B26A 1W73A 2P69A 3FAKA 2EFGA 2GD0A 4FZ5A 4G4JA 5HE8A 4ANFA 4LJ8A 4GNKA 5LYYA 3MJEA 4NEHB 3SJCA 1GPLA 1OV6A 4HAVA 1GZ5A 2RHWA 4TT3A 3WVNA 3REFA 3I58A 1CZUA 1NU6A 3SKXA 4E22A 3I39X 2NZ2A 2QSZA 1FTNA 1BW9A 3V2IA 2DFLA 1PJTA 4YRQA 3VAZA 4R6XA 2G4CA 3EOZA 4LHEA 4EJ2A 3UH1A 3G9XA 2CFTA 1JJAA 1PQ4A 5DH9A 3CT6A 2BZ1A 2H2FA 3TTSA 2XMPA 4FIZA 2FSVA 2GOYA 3H6GA 4PFKA 1Z0ZA 2C99A 4AF8A 2B99A 1P31A 5KI6A 2JIRA 5IULC 2N0SA 5EN4A 1KI1A 4YT4A 1C9KA 4CMGA 1BDIA 4W82A 4HDSA 1IPEA 1Z68A 5JNRA 3BWMA 3MMNA 2FXIA 3ZNQA 2G71A 4OY3A 1GQOA 3LF2A 5JAPA 4B82A 3LY8A 4Y1GA 2QYSA 3QU4A 3V2UA 2YHUA 5HUJA 4PS1A 1A69A 3FTNA 4NARA 4KSBA 5H7XA 3A32A 1LLQA 2B94A 2ORVA 1U7OA 2VNKA 2PXHA 3FI9A 2XMGA 4PNHA 2J32A 1TT5B 3BQNB 3WLPA 3F8TA 3VV3A 1RFGE 3FLMA 4OQXA 4C21A 4XFKA 1ZNZA 4CFZA 5LYJF 2F8MA 3KYDB 1H4TA 1CYDA 2A9QA 2ZAGA 3KQUA 4J1TA 5KOJA 1OBHA 2XTZA 2XEXA 1GL3A 3JYHA 3OHMA 2BH2A 3SEAA 3JD3A 5F4BA 2AE2A 3PUJA 5DX1A 4XR4A 3WAKA 4Z2AA 5AKEA 2X0RA 4Y2SA 3V2HA 5LFAA 5DN6D 2YDXA 3PDHA 1AKYA 1TLTA 2HI0A 1J2JA 2RGAA 2UVPA 2W2LD 3GEIA 1H0SA 1VMEA 1YL7A 2P8JA 3OCZA 2I3DA 2VWHA 4IJ6A 4R83A 4PN3A 3C3CA 3DZCA 5EWMA 5GMOA 4L9SA 3EXEB 3FTQA 3N7AA 2DFDA 3LBNA 5LP6A 4RKRA 3UC5A 4EY4A 4HEHA 2XYPA 1KVRA 4L8GA 4XX0A 2OHGA 1G20B 3DUWA 4X7BA 3M3PA 3L7LA 1T34A 4KE8A 3T3OA 1VJCA 4EG7A 1IONA 2DPLA 2PFKA 1QIKA 3OIGA 7REQA 4Y98A 2VG8A 2IIPA 5ENVA 3OCVA 5AK3A 4BNJA 1WABA 1ADYA 2G80A 1MC8A 3NWJA 3EBOA 1WY5A 4RX1A 2PL3A 1JEOA 1ZZGA 1VA5A 4XEHA 3KZXA 1SVIA 4F5ZA 2PMEA 4NBUA 3ND6A 2OK7A 3CR3C 5TPWA 3ZU5A 4CTNA 1M7GA 4LHXA 2D7CA 4BVKA 4Q3AA 3H2BA 3KOOA 5L4LA 3CEPB 1OV4A 2GSWA 2HLDD 3IKMB 5CB4F 3HL0A 2AX4A 3FMIA 3GNSA 2BHTA 3IT1A 3L7NA 3KJHA 4GVXA 2ZVQX 4OKNA 3SOZA 3TLZA 1HORA 1NQWA 1UEXC 2F1IA 1OXSC 1UFVA 2Q5HA 3BXXA 3FZQA 3GQVA 3H8JA 5GJCA 4ENRA 3CH4B 4LRYA 5C2JB 5LKAA 2ZBQA 1EFCA 1EVLA 1HNNA 3B89A 3U1VA 4EJSA 1K86A 1MQ9A 5ALQA 2YKGA 2NU8A 4U9IS 3TI9A 3PFIA 2FSHA 4KE9A 1BS2A 1I4OA 3P2JA 4UUMA 1BVYF 1ORWA 2ZJZA 4JA2A 2C98A 2WIAA 1NUPA 1QXSA 4KQ6A 4XGNA 4O33A 1ODCA 