4DLYA

Set 1 cacl2/dtt, ordered off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlyA00
1N6KA 3U3MA 3BXZA 4TL6A 3QQ5A 2JLUA 1G8FA 4H1VA 4O3MA 1G5RA 1BOFA 2BCGY 1DG3A 4NP6A 2QSYA 2IS4A 1LS1A 1XD8A 4Q4HA 4DLYA 2YWGA 5A5GA 3AF2A 4QGGA 1YR8A 2QP4A 2OILA 5AJYA 5IK2D 3VR4A 3WYAA 5TXGA 2IA5A 4XWAA 2I3BA 3VKHA 2UKDA 3OIUA 1HEIA 3B1VA 1A2KC 3GCGA 2NO0A 2DFLA 4HSEA 1G3RA 1OFUX 4DVGA 1OFTA 2GKSA 2OT3B 4DLXA 2REXB 3M6AA 3CR7A 2IYSA 1P9RA 3IEUA 5FBRB 4TYNA 2YZ2A 1GRNA 1KDTA 2EWWA 4K8OA 1W48A 3QKSA 3MRSA 5P21A 3THXB 1COWD 1NKSA 4RKEA 5AUPB 4TZ6A 1JJVA 1XTSA 2DY1A 1W47A 5JS8A 3DMDA 3QE0A 4QGHA 3QXHA 5FOTA 2H5EA 4MYUA 4D0NA 2REBA 4WZAE 2IYTA 5AJVB 3ZIAA 4TWZA 2WMNB 1Z6TA 2WTUA 1GP2A 2IYYA 3QF7A 3TSWA 1BMFA 2DFNA 5E7IA 1II8A 1WRBA 3TVDA 1P7CA 5DE3A 3U3OA 4LJ5A 2A5JA 1QHHA 2BV3A 1OXXK 4KLNA 2HJGA 3HPQA 4RFVA 2F9LA 3JZMA 3EX7C 2P67A 2QTHA 1OXUA 1P2UA 5DI3B 4XIGS 2R2AA 4C0KA 1HTWA 1UADA 2X77A 2ZEJA 4PZZA 5C18A 4JLBA 1SXJB 3O8DA 2Q9BA 3BS4A 4A8JB 1KAGA 5JHHB 4MA4A 4DWJA 2BM0A 4LZZA 5J4KA 1KI7A 4DJTA 1J70A 3UMSA 1QG2A 2ANBA 3ZZ0A 2F55A 2WAYA 3CPJB 4MRVA 1KI4A 4AG6A 2CCJA 3CUEF 2FSHA 2L0XA 1COWA 4A82A 1LB1B 2C9CA 2DBYA 3IDQA 3X1ZA 1CJKC 2QMHA 5IDVA 1T9HA 4OL0A 4ABYA 2RGBA 1I2MA 2PJZA 3G0HA 1Q0UA 3RSLA 3FMIA 1WA5A 4LJYA 3T61A 2BEJA 2ZVQX 1M7HA 3WHLA 4P4TA 1YRAA 2FEMA 3FKSD 4Q21A 3Q8XB 3GLGE 3BB1A 1UBFA 4PQFA 2AXNA 3SZRA 4EAQA 4PAQA 1G8GA 1HY3A 4NCNA 4JZKA 4Q9HA 1KO4A 4ERNA 3AP1A 3Q85A 2O8DA 1GNPA 2QMEA 3BOSA 5HKKD 3KDSE 3PQCA 1G4AE 5BYKA 5GJWC 4LV8B 4URUR 2PLRA 2ZYWX 1HURA 3GLHB 1G18A 1YE8A 2AXPA 5EZ5A 4Z1MA 3QENA 3TW8B 3HU1A 2H18A 4RD6A 3D31A 2AD5A 1W0JD 2VP5A 3QKRB 1OHHA 2KJQA 4JL8A 1CJVC 3AB3A 4YMTA 2ZJYA 4RCYA 3GLFB 2H92A 4GMXA 5KDDA 3TUZC 1ZUHA 3AUYA 4LK2A 2FN4A 2JLXA 4Q1EA 4JLJA 4YDSA 2BEKA 4TL8A 1KY2A 1E79A 1R5NA 1XD2A 1XCGB 4Q9LA 2WAXA 3FKSA 4M9SA 5FH9A 2KI5A 3FPAA 1BS1A 4ZKDA 4NMMA 3CF0A 4R7ZA 3RRZA 4PAOA 2IBMA 3RABA 2RGNA 1MO5A 4ITRC 1GKIA 2A78A 1QHYA 1KI6A 2ZR7A 1VYVA 4Y0VA 1CLUA 1Z3IX 1P75A 5HKKA 1Q3TA 4XVRA 5FOUA 3RS7A 1OH6A 2EWVA 5TV2A 1ZU5A 3SU8A 2ZUDA 3VMFA 3X1DA 4BLRA 1FUKA 5E7JA 4Q7LA 2DR3A 4O2LA 5HCIA 3SYLA 1C1YA 2GTPA 1NSTA 4M9ZA 2CLSA 4B44A 4PFSA 1W0JA 2ZRAA 3B85A 3F8TA 3SBEA 2I1VB 3GEHA 3WMFA 2AK3A 3P26A 4YONB 2RHMA 2JJ8A 2FGKA 3GJ4A 4QJ4A 4X8OA 1H8HA 3DVLA 2G6BA 5B58C 4U02A 2IXGA 4CYMA 2RGAA 2ZJBA 4WVFA 1G17A 4RZ2A 4DCNA 3Q7QA 4E03A 1W49A 1QHNA 2H57A 3B5JA 5L3VA 4OBEA 1G3UA 3QEJA 4MGKR 5L3SA 3FHTA 3EZ6A 3P4YA 4FD2A 4DSNA 3W3AA 1G4UR 4A0RA 4HDQB 3AVTA 5G41A 2BMFA 1TMKA 5H1YA 5FPHA 1KGDA 2YKGA 4NBSA 1GL6A 2G1JA 2GBLC 1KDRA 4AG5A 1E0JA 1KO7A 2GZAA 3V9PA 3DHWC 1PUJA 3I8XA 3JZAA 5CIWA 4G5GA 1CJTC 1X8JA 2ZM5A 5JEDA 5BWMA 4CF7A 1SKYB 3FKQA 5JWHA 2JCSA 1Z2AA 621PA 3CR8A 4NH0A 5KPDA 3UG7A 2ZJ5A 1XTQA 4Q03A 3D7MA 4LHYA 4R71A 4Q7KA 2QPOA 2H7VA 5EP4A 1Z07A 4C2TA 1XBTA 4XWKA 5KSYA 3VHLB 2VF8A 4BE7B 2OESA 3LQRA 1Q1ZA 5JSZA 3R9WA 1NL3A 2HV8A 2BC9A 3Q72A 5C4GB 5TDHA 5KYKA 1XB2A 2HUPA 2BKEA 2PEZA 3T1TA 1AN0A 4US0R 1ETUA 1QHSA 1YJ5A 4IKEA 4EJSC 3T1OA 3CPEA 2YC2C 1VG0B 3SJBA 4KVGA 2Z83A 1E9EA 3W8NA 4CGZA 3ONWA 3SOPA 1KNQA 3QXSA 3EASA 3SS8A 5F2EA 4DLTA 4FN5A 3QPWA 3C16C 4E5UA 1DAGA 4TLDA 4Q9KA 3ZS8A 3ICEA 3EIHA 1E2GA 4AC9A 3EAQA 1ZNZA 2CBZA 2GJ9A 3VAAA 3K70C 1FX0B 4H1UA 4JLOA 4GZMA 1N6HA 2W00A 1ANKA 1FFHA 4Q4LA 1E99A 2A5FA 2GILA 1P73A 4M1YA 1DAFA 5G40A 1CULC 4HAZA 1ZNXA 1NVVQ 3KTAA 4TQ9A 3REFA 5J4LA 4URVR 4A15A 4Q47A 4CIDA 3K9NA 4OI2A 1NBMA 4DEYA 2ERXA 1PV4A 2J0UA 2WWHA 4PO9A 5DHAA 3EG5A 3A4MA 2RCNA 1QVRA 4WBSA 1NBME 1JECA 