4DLYA

Set 1 cacl2/dtt, ordered off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlyA00
2AFIE 1II0A 5EE1A 5EE9A 1JEDA 4Q4AB 3CB4A 1MH1A 1N5KA 3WNBA 2ZXUA 4BFWA 5E95A 3NXSA 3AM1A 4N0DA 3TQCA 2C9YA 2ODWA 3KJGA 2PCLA 3DEFA 4URZR 1XJQA 1KI9A 4LYHA 4DDVA 1KHTA 3TUZC 4CIDA 1Z6AA 5EXXA 2Z4SA 5JRJA 4PTLA 4A36A 1IJFA 1U81A 2J5XA 5K8UA 4YMVA 3Q3JB 3QKSA 2G9NA 2ANCA 2AHOA 2DFTA 2AKYA 3CKLA 3SI7A 4IDPA 2IS4A 1XEWX 3ZD6A 2CHVA 3I92A 4G0NA 4Q66C 4KHZA 4LYJA 3U44A 4LZZA 5G40A 1IJEA 4LV5B 2RB4A 4GOJA 5DYIA 2GILA 1YZKA 1Q44A 2OSBA 5FPYA 3DVLA 4DCTA 2AX4A 1RPZA 2OG2A 3N2IA 1HQYE 2VYFA 3U3RA 5FOWA 4IHQA 5J4HA 4HB3A 1NF3A 2GHIA 5C46F 3AVXA 3RHFA 4MITA 2NOAA 1G21E 1GKUB 1ZNXA 3HU1A 5KDLA 4OI0A 4ESHA 1GL7A 3AF0A 4MKHA 4LPKA 3GJ8A 3GJXC 4JVSB 1QHYA 4I1OA 2WWGA 2IYQA 5G3YA 4DCNA 3H0KA 1II8A 1UM8A 2NO6A 1VG9B 3K0SA 3AKCA 4P4SA 2CJWA 3OIWA 5FUYA 4AIIA 4MDFA 2QY9A 3AVYA 4OQFA 3RC8A 4OK6A 3TW8B 4A2QA 2ZJ2A 1JPNA 1W49A 3LNCA 3RVBA 4BLQA 3B9QA 1G3RA 3OFNA 4MQBA 3HP1A 3TVTA 2ATVA 4YLGA 3ZQ6A 1LFDB 2NGRA 4IFEA 3SYNA 3P4YA 4A4DA 4PZYA 821PA 3H2YA 2ODEA 3A8TA 3PG5A 4PSVA 2G0NA 3GLFB 3P1JA 1OFTA 1RE0A 1NVVQ 2V6IA 4LCBA 4MRRA 4V0KA 3AH8A 2NO9A 3T1OA 4F4IA 1KSHA 4CEHB 4PAOA 2H18A 2PMKA 3P27A 4O2LA 2XXAB 2CNWA 1OF1A 1U98A 3UKDA 5H8WA 4TZ6A 4TSFA 2GEUA 1VCMA 1VHTA 5LD2C 4Q4AA 4EPXA 1M1YE 3FGNA 2D2FA 1GNPA 1KK0A 2ZJBA 4B43A 5E4FA 4Q1AA 1YRAA 1CR1A 3UG7A 2O52A 2R65A 1EFUA 5CK4A 1JAIA 2ZI3A 3ZYCA 5J4VA 4N1AA 2MSEB 4UNNA 4U7DA 4NCNA 2VRWA 4BASA 3RS3A 2QPAA 3EC2A 1OXVA 5DN6D 3T06B 3F0TA 2AD5A 4MUAA 2ZJ8A 2YOGA 5H68A 5B2ZA 4DEYA 4BLPA 3QUSA 2QE7D 1SVSA 5CLLA 1VCNA 4P0TA 4AYTA 3EPKA 5B58C 4WW0A 3THXA 4B3XA 4GL2A 3IQWA 4PPFA 5LD2B 2PH1A 2REXB 4DSUA 3TVDA 2WHXA 4EQ6B 1CRPA 2C9CA 3TKLA 3ZVRA 4GMDA 2ZEJA 2FJUA 1SVIA 3BERA 2CL6X 3QPVA 4D4JA 4PFSA 5JMTA 4EPRA 5HKKD 3LLMA 1HA3A 1QDEA 5SZJA 3QXXA 2PCJA 1KDOA 3BJIC 3SEAA 2O8BA 1RC8A 5CLQA 5FBWB 2I3BA 4EFNA 2J0QA 4ZCMA 2IXGA 2O8CA 1UKZA 5BN5A 5D3MB 1UDXA 2D2EA 3LH5A 2DBYA 1NRJB 2A5GA 1W7AA 1IQPA 2OZEA 2ZRBA 2QTFA 3B1VA 4URYR 2EWVA 3U6KA 5DYGA 3AVVA 4JL8A 5FOTA 1KO4A 4ZDJA 5A0FA 1JQJC 3SC3A 5HE8A 2JATA 1NN0A 1KMHB 4L9SA 5GVSA 1KTVA 3KL4A 4F4CA 3KXIA 1YKSA 1CJTC 1QHHB 4M22A 3PUZA 3I73A 1W0JD 2DFLA 4PO8A 1VIAA 2XTZA 4M8NE 4LUCA 3WHKA 2GXUA 5C2JB 4A82A 2CL7X 5J5CA 2XTNA 2RGDA 3A1SA 2ZITA 5AUPB 1KI1A 2IHBA 4Q7LA 4ACBA 2VHCA 1ZNZA 1U0LA 4ITRC 1JI0A 2GCOA 5AK0A 5FFMA 1W4RA 2QBYB 3CRVA 3I62A 1NJFA 2BMFA 4ZPXA 5CITA 1E1QD 2W58A 1YE8A 3MRSA 4DCSA 2ODBA 2WWYA 1MV5A 3U7FB 2Z6VA 1JR3D 1N6LA 4LSGA 4CF7A 4ZDWA 4YMTA 1BOFA 5EXTA 1M74A 3CH4B 3QBTA 4G5QA 5GVRA 1NLZA 4R7ZA 1DAEA 3KFXA 2CCJA 1E32A 3HYRA 3UMFA 5CDFE 4BFTA 4K46A 2CVHA 1Q0UA 5KUTA 1Z0FA 2P65A 4S35A 4EAQA 1SXJC 2FNAA 3NHBA 4IJMA 4NYMQ 1QHIA 3SJCA 3U3JA 4RCYA 4B35A 4F93B 1KDPA 4Q5IA 3DDCA 4TMWA 3GJ7A 2AK3A 2CNWD 2F1HA 4CEHA 3EARA 3U7HB 1RJ9A 2I1QA 2RGCA 3A4MA 4QXAA 4E5UA 2GAAA 3L43A 3RLFA 5JSZB 3LXXA 5HTKA 3WMGA 2P6RA 3OE7A 4R9UC 3PEWA 3THXB 2GRJA 3EIEA 3MUFA 4A2PA 3K0AA 4U00A 4HEJA 2RGEA 1E4YA 4X8MA 3EZ9A 2RCNA 3CPJB 1G8PA 2C5LA 2QI9C 2WPDD 5FOXA 3F3YA 4RZ2A 3IPXA 4X8OA 4NYMR 4AI6A 5EE3A 3PCRB 5CK5A 2Q9BA 3AP2A 2FSFA 3DM9B 1XU4A 1UAAA 5L3QA 1ZUNB 2CCGA 3ZJYA 3SHWA 2Z83A 4OJKA 4MGZR 4NCIA 4R98A 5BYJA 4MRVA 1HYQA 2O0KA 2ZSFA 3CZPA 5KYKA 1L8QA 3Q85A 1Z63A 2AL7A 3FFAA 4XVQA 4IVQA 4RKFA 1Q1BA 3PV0A 2VPPA 5FTJA 1N3BA 1DAHA 1KMHA 2BBSA 1W1WA 3AVQA 4I4LA 3ETLA 4M21A 3RSOA 3ZD7A 5CM9C 2VP4A 4LRWA 2N46A 1ZAKA 2XNDD 2REBA 1Q12A 2OESA 2NPFA 4M0LA 1E9DA 3JZMA 3G82C 1FOEB 4LC1A 4GSYA 1E2EA 4GPTA 1NBMA 5FI0B 3U44B 1R6BX 2Y8EA 2E1RA 4CGZA 3LLUA 2DHRA 1MRSA 4F38A 3X1XA 1OPXA 2YNMA 5DLQC 2H1LA 3KQUA 5DO9A 2GKSA 4Z8YA 2GCOB 3CWZA 3N70A 5L3RA 1XTSA 4E03A 2KBFA 5DHFA 1G3QA 1KAOA 3QKRB 2OO7A 1VPLA 4LBZA 1GG2A 5GJWC 2IYRA 1WQ1R 2A5JA 2IUTA 4TMTA 1SKQA 5EZ5A 3GD7A 4L16A 1Z6GA 3ZVLA 4UJ3A 1CIPA 4IVRA 4BZXA 4C0AC 1NSTA 1G8HA 1YZLA 1CULC 1DE0A 2NPIA 1J70A 4HSEA 2QRNA 2BEJA 4UKDA 4BFVA 4DLSA 4PAQA 2WKRA 4HI0E 4DDWA 4B73A 3ZGXA 3KQHA 4Q7JB 2VP5A 2QQ0A 3KQNA 3FKQA 3BXZA 5CJPA 1W36C 3EZ2A 1JPJA 4OBEA 4XIGS 1FMLA 3E2IA 2IWRA 3DMDA 2ZJZA 3GLHA 1E94E 1R5OA 2GJKA 2IT1A 5DNYB 1GVNB 1SVWA 2FFQA 2V6JA 4YMSA 5BW8A 1KK3A 1V5WA 3CO5A 3LV8A 4BEBA 2F43B 1T0JB 3EWAA 5SZIA 5DI3A 4DT1A 1ZIPA 5KHOC 3KKNA 1DADA 5FPSA 3OE7D 1AKYA 4TLDA 3THWA 3QVUA 2OCBA 4A8JC 4GT1A 1J8YF 5H70A 3RS7A 1G41A 4NE2A 5KDOA 3JVUA 2DFNA 1D5CA 4YXWA 1CJKC 3X2SA 5IT5A 4R71A 3CH5A 4B34A 1ZUHA 4JIMA 5LB2A 1E2NA 2B8WA 3BH7A 5BWMA 4IEEA 2ANBA 3KFVA 2HXYA 3ZH9B 3L0SA 2QT0A 2QPTA 4M4SA 5ANRB 3RRNA 4IVPA 3REFA 3THYA 1KK1A 2EYQA 3FB4A 2XJ4A 1WBDA 1E9BA 2ZU6A 4YC7A 1W46A 1HQCA 3SS8A 3QOFA 1XJ0A 1RKBA 2GZDA 2W0SA 2DR3A 3NWJA 4QM6A 1DAGA 1SVKA 4URWR 4HLDA 3FVQA 2IBMA 1XEFA 1ZM7A 3I3SR 2ZRDA 4QKQA 1AGPA 3SHFA 4D81A 1P9RA 4M1MA 1G18A 3SFZA 5AUQA 1LS1A 1QVAA 3I4LA 1MABA 3X1ZA 1D2MA 1GTVA 2WJVA 2LCFA 4GBMA 1ZM9A 1ZP6A 1MRNA 3FYHA 2CLCX 5TXGA 2LKCA 4PC1A 1II9A 4D25A 1OE0A 3QBVA 2FSIA 2V4ZA 3HDTA 2EW1A 2F1RA 3IGFA 4P4UA 