1CUIA 3OF5A 4PRKA 3GUYA 3OE5A 4ZC1A 3VXKA 2Z2YA 4PONA 3TAUA 2OB2A 3RLFA 2ZTMA 3MN1A 1W2HA 1E1MA 1U7DA 4LPKA 3ESQA 5ERXA 4WUTA 3GH3A 4FNOA 4NJEB 1E2BA 1ZLXA 2YJ6A 3R3ZA 3AP1A 4JK3A 4BMOB 1ZN8A 1U7ZA 3FVQA 4N9QA 5K3CA 1AH2A 5DGXA 1VL1A 5IDWA 1E6CA 3OM8A 2BIFA 3P9YA 3AY3A 4JSRA 3QWHA 3B36A 2PMKA 4EYSA 2MT9A 5LP1A 2DJ5A 1AUOA 3AR6A 5JISA 1WXHA 2VYNA 4PYRA 5ALZA 5KYWB 4DVJA 3S7ZA 1KWKA 3AVWA 2C7BA 4F6RA 4C06A 2X4GA 4D9EA 1WNTA 4QT0A 5AUPB 4ZQFA 4PIPA 3K70C 4Y2HA 3FNEA 1GXSA 3FW1A 2X9VA 4B9AA 4TPKA 1FNBA 1X1AA 1Z7WA 2Q41A 1GKKA 1JQ3A 1KBOA 1NN5A 3KVRA 4CT4B 3UK7A 3GZJA 5G4KB 2PUCA 1YI1A 4AJ1A 1T4GA 2QN2A 3PHHA 2EBHX 1GP2A 3KCQA 4OXYA 2MYTA 2W2KB 5I9SA 1T8TA 4UW9A 2HO5A 4YP0A 3OMWA 1AZLA 4LNUB 1QGAA 2D5BA 3K96A 1U5AA 1BSVA 3A4LA 3TNFA 3URKA 2CLMB 2FPPB 3BL8A 4S0ZA 3VZPA 4DR7B 3PXEA 1E2IA 1XEWX 2WAAA 3A6JA 4TQAA 3ZBPA 1W47A 1PFVA 3IE1A 1SQSA 4EVRA 3GA7A 1XWIA 3MGCA 1Q0RA 1OAAA 1UPXA 4XUEA 3T6KA 4E21A 2J5RA 4ND8A 1ZBQA 4JQCA 4PF1A 5EKXA 1UPFA 3HEBA 5E7MA 1DIAA 4Z7NB 3FLEA 2P90A 3P9PA 4E08A 1I2ZA 2Q6VA 3OPXA 3MIIA 1W0JD 2XUGA 3UAWA 3D3QA 4YAJA 1IWOA 1M1NA 4FDMA 1NQVA 3Q1LA 4C0JA 3CFYA 5B2FA 1G7TA 5L7WA 1SCBA 4XM0A 3AVQA 1E9AA 1NATA 3K9LA 1N2GA 2IE8A 1B93A 1ZNQO 5BVHB 1YXMA 2OC9A 3DCJA 4Q3OA 1IIRA 5INTA 1W4LA 3G89A 3NEJA 2XV1A 4DDVA 1G2QA 1KK2A 5BN1A 3OIWA 2O14A 3OX1A 4OAPA 4FBLA 2PMWB 1VHQA 3FYHA 4QU9A 2AG1A 1ETUA 1JHVA 2YYZA 1RXEA 3T9CA 1B74A 5B4UA 4MWZA 1IFXA 5ICFA 3O4HA 3ZDEA 1QAMA 2Q6LA 3D3WA 1DB3A 4R1OA 3RYTC 2W42A 4C3ZA 1QYCA 1W4BA 3NWBA 2BEJA 2V6IA 4ASUA 1EJBA 1V2HE 2P91A 3FHOA 3OWOA 4QREA 2DULA 3BICA 3OESA 1AQUA 1OFVA 3PWKA 1ZQ1A 3AC0A 4MJLA 3U16A 1LX6A 3K92A 1Z35A 2ZIZA 3L82B 3BWYA 4I8DA 2HBZA 3AB3A 4MR9A 4NX2A 3OJEA 4Q48A 3LBFA 1BKYA 4RL6A 3RBVA 3SICE 4EPYA 5A06A 1R0XA 4AL4A 1VPEA 1A8SA 1UM9A 4H0NA 3RU7A 2BI4A 2V6JA 1ZMTA 1A4UA 4BWVA 1NBHA 3SX4A 3PL1A 1XTKA 2ZYVX 1J20A 4MKFA 5I9MA 1JEYA 1BEZA 5K3SA 2WAXA 3N2KB 3AVPA 1GJRA 3NORA 2FRDA 3TVYA 1QU3A 1BOFA 2Q1UA 2VATA 3E18A 4HYQA 4D56A 1E9EA 5A3RA 5LJIA 