2CDNA 1QHXA 3N2IA 2OO7A 4D4KA 4ZI2A 1SVKA 3EZFA 4ASUD 4D80A 2B8WA 3AEZA 3B7GA 3FHCB 4L15A 3MLEA 2R62A 4F4CA 4BFYA 3Q9LA 2Q6TA 1CRPA 2MSEB 1Q12A 1HV8A 2QU8A 1NVVR 3REGA 1TQ4A 1TNDA 5DIFA 1YR7A 5DO9A 3UMFA 5J5CA 1W36C 1KK2A 2FSFA 1U98A 2KBFA 1N3BA 1ZMXA 2G83A 2XJ9A 3CRRA 3LWNA 3L43A 4ARZB 1BO6A 4LRWA 1W5SA 3UATA 2BBSA 4A2QA 1RRFA 2WIBA 2XNSA 2OXCA 2XAUA 1E0KA 4JSTA 3R9IA 2YNMA 2NO9A 1WXQA 1GNRA 3I4LA 2GJAA 3IBGA 4DHEA 2WOJA 2G9NA 3CRVA 3L2OB 4WA7A 1US8B 4I1UA 4A92A 3FB4A 4LHXA 2PBRA 5CLLA 1S0UA 1XEWY 3KUDA 1XJCA 1QRAA 3WNBA 4KSCA 4P31A 2ORIA 1IJEA 3RS2A 2V7QA 2ZUCA 3AF3A 1R6BX 3L0SA 4PZLA 5FL7A 5KDLA 3I62A 2BBTA 1FW6A 4ILEA 1XU4A 1KK0A 4OHVA 1MO6A 2XNDA 4IFEA 3P27A 4KVAA 4X8LA 4JIMA 5CDFE 4JLMA 1NRJB 4ASUA 4PSKA 3K0AB 3A1UA 4LOAA 2Y8EA 3LV8A 1TUIA 2YOFA 5HZKA 1RZ3A 4EKDA 3EWSA 4TMWA 3C15C 4QM6A 1XTJA 1XXHA 2WJGA 2D2FA 2W0MA 2W6JA 2ZJZA 4B3CA 4DCVA 4GSYA 1Z6AA 1Z5ZA 3QEOA 1IY1A 4RVCA 3UXMA 4URXR 4F93B 2PJRA 3IGFA 1N6IA 1MO3A 4MKFA 3R8CA 3CWZA 2AL7A 3CX7A 1XWIA 3IHWA 1OYWA 4DDVA 1F48A 1BH2A 2D3WA 3B13B 3X1WA 4E22A 5J4HA 2YINC 4QGAA 1X8KA 2PZEA 1SVLA 3QBVA 3DPUA 2ZQ5A 4AIIA 1XFAA 3DKVA 5IRCD 1Q20A 4KYIB 5DN6A 3LBNA 3GFPA 3E1SA 2NIPA 2VP2A 3NBYC 2J0QA 1LF5A 2X2FA 1CR1A 2FJUA 2HLDD 2QUZA 1TPZA 3KKPA 4PSVA 1E2JA 1N5JA 3BGWA 2ANCA 4IOKA 4L9WA 3CW2A 2ZROA 4GDFA 2VP0A 3TRFA 2QGZA 3A36A 4XH9B 1W2HA 5JI3E 4ACBA 3THWB 821PA 3T12A 2OBNA 1EFCA 2NOAA 1UF9A 4N0EA 3BRWD 1GSIA 1TQ2A 1W0KA 1E2PA 2RGCA 721PA 2ZSEA 4G5OA 2ZSBA 1KI2A 4W5HA 1X1RA 4MKGA 3N2EA 4FINA 5AJWA 5L3QA 1SVSA 2FPMA 5LB2A 4XJXA 4UXHA 3NC0C 2Q0HA 1KI3A 3U6BA 3N70A 3KB1A 1AS3A 3EW9A 2BMJA 3GJ7A 3TE6A 3TAUA 2K5UA 2O8CA 1BKDR 3AUXA 3CNNA 4CEIA 2WKRA 3KQUA 3ND8A 4NKRA 2VL7A 4IXNA 3SYNA 4M2LA 1G19A 1MOZA 2WIAA 1NVXQ 2AD1A 2X1VA 2CEAA 1SHKA 2GESA 4KU4A 2ZTSA 4HB0A 2D62A 1RYHA 1G9XA 4II7A 4DB2A 3T1QA 1XTRA 3HPRA 4OI4A 4NDZA 4V0MA 1XMVA 3VR2A 4Q18A 2IYXA 3CRMA 3BFXA 3LVRE 5DSZA 3EC2A 4A1FA 3I1FA 1E2HA 3ZGXA 4V0ME 3TIFA 2ZSFA 2GVDC 3B1WA 1NG9A 2R6FA 2GZHA 3HU2A 1KTVA 3DMNA 2OZEA 1U81A 4I1SA 3WNDA 1YZKA 2QP9X 2VF7A 1CBUA 5JHGB 2GA8A 4QGFA 2JIZD 5CB6A 1K5GA 4URZR 3LXXA 3ZJYA 3TNFA 3F5FA 2I4IA 4LBVA 1YZLA 4PZYA 2PZGA 3GLIA 1XNJA 5SZKB 3AVOA 4DSOA 1U8YA 3OFND 1U94A 4MITA 2FFAA 5AUOB 1KIMA 2RGNC 1E9DA 1SHZA 1TX4B 1GIAA 1HQCA 3VKGA 3GLIE 2ZRMA 2W6IA 1G5TA 4NCKA 5M04A 1P6XA 3AF0A 3CB4A 4DXAA 2UZIR 4UQOA 3B60A 2VH5R 1QZXA 4C7OA 1OXSC 4AYWA 3RLFA 5FOXA 2PT7A 3NEYA 1EXMA 3QIAA 3CF2A 3CPHA 1AGPA 1CTQA 4P4UA 4TLBA 1T91A 1UM8A 2CL6X 2QRNA 3WBKA 2GCOA 3KKOA 2IUUA 3VR1A 1RRPA 4IHQA 5FFMA 5HR5A 3B82A 2QY9A 4JL5A 5K8LA 2DYKA 4JJKA 2D7DA 3I5XA 1J8YF 4K81B 1KDOA 1RKBA 3BORA 2HCBA 2VHCA 2GF9A 1IXRC 4BGDA 4BLSA 3B1YA 1XMIA 3DDCA 4QBHA 1WDTA 3A4LA 3QSYA 1TAGA 2JASA 4FWIB 4TTPA 2JIZA 3C8UA 4Q1DA 2VBCA 2GXSA 4KFSA 2GRJA 3VFDA 1XF9A 3OFNA 1UBGA 3NH6A 3M1IA 3HR7A 5HTKA 2ZPTX 4C30A 2FZ4A 2GVZC 2JEOA 3CRW1 4O0MA 1E2NA 4F92B 3EZ9A 2F1JA 2QG6A 3TR0A 3F0TA 1IN5A 2HEIA 1P60A 3L0OA 2PX0A 1WBBA 4KSBA 1PUIA 5LD2C 4O2RA 3CX6A 4PQRA 1E1QA 2OAQ1 3LH5A 1EK0A 1L4YA 4LJAA 2QL6A 3SC3A 3WMGA 2YV5A 1XTKA 3MAAC 4JLPA 4L5BA 2C98A 3GP8A 1E1RD 2GEVA 5DI3A 3FOZA 3CX8A 3BBPA 2EW1A 2KWIA 4TMZA 1IY0A 2VPPA 3ASZA 1DADA 4A2PA 5KNBA 3AH8A 4QJ5A 1Q21A 1NN0A 4A9AA 1R4AA 2GJSA 2QRZA 4N3NA 2A3RA 1SXJE 3C5HA 1AZSC 4FXPA 1Q1EA 4NYMQ 1GNQA 1G7RA 4AWXA 3A1SA 3L0PA 2ZRBA 2XGJA 3KQLA 2FV8A 3DZDA 3ZVLA 1TF7A 4GFDA 1Q3HA 1II9A 3AP2A 4Q1FA 3S1AB 4LPSA 2OCAA 2QT1A 4C4PA 4LUCA 1VG1A 2ZETA 4FWTA 2CHVA 4HLQB 1FNMA 3CZQA 3AVQA 4I99A 1G64A 2NTYC 