1R5BA 2PEYA 2ZRJA 4TTQA 3I5XA 3CNLA 4KVAA 4V0LA 2NO1A 3AV0B 1OKKA 3QKRA 1FX0B 2HJVA 3WRYC 1F2UB 1XX6A 4EPWA 4BUJA 2OE2A 1ESMA 2HCBA 2WOOA 3FHTA 1U8AA 3QXCA 1R8SA 2A5DA 2OCPA 4TL6A 4BGDA 1E0JA 2VF7A 1E0SA 4CT4B 2OXRA 4HUQB 1VG8A 1XNJA 1BYUA 3Q5EA 2VHQA 3GLIB 1RW4A 2ZJAA 1FP7A 2QMUA 3EAQA 3EIQA 4KFRA 4NU0A 2ZR9A 1QHXA 2NTYC 1QHHA 2P3SA 3NKVA 2A5YB 3EG5A 3S1AA 3TJZA 5F9HA 1ELOA 1K5GA 4OI1A 4JLVA 1KGDA 4TYWA 121PA 3G5UA 3SBEA 2W0MA 2JLYA 1PUJA 3EASA 4Q1DA 2AKAB 3FFBA 3OEED 4PO1A 2NO7A 1TU3A 1XPUA 4HAXA 1N6NA 1GWNA 1EFHA 2VL7A 4ZKDA 4TN1A 4FXPA 1NN5A 3THWB 2ZE6A 4FD2A 2JCSA 2Q9CA 1A1VA 4WVFA 4A6XA 4V0ME 4BQSA 3A36A 5TARA 2YVUA 1ZCAA 4QGHA 2ORVA 3IDQA 5EE0A 4F92B 1UBEA 3KJEA 4KYUA 3WNCA 4A0HA 1W36B 3B85A 3GJ3A 2FU5C 2JLZA 5JCZA 2O8FA 2H5EA 4H9GA 3VR4A 3THYB 2BBOA 4TTRA 4G5SA 3U3OA 4Q7KA 4EIWA 3ICQB 3BE4A 1CJUC 3VHXA 4BECA 3HPQA 3TNFA 1OB2A 4Q1CA 2EFEB 3AVPA 2XAUA 1A2KC 1KDRA 4F7WA 4DVGA 2KJQA 2HT1A 4HDCA 5JSZA 1SVOA 3TSZA 5C18A 2V9PA 4OI4A 4GMXA 1RIFA 5AR1A 2AN9A 3SQXA 2FZ4A 1TQ4A 4Q03A 6Q21A 2VIIA 4OI2A 3EX7C 2FSGA 2QGNA 1KDTA 3AP3A 1TQ2A 3L2OB 4QG7A 5FOSA 4ILEA 1W2HA 5FH9A 1TF7A 3CIOA 3TSOA 3A6PC 1N6PA 1P62B 2PT7A 3OEHA 4KYIB 1AQUA 4XH9B 1KSFX 2X19A 1AN0A 3A1UA 3CBQA 1NVVR 2FX3A 4MRPA 4TQAA 5AJZA 1G3UA 3ADBA 2G83A 4QC2A 5HZKA 1SVMA 2CE7A 1KKMA 2X8AA 2PMDA 1FP6A 2F6RA 2RKOA 2Z5FA 1YR7A 2ZYVX 1E1RD 2B92A 1E9EA 4JL5A 4EPVA 1QHSA 4M9ZA 1M6NA 1U90A 5JFGA 4CEIA 4B6EA 3RDPA 3K0CA 1W4CA 3OESA 1LW7A 2DWQA 4QGGA 3GP8A 3WY9A 1L7VC 5CJ2A 3DPUA 1FMJA 1GL6A 1UKEA 4V0MA 2OFOA 4XJXA 3ZQJA 5JS8A 1H8ED 3H86A 3ZIAD 1NBMD 1QG2A 2FG5A 1GIAA 4A15A 5SZHB 1S9HA 2BV3A 3WXMA 4J0QA 2ZRPA 5JS7A 2QA5A 2H7VA 4DIEA 4Q47A 3CRQA 1YZQA 3K8YA 4FMCF 4NZYA 5J4KA 4A9AA 2QQEA 4HDOB 3CX6A 4LJ5A 2P6NA 1ZD9A 4TMVA 1IOZA 4CEJA 2C2HA 1G7SA 2WJJA 2L0XA 1GL9B 3KKPA 4EJSB 3O47A 4RKEA 5FUVA 1XXHA 3O8BA 2GF9A 3BAFA 3NBZC 2ZSDA 4QGAA 5AJWA 1XFAA 1SXJE 1UEJA 3R20A 1S0UA 1HE8B 4A0GA 2HJGA 4URXR 1OXSC 1X1SA 3DMNA 4M1YA 4RSGA 4HUTA 2HF9A 1KYIA 2WPDA 5DI9A 4QM7A 1IN6A 4QBGB 3GLHB 2DY1A 4NCKA 4LDJA 4DB2A 4OK3A 1PLJA 4JBWA 4JSTA 2HLDA 2P67A 2V54A 3KJIA 1VHLA 4QFMA 5EXSA 1CEEA 4D0LB 4IOJA 4IXNA 2CMKA 2GXQA 2XNDA 4HZUA 2O8FB 1GUAA 1NKSA 1W0KA 2PZGA 4GNKA 4LOAA 4AKEA 4B3CA 2DB3A 1E99A 4BLRA 4GFDA 4W9MC 5EZ6B 1GRNA 1OXTA 1AIPA 1OYWA 2VEDA 2H16A 4P33A 2IWHA 1DS6A 4CYMA 1E2IA 2OILA 1VYUA 2IYXA 2WAYA 2ZE7A 4QGFA 2CEAA 1RRGA 1EFRD 2ZJOA 2BMDA 4DIDA 4N0EA 1ZM2A 1FL9A 1OYYA 2BBTA 5J40A 5A5GA 5KSZA 2UZ3A 1J2JA 2O8DA 5DISB 1C9KA 3ZZUA 2CHQA 2D4HA 2G6BA 4A8JB 5FTLA 4B3FX 2A7QA 3GEIA 1HV8A 1ZBDA 4DWJA 3DL0A 2QAJA 1GP2A 1T8UA 3A4LA 4ESVA 1Z0JA 3GQBA 1GFIA 5HPYB 1W44A 2V1UA 1G4UR 1T5IA 3IUYA 2WWIA 2JA1A 4HLQB 1FNNA 4PR0A 5JI3E 4LJ9A 1UFQA 5CB8A 1OHHA 3QE0A 3UWKA 2P2LA 4WZAE 5DSZA 3SE0A 1N5JA 1DOAA 3W34A 5L3SB 1G8GA 1EK0A 3LBHA 1XD2B 4DUGA 1WE2A 3LQQA 1FW6A 1PV4A 4BFXA 2QAGA 3GLGA 4S2EA 1NG9A 4NPHA 5ELXA 4FI3C 1NMXA 4IDNA 4ABYA 5CYOA 4YMWA 2F1IA 5AUNB 3BIFA 2PZEA 3QKUA 1FX0A 2WJIA 4OHZA 3FOZA 2F9MA 2J7PD 3Q5DA 4PANA 4I1SA 4LGMA 1AK2A 1M8PA 4B3BA 2Z4RA 4I1VA 5TB5A 4D82A 1IXSB 1II8B 3V4RA 4ZDKA 2V55B 1ONBA 1IHUA 2H8KA 4HUQA 4V02A 1JJVA 3IQXA 4DLVA 2JJ2A 5TVKA 3RSLA 2ZVPX 1JR3A 4QJ4A 2QM8A 5G41A 1COWD 3SYLA 2G1KA 1DAMA 2UKDA 5KU1A 3VKGA 3HU2A 1JALA 1EESA 2ORIA 1GKIA 3NBYC 5EP4A 2VP0A 4TMXA 1MR3F 2IXFA 4MGKR 1XPRA 4A0RA 1E1RA 3OIUA 4C0BA 2XZOA 2QU8A 3D3QA 2IYWA 1M2OB 3U2QA 4BWYA 2WWXA 3CRW1 1KJYA 2GTPA 5JJIA 4OQNA 1CXZA 1P60A 4XTRA 3VFDA 2W6JA 1I4DD 1E9CA 4PSAA 1P2SA 1H8HA 3BOSA 3PITA 4DLWA 4XWOA 5C4MA 1KO7A 4ZI2A 2HT6A 3W3ZB 1J8MF 1DBSA 1G9XA 4MYUA 3TR5A 3QPUA 1S4QA 2WSSD 1TUIA 4O2RA 3BFKA 3VX3A 1QF9A 1S9DA 2ZTSA 3UIEA 4BPBA 3VKHA 1P72A 1ZC4A 3IO5A 2EFHB 5TDHA 2PJZA 1NIPA 4RD0A 4PHGA 5CYPA 4ERNA 2ZETA 3IEUA 2ZE8A 1M7GA 2OUKA 5HZHA 4JLAA 1JECA 2P6UA 3NVAA 3LO5A 4MGYR 4P31A 3QEOA 4Q9IA 1YZNA 4YQFA 4Z51A 4RZXA 2I4IA 2FEMA 3FDIA 3QENA 4FMBB 5IK2A 4Y0AA 1OH6A 2JEOA 4EFMA 4UJ5A 1W5SA 4YMUA 4B2PA 2IC5A 5BXQC 2MSCB 1OW3B 3EIHA 1TX4B 5JWHA 1L4UA 2QSYA 4IKEA 2R6FA 3L8YA 4OHXA 1VTKA 4TYQA 2HV8A 1GKYA 2A2ZA 2ERYA 4AYWA 1LV7A 2WIAA 3FE2A 1KO5A 5FL7A 2WIBA 1JXOA 5JHHB 2QG6A 1US8B 1A7JA 3OHMA 4HLUC 3SOPA 4AWXA 1UADA 4H1VA 1YU9A 5DHAA 4Q1BA 4HDQB 4Z8XA 1KSGA 1E79D 3SFVA 2REOA 5DGXA 2IUUA 1G3MA 3FKSA 3EW9A 1VG0B 1GITA 2CLSA 4HLUA 1BH2A 2OM2A 3KKMA 5C1BA 1XD2A 1XEWY 2IS6A 2GCNA 4FCTA 4LYFA 4XSHA 2QAGB 2QAGC 2AXNA 1GRRA 1VG1A 3DO6A 2OCAA 4LHVA 5CIWA 4L8GA 3P20A 3QXSA 2O8EA 3RS4A 2OV2A 4JVLA 4WBSA 5AUOB 1Z8FA 5LPNA 3V4FA 2XSZD 2OXCA 1E2QA 2QUZA 1U9IC 4HZUB 3B5JA 1P3JA 3CF0A 1R0WA 3GCGA 3SN6A 2XGJA 3AVWA 1ZJ6A 3UXMA 3BC1A 4XWKA 3EZFA 1EGAA 3LVQE 1COWA 3VR5A 2EFGA 4RD3A 3VR6A 4C30A 3M0EA 3WRXC 2FPKA 2DYKA 3X1WA 1YQTA 4TT3D 4NDZA 2WJHA 2FGKA 1MO6A 2AD1A 2ZIAA 3R8CA 1OH7A 1IXRC 1DELA 1E1QA 1CF4A 2JASA 3A4NA 3FMFA 1AS2A 4PHFA 4F4JA 3O8RA 3QKTA 4AKIA 4XD7D 3J81k 3BK7A 2ODNA 621PA 1Z06A 4HYYA 4QBIA 5GADl 3C16C 3PQCA 3L0IB 2YINC 3R9XA 5EXPA 1E6CA 3I72A 3JZAA 4HATA 5EQTA 2WVJA 4AURA 