2PQMA 2QD4A 4B2YA 1DC8A 2B0JA 3T1TA 4HMOA 5E4YA 5I4IA 2PSSA 2ZT7A 1OA0A 1QVRA 1FDWA 4OHOA 3M0EA 4QEDA 1X1QA 2CEAA 1BGVA 4WZBB 2GEJA 4Z9AA 2BFEA 3E9QA 5DXAA 1A98A 2MIIA 3GDHA 4URZR 3PXUA 4KXMA 1W5FA 5EESA 5AKXA 3QXJA 4J3JA 3RSFA 4DE5A 3LT4A 4E5NA 1F1BA 2QYOA 1KH2A 2LIVA 4LZLA 2D5AA 3TX2A 5FOUA 4BO4A 4GFDA 3LCVB 1ACMA 2ZUBA 2DWOA 2BJVA 1ZRSA 1G63A 3HCPA 1GYPA 1PNQA 2WVAA 1QK4A 3WADA 4KKXB 5ICGA 1OI4A 1B7GO 2AQIA 2J3QA 4ZANA 2NO1A 4YQZA 3U5TA 1GILA 2J5QA 4IPTA 4XVUA 3WGYA 2XZTA 2X23A 3JVUA 1TTTA 3A9VA 2RB4A 1AGRA 5BVGB 1JSLA 1NQ5A 1L3CA 4ZEWA 3B9RA 5AKKA 4IMJB 1QHYA 3WGLA 1KIMA 4CIWA 4EX7A 3KM0A 4KRYA 5HIAA 3DB2A 3HB5X 1H05A 1Q21A 3BIXA 1GPWB 2YXDA 3HVKA 4KBFA 2J46A 3SYMA 4BFVA 3AJ9A 1E3WA 4BMPB 1SOMA 3DL7A 4Z4CA 2BFNA 4YLGA 4EW1A 1TOAA 4KN8A 2HXSA 2WLTA 1WPXA 3HDJA 3A3OA 2J9XB 1KDOA 4TXNA 2JFFA 1II8A 1RAEA 4HXFB 5EVJA 5I45A 3W3AH 2HJRA 3QMMA 1ZNXA 1MU0A 1LQTA 4LWQA 3UB4A 1EVZA 5CFPA 1KBQA 3T06B 2ID9A 1GAEO 3U4IA 3UK1A 2CVFA 1XEFA 4LGMA 3EASA 3ZV4A 3OEWA 4HGRA 1RPNA 4FFBB 4MVJM 3V00A 3A4YA 2V7GA 5L8VA 2GEFA 3C98A 1UH5A 4HDMB 3EEYA 3BBLA 3P0IA 4FYWA 1J22A 3T99A 1IN5A 2OHJA 1R0RE 1V8OA 9ATCA 4AM8A 3UKDA 5BUCA 1NDUA 5BR4A 4OOEA 3WOVA 3OZWA 2GTHA 1MV8A 2B3DA 1Z7GA 2WVGA 1X80A 2E82A 3HEMA 3WYNA 5FO1A 4OFBA 3U7IA 5IKPA 4EG4A 4RQUA 3I01A 4QZVA 5TE9A 2IYVA 2JH3A 2AZDA 2Y0CA 4HNAB 4KXLA 1C1DB 1G5PA 2EZ4A 3KT6A 4NENA 5CPBA 3HXOA 1REQA 3JAKB 3OY7A 5LB2A 2FKNA 2WUGA 3NV7A 1YV9A 4W4TA 4DCUA 1R9JA 1SBTA 4UBJA 2ZBPA 1TYBE 2BOVA 5I4KA 5D6OA 1Q0UA 3K0HA 4Q5IA 2MMGA 1E1RA 3AGPA 3AJRA 2QM3A 4NZYA 2V4ZA 2CDRA 2ZR0A 2QPTA 2H2AA 2B1QA 2JLBA 5H80A 3ZWKA 3NVAA 4MGYR 1ONPA 5DTEA 5JQGB 1AHHA 3LC0A 3HUUA 4ZD6A 4Z2YA 3ZX4A 4LIPD 1FZQA 5FI1B 1J2YA 1F8YA 2JJQA 3LC7O 4BKQA 1YJ8A 4A36A 3LT0A 3UJ6A 2VHWA 1G0OA 2ZQ5A 2Z9DA 4EVQA 5KSWB 2YXLA 3GOHA 1XI2A 3Q8MA 3FOBA 5A7GA 2P3OA 4RH0A 1GV0A 3JD1A 3DVRX 1EXWA 2NLOA 3P26A 4TTVA 4LXUA 1ZGGA 1WCXA 1L5QA 2PY6A 3OIFA 3OAAD 1EK2A 3WK7A 3NHKA 5B6IA 5FR2A 4B8WA 3E7DA 5HIMA 3EEFA 2DBZA 1VIDA 