3TSOA 2G1KA 4RD3A 4IDPA 2FSGA 4PANA 2F43B 4LWZA 4B32A 1NVUQ 1R8QA 2DHRA 1S9HA 2O8EB 2AK2A 4TYQA 5FR2A 4KBGA 5KSOA 4B74A 1RFLA 4NYMR 1OFHA 4IXMA 1I4LD 4S2EA 3ZIAD 4PO1A 3Q3JB 1JALA 4CEJB 1WCV1 4LHZA 4HB4A 4M9QA 5TB5A 4Q48A 3DOFA 4JVNA 2G0NA 1BYIA 2XOKA 1UKVY 2QBYB 1WF3A 2A30A 2ZSDA 4KCGA 2C77A 4IOMA 2GK6A 2ODNA 1CRQA 1IN8A 2V55B 3GLHA 4IDNA 2ZE7A 4AYXA 4DB4A 4DSTA 1T6NA 2QN6A 4B6EA 2NZ8A 4KFUA 3FMOB 1L8QA 2CMKA 2WKQA 5FUWA 3H4MA 4JS0A 1VTKA 2F1IA 1UEIA 3GLHE 3QKRA 1D8TA 5EXSA 1EESA 3RC8A 3C41J 2O0HA 1DTSA 4YQFA 3LO5A 2QM7A 4ZO4A 4EFMA 4NONA 5JRZA 3LD9A 1DO2A 3GLFE 4IEIA 4W5WA 4U00A 5EXPA 3V4FA 1JR3E 1KZGB 1CIPA 4JJZA 2RB4A 2ODBA 4D2IA 5KUTA 1RRCA 4LGMA 3SJAA 1HT1E 8OHMA 1QVAA 5EP2A 2BBOA 2ZRPA 4BZXA 1S8FA 2IEZA 1N6LA 3GMTA 4MYHA 3KXKA 4OK5A 1J90A 4IW3B 1G8PA 2YOHA 3I32A 4S35A 2WWGA 4C0SA 4POAA 4KBFA 1I4DD 4Z8XA 1EGAA 1E2EA 4ZDKA 2B6HA 2ORWA 5FOVA 3GFOA 4LJ7A 3K09C 1P2VA 4TL9A 2GXQA 4A36A 1ZCAA 1KOFA 4XSGA 4CVNA 3PR1A 1YU9A 1G8YA 2CJWB 4H9GA 4P33A 4R2HA 1XEXB 4G01B 2FGJA 1Q44A 2JATA 2YVUA 2Z0MA 1AS2A 2QA5A 4EJSB 1YZQA 2YWHA 1FPMA 2RHDA 1ZRHA 1ZM2A 4Z1MD 2PLFA 4XOIA 1YZGA 1UDWA 1B23P 2JAQA 4WOPA 3EPJA 3DEFA 3KXIA 3KFVA 4IOJA 1OHHD 1DBSA 1U9IA 2J59A 2F1HA 2D2EA 1S1CA 2R8RA 3A1TA 3KJHA 3QXJA 4PXAA 4BLOA 1DPFA 4KAXA 3QPVA 2JLVA 3L82B 1TQ6A 5CLQA 4PTLA 1KDPA 4C2UA 2EYUA 3GLGA 1EFRA 1E79D 2OBLA 1SVOA 1U8ZA 2QQEA 4PC7A 3R7WA 3T35A 4TL7A 1TF2A 2GDJA 3TH5A 4B71A 3AVYA 3LDAA 4YXWD 2N42A 2VHJA 4PC2A 4QBIA 4EPTA 2WZQA 1EWRA 2EFCB 2XB2A 5TARA 2JLWA 2CLCX 2P2LA 4IDOA 4IVRA 1ZCBA 3O47A 4HAWA 1T5LA 4LDJA 4UNQA 4RFSA 2DB3A 2BIFA 2NO1A 4L9SA 3BWDD 2P5SA 3WXMA 1SKYE 3IUYA 2ZJOA 3WY9A 2NMVA 1HE1C 2A7QA 2C9YA 2JLQA 1H65A 1VKJA 2P5TB 1E32A 4BFVA 3K53A 2J5XA 1LW7A 3AVPA 3B1XA 3UMRA 1Q1QA 5EXTA 4Q7JB 5D3MA 5HCNA 2FG5A 1YZTA 3MJRA 3LW7A 4BFXA 1N0UA 1KJYA 4I1OA 3K0FB 5IT5A 2PT5A 4BEBA 4M1KA 5FI0B 1DS6A 3HJNA 1QG4A 3G5UA 3EC1A 3PUZA 4LC1A 3ZZUA 4CDGA 4DDWA 1H8HD 4TYWA 1OIWA 2Q21A 2XZOA 1N25A 2Z4RA 2C9OA 2ZAMA 2KSQA 3UIEA 3RWMB 1YQTA 2AKAB 4V02A 4GT1A 2QENA 1Z83A 2ZAOA 3K0SA 2WWIA 1CR2A 3ECCA 4KI0A 4RZ3A 4E09A 5KSPA 2C03A 2H8KA 2PCLA 1VDZA 4JT4A 4YXWA 1FX0A 2OSBA 4HAUA 3U3KA 4M1SA 1ZUNB 1EWQA 2W2VA 2AKYA 3IIJA 2B92A 2FF7A 3Q5EA 1JAHA 1SVMA 2J87A 2ZU6A 4PHFA 4TYPA 3J81k 1KJWA 4B2LA 3EZ2A 3CONA 2IEYA 2QP3A 2CE7A 3QKSB 4PPQA 2FEOA 1R0WA 2F9MA 1NP6A 2PH1A 4Q1BA 1AK2A 1E2FA 3L8YA 2N46A 4OHXA 4C0LA 2QPAA 3B8HA 1AKYA 2H17A 3RC3A 4U7DA 1G21E 3U7GA 3GJ6A 3CH5A 2JLZA 2NPIA 1D5CA 2OFXA 4OQMA 1KHTA 3NHAA 2XZLA 2XTMA 1GITA 1OV4A 1IXZA 4ZIRB 5E4FA 1ZD9A 1QHHB 4QFMA 3WNCA 2IYLD 1F60A 4EIWA 1YR9A 4HEJA 1KI9A 4LYJA 1MRNA 3ASYA 3AVVA 3U3JA 3FDIA 5CJ2A 3EA5A 3TAHA 1X86B 2QE7A 4B3FX 4DKXA 1Z28A 2YC4C 4DT1B 3OEHD 3AF1A 1IXSB 2QT0A 3IPXA 4Q4AB 4DLUA 2GXAA 4UJ5A 1HQYE 3PUVA 3U44B 3CKLA 1W4BA 3LFUA 3QVUA 5G3YA 2QI9C 3AVWA 2BCJQ 3EPHA 4FCVA 1NMYA 5J4YA 4M9XA 3TK1A 1JEDA 1OSNA 2FNAA 4C0BA 2D4HA 5FTLA 5K8UA 5JWOA 1YHNA 3W34A 3KUCA 4HI0E 1MRSA 3KB2A 1T0JB 3RRMA 4Z51A 3CIOA 2LCFA 3K9GA 3K0AA 4DLWA 1NBMD 4HUTA 1DAIA 2WM9B 1W44A 2VEDA 1E69A 5DH9A 3TUJC 3W6OA 1E9RA 4DLVA 2QPTA 4QBFA 4FMCF 1ZM4A 1WQ1R 5SZHB 3LA6A 3QG1A 4NYJQ 2HYDA 2HT6A 4GI7A 1KSGA 5DLQC 3OEHA 5EE1A 4TQAA 1NIJA 5CK4A 4F4IA 1Z22A 1DEKA 1F2TA 2EU8A 3LX5A 4ZKEA 3AP3A 2JJ2A 4MRNA 4EDHA 1KNXA 5B57C 4EFNA 2ZI3A 3C4JA 2F7SA 4JSYA 5FBVB 4FMCB 1GAJA 2NO7A 1ODFA 3SI7A 4DZZA 3U4QB 1M74A 2WPDD 2FA9A 4XD7A 2JLYA 3P20A 1FTNA 3OEED 1NSFA 5AJXA 4HLUA 4HZIA 4D6PA 1VYTA 4QM7A 4NYJR 4AI6A 1ZM3A 4US1R 3WP0A 2Q3HA 1NF3A 1IN7A 