3TR0A 2HUPA 2XZLA 1J99A 2JJ8A 4OHYA 1GDDA 1XEXB 2N42A 1BMFA 1FUUA 3T34A 3QSYA 2ECKA 1KNXA 4URVR 1NKTA 1QZXA 3AQ4A 3RAPR 2YWEA 2GEDA 1FFHA 2FPMA 2A5FA 3U3MA 1QG4A 2J46A 3A1TA 3MAAC 4HAVA 2J7PA 2IYZA 4LBYA 1E2PA 2YHSA 3GLHE 1Z0IA 2J1LA 1GOTA 2ATXA 1HUQA 5FPHA 4CVNA 4PC6A 4ZO4A 3TW4A 1IN7A 3JVVA 5FUXA 1IN5A 3N2EA 1MT0A 1KI6B 5TY0A 1G5TA 1W0JA 3LBNA 1JXMA 1PVOA 4TZ0A 3L8ZA 4UNSA 4FMDB 2G1JA 4WIAA 1C4OA 4Z1MA 1LTQA 2YC2C 2BM0A 1ZU4A 3VAAA 1Q1ZA 2QN6A 2R62A 4A8JA 1U8ZA 3OAAA 2KSQA 4QHYA 2QT1A 3D31A 2ZI5A 2B8TA 1S2MA 3HYTA 4UXJA 2IHYA 3AF3A 2CHGA 3TIFA 3DKPA 3U60B 1ZD1A 4DCUA 3GEHA 3MLEA 4Q4JA 1EFCA 2PBRA 3EXAA 2GEVA 2XZPA 2QM7A 5KO2A 4JKYA 2O8EB 4KITB 1US8A 2CK3A 4C4PA 2X1VA 1CU1A 2KB0A 1N5IA 4NYIR 1R10A 1AM4D 4LX0A 5B30A 5FL3A 4TLCA 1O87A 4EUNA 4JYBA 3LX5A 2QTVB 1IN8A 1QHNA 1X8KA 2YWHA 2QPOA 1P2VA 4P32A 2JDIA 1R0ZA 1SKYE 2HDNB 3DZ8A 4ACAA 1K8RA 4B6FA 1Q57A 2D06A 4TYNA 4MDEA 2FN4A 4BZPA 2KE5A 4POAA 1HURA 2R9VA 2QTHA 1U9IA 5JZVA 1IN4A 3VNVA 2JLRA 1Q1EA 3BH6A 3SU8A 1NNEA 3CX8A 1UF9A 1T3HA 2G77B 1GSIA 4Z54A 1E69A 3AGQA 3K70B 3EA5A 1T5LA 3FTQA 1P7CA 4BFZA 1DARA 2XB2A 3T5DA 1Q3HA 1SZPA 4OK5A 4IOKA 1QRAA 1HH4A 3NEYA 3I5YA 3MSXA 3IIJA 2RHDA 1P9NA 4CRWB 3B6EA 1G8FA 1IAQA 1KI4A 4LK2A 3TSWA 3B8HA 1D6JA 1ZU5A 1Q3TA 4OQLA 1W4AA 4HB0A 4RD1A 4DT1B 3P26A 1I4TD 1OFHA 3TUJC 2JAQA 2JIZA 3Q72A 4NYIQ 4D80A 2CXXA 1Q22A 4I99A 1HE1C 5GJCA 3VU9A 4EFLA 5CB6A 1G7TA 4DLUA 3VTKA 3EA0A 2PX0A 1G7RA 2ZE5A 1G8YA 1AS3A 5C4GB 1D9ZA 3D6TB 4NONA 2QORA 4PPQA 2VSOA 5FTMA 2JJ1A 2C04A 2ONKA 3FHOA 4JLPA 1LB1B 2FA9A 4KJZA 3W8RA 1OLOA 5KNBA 3R9WA 4D6PA 2BC9A 1VIYA 4PQRA 2BVNA 1W36D 1DTSA 3E70C 4MKGA 1VYVA 2HCJB 1NG1A 1R4AA 3BB3A 3IIMA 4GOXA 4RFSA 4U02A 3RANA 1XD9A 3EPJA 1RYHA 5KSPA 4C0KA 2YWFA 2AK2A 4GZLA 5K8LA 1P2TA 4G5GA 2W6IA 2VA8A 3MWLA 3OIYA 1AZTA 1TUEA 4WZBE 2B6HA 5FR1A 4P3YA 2HF8A 1S3SA 5FBRB 1T3LA 4DLZA 3O8DA 5HCNA 3QPWA 3ECCA 2FGJA 2JIZD 3SJAA 2EWWA 5EP3A 4D0NA 5KTYA 1DPFA 1XDBA 3GEEA 2CJWB 1WMSA 2GJAA 1G6HA 1UKVY 4LJYA 1SKYB 3U7EB 4X8LA 2IA5A 1KZ7B 4JS0A 2QSZA 2WMNB 4OJQA 2BWJA 1SQ5A 4KO8A 3NH9A 4AKGA 1TADA 3TRFA 3NEJA 4C0LA 2UZIR 5IK2D 3SJBA 3K09C 1E9FA 4ON9A 2MMCA 1AJEA 3K70D 3GJ5A 3MCAA 3CF6R 2IS2A 2IF2A 1W2GA 1GNRA 1XBTA 2OFWA 2QMOA 2WJYA 3K09A 3WMEA 4YONB 3PUWA 1KI8A 2FH5B 2WOJA 2CL0X 1YR8A 1KKLA 3FWYA 3FHCB 1YR9A 4XWAA 5E7MA 3P32A 5G53C 2NZJA 1GNQA 1WB9A 5BN3A 5E7IA 4JKIA 3S1AB 1X8LA 2O0JA 2RHMA 1RYFA 1YJ5A 2W2TA 3M6AA 3LD9A 2D7DA 2VP2A 2VP9A 4JT2A 1YR6A 1XF9A 1CRQA 3BS4A 4V03A 2BBWA 4PPNA 1NLFA 5KPDA 2B7CA 4B44A 2VHTA 1NY6A 4JJZA 2W6JD 4US0R 1U99A 1LNZA 1Z2CA 3PUXA 4PO9A 2QMEA 4WZ6A 1RVDA 2WICA 2GJSA 2ZRGA 4HB2A 1CJMA 3GLFA 2PJRA 1G3IA 4HLCA 1DAIA 4ZCIA 1KMQA 3AVOA 1E96A 1FTSA 2RAPA 2IYUA 2O8CB 2GZHA 1P9WA 2J0UA 3UMSA 4TLAA 4KV9A 1T8TA 2JLUA 4IFBA 4AK9A 4IOMA 3SBDA 4DSNA 2J7KA 4C0SA 4EQ6A 2VTKA 2IYSA 4KFTA 1CR0A 4AYXA 3SDZA 1XPOA 3T35A 1ETUA 1XTKA 2OCYC 3MJHA 3RNLA 2GA8A 4LYAA 3HR8A 3LW7A 2WKPA 1I2MA 4IW3B 2XTMA 3PJRA 3K0AB 4DLYA 1AGRA 3AF1A 3R8FA 2R6GA 3TAUA 2GK6A 1PJRA 2X77A 2ZI4A 1R5NA 1E9SA 2BIFA 3PUYA 3R7WB 4W7SA 4LHZA 1Z83A 3R9IA 5DN6A 2R8RA 2MMGA 3WBKA 4ZIRB 4FMDF 3A1VA 4JSYA 2ZS8A 1OJLA 4NYJR 2WWWA 4Q9KA 3T1VA 4MYCA 1JJ7A 2ZI6A 4M9SA 2RGNA 1S1CA 4LI0A 4LY6A 5JRZA 2D3WA 5FPKA 4PZLA 2EFDB 1E2LA 3IBYA 4PHTA 3T1TA 4GDFA 1T4GA 1W48A 3W5JA 1BMFD 4OYHA 3OZXA 1MO5A 2WWHA 2E9SA 1I4LD 4MRNA 1XD8A 5F9FA 3ZVMA 2F3TA 2BMEA 2C98A 4JBYA 1ZD8A 4DUGD 5HR5A 3GMTA 2J3EA 5AJXA 1N6OA 1XMIA 4M1TA 2G88A 5LB4A 3DHWC 1QHGA 2QBYA 1XCPA 3C14C 2BHRA 3DOEA 1WXQA 2G0TA 1WBBA 2O5VA 4CT5A 5JEEA 1EWQA 4MYTA 2VHJA 1YHNA 2ZSBA 4TT3A 3K53A 3KQLA 3AEZA 2O8BB 1P4SA 2QNRA 4D0GA 3PEVA 4PHHA 5GJVC 1VCOA 3OFND 1OH8A 3TBKA 1E2GA 4A1FA 1SXJD 2ZUBA 3LRPA 4ZI3A 3B2EA 3QI2A 4LHYA 2BM1A 3W90A 4GOKA 2GZAA 4E09A 1XJCA 1N6IA 3MD0A 5BYKA 2P0EA 3I1FA 4HAYA 3NHAA 2IS1A 4KLZA 3TE6A 2XEXA 4RD4A 4XSGA 2D62A 3NIBA 2ZI7A 2B21A 4AG6A 5JWOA 3HR7A 4V0NA 4DZZA 1RJ9B 3SNHA 2P5SA 2WKQA 3DKVA 1S3GA 4HB4A 4JJKA 2ZRLA 5AWFC 3X1DA 3RS2A 3U5ZB 2VBCA 1F48A 2D7CA 3C15C 3CONA 1J7KA 1TMKA 3D7MA 3C5HA 1EG7A 4JLMA 3U6BA 2ZU0C 3A37A 1TEVA 4DDTA 3UPUA 2HXSA 3B78A 1CBUA 2AWNA 2WMOB 4L9WA 3QVVA 5JEDA 2F3RA 4PSKA 4JLNA 1E0AA 4KBFA 2QE7A 3ASYA 3LDAA 3RYTC 1P73A 3WHLA 1LF5A 4C0JA 1ZIOA 1GRQA 3BH0A 2C8VA 4Q1FA 2J0SA 3O8CA 4TMZA 1E98A 1YRBA 2RMKA 1MKYA 4OQXA 3NDPA 3BB1A 1VDZA 4KBGA 2CCKA 4BE7B 3KB1A 2YKGA 1M7HA 4DXAA 3VNUA 3ND9A 1BYIA 2VO1A 2OHFA 5KSYA 1X1RA 4GP6A 2YYZA 4DEXA 1TQDA 1YZUA 3UMRA 1FQKA 2WJGA 4JBXA 4OQMA 4BLOA 3UWOA 5D3MA 2ZS7A 2FMXA 2FOLA 2B7BA 1X86B 5EUQB 2A30A 4RZUA 1XMVA 1ZM4A 2FF7A 2ZYWX 2ZPTX 1XCGB 5A4JA 2V1XA 1F2TA 1OFIA 3MFYA 4A92A 5IRCD 4BLSA 2A3RA 2ZANA 5IHPA 4IDOA 3LBIA 1DVRA 4WOPA 1H8EA 4UNQA 3ZIAA 1D8TA 1W47A 2QMHA 1F60A 5KNCA 4KFUA 2OBLA 1G17A 2J41A 3W6PA 2BJVA 5FPTA 3MWYW 4LV8B 4TLEA 1KOFA 2GJ8A 1BIFA 4PAMA 5EE5B 2P5TB 4JLJA 4DBLC 1G64A 2ZJ5A 4M53A 2RGGA 721PA 3LVRE 2PLFA 3UANA 3KTAB 1G7CA 4ASUD 2AR7A 1F2UA 3KX2A 5L3QB 1SHKA 3ADKA 2ZS9A 1PZNA 1Z28A 3QF7A 