3N8KA 3ZWWA 2XUIA 3TNLA 5CA0B 3TCXB 1HEUA 1RXUA 2XDWA 3NHZA 5H70A 3W5HA 3PPXA 4FYKA 2VZ9A 1UMDA 4LWOA 1FE8A 1KARA 5AOCA 4AJIA 3JASB 4FB5A 1Y1TA 2HNKA 2POQX 3HFJA 1UPTA 2EBWA 5CLHA 2Z2KA 4CLRA 3VKUA 1KY3A 3M6WA 3BGOS 3GFQA 4C4XA 3R8XA 1X9IA 1N0IA 3QP9A 5T7BA 3DVAA 1B8PA 1LBIA 2XODA 2J0UA 1DZ3A 4MGEA 1DC4A 2NXCA 2VAXA 4WEQA 2VPTA 1S8NA 1ZN7A 1BW9B 2C84A 5CD9A 2VPIA 3EF1A 3A8TA 4XVHA 1MOPA 3L5OA 1Q2XA 3NIFB 4EI2A 4BP8A 1G4HA 3TW0A 4EI7A 2BJHA 4OJQA 2HFKA 2ZE5A 2I4IA 4GYYA 3W6PA 2ZW9A 4WGFA 4DIKA 2ZM5A 2OV2A 1Q77A 1OH7A 4PZPA 4RXUA 4QDTA 4URXR 3ICQB 1OXVA 2GI4A 2FA9A 2XB8A 1X3SA 3WDSA 3G5AA 2QTWB 5L40A 2WQZA 4TV9F 3QU5A 4YDHB 4G8BA 3BJRA 5I7RA 2HO4A 4F04A 1F2TA 3DOHA 2XB4A 2ZUDA 5I7FA 3X1YA 4E3WA 1Y7IA 2IGBA 4PLZA 2H2GA 2JLAA 4R8RA 3T61A 3O1IC 2LCQA 2A5JA 3OQPA 1KDPA 1S2NA 3LKVA 3LTNC 4PC3A 1ATZA 5DLEA 2MHCA 4NI5A 3IPYA 1WSDA 1A9XA 2RHMA 4DBZA 3DL0A 4KUHA 1XTZA 4LF7B 2FPIB 3UEOA 2OPBA 2QNRA 2WRZA 3DBOB 4ALKA 3B1XA 1XQVA 1D6MA 4NESA 5TGZA 4E13A 2Q2NA 3KCNA 4PLYA 3TNDA 1ILWA 1ZAYA 5CDGA 4M9RA 4RD6A 4R8MA 4D3ZA 3M33A 1TUGA 3O92A 4BO5A 4PCUA 5L3RA 3B6KA 4B45A 4I9HA 5EE3A 2GEUA 5I6DA 2O3TA 1KFCB 4L07A 1VXOA 3HN6A 3FVTA 2QYTA 3UTCA 3QIAA 4BQRA 1ZKMA 5D3ZA 3RFUA 4YRBA 5JO0A 2CFIA 2XZPA 1QRDA 2I3BA 3LDFA 4G5FA 2OXTA 1ES9A 3GEHA 1V8PA 3QF4A 3MJFA 4P4LA 3T3MB 1S2MA 2VCHA 5LP6B 3EIEA 3WGUA 1F4VA 2OXEA 2A9VA 2JBWA 4HLUC 4XX0B 4DKXA 2APJA 1PV1A 1TU0A 2EJTA 4M8IA 1CW2B 3CX7A 2WA2A 2IXEA 2QQ5A 4XWGA 5C3MA 3T3PB 5JLJA 2PWBA 5GP1A 2DHCA 4BLTA 3WZ2A 7REQB 2XCIA 2DC1A 2EZTA 2OK8A 1RTTA 1THZA 4KE6A 4ZOAA 4GYJA 4IJVA 4JJKA 4YMSA 1Y6RA 3GAFA 2GPAA 3C6QA 3SJBA 1YK0A 3LLVA 3N9IA 4IP0A 5TRTA 4LOHA 2A9PA 3TSWA 4ZJZA 2X8JA 3M2PA 5AI5A 1Q0HA 1DXHA 1JHQA 4LNAA 2JGIA 2WTNA 1GNRA 1J06A 1EGQA 1ICIA 1TZBA 5TPWB 5LQUA 2H11A 2FWJA 1N2CE 5CFMA 3H1TA 2GRUA 2EJBA 5DBGA 3M5CA 2ZSBA 1Z2EA 4L02A 5DTIA 1A95A 5HOQA 1UODA 4ZEOA 1WB9A 3R20A 4D3FA 1R66A 4RDIA 4F1KA 2BCJQ 5JFOA 1IATA 1RRMA 1SUDA 3NKVA 5HGXA 2Q7DA 1W76A 4B3CA 2ZI7A 1NJ5A 3JQQA 1C3EA 