1A4RA 3FFBA 1J7KA 1UAAA 4FI3C 3WRYC 1TTTA 4JBXA 2B8TA 4RKFA 1XD2B 3T15A 3BK7A 2V7QD 5FL7D 1FTSA 1PLLA 3EXAA 4ZDJA 4MDFA 2GK7A 1S96A 3NXSA 1U0LA 4HB3A 4L4UA 2OUKA 4A6PA 4ZCMA 3KQKA 4QXAA 3ZVNA 2A2ZA 2HDNB 2XNDD 4PPFA 2DWOA 2QSZA 2Z6VA 4KLZA 2E9SA 1YRBA 4O25A 4XSHA 2J7PD 3EPKA 4HYYA 2BBWA 2QZ4A 1KI6B 2VA8A 3MG9A 2O8BB 1XCMA 2WSMA 2XTNA 3K9HA 3TJZA 3W8RA 4BFZA 2VSOA 4HAVA 1DAKA 2UVQA 1IOZA 3MWJA 2W6JD 4KXFB 4OI1A 4LPKA 3AVXA 2ASEA 2AR7A 2ZRKA 1JJ7A 1IAQA 1VHTA 3KJEA 3UWOA 1QBKC 3LNCA 2WPDA 1CKEA 3R9XA 1Q57A 1YR6A 1NN3A 2OCPA 3MD0A 4LC0A 3OEEA 4MYTA 1NY5A 2G3YA 1KK1A 2CL0X 4ZDWA 1OIXA 4DC9A 1F6BA 5FUYA 3H1TA 4F38A 3GJ3A 2WSSA 5JRJA 1M2OB 1HH4A 2GZDA 3TLXA 2R44A 5DN6D 4R9UC 2YYZA 3Q7PA 2BMEA 3W6NA 1E9CA 1JXOA 3CF6R 4HZUA 2I1QA 1N5KA 1IONA 4UKDA 5CDFA 5BN3A 1AQYA 2ZJAA 3OAAA 1OE0A 3KZ1E 1ZNYA 2C8VA 2CLDX 2IWHA 2J7PA 5E3HA 1C4OA 3KQNA 2P3SA 5JS7A 2IYZA 1E0AA 4P4SA 4LJ8A 1AIPA 4B48A 2ZR0A 4URWR 1VYUA 1W0KD 121PA 2GJKA 1IBRA 3THYA 4WIAA 1J8MF 1SVIA 4AYTA 2RGXA 2HT1A 5LD2B 3PEYA 4JBYA 4YLGA 1KKLA 3VNUA 2NZJA 3GEIA 5EXXA 1G16A 2NQ2C 2HYIC 1DELA 4PHGA 2A5DA 1GRQA 1Z47A 3AKEA 3BC1A 3VNVA 4OHWA 2GEUA 2MMCA 2QNRA 3SNHA 1LNZA 2AWNA 1O87A 1N6RA 4OK6A 1P3JA 1Z08A 3CZPA 4FIDA 1JEEA 1Z06A 4U5XA 4OQNA 1DAEA 1KY3A 1XTIA 3L0IB 5GVSA 3ADCA 3SJCA 3BERA 1RE0A 5TVKA 5DISB 3CLVA 3W3ZB 5FTJA 1R8SA 2XX3A 5CITA 1F3OA 3BD9A 2XXAA 4QBGB 4HUQB 2HF9A 1ZIOA 1L2TA 1NI3A 2QQ0A 4X8MA 3B1ZA 1U9IC 4M8NE 4N1AA 4UJ3A 2V3CC 2W0SA 4OK3A 4CEHB 4Q66C 2Q9CA 3VHXA 1GDDA 2F1RA 2QAGB 5KO2A 5DI9A 1II0A 4BASA 1FOEB 2VSXA 3IIKA 4KHZA 3DOEA 4IFBA 1OH7A 1U99A 4D4MA 1E0SA 1SQ5A 2G0TA 3BH6A 5FTKA 2CVFA 3RRNA 2F6RA 5B2ZA 4DCTA 2REOA 5JBQA 3RVBA 2VHQA 2FMXA 4Q1AA 4LYAA 5FPSA 5JEEA 1M6NA 2ZSAA 1H8ED 1HYQA 1WE2A 2Q9AA 1SKQA 2J0UB 2ZRHA 4TMTA 4RJLA 2W6ID 3RYTC 1E2IA 3QF4B 1B0UA 1XJQA 5EP1A 2KE5A 3T1VA 5TMPA 2FPKA 5FBWB 2ZRNA 2R6GA 2FDCA 4RD2A 4AKIA 2ODEA 5CK5A 2X8AA 1RJ9B 4EUNA 1NY6A 2J1LA 5E7MA 2B21A 3QUSA 4RD1A 4EFLA 1QDEA 4OYHA 4TT3A 4OQLA 2BJWA 3U5ZB 2J41A 2PEYA 4GZLA 4V0LA 3OE7D 5K8TA 2J9RA 4Q5IA 1N5LA 1P9WA 3FFAA 3IPYA 3TW4A 4HDCA 3W5JA 3KQHA 3ADDA 3S1AA 1K5DA 2ZI4A 3V4RA 3SQWA 1UEJA 2CE2X 2FPLA 2ZI5A 3H0KA 2YHSA 1XD9A 4V0KA 3GD7A 2WV9A 2V1XA 5B64A 4BLQA 3A1VA 3F3YA 3G82C 1FQJA 2EQBA 1GUAA 1K6MA 3MCAA 1YZNA 1OPXA 4I4LA 4G0NA 4IRUB 1R0YA 3OZXA 5EUQB 1J99A 2VO1A 1ZINA 5CJPA 3WP1B 1H8EA 1OKKD 5A4JA 3EWAA 1ZM7A 2V8OA 2IWRA 1FMJA 4HDOB 3MJHA 4Y0AA 2WWYA 2JGNA 4LBYA 1N0VC 4CEJA 3AV0B 3B2EA 1IJFA 1GKUB 1TL7C 3PITA 3EARA 3SEAA 4EPYA 3HP1A 1VECA 4DLRA 4MKIA 1DARA 5K8IA 1AZTA 1VCMA 3FMFA 5JJKA 1EX7A 2QBYA 1W4RA 5LBIA 2AN9A 3IILA 3NG1A 1GRRA 2QMOA 1GKYA 1Z2CA 1E1QD 3LX8A 2WJYA 4B3BA 4TSFD 3LQQA 1XXHB 1P4SA 5JECA 1PVOA 4ZDIA 5LPNA 4MUBA 2J45A 4JLKA 3DL0A 2ZI6A 1EX6A 4Q1CA 1VCIA 1ZAKA 3IQXA 4JLDA 3C7KA 4ZV4A 2IL1A 3OE7A 4BWYA 5KTYA 3U7HB 1SXJD 2ZRJA 2FWRA 4V03A 1KK3A 1NMXA 4ON9A 2P65A 3SYKA 5KNCA 1E2DA 5KHOC 5ELXA 3LW8A 4GMDA 4LY6A 2DWQA 5JFGA 1FP6A 1E9FA 2VIIA 2V1UA 4OJQA 4M4SA 2VLIA 4RD4A 3THXA 3KJIA 2VYFA 3E2IA 3N5CA 1ZW6A 1OKKA 2RGGA 5EE3A 1W4AA 2VP6A 2ZRIA 2ZS7A 5L3RA 1G7CA 2ZUBA 3KKNA 3ZDQA 1GL7A 2VP4A 3LBHA 4MQBA 2FE4A 2ZVPX 3CO5A 4LV5B 4R2IA 4A0FA 1P9NA 4E07A 3TGPA 4I81A 1KSJA 2ZXUA 1F2UB 1KYIA 1D2NA 4QHTA 2MMGA 4QKQA 1TU4A 4TMKA 4IVPA 4DCUA 2VHUA 1BYUA 2V6JA 4MGIR 1T3SA 4TSFA 2YWFA 4FMDB 3L8ZA 3ZVMA 4AKGA 1ZP6A 5HZHA 3U7FB 1MH1A 1DE0A 1KMHB 3QY0A 2JJ1A 3KXLA 1XPOA 1GWNA 2OAP1 3RWOA 2XOKD 2RAPA 1CJUC 3QJYA 3VR5A 1SXJA 2CJWA 4QOSA 1XEXA 2HF8A 2WMOB 4A8JA 1GL9B 1UKEA 3A37A 