4Q4HA 421PA 4D26A 4K8OA 3H1TA 3THOA 4OHVA 2XB4A 2GETA 4B32A 2V3CC 2UVQA 3REGA 4IOLA 3OEHD 3IKJA 1AA9A 4Q00A 3CUEF 4MH0R 2NQ2C 3RRYA 1Z0KA 1Z0AA 2IW3A 3GLIA 2ZAOA 5G3ZA 1U0JA 1E2DA 3PIRA 3T15A 1E9AA 2FSHA 2ZRKA 2KWIA 3BWDD 2F43A 2GDJA 2ZRHA 3WYAA 2H92A 2YJTD 4HAZA 4W5WA 5DI3B 2XOKA 1E2JA 4HAUA 1FNMA 2ZQ5A 4IRUB 3U3KA 5EP2A 1X6VA 1S1MA 4C2TA 221PA 3OF5A 5FOUA 4BEJA 2KBEA 2JLWA 4XTCS 5JECA 2TMKA 3V00A 2HYIC 4R2HA 1OIWA 3NG1A 2IXEA 3KJHA 1Z08A 2ZRCA 3CNNA 2X2FA 1XP8A 3CR7A 3ICEA 1NBME 1IM2A 3KKOA 4L15A 1DAFA 4M9QA 4C0HA 1J90A 4QRHA 2CVFA 1SVLA 3TQFA 4B74A 3CX7A 2C77A 1N6HA 1PUIA 1MABB 4LV6A 5BQ5A 3DOFA 4DKXA 3HWSA 5FR2A 3UATA 4WXRA 1O3YA 1DAKA 3LXRA 4RVCA 4H1UA 1H8HD 1CS4C 2PT5A 3ASZA 3A58B 3CZQA 1ZC3A 2WV9A 2Q9AA 5J4YA 2J0UB 5E7JA 1FUKA 1EFRA 1EX6A 3U4QA 3AUYA 2C99A 2G3YA 2FZLA 2CE2X 2JLVA 2ZI9A 3Q7QA 4FWIB 1N0VC 4M1OA 1Q20A 2GBLA 3ZZTA 2DWOA 3GFPA 2FE4A 1V43A 3I8SA 1L4YA 4JLOA 2ZSEA 1LVGA 1VKJA 4CW7A 3ZLJA 4E22A 1UJ2A 2GBLC 3I32A 1YZGA 1ZMXA 2OFXA 5TV2A 4OKSA 3EZ7A 1RRCA 1NN3A 3R7WA 5GJBA 5L3VA 3T61A 4UNPA 3PEUA 1RFLA 4ZIRA 4W5HA 1S8FA 2F1JA 2ZUDA 2HLDD 4RCZA 2RH5A 3K70C 3K9NA 1KIMA 2BCJQ 1OIVA 4DSTA 3IPYA 1OIXA 5J47A 1M7BA 4KODA 3U7GA 2WBLC 1N6KA 2XITA 5FL7D 1UPTA 3I61A 1HT1E 1CJVC 1NMYA 4D4MA 1HT2E 2QP4A 4LC0A 1R7RA 4KSCA 3EPHA 3VR1A 2ZRIA 1NJGA 4B33A 2FFBA 3C4JA 5JLJA 1JR3E 3KTAA 3LW8A 5K8TA 2FV8A 4US2R 5JJKA 2C96A 2GWHA 1S96A 2FFHA 5JJLA 3T12A 4Q4HB 5FI1B 1R0YA 4RFVA 1G20E 2ZRMA 3DM5A 1NI3A 4QNMA 2WM9B 1FTNA 4DB4A 4XOIA 4B48A 3TH5A 4IXMA 4MA4A 3AVUA 3ONWA 2ZRNA 4UQOA 1WF3A 4Q9HA 3K0EA 3WYFA 1W4BA 4PPGA 3QJYA 1U8YA 1OFUX 1K5DA 2R6CA 3FPAA 4DHEA 2F55A 5H1YA 2MSDB 3Q9LA 4QNRA 3RWMB 3GPLA 2V7QD 2ERXA 2E87A 4NTZA 1CLUA 2IYVA 3LX8A 1W5TA 1T6NA 4EJSA 1AKEA 2J59A 2WAXA 2XSZA 1DG1G 4JMPA 3GJ0A 4ZDIA 1N0UA 1WP9A 2YC4C 4QBFA 4DSOA 1KJZA 1XTJA 4YXWD 3WNDA 1UKYA 2CBZA 4NMMA 1VYTA 5E3HA 2R6DA 4TYYA 4WXPA 2GVDC 2Q0HA 1P5ZB 1AS0A 3H84A 4B71A 1PLKA 1GAJA 1OHHD 1NVWQ 3OAAD 3U4QB 3GLGE 1Z2AA 1TF2A 1R2QA 1T91A 2ZVQX 3Q7PA 4EPTA 4KU4A 2VF8A 4RZ3A 2GCPA 1U94A 2W2VA 4LJ8A 4QOSA 5CDFA 2ZSAA 4QHSA 1ZNYA 4PC7A 5L8VA 3NBFA 1LS6A 4QHTA 4Q48A 2JLQA 2LKDA 1WCV1 4QJ5A 5EP1A 4Q02A 3MGCA 3U61B 4KFSA 2IEZA 4PC2A 4DLTA 2DCUA 2ZAMA 3HPRA 3G0HA 4M9XA 2JJ1D 3WYGA 1VCIA 3BB4A 2JJ2D 2QL6A 3VHLB 3TMKA 4G1UC 4ZCLA 1H65A 1UBGA 2WWFA 2KI5A 5LBIA 1RZ3A 4JLKA 4TL9A 2CLDX 1RRPA 2ZYTX 5JHGB 4TTPA 1IXZA 2BJWA 2GAOA 2A78A 3NTUA 2Z43A 5P21A 1IBRA 4FMCB 2Q6TA 3CWQA 2ZR7A 4NP6A 1CKEA 2WSSA 4C2UA 1C1YA 3VMFA 4AY2A 3UK6A 4UXIA 3W8NA 2ZRAA 2V8OA 4BFYA 1F2TB 2F9LA 3IIKA 5TMPA 1A82A 3WP1B 4B3GA 2RGBA 3W3AA 2OAQ1 2QROA 1BO6A 2JLSA 1CR4A 5K8IA 2R6AA 1KI2A 3SJZA 3NC1C 2SHKA 1KJWA 1XTIA 3N5CA 3BGWA 5L3SA 5HE9A 1KY2A 2N1BA 2J0VA 1Z6YA 3NH6A 4Z1MD 1NVXQ 2DPXA 2R2AA 4CEJB 2QZ4A 4PX9A 3K0CC 2J9RA 3QF4B 1M34E 2PLRA 2F7SA 3LFUA 5SZKB 4NCHA 2K5UA 3FMIA 3F5FA 1XMJA 4MUBA 3NC0C 3NDBB 4FCVA 3CW2A 1P2UA 3NBXX 4KCGA 4DC9A 1IY1A 4RD2A 3AVTA 1E3MA 3DZDA 1KNQA 1Q1QA 4K81B 4AG5A 4TQUS 4CZ2A 1KY3A 1YVDA 3ZS8A 2GK7A 1GILA 3K0FA 1XZQA 4IEIA 1CTQA 3HJNA 3Q8XB 4HZIA 3IBGA 4CEIB 4DJTA 1DO0A 5HCIA 1Z22A 3QG1A 1P75A 3GFOA 2BKEA 3L82B 1TNDA 3GLIE 4B47A 1XB2A 1FZQA 2Z0MA 3WP0A 4QL3A 3FMOB 2WTUA 4URUR 2BKUA 2HYDA 4UXHA 1ZM3A 5FBQB 1P6XA 3KXLA 3W9YA 5EJEA 4RD6A 5CM8B 4AC9A 2O0HA 4G3XA 4NKRA 2RGAA 2ZREA 3GJ4A 4UNRA 5JCPA 4U5XA 5F2EA 3BFVA 5B57C 3B1ZA 1A2BA 3B9PA 3B13B 3PR1A 5KOYA 2W2XA 1G291 5JBQA 1WA5A 3I8XA 2EVWX 1E0KA 1G5PA 2VQSA 3MWJA 4LHXA 1FPMA 2BDTA 1KZGB 2OBMA 4KAXA 4A0FA 4XVUA 4O0MA 2GJ9A 3MWKA 4FN5A 4TL8A 1F3OA 1K6MA 1UBCA 3KZ1E 4X8HA 1JNYA 1F6BA 2QEQA 5DE3A 1F5NA 4KXFB 3OIVA 4BZQA 2RGNC 1TPZA 1Z6TA 4JLDA 1Z5ZA 4N3NA 3AF2A 1D2EA 3RS0A 5JI2E 2IF0A 2QGZA 3E5HA 3B7GA 4L4UA 1Y3AA 4EJSC 4IDQA 5F3WB 3RS5A 3IILA 2WSMA 4RFSB 4TWZA 3CRMA 4QJ3A 1I2DA 2ZROA 2O8DB 4HAWA 2PX3A 1ZINA 1SHZA 2CK3D 2ZUCA 2ZYUX 3AKEA 5IDVA 3UG6A 1U0HC 4JVMA 1SULA 1D2NA 3B1XA 4NCJA 4JVNA 2AFHE 4NHOA 5KNDA 2OAP1 3LA6A 3LWNA 4MYHA 4Q01A 4V0OA 3RRMA 2NIPA 1E79A 4B2LA 2YOFA 4FCWA 4QBHA 3TAHA 3KXKA 2IEYA 3CNOA 1G1MA 1Z0DA 3SR0A 4KLNA 1Q21A 1R8QA 3C5CA 4LHWA 3KB2A 3KUDA 1HTWA 1ZRHA 1JR6A 5LDDC 4Q1EA 4Q21A 2YV5A 4MGIR 3GLGB 1E2KA 1E2HA 2VH5R 3CPHA 2WZQA 1AQYA 3F8TA 4LJ4A 3CR8A 1XXHB 4D4KA 3T5GA 2BEKA 1G4AE 2J87A 1JB1A 1ZNWA 2W00A 3C8UA 3IHWA 4OHWA 5FTNA 4ARZB 1NP6A 3AB3A 4NYJQ 2VHUA 2QP9X 1CP2A 1EFTA 4EDHA 4O3MA 2OBNA 1ANKA 1XZPA 1UEIA 3W5IA 1SXJA 2QRZA 1NY5A 3IEVA 4B3DA 4BLTA 4PZZA 4EPYA 2YOHA 2ZM5A 4IDHA 4YDSA 2VP6A 1NMZA 1DO2A 4PQFA 4C0QC 1QBKC 1Z6XA 1ZCBA 4PXAA 1GM5A 2ZRFA 4DDUA 2Q3HA 3CRRA 3QG5A 1EX7A 1B23P 1NN1A 3RWOA 3AKDA 1NSFA 3VQTA 1G16A 1VECA 1D9XA 2XNSA 1NIJA 3CF2A 2YWGA 4TSFD 1XWIA 2BMJA 3SYKA 3PFIA 5DH9A 2ZJYA 1N6RA 5D3QA 2NG1A 2ZR0A 1OSNA 3IHLA 5FTKA 3FMPB 3SQWA 4BRUA 4C7OA 2H17A 4PC3A 2IL1A 2FPLA 4YDHB 4XD7A 3AKYA 1MO4A 4TQ9A 1XXHE 3L0PA 2XOKD 1Z29A 3VX4A 4A6PA 1KK2A 2IK8A 4BFSA 1Z07A 1T0HB 4LJ6A 1IONA 5FBVB 4M1SA 4O25A 2VSFA 3AF4A 3MMPA 1DEKA 3EC1A 4KI0A 1CR2A 3C41J 4MRSA 3V9PA 