3OJ0A 3ZR4B 4NH4A 2R0QC 1YJQA 2FQQA 3PQ6A 4EUNA 1Z29A 4ND2A 4EKGA 1M74A 2CWWA 2NU8B 4OFXA 3TVTA 4MRVA 5JASA 1E1KA 4RK5A 4N0EA 3ASYA 4F4IA 4JBGA 4ECAA 3GRRA 5FEUA 2IY9A 2VQ6A 4EA7A 3STVA 4BVFA 3LZDA 3QI2A 3MHPA 2LUOA 3BXHA 1X7DA 3CBGA 3WQBA 4UTPA 5LQRA 5E6RA 3E6AA 2PM8A 2A9KA 2XVMA 3A4NA 4RMJA 4UM9B 2BM0A 1DI0A 3QBDA 2GAFA 4B84A 1GEEA 2QMEA 1JQLB 2IUYA 2R00A 2GXAA 4MW0A 3E53A 3RWOA 4EMUA 4K9LA 5DBFA 4EKNB 3L05A 4JDPA 4WWHA 2UUOA 1H9BA 3V8PA 2BFFA 5EJ4A 2FMIA 3AUYA 3H87A 4MW1A 1I3MA 2ZUUA 3IOMA 1Z6XA 3ZWYA 2OSVA 4W6ZA 1SBYA 3MCAA 3MF4A 3DUFA 1CR1A 3I2YX 1NPDA 2BGWA 1NFQA 2XAAA 1EUCA 2V6GA 2IUSA 3LGAA 3EVDA 5FYDA 2EG9A 4NEQA 1PVOA 4XFDA 3WK8A 4HPJB 2AXQA 4MOWA 3CV3A 1U4NA 1SZPA 4IWYA 2FP4B 2MR5A 2Q1YA 3IE0A 3IDOA 4JOBA 4F6RB 3KX2A 2JHCA 4BN5A 2GTIA 4Y30A 3AF1A 3QUCA 2CLEB 3PENA 1TQ8A 5KOHA 1Y9JA 2BMWA 3HKCA 3LGXA 5DCUA 3DNMA 3I2GA 2O0HA 4ZI2A 1RQPA 2W6PA 1QLWA 4H3KB 1RC8A 3VNSA 3DZIA 2VSYA 3IIJA 4S12A 4TTTS 2QRKA 2J6IA 3PZRA 3R7WB 1MD9A 4UCFA 4DUYB 1FSZA 4X3CA 3TK1A 5JD5A 3ZQ6A 5T3UA 5C8VA 2C7PA 1Y5IA 1BTOA 2KQUA 2COKA 4LMPA 5BOVA 3E70C 2GN2A 3W79A 4BMDA 2RGXA 4I14A 1XE3A 3H4VA 3JRXA 4Z4HA 3DJFA 4H77A 8GPBA 5KZMB 1MAUA 3LJKA 4L0DA 3UGJA 4I50F 4ARSA 4C7JA 4EW3A 3BA6A 4B3HA 4G0VA 3PEUA 4FS3A 4MQMA 2XRZA 2IXAA 4CMJA 1I7DA 4XWYA 5G3ZA 3HADA 4FCVA 1S2OA 4JZYA 4LWPA 1L4KA 3C48A 3N2GA 3NBQA 3IKTA 3L1JA 5EXSA 2EKBA 3CLSD 3EHDA 2VDJA 2YZNA 5LB4A 3H97A 3OO1A 3QXGA 5KJFA 4MEAA 1RXIA 3RYFA 4P4GA 1PQPA 1U8UA 1U94A 5BW8A 5JJKA 1U8FO 4WBNF 2AG5A 3GZTB 1BJRE 3ZKWA 3PLRA 4Y2JA 2W6ZA 5J5AA 2GF9A 1ZMBA 1T5LA 2Q50A 1JH8A 3B8EA 4IWNA 5TVGA 3DWIA 4V1CI 3PEWA 1R37A 3K2BA 3SKVA 4NMWA 1IQPA 1Z7BA 2W83A 3BAZA 4DR2B 3TSAA 3A9WA 1H2FA 1XTSA 3R4CA 4ZDKA 5FR1A 4C2BA 1IAVA 1TJ5A 4GE3A 3A1NA 5BSGA 3KPWA 3OOEA 2VJAA 4OMUA 3UOGA 4X1IA 3LC2O 1L5NA 1LQUA 3NTOA 3RT1A 4HDOB 4ZCRA 3L6OO 2GEKA 2LD4A 3D3WB 4OA5A 4LVOA 4Q93A 2AXEA 1TJ4A 1NT2A 3HKEA 5K3BA 4R7ZA 4F4DA 4OBWA 5JC1A 5B3KA 5LNK6 3GL9A 2WWFA 1G60A 2OFOA 3BXEA 2XNDD 5FLEX 3O0DA 2YJ5A 