5EE0A 1VIAA 2O8CB 2XJ4A 4CEIB 4B3XA 1J2JA 4W9MC 4JBWA 5FPTA 4EJSA 3BAFA 3NDBB 3NBFA 1RYFA 3DO6A 4EPVA 4MDEA 4B2IA 2HCJB 1VHLA 5H8WA 1JAIA 2AFIE 2CHQA 4TLEA 1PZNA 3QKTA 1WP9A 2XEXA 4JT2A 1MABB 4MH0R 1OLOA 4NYIQ 4BUJA 521PA 4DIEA 5FUVA 3U7EB 1CU1A 1JR3D 3TBKA 4WXPA 1EG7A 3KX2A 1JR6A 2QMUA 3PFIA 1ZNWA 4XTCS 5AK0A 2R65A 1KZ7B 4CW7A 2ZRFA 4HLUC 3K1JA 4XTRA 1DO0A 3WHKA 4LBZA 1T8UA 2O8FB 1MO4A 1X1SA 1E6CA 2BDTA 2SHKA 3K8YA 4DEXA 3TMKA 2IX3A 4NE2A 5FPKA 1HA3A 3ADKA 3BH7A 1E9SA 2ZRDA 4D4JA 1OXTA 4NYIR 3ETLA 1M1YE 2GWHA 4WZBE 3SN6A 2IHYA 3MFYA 3QOFA 4QRHA 1W1WA 1DVRA 5FUXA 1YVDA 2ZJ2A 3GFTA 3U60B 1LFDB 2IK8A 1LF0A 2NGRA 4YMSA 4BFWA 2JA1A 2GHIA 1ZU4A 1ESMA 2OE2A 2H1LA 2CK3A 2VHTA 4G5SA 2JDIA 1TF5A 2ATXA 2IUTA 2DCUA 1VG8A 3K0FA 1E96A 2WJIA 3NBXX 1JPJA 4OQXA 2ECKA 3X1YA 4NCJA 3GLFA 1VMAA 3EIQA 1XMJA 1A2BA 1E2MA 3HYRA 2LWIA 2VSFA 1JR3A 2F3RA 3B6EA 1GFIA 2GEDA 4DUGA 1VCNA 5KOYA 3DM5A 4OQFA 2GCOB 1RW4A 1RRGA 4C3ZA 1UPTA 2WOOA 2QORA 2ONJA 4PQYA 2FFHA 2EFGA 2FFQA 4Q4JB 4B75A 1ZYUA 1JB1A 3T5DA 1M7BA 3LBIA 1UKZA 2IUSA 2GF0A 1EFRD 4Z54A 1G7TA 2BWJA 4YMWA 1G6HA 4L16A 1M34E 4MUAA 2D74A 2EVWX 2LKCA 1A1VA 1FMLA 3NTUA 4B76A 5C2JB 5KSZA 4B3GA 5CIQA 5IHPA 1AJEA 1UDXA 4Q00A 5EZ6B 3UWKA 3UG6A 3NVAA 3IBYA 3ICQB 2V4ZA 3X1XA 1OXVA 1N6OA 3KKQA 1VIYA 1R0XA 2ZS8A 4NL4H 5AUQA 4D26A 4RD0A 5AR1A 4HAXA 1LV7A 4FCWA 4B33A 3RS5A 5GVRA 1OF1A 1P2SA 4BRUA 4FCTA 4JLAA 1G6OA 2B7CA 5HE8A 1ZBDA 4B34A 2OM2A 4GP7A 2AX4A 4ZIRA 4W7SA 4US2R 1SGWA 1R2QA 5EE5B 3PEVA 5DYGA 3GPLA 2XITA 1V5WA 1N2CE 3IO3A 3ZYCA 1W7AA 2DPXA 1TU3A 2IF0A 2O0JA 4PX9A 3EA0A 4DT1A 3T5GA 5IK2A 3K70B 1L7VC 4D0GA 4Q4AA 4F91B 1KI8A 4JL6A 2PCJA 2BM1A 1KJZA 5JMTA 4C0JA 3U44A 1NG1A 3TR5A 4QL3A 4UNPA 4CRWB 3IKJA 4D0LB 2H16A 4EQ6B 4LHWA 2GJ8A 5DGXA 2G88A 3OHMA 4GNKA 4YMVA 2FOLA 3PG5A 4K46A 3WMEA 3VTKA 2IS6A 3K0CA 1Q22A 3RDPA 5C46F 1IY2A 2F3TA 1Z63A 1GOTA 1UBCA 3SJZA 2WHXA 2HXSA 4LV6A 1JXMA 3SFZA 3CRQA 4NCHA 3KL4A 3VU9B 5FOWA 1T3HA 4EPXA 4D25A 3BFVA 1X3SA 4B6FA 4NHOA 5SZIA 5C4MA 2PZFA 3UKDA 3D3QA 2FX3A 1GM5A 1T8TA 2IF2A 1CJMA 1W36B 3QNUA 1P62B 2ONKA 2ZE6A 1OIVA 2J7KA 2VQSA 1FUUA 4M1OA 4GOXA 4RY2A 2GCPA 1P2TA 2RH5A 2VTKA 4JMPA 1LS6A 2VRWA 5D3QA 2IYWA 3DM9B 3CNLA 4IDHA 1JPNA 4XVQA 1E3MA 5FBLB 4BZQA 2XSZD 4RSGA 2QAJA 2ORVA 1D2EA 4MGZR 4Q4HB 2IT1A 5BXQC 3R8FA 4GBMA 1RPZA 2QROA 2QE7D 3U4QA 2R6DA 1WBDA 4OI0A 1N6PA 1KSHA 4GL2A 2OLKA 5DYIA 1MR3F 1G3IA 2CCGA 1NLZA 2V6IA 3FVQA 1N0WA 1L4UA 1QHIA 3DKPA 2LKDA 1TEVA 2QTVB 5FTNA 4URYR 3I3SR 1W4CA 2AWOA 2C04A 3LLMA 1FNNA 1ZD8A 4B47A 5DNYB 5GJBA 3UPUA 1Z0FA 3CH4B 1C9KA 3CBQA 4DBLC 1KO5A 1QF9A 3T34A 4IJMA 4L8GA 3A1WA 4PPNA 2ZYUX 5BN5A 3HDTA 1E4YA 2OFOA 3BJIC 3AF4A 3GJ5A 1CF4A 3RS0A 1P72A 4IOLA 4PO8A 3ZVRA 3RAPR 4TMVA 3ZH9B 2P6NA 4D81A 1II8B 2GAOA 2O5VA 4KYUA 2O8BA 2OEPA 1F5NA 5TY0A 1NNEA 2XB4A 2A5YB 1G41A 4V0NA 1OW3B 2DWPA 1ELOA 1R5BA 1S3GA 2IXFA 4UNSA 2XSZA 1TADA 5FR1A 3NC1C 2BKUA 4BQSA 4ARZA 1PLJA 3PUWA 1FQKA 4JVLA 2R6AA 3RHFA 1AS0A 1P61B 5KPJA 4KFTA 3ZQJA 2V9PA 2JJ2D 2CL7X 4AKEA 1CR4A 3TUIC 1Z8FA 1ZVQA 2AHOA 4NTZA 4PC6A 2GXUA 3SHWA 3I72A 5E95A 1US8A 4KODA 3GQBA 3VR3A 1RIFA 4KV9A 3NKVA 2AFHE 4XD7D 2OXRA 2P6RA 4G5RA 4Z8YA 3KKMA 2HXYA 4F4JA 1QHGA 2ZYTX 3P4XA 4M0LA 4QNMA 2GETA 1JBKA 3NH9A 3SDZA 3K0EA 3WRXC 2NG1A 4UXIA 2QEQA 1IN6A 3T06B 4DSUA 3O8RA 5GJCA 4AK9A 1M7GA 1WMSA 3FE2A 2E1RA 2ZITA 2OG2A 3I92A 3OIYA 5FL3A 2WWFA 1XMSA 2OCYC 1ZUIA 5DHFA 3R7WB 3GLGB 5AWFC 2FFBA 1NJFA 2C96A 2XZPA 4NZYA 4DRZA 3C14C 3MWKA 4GRAA 4AKHA 1MT0A 1ZIPA 4PHHA 5JI2E 1U0HC 3NWJA 1ZM9A 2ZJ8A 1UFQA 