4NH0A 4OL0A 4FWTA 3QQ5A 3X1YA 4GP7A 2IYYA 3QF4A 1ODFA 4DCVA 3MG9A 5FOVA 3B1WA 3EPLA 1JEEA 3PENA 1KAGA 1R0XA 1JBKA 3B82A 3M1IA 4Q9LA 2VLIA 3D8BA 3RRZA 2EFCB 1XRJA 2EU8A 3LAWA 1OXXK 2AWOA 1OT3A 1DG3A 3ZVNA 3C7KA 5BN4A 1MOZA 4G5OA 2DWPA 4ASUA 2OT3B 3A1WA 4Q18A 3W6NA 3ZS9A 4FINA 3GJ6A 2GNOA 1T9HA 5IF9A 4TYPA 4JL6A 2ORWA 1X8JA 1KO8A 3ND8A 4JZKA 1OB5A 2C95A 4LWZA 2EQBA 3QNUA 5UKDA 3K9HA 4CDGA 3KQKA 4Q7MB 2PEZA 2VSXA 4AD8A 3PEYA 2NMVA 4WAUA 4II7A 4TL7A 3QKSB 4BFUA 4MKIA 5M04A 2QENA 1HEIA 3PUVA 3QXHA 1SGWA 3P4XA 3K1JA 5KDDA 2W83A 4JLBA 2R44A 4PQYA 1N25A 4D4LA 4M1KA 1IY0A 2JGNA 1P61B 2OEPA 2FFAA 4F91B 5CIQA 1ZW6A 4US1R 1WDTA 2W6ID 3B60A 1IY2A 1XEXA 3ADDA 4LBVA 4I1UA 3PVSA 1Z3IX 2GF0A 4TLBA 2FEOA 2NO0A 3VR2A 1NLYA 1T3SA 4M1WA 4FW9A 2I1VB 2LWIA 2JDID 1A4RA 4EKDA 2XJ9A 3KDSE 4C3ZA 4MKFA 1ZYUA 1E9RA 3TGPA 5JWRA 2GESA 4B75A 1OXUA 1YZTA 1Y63A 3KUCA 3K0FB 3WMFA 3H4MA 3ZDQA 1KI6A 3AUXA 2GXSA 2Q3MA 2QP3A 2IUSA 1ZUIA 2C78A 2JLXA 3T1QA 2IX3A 2X2EA 2H57A 1LY1A 3CPEA 5AJYA 2BOVA 8OHMA 1UBFA 5HKKA 4AKHA 2RGXA 1TU4A 2EYUA 1XTQA 5FUWA 3RC3A 1KSJA 3VU9B 1XTRA 4ZV4A 3LQRA 2XX3A 3BBPA 4G5RA 4I81A 1QVRA 4C7OB 3TUIC 1E4VA 1XCMA 4WA7A 3BRWD 4FIDA 3EWSA 3QIAA 2XXAA 2V7QA 1B0UA 5FBLB 2HEIA 4R2IA 1W0KD 5AJVB 4B2IA 4LJ7A 1AZSC 1N5LA 1E2MA 1L2TA 3QXJA 3E1SA 1U2RA 3CM0A 4E07A 1G19A 3VR3A 4NBSA 2PZFA 1RRFA 4BRWA 3CLVA 1ESNA 3TK1A 521PA 4LPSA 1NVUQ 1OKKD 3ZZ0A 1MO3A 2CDNA 3MJRA 4DRZA 4JT4A 1OH5A 2Q21A 4P4TA 3SZRA 2A9KA 3L0OA 1VMAA 5DIFA 4JYCA 2IYTA 4GI7A 4XVRA 1KO1A 4DLXA 4GZMA 4P4SB 3ADCA 1EWRA 3WBJA 1JAHA 5J4LA 3GLFE 5KSOA 2OLKA 1A5TA 2PL3A 1TAGA 3TLXA 1TL7C 4Q4LA 3PXGA 1KI7A 1NL3A 4G01B 4RJLA 1X3SA 2NZ8A 2ONJA 5F98A 3K9LA 4Q19A 2D74A 4Q4JB 3M4YA 1PLLA 1WRBA 1BS1A 4Q9JA 3VKWA 4RY2A 4LBWA 2C9OA 1TQ6A 4Y0VA 4DLRA 3OEEA 4L5BA 4NL4H 1TF5A 5EUMA 1GZSA 4B76A 5B64A 3B1YA 1N2CE 1G5RA 1TEXA 5KPJA 2AXPA 2BCGY 3W6OA 1ZVQA 2GXAA 1OV4A 4GRAA 1UDWA 2Q3FA 4W5JA 2DFKB 1G6OA 3HU3A 3BORA 4ZKEA 4LJAA 2C03A 3GFTA 3QEJA 2J45A 1TTTA 4KSBA 1E2FA 3BFXA 4D2IA 1Z47A 3QY0A 4ARZA 2IYLD 2FDCA 1JQLB 2YZ2A 4TMKA 3RABA 4A2WA 1SXJB 3FKSD 1XMSA 4KVGA 1BKDR 1FQJA 1LF0A 3BD9A 3EZ6A 1HY3A 3KKQA 1EXMA 4M2LA 4C9BA 3IO3A 2FWRA 2GVZC 3AGPA 1KI3A 1N0WA 3AP1A 2OLJA 3LY5A 2ASEA 3K9GA
chains in the Genus database with same CATH superfamily
2ZJ7A 3GFVA 4FNMA 4R4JA 4XKJA 2HPAA 3EMVA 3FCOA 3G9ZA 5EE1A 2IUFA 2D0OB 4FHGA 3I9JA 4JB2A 4J9VA 4Q4AB 3W2IA 3CB4A 3EQ2A 4GKVA 4TRJA 1UC8A 5DP2A 3WNBA 5G1OA 4OJTA 4I4TF 4AJ1A 2OXTA 5LZ9A 2WTBA 1QV6A 3BG5A 4MCJA 4PZUA 2PCLA 3KC2A 3L6RA 3Q88A 3RWBA 1XJQA 1FFBA 2RAVA 2DWCA 4DDVA 5EJ9A 5IVPA 5JCJD 2EP8A 3VA7A 3TLBA 2Z4SA 3IP8A 1HEUA 2XUJA 4HPWA 4X1IA 1E6MA 1WMAA 3JATB 2XQJA 4F3YA 4FGLA 1UFRA 2VKQA 3Q3JB 1G0OA 1CP3A 5FWDA 1AN9A 2X0KA 3IKVA 3CKLA 4ANFA 4CL3A 1MV8A 4EJMA 4TUYF 4CM1A 3I92A 5E8RA 4ZEOA 3LBAA 2Y71A 3TGLA 4U7JA 4Q66C 1RXEA 1V8BA 3KR2A 2QU7A 4KHZA 4LOLA 4ZCPA 1P7YA 3E5MA 4D43A 3IRVA 3OBIA 1B6RA 1SHTX 4OGFA 2D0DA 2DQKA 4LV5B 5DNEA 5FYDA 5H02A 3UN1A 4ZJYA 2ZYRA 4BATA 1IHYA 4DS3A 1QMPA 1Q44A 1UFKA 2FUG6 2AMLA 1KR2A 3DVLA 4UTPA 2HC9A 3ACDA 1JLMA 1ZISA 2Q3BA 1HQYE 1RJEA 3JAWB 4IUBS 1RPZA 2VYFA 3U3RA 4IHQA 5J4HA 5CB0A 1T3GA 2PSSA 3AVXA 3ICCA 2G4LA 3BMNB 4Y6SA 3PC7A 4GOOD 2NOAA 5JXWA 4BU0A 1GKUB 1ZNXA 1P0PA 1TM3E 3IC5A 5KAMA 1KY5A 1GQOA 3UV6A 3ZTTA 7MDHA 1Q0SA 3SC4A 4EA9A 2DOKA 3ZI4A 1UBHS 2YICA 3GJ8A 2HPVA 1J0CA 2C3MA 2Q0SA 3DUFA 1O6FA 1XA0A 2CNNA 4ARBA 5LJIA 1EG2A 1X14A 4R84A 1OLXA 1CLEA 1ZOPA 4GLBA 2ESRA 3AKCA 2OYSA 2R5NA 2HU2A 4P4SA 4BWGA 1R6VA 4AIIA 5FXMA 3GJZA 5BSRA 3DGEC 3WC4A 3RC8A 4OK6A 1XJ5A 2FQYA 5A4DA 3TPZA 1JPNA 2HJWA 2FZKA 3H65A 3B9QA 1P7VA 4RHYA 4WCVA 2ATVA 4H0NA 4BL5A 5BVGA 3ZQ6A 3UW3A 1JWLA 1BROA 1T4CB 2YH2A 3SYNA 2D3TA 5JAIA 4K9KA 1ISGA 1E60A 2BEWA 3N59A 821PA 2IBSA 1GZUA 2EJUA 4EZBA 6PFKA 4Q3AA 4DCPA 2G0NA 2P35A 4EARA 5IAAA 3TLCA 5EZSA 1RE0A 4AJ9A 2FW8A 3W9UA 5G4KA 2V6IA 5BPHA 1ULUA 1HL7A 2FPUA 3BXHA 2X9LA 4MW6A 1ZVVA 4JQCA 1KSHA 4CEHB 1OWLA 4AN0A 5CNKA 4BNJA 3N39C 4H7DA 1AQ6A 4Y9SA 5ES4B 5DU2A 4YV0A 2XXAB 1M54A 1EUDA 1U98A 1J9GA 1U11A 1Y48E 5DTQA 1SXQA 2R6ZA 2JK0A 4TSFA 4TZ6A 2GEUA 1VCMA 1JEQA 5IBPA 4NIMA 3KSAC 1V96A 4Q4AA 1GPJA 3TXAA 3FGNA 3AEQA 2WAOA 1YSCA 2OC9A 3JVEA 5E4FA 5FUMA 1XYVA 1EB8A 3UG7A 1VPWA 3CBGA 2W4MA 3OFSA 2GASA 1MX5A 2ZI3A 5J4VA 1MA3A 1XZHA 4XYEA 2EAUA 5KTTA 1XVUA 1KY4A 1CIVA 1YFLA 2RK6A 3NIGB 4BASA 1HFEL 4U2KA 3OC0A 2E37A 2AD5A 1RYYA 2ZJ8A 3H11B 4MUAA 4RL6A 4X1KB 4IYJA 5B2ZA 3QUSA 1E3LA 3I01M 3O4JA 3OEWA 4MS1A 1DC6A 4P0TA 3RV4A 5B58C 4JBGA 5JSFA 3NHRA 3THXA 1T8PA 4IRXA 3FH0A 5BW4A 4XIJA 5JARA 4PBTA 3IAM6 2WM3A 3AERB 5LD2B 2FMIA 2VR1A 1TYCA 4JT8A 1T4BA 2REXB 4DSUA 3L6DA 2WHXA 1JMYA 3BSFA 3A1CA 5E6SB 3QUCA 4EQ6B 5F2NA 1CRPA 1IB6A 4KXUA 2IDKA 5A4KA 2JGDB 3L1VA 1R50A 2F48A 4PFSA 1A96A 1H0RA 4EPRA 5H83A 1U9YA 1KXJA 1LZLA 4LWOA 5FWXA 1KDOA 2JD2A 5CLQA 2I3BA 3GWZA 3RUFA 4CM3A 4IIFA 4Q9NA 1JHQA 2OYCA 3SMVA 1QWSA 2DF8A 3DQZA 3F9RA 1UDXA 3QITA 5BUZA 3TB6A 4H08A 5JAOA 2DBYA 1W7AA 4GM4A 1Q1AA 4AF8A 