1NI5A 1YI8A 3CKMA 4MR9B 3SIRA 4A1OA 2Y1OA 2YVAA 3CX6A 3IUEA 3C6BA 3K31A 3LY9A 4LSZA 5AI8A 4LZAA 5EJ2A 3V4ZA 5BSEA 3P5SA 5K2MA 3PFHA 4WLUA 2DTXA 5IDXA 1UM9B 4V2IA 2O8FA 1E3DA 3REGA 5JCOC 1S96A 2YXBA 3AUJB 2Z2JA 4LRUA 4F7DA 5KJ1A 4RS4A 3CM0A 1GGHA 3UJ3X 1JEYB 1L9KA 3VZSA 2A35A 1G5HA 4OTZA 5IFKA 1PYGA 1CG6A 2HR1A 3UUWA 2C04A 4FP9A 5TT1A 3I9V6 2FGKA 1VDMA 1DVRA 3OJOA 1DBPA 1KY2A 1XZNA 4AJNA 4ZOQI 2IV2X 1P0FA 1SURA 4BNXA 3VFDA 1KC1A 1H8EA 3REOA 5K8LA 2YHAA 3KTFA 4PG4A 2O5EA 3CUYA 1ZD8A 3I9MA 2JLVA 2QUZA 4UBIA 2BFEB 3RF6A 3URMA 6NULA 3P27A 4RCZA 1NF8A 1ZH0A 1E0JA 3FPGA 3WWZA 2Z3ZA 1MQ8B 4N3BA 4E1AA 3UJBA 3E0XA 4YYEA 1IPFA 2X9QA 4X8MA 2ZSUA 3RT7A 2V0CA 3AKEA 2M9MA 4PVDA 4WOJA 4CEJA 3P4YA 2PA0A 1W52X 3BAFA 3KPVA 1FFDA 3OF3A 1XEXA 1RBMA 1U3CA 2FN8A 1Q1QA 3O8DA 1Y4DE 4I6EA 5EQTA 5SZJA 1XP8A 4HN4B 1U1IA 1W36D 2GNPA 1XF9A 1X19A 1MB2A 5C4GB 3TB4A 5IABA 1PG5A 2E89A 4QU5A 4ZVRA 5FV7A 1IYZA 1LJUA 4JU8A 4NJMA 3SD7A 5LLDA 4LFBB 3UV3A 2HYIC 1GLVA 1WCV1 3F49S 2OLJA 1JTEA 2WICA 4X41A 1WP4A 4V0QA 3ZQKA 2M6RA 4B3FX 2O8DB 1NRIA 1WQ1R 4O8ZA 4CW7A 2A78A 1F0KA 1OPRA 3KLNA 3THRA 4EGQA 2IHUA 5FUQA 4ALMA 3FNFA 3IP9A 4YREA 1DKPA 5ADUS 3PC4A 1DTEA 1PWZA 1R3DA 3GEEA 3FWNA 3GZ4A 2I91A 3ZQUA 1II8B 4W5OA 2DQYA 2P40A 3LFHA 4E31A 1P2BA 3G0GA 2OM6A 4FMPA 3RUFA 1TD1A 3Q8KA 1W29A 3WL7A 2FFAA 4BNTA 4ZHQA 4WK0B 1P5HA 2CE2X 5F23A 4HRXA 5KTNA 1P9OA 3DEIA 1BRTA 4X6YA 3OLCX 1U28A 1F2DA 2WFLB 2WI8A 2YV2A 2B5OA 2R4UA 4V0LA 2CSUA 3HC7A 4X54A 4AD8A 5DT2A 3TMAA 4MP3A 1BXZA 1PX2A 1Q12A 1R6XA 2OCYC 3D6FA 3NDIA 3O74A 3Q7EA 4JVOA 3TX6A 4QOIA 4BFUA 4MVJF 5CT8A 1QTNA 1X80B 2HMYB 2ZUCA 4KO2S 1IMJA 5E7QA 2QV0A 2QPOA 4PRZA 1REQB 5DN9A 3ETGA 3PDIA 4MPJA 3TOSA 5EKDA 2D2XA 3T1VA 5CTJA 5B3LA 5BWMA 1JKIA 3VPCA 1O5IA 3HXMA 4KQIA 5DYTA 1F9AA 3S81A 4O1MA 4V0KA 3RVNA 3FN4A 1PHPA 1PJSA 3DTVD 3DC2A 5H3CA 2X1MA 3ANXA 3OT5A 5A6SA 2XIQA 3AU8A 1QO7A 3QLJA 4P86A 5HW0A 2VHEA 4JLOA 4AP5A 1ENOA 1AQIA 2PKQP 4DM4A 4PANA 4XLTA 1Q91A 3H84A 5FLKA 1V6AA 4DCOA 3H9QA 5JZ9A 4UZSA 