4MGYR 2C5LA 1KO8A 1XJ0A 1HUQA 1R10A 5EP3A 4M21A 4GOJA 3FTQA 4RFSB 4WZ6A 1OH8A 2P6UA 3I73A 2O8DB 1X8LA 4UXJA 3ZZTA 2QGNA 1UBEA 2KB0A 4PC3A 4ZCIA 2YOGA 3U2QA 2WKPA 4YC7A 4ZCLA 3WBJA 4LYFA 1Z0AA 3P32A 3VX3A 4AURA 5JZVA 2ZI7A 4KFRA 5D3MB 4JYCA 2KBEA 5J4VA 2OCBA 3ADBA 1SXJC 4A8JC 3LVQE 2X2EA 3X2SA 4TYYA 4YDHB 2TMKA 4BEJA 1S3SA 1U2RA 1UJ2A 4DDUA 5F98A 2IC5A 4UNNA 4N0DA 1W5TA 2WSSD 2BMDA 4HUQA 3I5YA 4BRWA 2HJVA 2WVJA 1T4GA 1IM2A 1DAMA 1GZSA 2DFKB 2P0EA 1KSFX 2WJVA 5CM9C 4CT5A 3HWSA 5AJZA 3BIFA 1NJGA 2MSCB 3MWYW 2NPFA 3THWA 1G1MA 2ZE8A 3RSOA 1NLYA 4MRRA 3THOA 4CEHA 2ZU0C 4C0AC 2ZE5A 2QM8A 3OAAD 2QAGA 5JJLA 1U90A 3SHFA 2XTZA 5AUNB 2DFTA 4TTRA 3AVUA 1UKYA 5LDDC 2GNOA 4HB2A 2WICA 3IIMA 2IYQA 3GEEA 3QXXA 1KKMA 2IS1A 1JNYA 1D6JA 4JVSB 4XWOA 1G291 4AY2A 1VPLA 2YJTD 3VX4A 2RKOA 1DAHA 2RGEA 1E98A 3HR8A 3EZ7A 3QF4A 1XPRA 4P32A 2OBMA 4QHSA 2ZRGA 3IHLA 1T0HB 4LSGA 1A5TA 3U6KA 3AQ4A 4EPRA 4B43A 3QI2A 1Z29A 1CR0A 3W6PA 2FSIA 1XEWX 4M1MA 1RJ9A 3M4YA 4AD8A 3I61A 1XZQA 4EPWA 5FBQB 1AKEA 4PC1A 3PVSA 1K8RA 4A0HA 5KDOA 5EUMA 5H70A 2UZ3A 2JLRA 5IF9A 1S1MA 4GPTA 5L3SB 1ONBA 2CHGA 4OKSA 4D82A 2PMDA 4PHTA 4GP6A 2Z4SA 4G5QA 4JKYA 4M1WA 3RANA 3WYGA 4DCSA 2C2HA 4ACAA 3PCRB 4ESVA 2Z43A 1CS4C 3EPLA 2ZRLA 1A7JA 4JVMA 4JYBA 1LY1A 1JQJC 3SR0A 4A4DA 5GJVC 2ZR9A 3FHOA 1OFIA 2WWWA 3QXCA 3ZLJA 3B9PA 3O8CA 2IXEA 1DG1G 3R20A 4C9BA 5B30A 3PENA 3BE4A 2J3EA 4LJ4A 1PLKA 3OF5A 1HT2E 4QG7A 5F3WB 1E2KA 3K09A 3FMPB 1Q1BA 2WJJA 2QTFA 2IW3A 4V0OA 2D06A 3BFKA 4M1TA 5JWRA 3LRPA 4RCZA 3ZS9A 4LJ9A 4HAYA 5JCPA 3AKYA 2RMKA 3DZ8A 3W9YA 2OV2A 3OIWA 1OB5A 3NBZC 5JSZB 1N5IA 4P3YA 2CVHA 4X8HA 2CCKA 1S4QA 1EFTA 1G20E 4Q7MB 1AGRA 4QC2A 1ZC3A 2E87A 5L8VA 1SULA 2PL3A 1XXHE 4B2PA 5FTMA 1E2QA 1PJRA 3JVVA 3VR6A 1G7SA 1SZPA 1EFUA 1I4TD 1S9DA 1F2TB 1HE8B 1YZUA 3MGCA 4QJ3A 5C1BA 4TZ0A 2W58A 2W2XA 4TT3D 5JLJA 3RRYA 3TQFA 3AKDA 1DOAA 1GVNB 1NN1A 4TN1A 3FGNA 1TUEA 2G77B 1NVWQ 2NO6A 1NKTA 3H2YA 3RNLA 2IYUA 3RS3A 3O8BA 1G3MA 3KJGA 5UKDA 1G8HA 1X6VA 1Z0IA 1U8AA 2J46A 1Z0JA 4QHYA 3A6PC 1NMZA 1JQLB 4NPHA 3U3RA 2R6CA 6Q21A 3NIBA 1E9AA 1FL9A 3LY5A 2WBLC 3KTAB 4IVQA 1E94E 1F2UA 1G3QA 1RVDA 3NHBA 5ANRB 4BECA 4PSAA 1OB2A 2BHRA 2D7CA 4LHVA 3K0CC 5J40A 4BFTA 3MUFA 3QBTA 3QPUA 5KNDA 2R9VA 5A0FA 3NDPA 4DLSA 4YMUA 2FH5B 2EYQA 1FZQA 1KMHA 3IQWA 4CT4B 1FP7A 1OT3A 4BLPA 2OLJA 3MSXA 4PR0A 4Q9IA 4CZ2A 1GTVA 4KITB 3AGQA 3V00A 5FI1B 3W5IA 2W83A 5EE9A 3PJRA 2IS2A 1IQPA 4Q01A 1NN5A 4PAMA 3LXRA 1E9BA 3WYFA 3QKUA 5F9HA 2J0VA 5CYPA 3TSZA 3OESA 3HYTA 1Z6XA 4MYCA 2O0KA 4WW0A 1NLFA 2ATVA 1R7RA 2Q3FA 3SQXA 4R98A 3PEUA 2X19A 2J0SA 2IYRA 1XCPA 3EIEA 5J47A 1MABA 2GCNA 3OIVA 4A2WA 3D6TB 5HE9A 3A8TA 4TLCA 2HLDA 3E5HA 3IEVA 1U0JA 4Q9JA 4Q02A 221PA 1ZD1A 4A0GA 3U61B 5HPYB 3VKWA 1S2MA 1W2GA 2F43A 3A58B 3AKCA 2MSDB 5KU1A 2O8EA 1Y3AA 3B78A 1TQDA 4HZUB 1OYYA 3PUXA 1GG2A 4GOKA 1D2MA 2EFDB 1ZJ6A 2EFEB 4KO8A 4DDTA 2GAAA 2O8FA 1XRJA 3PIRA 3FYHA 3GJ0A 4Q19A 5BW8A 4DLZA 5F9FA 5JCZA 2WJHA 1GILA 5BN4A 4FW9A 1XX6A 3RS4A 3VQTA 1YKSA 1CXZA 1CP2A 3M0EA 4TMXA 4XVUA 3TKLA 4P4SB 2RGDA 5LB4A 5CM8B 4UNRA 4M22A 3THYB 1Z0KA 4JLNA 1LTQA 1T3LA 2C99A 2JJ1D 4M53A 4C0QC 4WAUA 2N1BA 4RZXA 2BVNA 4P0TA 1KO1A 1LVGA 1ZC4A 4TLAA 3C5CA 5H68A 1JI0A 2CNWD 5G3ZA 4LBWA 2IHBA 5EQTA 4TQUS 1P5ZB 3D8BA 3QVVA 2ZS9A 3IO5A 1XP8A 2ZIAA 1IHUA 2JLSA 1OJLA 3LAWA 4F7WA 1R5OA 3MWLA 2GBLA 3UANA 1AA9A 4WXRA 1I2DA 2FZLA 4BPBA 2EFHB 4MKHA 3NEJA 4FMDF 1MV5A 3K70D 2XXAB 4LX0A 4Q4JA 4OJKA 3H86A 1Z6YA 2IYVA 4G1UC 1Y63A 4MRSA 2WWXA 2ZANA 4RZUA 1G5PA 4W5JA 1D9ZA 1MKYA 4HLCA 4D4LA 5SZJA 