2OZEA 2E55A 4HN4B 4IJ6A 5ALLA 4JL8A 4JI3B 1ZH4A 1T1RA 5DTRA 4ZVQA 1AA6A 3T9BA 1JQJC 1C7ZA 4J94A 5FRDA 4CCWA 1KTVA 1HFJA 3FRIA 3KL4A 4GZ3A 5KX5B 5HM6A 1YKSA 1CJTC 1V4NA 3KRTA 3M3HA 2QTLA 4P9NA 4W5QA 2XCIA 1F9AA 1WZNA 3QE3A 1ISSA 1A95A 3PD0A 3A9WA 1YIOA 4JOBA 2OOSA 3JQGA 1Y7LA 2GXUA 5C2JB 4YX9A 4NI5A 3KWJA 5J5CA 3ZU4A 4TUYA 3CO0S 4B3TB 1L5QA 3D0OA 5DWDA 2ZITA 5AUPB 4BC1A 5BP7A 2LUOA 1U3FA 2IHBA 1AXEA 1IWBB 1USGA 5THQA 4ACBA 2VHCA 4R83A 4ZOLB 2OZKA 4WY8A 3DEIA 2PJDA 3PNQA 4L75A 2GCOA 2PUWA 2PRIA 5F9MA 4X7MA 1E1QD 3F7OA 4Q1VA 3U49A 1MV5A 1VI5A 1CZLA 2DR0A 5AJTA 3U7FB 4LSGA 2QRKA 4PZ9A 3LZCA 1DLIA 1AXRA 2WG0A 4XQGA 4HN9A 5AKYA 1E3SA 3MCZA 1NBIA 4YMTA 4P3PA 4D79A 2BN4A 2H0RA 3CH4B 3O0DA 2QZPA 1NLZA 4R7ZA 1N8TA 1YDWA 4OV6B 2OBYA 4BFTA 1CFJA 1TK2A 3CGGA 2CVHA 1NFFA 1OLUA 1TVMA 3NDJA 2HV9A 4EKIA 3G88A 3I3OA 3SC6A 4BNZA 3SVLA 4W99A 2XCTB 3D0QA 1QH8A 4TYMA 5A02A 2FNAA 4NFLA 1WMDA 4LMRA 2E21A 3PEEA 4F93B 2PL9A 1KDPA 1QVWA 3DDCA 3HB9A 3I4FA 2HU7A 1ZVJA 4PF1A 1M1UA 4ISBA 4YASA 2OFFA 1MGOA 2F1HA 2AK3A 1LJLA 2QVLA 1LVUA 2BMAA 2AZDA 3EBLA 5HOEA 1HFWA 2I1QA 2CWDA 5HW0A 2YWRA 4IGFA 1ZCJA 2B25A 1DPGA 2G1AA 4RZIA 1D7AA 1VIVA 1C9DB 5JSZB 3ILSA 3LYLA 4H7IA 4NNPA 4ZQHA 3BA1A 1MJFA 4YV1A 1B16A 3B8EA 3DZFA 3THXB 1FDUA 1AV6A 3EIEA 4EW6A 5A9SA 1T35A 3UBMA 4KN9S 3R5SA 1QGAA 3MBOA 4U00A 4HEJA 4HLNA 2RGEA 1YGYA 2RCNA 3LUHA 3AW9A 4PE5B 4QFDA 3VDQA 2P4SA 3I76A 4L5IA 2XQIA 1N7GA 3MUEA 3CLUC 1YIAA 5K3CA 4B45A 3DJFA 3I1JA 1UC9A 1PZGA 5K0JA 5CK5A 3FVWA 4LWPA 2QD2A 4ZRDA 2NYVA 5DNAA 2CCGA 1UQRA 5DBIA 3SHWA 3ZJYA 1B00A 3RAEC 2Z83A 5EXDA 2HREA 3RBZA 5BYJA 3GN2A 3GHYA 2C2OA 2J3QA 2OGUA 1L8QA 1IWOA 2W6QA 4Q34A 1YU6A 5I9MA 2CXUA 1OYOA 4XVQA 4RKFA 3PV0A 3PSHA 2VPPA 3HGTA 2IZOA 1KMHA 4G0OA 2BBSA 3HP7A 3C4QA 3WQRA 2B9EA 3AVQA 1JAZA 3ETLA 3DMTA 4GP9A 3RC7A 1TYBE 5HIJA 2VJLA 3L02A 3MD9A 1WULS 2QNIA 5CGZA 2AOTB 1NLMA 4G56A 1R9MA 1ORWA 1B0AA 5EL0A 4AROA 4JUCA 1YHYA 4BKUA 1V7CA 2GYVA 5HRUA 4ZAYA 4L9RA 1R6BX 3K72B 2E1RA 3NFRA 3O4HA 1J1ZA 1MRSA 4JGGA 3IMEA 4BNFA 3ZE6A 1OPXA 4QTTB 4NDNE 1TCBA 1Y1KE 3S7ZA 1VI6A 4KGVA 2Q62A 4FZ3A 2GCOB 1BCRA 4CETA 3E7XA 4E03A 3IXQA 1E89A 2BH9A 3P19A 5DHFA 1TZCA 5G0SA 4YJGA 1FUYB 5JVDA 3QKRB 5CH8A 2OO7A 4K7JA 1VPLA 4N5IX 1M0EA 4LBZA 2H9AA 5JS6A 1GG2A 2WM8A 2FKAA 3JTMA 2IYRA 4S1VA 3ZHXA 2IUTA 4GUAA 3RU9A 4NE9A 4L16A 1IG0A 3UFXB 3JYOA 3TTXA 3VR3D 4N3GA 5IN4A 4L1KA 1K88A 2RHLA 4IMPA 4J2TA 1DE0A 1X9HA 2NPIA 3HACA 1KH1A 3PXXA 5C52B 4HSEA 4A10A 2BEJA 4MYRA 3I04A 5HZMA 2P3OA 1Q15A 4DLSA 2RI6A 3GT3A 4EO4A 1G66A 1AG9A 5NULA 4FHZA 4E21A 4P7FA 2B4QA 2KX7A 3ZGXA 4DDWA 4Q7JB 2VP5A 3KQNA 4R2WA 3DZBA 4XIGS 3VAZA 3FNFA 4RL4A 2IODA 3GLHA 2QTTA 1R5OA 3HGQA 2CFSA 3WK6A 2H7XA 2HOQA 5DNYB 3ADOA 4XEHA 2FFQA 1THZA 3S70A 7AT1A 3ROFA 1EUCA 1KK3A 4P3XA 4KQJA 2QMYA 4BEBA 2BFCA 3EWAA 3KOYA 4PQGA 4BUZA 4DT1A 5KYYA 1ZIPA 2ZJ0A 3U62A 2XA2A 1AKYA 4NX2A 1IWPB 2OCBA 5HK9A 2YNMC 4OREX 3SYTA 4BVEA 3U7QA 2ZR8A 3RS7A 1H4SA 5D85A 1VE6A 3B38A 2YRWA 4YHBA 1F0PA 2Y93A 3JVUA 2DKFA 1GPKA 3BIXA 1CJKC 1V8OA 1B8PA 3BXPA 4BC0A 3E5NA 1EEHA 1ZUHA 2HK8A 4JIMA 4M99A 2NTJA 5CX1B 2B8WA 5ALOA 4K6KA 3BDVA 4QYIB 2HXYA 2FZCA 3EXG1 3L1HA 3N5KA 3ZH9B 1KRWA 1QO7A 3ZN2A 3SICE 1B1AA 4HZGA 4IVPA 2H63A 1PW5A 3GPBA 4QTUB 4B3MB 1J0EA 1KK1A 2EYQA 5F2OA 2XJ4A 4IDEA 3ZR4B 4YRCA 5BR7A 3JWPA 4DBVO 4OX9B 1ZBQA 1SAYA 2OB2A 1H1LB 3CX3A 4KZPA 2GZDA 3ET4A 1UOPA 3DKIA 3TNLA 2QXUA 1H9AA 2WMDA 3LHIA 3R5XA 4HLDA 3FVQA 4URWR 1IHDA 3D5EA 3I3SR 4FYXA 4UBKA 1PX2A 1JSLA 1P39A 2ZRDA 3N6RA 2RH9B 1LQUA 5EUCA 2AW3A 1WLYA 4BIIA 4D81A 4OX9Y 4OGGA 3SFZA 1FMFA 2JFXA 3G2JA 4IDCA 2JCGA 4GBMA 4XCVA 1T2VA 3RT1A 4D25A 1EJ2A 2X15A 4OHRA 3HUDA 1OE0A 5DLYA 3ZX4A 2FSIA 4FKBA 4EVSA 5CFMA 2WWVD 3IGFA 2AVNA 2YMLA 3PGMA 2PEYA 3RIHA 3Q3VA 1ONSA 4TTQA 5BSFA 3IXMA 2DPMA 3CNLA 1OGYA 4G1MB 2P40A 1SOVA 1OKKA 2CNBA 1BW9A 1FX0B 2DLDA 4MQMA 1DCFA 2IUYA 4BUJA 4EPWA 4BKMA 2HCBA 4C7KA 1U8AA 5LBUA 1R8SA 1G63A 2OCPA 1E0JA 2IE8A 3VR6D 1U0NA 4CT4B 3JYHA 3B3AA 3AILA 3A6LA 5I45A 3H8WA 4PO3X 1Q19A 2XIJA 1H6CA 2GNAA 2VUSA 4LOJA 1BAPA 5AVTA 1JMVA 3TRHA 5C8YA 3PC8A 1VG8A 1XNJA 4OLAA 1BYUA 3GLIB 1RW4A 5H0IA 1FP7A 3RVMA 4FB5A 3DLHA 3EAQA 3LLVA 3JARA 4YRKA 5JIBA 5L51A 1K8YB 2NTYC 5FI3A 4C4ZA 4CR8A 1FNBA 1VZ2A 2CDRA 4EG3A 3S1AA 3JWHA 3I83A 2J9FB 1ELOA 3ID6C 3MJ4A 3EVDA 3SIWA 4DIUA 1JW9B 4EYSA 4JKOA 2EATA 5IT0A 2HGSA 3KLPX 4Z9YA 3NHMA 1U1CA 1NKVA 4LOHA 4X91A 5I7FA 4ZMSA 2FQQA 5HFJA 1P1KA 2PWPA 3CMCO 1YB7A 3VNAA 1PUJA 2EOAA 2BEUB 5JNTA 1L4KA 3FFBA 5FAKA 1P0QA 4KR7A 4PO1A 2YCLA 1GQYA 1Y7TA 1HE4A 4EMTA 3CLTD 1CY1A 4IHJA 1EFHA 3W4KA 2C57A 2CW5A 4MV8A 1JKMA 3ETNA 2ZE6A 5JDIC 3PDHA 1GN9A 4FD2A 4YGYA 2R97A 4NBUA 5TARA 1VLLA 1ZCAA 3L7JA 1SG9A 1ZN8A 4PYMA 2ZUTA 3SEAA 4XPZA 2ET6A 2NVBA 4MUFA 1OFGA 3IL2A 2GZ2A 3IPCA 4MMZB 2GLUA 2XKJE 3N86A 4YRJA 4R1OA 3H2BA 4ENTA 3HBJA 3KT0A 3NHLA 2O8FA 3D0KA 4FBLA 5L4NA 3ACBA 4IIDA 2BSAA 1LI5A 2Q5HA 3OZGA 5JSHA 3H05A 3ND7A 4DV4B 3BE4A 4E5NA 2A57A 4AO8A 3TNFA 1QZUA 1JG2A 2EEPA 3KKEA 4Q1CA 2VJPA 1A2KC 3B1JA 