2XCSB 1GTSA 3L6EA 2WWRA 4LPSA 1AXGA 1Z0IA 5F1PA 1EGAA 1FUYB 1N7HA 4D4GA 2H1SA 3FVVA 3G6KA 4X0EA 4OQ4A 5K03A 4PM4A 1NM5C 1WG8A 4E32A 1ZS9A 3LOQA 4PZCA 3KHKA 3W5JA 1B73A 2G40A 3EUFA 3P0JA 2ZAYA 1K9SA 3R44A 4ND7A 1D5CA 1JLRA 1NAIA 3EISA 5FWXB 4FYYA 4LV8B 4G0UA 1L5LA 3D81A 1IDN1 3BSSA 1PN3A 1VL5A 5D5PA 1QHGA 3VBEA 3ZS8A 2IUUA 2YIDA 1U0FA 2R96A 2WWGA 3I52A 3SYNA 2HSJA 3EEIA 3GDOA 2Q8NA 2ID7A 4GUAA 3R9KA 4B4DA 2YC2C 3CVUA 1UMDB 3A9TA 2WF5A 2G72A 2REQA 3DGEC 1CS0A 4TS9A 4UXJA 3OZDA 1JZQA 4D7AA 2OXFA 2Z95A 2AC7A 4HNVA 3OZUA 1A88A 4IFEA 1WCWA 4L4XA 4OHKA 4ALLA 4CLRB 1W4RA 2OO5C 5HF5A 3ZDRA 1BU8A 2CWDA 2DH5A 1ORTA 1TLLA 4OI1A 3ZN2A 4DCMA 5GADl 1T2DA 1GUAA 3OTOB 1TT7A 3DVAB 2JLRA 1UWKA 821PA 5IKMA 1PT9A 4OH1A 4Z9BA 1I9CA 4WOBA 2AMYA 2PLWA 1DADA 3NWPA 4RLFA 4JUCA 3AI7A 2B4QA 2OZPA 3FCCA 1CIPA 3QVGA 5DV9A 3RAPR 4U2KA 1WSAA 4G3XA 5E9JA 1JIXA 3AM1A 1UXKA 1E9BA 3NCHA 2FQYA 5F76A 1MAVA 4EO9A 1BN7A 4J2TA 4UAVA 5H4HA 4FZJA 1HOTA 2W6CX 2P2DA 1QYXA 1DKNA 1L5SA 2J6BA 2VJQA 1KZGB 3RK4A 3S8MA 1BDJA 3ZW9A 1A72A 4C3OB 4PNEA 3U17A 2VNHA 4MV8A 3B1YA 2TS1A 3HXKA 3P8ZA 4ZCPA 3SC6A 1M6HA 4JHLA 4NXNB 2A1IA 1Z73A 1AQYA 2C7QA 1F2TB 2WG1A 2ZULA 1TQ2A 4QO7A 2ZGVA 1B0ZA 2IHKA 1ZG3A 3BWCA 3MK31 1LSUA 3O8NA 4HWOA 5HQJA 4II7A 4EG6A 4NE2A 4JJZA 4TTPA 1GAQA 4GLBA 4TLDA 2XB9A 2CXSA 4DLYA 1PS9A 3C3EA 3KWJA 2VIIA 1UPAA 3ASZA 4D98A 4AMUA 1A9XB 1U5BA 5DNVA 2OHFA 4GXQA 1KO7A 3A26A 5MN5A 2AF4C 1JJFA 2J3KA 2D13A 2Y4NA 4YXWA 3QPBA 3RROA 3SYLA 3VR1A 2O57A 2YW9A 4DV6B 4OQLA 3GPLA 3K1YA 2WUVA 3KJZA 4ALIA 5ICCA 1GPJA 1SCKA 4X97A 3S68A 4XGRA 4W1QA 2Z6VA 3TM4A 3IHTA 1P3DA 2QPAA 4G09A 5H83A 3TTWA 2BW0A 2DOKA 3OICA 3LTEA 1GR0A 2G0TA 4GMDA 5IBRA 1K6MA 4BMNA 1MT3A 4B85A 3AM5A 3KV1A 4B48A 1N1GA 2ZIGA 2CY0A 3FM9A 3LXRA 4MCIA 3KE8A 4QTUB 4Z0TA 1T2CA 1QP8A 2C97A 3OX4A 1I51A 2EP7A 4DDKA 1ZHFA 1BJKA 5KC8A 4OUKX 4UEKA 3KR2A 2W2VA 4FONA 4X6UA 4DARA 2B1GA 2OO7A 4ZKEA 5ALVA 2IVZA 2YJNA 1HE1C 3C45A 3VA7A 1LLFA 3QVOA 4Q00A 1VMKA 5FQOA 2ZM6B 5LZ7A 2ZYSA 3HJAA 4JBLA 1IVSA 