2ZREA 1WB9A 4C0HA 5BYJA 1EFHA 3GJ8A 1D9XA 1N6NA 3B9QA 3E70C 5BQ5A 2CXXA 4JLVA 4ZI3A 4LJ6A 2B7BA 1RC8A 2PMKA 4IEEA 4B35A 5L3QB 1XPUA 3AM1A 3TQCA 1VCOA 1XDBA 1SVWA 3SE0A 3ZD7A 2PX3A 4QNRA 2FU5C 4PPGA 2CNWA 1Z6GA 5EJEA 2ZI9A 3K9LA 4G3XA 4HLDA 1OH5A 4NCIA 1KAOA 3PV0A 1E4VA 2VP9A 2ZYVX 2ERYA 2CK3D 2JDID 1W46A 3MMPA 4BLTA 1KMQA 3LLUA 4OHZA 1W36D 2OFWA 4A6XA 3QG5A 1Z0DA 3W90A 4B73A 5CB8A 5CYOA 1BIFA 2C95A 1R0ZA 3JVUA 3I8SA 2O52A 4DUGD 2Q3MA 4JKIA 3AGPA 5JJIA 2V54A 3KFXA 4KJZA 4HATA 4LYHA 5FOSA 4EQ6A 2W2TA 4MRPA 3PXGA 3CNOA 4ESHA 4FMBB 5FPYA 3SBDA 1XEFA 3Q5DA 3BH0A 4LCBA 4J0QA 3CWQA 3UK6A 3PUYA 4ZPXA 3A4NA 3ND9A 3ZQ6A 3FWYA 3ZD6A 2A5GA 2OHFA 4IDQA 1IN4A 3BB3A 4OHYA 1ESNA 1KI1A 1CEEA 1O3YA 1VG9B 2BOVA 4BFUA 3GLIB 3VU9A 2BJVA 2QAGC 4BZPA 3BB4A 5G53C 4TTQA 4I1VA 2Z5FA 3HU3A 1A82A 1E2LA 1T5IA 3P1JA 3GJXC 3TVTA 4B3DA 4BFSA 2YWEA 4LI0A 1M8PA 4DIDA 1TEXA 1V43A 4C7OB 5GADl 3H84A 1XZPA 1BMFD 1E1RA 1NIPA 2ODWA 2C78A 3CM0A 3SFVA 2ZRCA 421PA 4NU0A 1AM4D 2A9KA 3PEWA 1AQUA
chains in the Genus database with same CATH superfamily
3CW9A 1BHSA 2J48A 3HKBB 3QQ5A 4H1VA 3A32A 3RK4A 1BOFA 4NP6A 1JJAA 3HSKA 1SQ0A 3FR7A 4IH9A 1LS1A 2IS4A 3QITA 5I8PA 1XDDA 3PGVA 3EY9A 4HO1X 3KQWA 3MJEA 4H3VA 4NLLA 1BXRB 5IK2D 4ZT4A 3IC5A 1V6SA 1VHWA 3WYAA 1M34A 1Z2PX 2IA5A 4NAVA 5TXGA 1NXQA 1P5JA 1JGTA 1P4JA 4XEUA 1QIIA 1ZLYA 1Y1QA 3GCGA 4UU8A 3TZHA 1H85A 4BNWA 5KCZA 5LN1A 2QTVA 2GKSA 4GHWA 4DLXA 4ZK6A 3BJZA 3SM9A 4BATA 2IYEA 4LJKA 2YZ2A 1OBFO 1E1DA 2VDUE 2JLAA 2X4GA 3M9XA 4RK4A 4JFRA 2P2YA 2JIRA 1BXZA 3KYCB 3TM5A 3TZEA 4WZAA 5HK9A 1XTSA 1P4GA 4ZT5A 2GHTA 1W47A 3OQBA 3LYUA 4G97A 4E6EA 4B5KA 4QGHA 1K08A 2BFPA 1QCDA 1QP8A 4WZAE 1BN7A 1QS0A 3LUKA 4D0NA 2B1QA 3CTPA 4OP3A 2JVIA 3B53X 4KPGA 1R4NA 1Z6TA 1TPYA 1CRWG 3KJNA 4JLUA 4XA8A 2IYYA 3TSWA 1GUYA 3EHEA 4C5AA 2DFNA 2Y9MB 4MWSA 1II8A 1WRBA 4NK4A 2XWBF 3ODGA 4L7VA 1N2CA 2JGRA 2Q7OE 3U3OA 4KWHA 4XW2A 2ZBEA 2HMYB 4LXXA 2ZCJA 3M33A 2XDYA 1KPGA 5IM5A 5JAOA 4OM7A 1JVBA 1UWCA 1OXXK 2XWSA 3ANYB 3FFTA 4KLNA 1AKRA 1OC2A 5DMXA 5GM2A 5A06A 4Q16A 1MXFA 3JZMA 1RM5A 3UQYS 1N7JA 2QTHA 1OXUA 10MHA 5DI3B 1QQBA 2R2AA 3M3DA 2O6HA 3UUGA 5C18A 2O7QA 2Q6VA 3O8DA 4AKSA 4QE3A 5CBPB 1SXIA 3AJDA 2XGOA 1L7QA 1HOTA 2PZLA 1MU0A 4MA4A 4XUCA 4BC0A 4KN5A 5ADVA 3MPUA 3M83A 1IVNA 4KLRA 3FG9A 4RJTA 5J4KA 1KI7A 1YL7A 1J70A 2ILVA 3UMSA 1JG2A 4DJTA 1M8FA 5AXAA 3PVZA 1P4AA 1G38A 3A6GA 2WAYA 4ZRDA 1U8FO 3CPJB 4UOEA 1UIMA 1KI4A 4TVOA 4ZYXA 3CUEF 4A82A 1COWA 2CZGA 1RT9A 3MIIA 1KIFA 2YWCA 4IP0A 4E5SA 2AQHA 2XQIA 5IDVA 3V8MA 3OOWA 4P54A 1NHWA 4WWHA 3RVPA 4BE9A 4OL0A 5C32A 3DHEA 3E53A 5E6SA 2P8SA 1AURA 1RABA 2J3LA 3DHYA 3EIUA 4ABYA 8ABPA 3MCZA 3T61A 1X7ZA 1B6SA 4F04A 4IIBA 1FP2A 4ER0A 4BXOA 3WHLA 3DOOA 3DXYA 2WFAA 4OU4A 4P4TA 3ZDCA 1B26A 3FKSD 4N7BA 4QYXA 3ORSA 4BV3A 1ZITA 2GN4A 5KX5A 1I1QB 3UM9A 3E81A 3C8MA 2DOKA 1HY3A 4J0DA 4EF5A 4FK8A 4RVOA 1IHOA 4JZKA 4LXHA 3FX2A 4ERNA 3AP1A 2O8DA 1K8YB 1GNPA 1D3AA 3JWIA 2RBEA 1YRLA 5JO9A 2NYVA 3BOSA 2AN5A 2PGIA 4MCIA 3PQCA 3EMDA 1G4AE 3L8EA 5DGHA 1ULBA 4PE5B 2GM3A 3IAAA 1LWNA 1PBNA 1PVVA 2IQIA 2PLRA 1XWWA 2Y6UA 3MS4A 5AVTA 1VB5A 1P81A 2VCHA 1NFFA 1T2UA 3EGOA 3QENA 5G02A 5LP6B 3GR6A 2HWUA 5ITZA 2H18A 3ZHTA 3E35A 2AD5A 1U0NA 1W0JD 1E59A 2GPJA 1CJVC 2VUTA 3TE7A 4OMDA 4WLNA 3PDWA 5KDDA 4AMGA 3EVZA 4JFAA 2BRUC 2QX8A 3GFBA 1DHTA 1F06A 2FN4A 2JLXA 4Q1EA 1N78A 4X64B 3TLBA 2H9YA 2DQZA 4JQZA 5K0NA 3WLSA 1FDVA 1MA3A 1OGJA 2AOUA 5K0TA 3V6LA 1H3FA 1DINA 1B0PA 4U6SA 4V38A 5IBCA 5K45A 4TS3A 1TK3A 2ZJ7A 2I76A 5CX4A 3N58A 2WU1A 4NMMA 