1KDRA 4GM1A 3WGQA 1RHRA 4F5EA 5CLHA 2H1IA 5IAGA 2BI4A 2KJQA 3C7TA 4J0IA 3RVOA 1U7XA 4NPAA 1M2GA 1QKIA 3NXKA 4D0RA 5K4GA 1L5FA 4K0RA 3SZLA 4CUKA 1UDAA 3ZDZB 4OOEA 5C18A 3I2GA 3OUTA 2AN9A 2VK2A 1FA9A 1N5RA 3DL4A 4I4IA 2OORC 4KWTA 4PFQA 3SQXA 3LT5A 1U28C 4L28A 4MW7A 1KZYC 2AMVA 1BXGB 2YWXA 4ETWA 5B55A 1HDCA 4YBZA 2QGNA 5CVUA 2GLTA 3L2OB 4ILEA 4CV2A 2VHEA 4XDYA 1WXEA 4YO7A 3CEJA 3LT1A 5FH9A 3ZU3A 3CIOA 1EUYA 1OBCA 1DQSA 3GH1A 1QIIA 3RS8A 3LY9A 3SHQA 3QWFA 2DWUA 3A4TA 3LK7A 1SU8A 1S2GA 2GRUA 4C43A 5A0VA 1AN0A 3A1UA 3Q3GE 2G36A 1NVVR 4QUBA 1I7PA 4UPDA 1JILA 2D5CA 2Q2WA 4RDCA 2G83A 4QC2A 1GLNA 3DOIA 4Z4EA 3NGMA 5B3JC 1ZKDA 2H51A 2RKOA 3BRQA 1YA6A 1YR7A 4UTZA 3HYNA 4FNAA 2ZYVX 5IJ0B 2WQ7A 3D0RA 5A0TA 1QHSA 4M9ZA 3QEKA 5J59A 4W9NA 1KEWA 3IAHA 3Q5GA 3JARB 5DXAA 5GINE 3QYPA 3SM9A 9GPBA 1KJ9A 1L7VC 1X70A 1JPVA 1B3BA 1NUUA 3DPUA 2E85A 1FMJA 2BKVA 5G0WA 3ZQJA 2OFOA 4XJXA 1OGIA 5JS8A 1H8ED 1K5HA 3STVA 1XMQB 2FG5A 4IX1A 2NVWA 4BVKA 3X1KA 1PWYE 4IIEA 3UAXA 3WXMA 4CKXA 5BR1A 1JRLA 1XRQA 2ZRPA 3Q9NA 3QRWA 4OAQA 4RA9A 4UBNA 3ZPXA 4AU1A 5ILOA 4Q47A 3IVAA 1YZQA 3K8YA 1OPRA 4H4CA 4TXJA 5HS6A 4V1CA 3LNTA 1U0GA 3PNYA 3C8DA 4HDOB 3CX6A 4JU9A 4TMVA 3F98A 2CKMA 2I1WA 5EJ4A 3PBKA 2L0XA 4I55B 2HY7A 3SYRA 1C80A 4NEQA 5FUVA 5DNVA 1FVXA 2GF9A 3C8MA 1CQWA 4DCOA 3ILHA 5AJWA 4YMLA 1JQ3A 3I6BA 2QPLA 3R20A 3PUKA 2YY7A 3FYUB 4XSVA 4G2NA 1JDSA 2AFIB 2HJGA 3FDFA 4YRBA 1IHOA 1X1SA 3LZ6A 4QEKA 1H2RS 4RSGA 1Y8ZA 3K1AA 5ALWA 2WPDA 1RI1A 4FR0A 4K05A 4K9NA 4CMHA 2NZYA 1FVOA 3I53A 2WYUA 2DY1A 1R0RE 2XMSA 5IM5A 1GU0A 1DXHA 5REQB 3ZCRA 1SH7A 1RHJA 3U39A 3KJIA 2V54A 1D2CA 1F5SA 1VHLA 2BTQB 1CEEA 4H4EA 4IXNA 2XNDA 3O8QB 2EIXA 2J33A 5FDFA 3WQBA 4I9GA 3KKZA 1VP9A 3UOGA 1N2GA 2DB3A 4JJIA 4GNKA 4AKEA 1BJRE 1TYEB 4JR1A 3WGMA 1NR5A 4B3CA 3NWBA 4BQNA 2JW5A 2O1WA 1NR1A 1Y33E 4K87A 3EEIA 5LM3A 1OYWA 1SPBS 2VEDA 2HD4A 4MB0A 4FSHA 1U7HA 4TV8F 1VYUA 4FOTA 3OX3A 2QLJA 3OM8A 4LZWA 3O26A 4BFCA 2NO5A 4LZOA 5DK6A 2F59A 3GZNA 4JLSA 3URMA 1EFRD 2WPNA 1NWHA 3GW8A 4DIDA 2OKCA 4K9RA 5COAA 3K9BA 5IUJC 5KSZA 4EG6A 2HA2A 2W98A 3C3YA 3EAFA 1NRIA 4HDRB 4LSZA 5KYWB 1B7GO 3ZCUA 2CGEA 8GPBA 3TL6A 5CFZA 4BX3A 3WYNA 1QH1B 1DQPA 4GXRA 4B3FX 4J3JA 5JR3A 2FX2A 2DTDA 4DWJA 1Z7GA 1FP4A 1GP2A 5FULA 4ESVA 1W4ZA 3UJ9A 1O5TA 1Z0JA 3GQBA 5LZ7A 4DNOA 3G2OA 4S1NA 1XK6A 1QU2A 4N6OA 2B2CA 1G4UR 3COYA 3IUYA 3AHFA 4IZHA 4PR0A 5JI3E 1FDSA 1V5IA 4LJ9A 3CLRD 3S7TA 5B1SA 3CRZA 1RFGE 4PGHA 3KHTA 3MWDB 2G09A 2Z9BA 4XM0A 5BW5A 5KYGA 1K1EA 1TAUA 4TTVA 2OQ2A 1N5JA 1PBTA 2FFRA 4Q3OA 1G8GA 4J4BA 3DO5A 4U0JA 3LBHA 4DUGA 3DV9A 1NATA 3WWPA 4CCAA 4A26A 2TS1A 1RZRA 1MTOA 1IG3A 2PWAA 3ONDA 4R69A 4S2EA 2AI1A 1Z39A 4TSRA 3CISA 2G28A 5AUNB 2QWXA 1BGWA 4IO0A 1HKHA 2BY4A 2WJIA 2HA5A 2YXDA 3DQQA 5BV7A 3FOZA 3DC7A 3IQEA 3FWNA 4PANA 3ROKA 3L4SO 1M8PA 1GTMA 3EFEA 4I1VA 1CIJA 3ANNA 5TB5A 2WUGA 4ZDKA 1R37A 2AXQA 2F2TA 1S89A 2CV0A 4ETMA 1H6BA 2H8KA 4HUQA 4V02A 4UPEA 2C92A 4RDIA 1J5PA 4NMWA 3COVA 2DBRA 5HKLA 1D1TA 2P91A 1PNVA 2VXOA 3Q0EA 4HWTA 2JI8A 4OMFG 1Z75A 1COWD 4GI3A 1VPEA 3T9AA 2I91A 2UKDA 4M1EA 3VKGA 3HU2A 3QLUA 1JALA 3LXUX 5EGNA 5ICCA 4RJKA 4B3HA 4ND1A 5KTOA 1L5LA 3NBYC 4GYYA 1FE8A 2VP0A 1PL6A 1BRTA 2H0QA 2JIPA 2IXFA 5G0UA 3OA2A 4MGKR 1XPRA 5JRDS 5LYJF 1VB5A 4PX5A 5HVNA 1YC2A 2PFGA 3IBSA 1GZ3A 3L4EA 5HDQA 1M2OB 4HGYA 5TQJA 5COBA 3W7AA 2OBBA 1SBHA 3FJOA 5JAQA 2GTPA 1Y5NA 2D59A 2PV0A 4XTRA 1CXZA 4MS4A 1YZ3A 3FDJA 4Z7QB 2AZTA 1J06A 3DAPA 1U3UA 4TWJA 3L4KA 2QTVA 4F4DA 1L4MA 1P2SA 4PSAA 3W3AD 3OE1A 1JG1A 1A9ZA 4RJ2A 4Z9FA 2Q5IA 1R8JA 5JJ5A 1DBSA 1J0DA 4YAUA 8ADHA 1G9XA 1SUAA 1KHHA 1PSZA 8AT1A 3TR5A 1MZPA 1KAQA 3M3PA 1X7GA 4B31A 1S4QA 1LLFA 4QUHA 2RH8A 4F8JA 5HQTA 3GZNB 4TXNA 1S9DA 2PG3A 2ZTSA 1KIFA 4BPBA 1UDBA 4K9MA 1M66A 4O3FA 1EM8B 1P72A 4MP3A 4WI1A 3WI7A 2W48A 4U9UA 3VKHA 5TDHA 4UAVA 5FT9A 4BO4A 5JU6A 3SSNA 3CA8A 5ITWA 4BPRA 1JPUA 3HCWA 2IRWA 1DKMA 2XUAA 3P9IA 3W8EA 4ERNA 2WJ6A 1V3VA 1FLAA 4WBXC 1IULA 3OICA 4N47A 3D9QX 4FQ8A 3DEHA 3WA6A 1EAMA 2WK1A 1RWQA 4Q9IA 2DMRA 3L8FA 4YQFA 4H3HB 4KE7A 5FTWA 1M76A 4RZXA 1V11A 4FJ0A 3RV3A 2XT0A 4MQ6A 2Y68A 3VJKA 1YCHA 2JEOA 1EE1A 4MSUA 1U6KA 4M9CA 5E1OA 5TT0A 3QP9A 1QO0A 2V59A 3EIHA 4IKEA 5P8WA 3HBFA 1MO2A 1DWPA 1VTKA 1F3LA 2XOEA 3FUXA 4GPIB 3I0ZA 2CLEB 3ONNA 2ERYA 4S24A 3IP3A 4J0KA 3PL5A 3TXYA 4YRLA 1URPA 1VIDA 4CE6A 3QQPA 2I54A 3JZDA 5E0KB 2WIBA 2YV4A 1T4DA 5HHTA 4MQ5A 4CF4A 1H9BA 2IEGA 3JPYA 3Q8LA 1Z4IA 3O7MA 5AI4A 5LOVA 2CMDA 1YU9A 4YJ2B 3SFVA 2REOA 3KR0A 5DGXA 1GPMA 1TO2E 3CSSA 1IJBA 5HGXA 5DP1A 1L5WA 1VG0B 5AKIA 3MTQA 5L95A 3AFIA 1LFAA 3A25A 1BH2A 4HLUA 1R8YA 2BGMA 5C1BA 5HS4A 1XD2A 1BU5A 3PKZA 1EFDN 1NV8A 2GCNA 3LIIA 1TM4E 1XALA 2AXNA 3E9DA 1GRRA 3DMHA 3OX2A 5CIWA 3BMXA 1Z4PX 1B0ZA 1Z8NA 2AG5A 3GJQA 1HG0A 4KHPB 2XWQA 2P8SA 3KLBA 3QXSA 1KDYA 1ZK1A 4KQCA 3ZJVA 3GVHA 2O8EA 2OV2A 3T1NA 2M6SA 5AUOB 1Z8FA 5HK8A 5LPNA 4I55F 3S40A 2VT2A 4CQJA 1H23A 2QUZA 1PTJA 1L4LA 2CNDA 3OZWA 4BTLA 4HZUB 3QE9Y 2QD5A 4EA6A 3U26A 3BN3A 2GYWA 2HA4A 2CBXA 3IERA 1TJ5A 3PUJA 3A06A 