3JXEA 3HYSA 2AOXA 2JLSA 4BQFA 4YI5A 3OEEA 4NYMR 1CUYA 1V41E 2ZXFA 3R5FA 1KI2A 4FYXA 4MUAA 4KIUA 4W6QA 5AKZA 3WK4A 5JDIA 3OKCA 3O8OA 3T0GA 4AK9A 4JSYA 5CG2A 3IMGA 3CNBA 1ORIA 1YD7A 4NYMQ 3OZTA 2X8JB 1FSSA 3VTZA 3QYPA 4HVTA 2EW1A 2C03A 2INGX 2X7XA 4ONEA 4EA8A 3R6LA 3VGPA 3WRVA 2WZQA 2DG2A 4KI7A 2JCBA 3VKWA 3QNUA 3TIIA 2POCA 2UAGA 3KC2A 3PD0A 1DINA 4WNCA 4YMVA 4DV2B 4J07A 1Y6FA 4CMEA 1RKVA 2CNKA 3ESAA 1QYVA 3GFTA 3MUFA 3H8WA 2WPDA 3U7RA 4OI2A 1NUAA 1YZNA 3E9YA 5AK6A 2WYHA 2PXXA 2I65A 2XJ4A 3BRSA 1NY6A 2RG7A 4QSHA 4C05A 1LS1A 2PO7A 3MBIA 4Y3UA 4TRMA 1E1DA 3U4CA 5DMXA 3NHAA 2JA2A 2YOFA 4C7BA 2FI1A 3WLHA 4PRLA 4G5QA 1KDRA 3VSCA 1WMFA 2H7XA 4CE6A 1DIBA 2W4IA 4IXMA 4JJAA 4DSOA 4NHOA 3WYFA 1FXWF 2XGOA 1H6CA 3F96A 5EP4A 5BV1A 5E6RB 1QH1A 1XZAA 1YMQA 3DMHA 4NRDA 2BKAA 3A0RB 1M6EX 3EPJA 4Y2RA 3HJHA 3HP7A 4S1NA 1SPXA 1WU8A 4RVDA 5DTQA 5AI4A 3QOXA 3OY2A 5SICE 3HYCA 3A3KA 3ZNPA 4KLZA 2KSQA 4HAIA 3U4HA 4X71A 5CNKA 4MMXB 2BFFB 4L76A 1RZRD 1G8PA 2PRYA 1FS4A 2A6PA 2C8JA 2WG2A 5T64A 1KO5A 3ZWVA 3UJCA 1AKTA 4ADSG 1WDMA 2B1RA 3DUFB 2FFQA 2RC6A 3IODA 4PYMA 1EUCB 1EE1A 4OYLA 4Q9IA 2XD4A 3ENWA 3TFQA 1A2BA 2WTBA 2R8OA 5JCPA 2AA3A 2VNAA 4CCYA 1TPZA 1DEXA 4MS4A 1CSEE 1SRRA 3R23A 1RDFA 2IYAA 5HHTA 1VSTA 3IXQA 1PE0A 1OZFA 3HCFA 1AUVA 3E3OA 1NSYA 4J9UE 4UFNA 1H6DA 3KEQA 3GJRA 5C3UA 3V1UA 1DLJA 2ZR9A 3G2JA 3RYIA 3U09A 3LPLA 2FSPA 3IRVA 5D86A 2X2PA 1DC6A 2DRIA 2IUFA 1Q11A 1B16A 1EVEA 1RWWA 5LBIA 1N75A 4YJ2B 5JBIA 1ZNYA 2PBRA 2QY9A 1ZWLA 1O03A 4AUMA 4TSFA 4F5EA 1EFUA 1M2HA 1UC4B 1X8KA 2E4ZA 3CX8A 3E3LA 3T38A 5JZSA 3Q7IA 2WTAA 3LS2A 2GA9A 1RBZA 4IO1A 4Q7QA 2OORC 1I9GA 2B5WA 4G9GA 4I1IA 2AX3A 2DQKA 3BWBA 1SD2A 3AEZA 3AZOA 3CLRC 2A92A 2DJIA 4MEJA 3WP1B 2ACEA 4XPIA 2YJ4A 4V0ME 4FKZA 1J7KA 5JYBA 3QFRA 1JKJA 3N2GB 4J03A 1WKVA 2OCBA 2YIVX 4GG1A 2WNHA 4G4SO 1N5JA 4NU6A 2C5SA 2CVZA 3EOAI 3K9BA 1FTYA 4WXMA 5GONA 2P2LA 4QDKA 3RYFB 1GKYA 1RAFA 1ST2A 2A88A 2QRNA 2FMXA 2ADMA 1YASA 1G9TA 2QOEA 3BH7A 3VR6D 1VFNA 4LQDA 5ES3A 3AHHA 5A4IS 2XNHA 1GN8A