3FCAA 3O73A 4NJOA 5BXYA 4MK4A 4F0JA 4WOKA 3QPCA 3DE1X 4NFYA 5A3JA 3VR5A 4YEDA 3NOVA 1YQXA 3WLJA 2YXNA 3A4VA 1IY9A 1QWOA 1KWGA 3WDLA 4EGJA 1YQTA 4TT3D 2DH6A 3SJ7A 3SMQA 3CINA 1YB6A 2EJTA 1MO6A 1J42A 1B74A 1C8VB 2ZIAA 3GI1A 4M0FA 1G5IA 2GPSA 2O14A 4CNQA 1DELA 1MJ5A 4ZV9A 1E1QA 1KZ9A 2XGGA 3LUAA 2JASA 3FMFA 1AS2A 1C7EA 4K2AA 4F4JA 3O8RA 2C4UA 1X1EA 2FRXA 2ID9A 2NZVG 4XCQA 2ODNA 4CMJA 4YUAA 3WZLA 3II6X 3NR2A 5LMNB 2V7BA 4DPMA 4HFRA 1AKQA 4NZMA 4QT4A 3AHEA 1WPXA 1W34A 1UK8A 3OWXA 4IGEA 2YINC 3DDHA 3T5MA 1E6CA 1ZFNA 4OP1A 1PR6A 2AV6A 3N76A 4MAAA 4AURA 2A1UB 2G5CA 3C97A 3WYEA 7REQA 2XZLA 4FM9A 1GDDA 2W2MA 4OHYA 3PA8A 2AYYA 1DQNA 2N42A 2J09A 2IHJA 2WNIA 3OZEA 4YBRA 4AP6A 3BL8A 4MQ4A 2VCEA 3AQ4A 1S01A 3TCXB 3QEBZ 3JQBA 2YWEA 3T5PA 5J2UF 3NOQA 3OJXA 3R5TA 3P71T 2FPMA 4DR4B 3ORSA 5K3SA 1PEYA 1NA5A 2J46A 4U6QA 2WU0A 4ND6A 3WMWA 5CYGA 2OO5C 4H18A 2J7PA 2IYZA 3H2JA 1E2PA 1FYDA 2YHSA 4LBYA 2VHVA 2YVQA 4PIVA 5AOCA 5AK4A 5K0NA 3A2KA 1X7HA 1GOTA 4RH0A 3KYJB 3HABA 4GR9A 4PC6A 1SA0B 3DBHA 3TOCA 3U4DA 1IN7A 3EBOA 4MRAA 1IN5A 3A0UA 3TS1A 1PJ8A 2C2MA 5KYNA 4IILA 1QKKA 1JLKA 4UC0A 2PSDA 4U2FA 1HRKA 2QV0A 1JEYB 4MVJP 1FMCA 1WCWA 4FMDB 3MSCA 1ULHA 2G1JA 3A2LA 3KR9A 1C4OA 5M5BA 5B12A 1EP9A 1UP4A 2GBPA 3LKDA 3O4FA 1JIQA 5AW7A 4A8JA 2FMTA 1K66A 3EISA 2QTGA 1NPYA 2PBFA 3S44A 1S2MA 4ND5A 3U60B 3O2QB 1XA3A 4MJXA 3E03A 3R6DA 4XPIB 4X71A 1SVUA 3MPOA 3GEHA 3RIXA 1NUTA 4R05A 5CXQA 1NUAA 2B82A 2DUMA 4P54A 3TDNA 2PR2A 3D43A 3DBVO 2CB0A 2PMCA 2QM7A 3T95A 2EZ4A 1P1IA 4JKYA 1X19A 2O8EB 4KITB 2B99A 4C4PA 1N5IA 3ZDRA 2R1TB 1O95C 3WFZA 1BE1A 2JK1A 2PS9A 4LX0A 1SY7A 3JU3A 3TTTA 3RE1A 3OCJA 5D1HA 3LP8A 1DKNA 2APJA 3LX5A 1KIAA 4RA6B 3RASA 3EGVA 4MIYA 3SVTA 1R6AA 2PO5A 1LI7A 5CFPA 4UFPA 1KH2A 1RAIA 4MQFB 3DVAB 5DEOA 1P2VA 2ETXA 4B17A 1PJZA 1KOJA 3H17A 2FSSA 1H5QA 4MIEA 1RQRA 1Y6JA 4ACAA 3DXFA 1FBTA 2JFNA 4BZPA 4C1BA 1HURA 3D7LA 4IJKA 2J0EA 5JZVA 1IN4A 3REOA 1IZZA 1TW2A 1QOQB 4M8KA 1ZN2A 1L7QA 2AEEA 1Y8QB 1UF9A 3P45A 2XMPA 3F3SA 3OTWA 1SCDA 1VE9A 2FTKE 1VKRA 5E6UA 1EXVA 3QBEA 3MQ4A 1U0OC 3ESXA 1T5LA 3FTQA 1P7CA 2P5YA 4J3NA 3T3DA 3V8QA 4BJ1A 3BVPA 4Z3KA 1MVOA 1YB1A 2H2GA 4IOKA 3VHRA 3I5YA 3Q0TA 3Q8KA 1P9NA 4UEJA 1YS4A 4WLNA 4BNXA 1E7QA 4GMHA 2M9MA 4R5MA 3B8HA 5IXJA 4NBKA 1ZU5A 4RVSA 1HO3A 1ULBA 3PYXA 1XZLA 4OPMA 4D5EA 4DT1B 4ERXA 1Q7EA 4JP5A 4RH3A 2VT6A 2OAEA 3Q72A 2XTAA 4D80A 1J1IA 2HEGA 1HE1C 3ZEIA 4GDMA 1J5XA 1M67A 1H9CA 1H85A 1G7RA 3EB9A 1G8YA 1AS3A 1O96B 4NS4A 3RC9A 4DDKA 4WD3A 2VSOA 4Y1RB 5ICGA 2QYOA 2C04A 3FHOA 3M2TA 4MP8A 2OQVA 4OB6A 5ERGB 4ZZ1A 1TU0A 4N5MA 1OLOA 3DQPA 3OQVA 3R9WA 3IP5A 1V4VA 2CDCA 3AJ9A 1WY5A 4PQRA 1W36D 4GH5A 4BXOB 3FHLA 1DTSA 3NX4A 4E94A 3PHIA 1XJWA 3UAVA 2HCJB 1DWQA 1NG1A 2R00C 4GOXA 4OKIA 5D8DA 2OXIA 3UJHA 3OEYA 3WGTA 3UTDA 3H5OA 2VSNA 1Z25A 4C0KA 2ZCUA 2YWFA 3WQQA 1P3DA 1THMA 2AK2A 4GZLA 2X23A 1NQVA 2VA8A 4UATA 3L9XA 4L72A 2PWYA 2AHRA 2SNIE 3MWLA 1X7DA 3OIYA 1DHRA 1TUEA 2K4MA 3D2CA 4IKOA 3WJ1A 2HBQA 1LBTA 1WAMA 3SEQA 5A6VA 1YNSA 1SFRA 4FNGA 1OX4B 3ZU5A 1XLWA 1JLHA 1JP7A 2CUZA 5CFLA 3DMPA 1JFTA 2EWWA 5EP3A 4YRNA 4TV9B 1JKJB 1DPFA 3U3XA 3GEEA 1G6HA 2HA7A 3PHHA 4L5JA 4X8LA 3LO8A 1KZ7B 3O8LA 1O4WA 5DCYA 4BMYA 1WW8A 2HLNA 3ZWOA 1YA8A 4LRYA 1JL3A 3FSGD 2AC4A 1MN6A 3NH9A 1TADA 4KH0A 3D8TA 1ZMTA 4DLPA 5IK2D 3ZE1B 1E9FA 1EDDA 5FBHA 4CKWA 2MMCA 4C7MA 2E49A 5L7TA 3K70D 1JFSA 3AUJB 2WUFA 4Y2XA 1WXWA 4NS1A 1CJCA 5GONA 1DKPA 3OHPA 1LBEA 4QXPA 4TVKA 1XBTA 5ITZB 5I7OA 1G8JA 1DC3A 2BEVA 4ZYTA 1T36A 3PUWA 3PWKA 5ARCA 1G59A 3I5UA 1U0BB 2CL0X 5T67A 3GGSA 1B8OA 1JG6A 3FWYA 1JDVA 4HDKB 5U1PA 2RHJA 3GGCA 4E3WA 2X6RA 1N2IA 4MI3A 1G5QA 2P9HA 2PRYA 4HGQA 4BNTA 1YQGA 3WO1A 1JT2A 2L18A 3OZDA 4JKIA 3TINA 4E5SA 2P3LA 1YJ5A 4H0FA 1H2FA 1XC7A 3AI1A 1RAGA 3DTNA 3IUEA 1KOGA 4IY1A 1OAOC 2AEJA 3KD3A 3ASUA 1NJ8A 3UJNA 3QNWA 1XCLA 5BV8A 1NY6A 4JJZA 2CVZA 2W6JD 3HLTA 4OEHA 1SBQA 3NOOA 1RABA 3FHJA 1JLLA 3IEXA 3RSGA 1PI3A 4HEQA 1GTSA 4REQA 4CG1A 2QMEA 3VVBA 1RVDA 5I9TA 3L1KA 5AVSA 1IZ0A 1CJMA 1BS9A 3GBVA 3LFTA 4HB2A 5EYPA 4JQZA 4Z4FA 1XLTA 2FUKA 3AVOA 4JC0A 4N0PA 4ZQFA 4RWEA 5IVHA 2O8CB 2GZHA 4BVHA 3KCQA 1RYBA 2G9RA 3DEAA 3GARA 1Y8AA 2ZIGA 2BI8A 4BRZA 3N2NA 5DVZA 4F85A 4LRTB 2OC4A 1CQJB 3SBDA 4BY9E 3G3EA 3G68A 3DA8A 2AN4A 2FOIA 4EW2A 2IYSA 3BT7A 4RANA 3ZHCA 1JHOA 1QOZA 1W1IA 1XPOA 4BO0A 1WXXA 3MB5A 1ETUA 2FPWA 3OA0A 4Y1GA 2OCYC 2K2QB 2Y9MB 5TMEA 4MV9A 1AGNA 3RNLA 3I6IA 4LYAA 1XE3A 4G4GA 3RRJA 1KEEA 1KYQA 4C4RA 2PANA 1D2AA 2HU8A 4B2YA 5C5IA 2EHJA 4LE0A 1ZPDA 4I1IA 3T3GA 4KGZA 4YLEA 2H2FA 3R8FA 3L46A 3SHOA 1PJRA 1CDZA 3IEPA 3KV3O 4QDTA 4U7HA 4EUEA 4H3SA 2ZI4A 3QVKA 1G21B 4MICA 2I71A 1PJBA 1PJTA 5KYUA 1E58A 3R7WB 4W7SA 4LHZA 2R4TA 3WBKA 4IPTA 4TOIA 4FMDF 4NYJR 1OJLA 4U9HS 1C2TA 1B42A 4MYCA 5JNWA 1JJ7A 4ENRA 1K9SA 3D4NA 4LY6A 2Q9UA 5FNVB 3QUTA 3R23A 1AE1A 4Y30A 1B73A 2XF2A 3OQIB 5HP4A 2A9JA 3IT0A 4BGIA 1MO5A 2WWHA 4HWKA 4WESA 2E9SA 3QOYA 2VYQA 4MRNA 3GIWA 3ZVMA 4R7TA 1HZJA 4AJKA 2BMEA 1E3TA 1HYBA 2YZGA 4DR2B 4JIGA 5HR5A 5AJXA 1XMIA 5I7HA