1HBJA 3RGWS 3CF0A 3RRZA 2COKA 2IBMA 1B6TA 1JB9A 3DEAA 5DSXA 3SR4A 1WZNA 1MO5A 1FNDA 4ITRC 3R5KA 3MERA 5M7EA 3GMIA 4BX9A 2SKEA 3U7QB 4F4DA 5CA1A 5CFNA 4M0KA 2ZR7A 3AM5A 3O38A 1CLUA 1KBZA 1Z3IX 2I22A 4IDFA 5F76A 3QOXA 3IQFA 5T4FA 3RWBA 2P9FA 1Q3KA 1Q7TA 1S2IA 1VMIA 2MYNA 2INGX 2WE7A 4JAVC 4KWTA 4QODA 1R00A 4ZEVA 5CHYA 1FFYA 2PD4A 1V11A 2A0UA 5LOVA 4KXUA 1FE8A 4MAMA 4BLRA 5JQGB 5ERXA 3T1YB 1CHNA 4ZDJA 2AEEA 1LK0A 3HACA 1B93A 5AESA 2XMRA 2Y1OA 4M9ZA 2JD2A 3OQPA 4G1FA 3HY3A 5EJIA 2AFHA 4PFSA 5CTJA 1H1LB 3W4IA 2I1VB 3GEHA 3P26A 3N2GB 4OD0A 2RHMA 3WOVA 1X94A 3IAS6 1GZ7A 2W71A 4OQYA 3DVLA 1KP9A 3QVLA 4YP1A 4WESA 4U02A 4AM8A 2IXGA 4CYMA 4N3AA 2IIVA 1RAGA 4PIPA 4DCNA 3JU3A 4S0XA 1F0PA 3G9UA 1W49A 1EDEA 3NOOA 3B5JA 5TR9A 4F6LA 3QEJA 5K0LA 5EQFA 3IP7A 5A5EA 3EZ6A 4OYRA 1GLVA 5AKXA 1VZ3A 2KPOA 2Q2VA 3W3AA 2LE0A 3AEXA 4A0RA 1RJDA 4F5EA 1IFXA 5IKXA 3ZGYA 1IVSA 1S8AA 2PA3A 4H4EA 4OYYA 3WLKX 5JNTA 4G25A 5L6LB 4KH0A 5FPHA 2VNAA 3PRHA 5EYPB 2GBLC 1KDRA 1P7YA 2B1JA 2GFIA 3BWVA 5JCOA 1A5ZA 4AG5A 4E7PA 1UJNA 5AW3A 1DMRA 1KO7A 1TQ8A 1VSUA 3V9PA 2O2EA 3JZAA 5CIWA 3V5NA 4TS1A 4KL8S 5H9VA 5BWMA 5ER9A 2J9FB 3LMKA 3OJEA 5I7WA 1WF6A 1YA4A 3MRVA 621PA 5IASA 2DLCX 3J7AC 1V2HE 4LZAA 4GI5A 5KPDA 2PZAA 4IDGA 2PUEA 2HSJA 5ALIA 5B3KA 1YT5A 2IUEA 4R71A 2YFHA 4BGVA 1WUHS 4H60A 3GEBA 4O2AB 4XJTA 4CLDA 1NXXA 1XBTA 3WIEA 3VHLB 3LLVA 3IJ5A 2QLJA 4Y2HA 1HFWA 3RVKA 2B98A 3O95A 3KSMA 2OP1A 3S1LA 5BMOA 2PMWB 3QEAZ 3VOTA 2OESA 2IE8A 1Q1ZA 1TYEB 4CJXA 5JSZA 2EJTA 3DKIA 4M8SA 4X61A 4JROA 1NL3A 4HY3A 1Q0QA 2BC9A 3Q72A 5TDHA 2G4LA 4JC4A 4EJ6A 3K4HA 4D0RA 5I8WA 4YCSA 2HUPA 3GCZA 3T1TA 1AN0A 3SEQA 2DPYA 2C3MA 3E6AA 4FD3A 4UHHA 3V2HA 4EJSC 1DEAA 3T1OA 5JARA 4HGPA 5L7WA 3QWFA 2Z6AA 3FOBA 2O5RA 3AR7A 1ISMA 3QPCA 4YMLA 4R6XA 3PGLA 4F84A 3ONWA 3SOPA 4M46A 3WL7A 3EASA 3HRIA 3SS8A 4DLTA 3EG9A 3FUXA 2ENWA 1LDEA 1GCOA 4FN5A 3GGSA 4R2MA 2ZBRA 4Q82A 4E5UA 5C4IA 5JC8A 3PGXA 4AC9A 3VAAA 5HUQA 1M0TA 2PE5A 3K70C 3L6UA 3N86A 1L9KA 2OCDA 4YBZA 9ABPA 3VOSA 1JLRA 3EBPA 1P9LA 4HG2A 1OGIA 5BW4A 1FVFA 1J7JA 2QAIA 1NQUA 4GE3A 3INRA 3B12A 4HWSA 1JU9A 1P73A 1OY1A 1SURA 2B3DA 3THRA 3HCBA 4EY7A 4MO2A 2G07A 4R1QA 5G40A 4AKTA 4D4GA 1ZNXA 3NFYA 4EOGA 3REFA 1RADA 3LCCA 4N82A 4YROA 3VPFA 4DTCA 3GZNA 4URVR 2Y71A 1ZGZA 1AO0A 4HGZA 2QX9A 2VAVA 1ZN7A 1WNTA 1NFRA 3DMGA 3A9CA 4DEYA 3S44A 1EFVB 2CLLB 4E2WA 2WWHA 2DEUA 2OORC 3B5EA 3CX4A 2AR9A 2FSVC 1QVRA 3HN7A 4WBSA 4Z2YA 3CLHA 4BOYA 2MYTA 3HYNA 3UKJA 3OE1A 2GM5A 2X0IA 2OO7A 3CUYA 5FJIA 3EZFA 3U80A 2BFCB 1EPUA 2H52A 2B8WA 5EJGA 3RVOA 3W8EA 1LX6A 3KVOA 3TN7A 3WQSB 5HNKA 1F8GA 3UHJA 2QU8A 2GMWA 1NVVR 3WGLA 1VSTA 1DJLA 1TNDA 3R3JA 4OBBA 3ANLA 4LDQA 1ZMXA 1RWQA 2O07A 3ZJ5A 4ARZB 5ESRA 1BO6A 1U0SY 1KA9H 3ONNA 3PUKA 2IYPA 3PKJA 1JAYA 3UATA 5BUQA 2QJRA 5T57A 2K2QB 2OXCA 5EIHA 1REQA 3ETCA 3VUEA 3NBUA 2C2MA 1NXTA 3NI2A 5DASA 1GNRA 2GJAA 3IBGA 2CZCA 2JHCA 3CRVA 4LISA 2G9NA 3L2OB 3WRVA 3CNQS 4WA7A 1X14A 4X95A 3GFSA 4OHPA 2NTJA 4NMWA 1LSSA 4LHXA 1H0KA 5CLLA 1XEWY 4DR1B 3QVOA 3GA5A 5G0UA 1EFAA 3DEHA 3LHDA 1GDTA 4ZVVA 4NFHA 1YZYA 4RWEA 3BILA 3PC4A 1ZFNA 2V7QA 4KRXA 5KDLA 3LTNC 3I62A 2X6QA 2Q5EA 4JBNA 3AYXB 1W94A 1R8YA 1Y8AA 3UJHA 1SD2A 1TIPA 5DHRA 3IP6A 4C7XA 4EW3A 2YFYA 3RYIB 1E4EA 2VA9A 3G5MA 4PSKA 3K0AB 1K1EA 4LOAA 2Y8EA 4F5DA 1NQXA 4UAJA 3EGDA 4PYOA 4RTPA 1Y3HA 2H06A 1RZ3A 3GCDA 4EH1A 4ZYVA 4CKCB 2YV2A 2ZAGA 3EWSA 4TMWA 4W9NA 1H2XA 3D7RA 4YAOA 2VCYA 5DBGA 5KNDD 3IEMA 5KIAA 2D2FA 1NLUA 4NATA 4Q12A 3QLJA 1IY1A 1U5BB 3KK0A 5BPHA 1Q2XA 3IGFA 3ONDA 3C24A 1RZVA 1ZCJA 1FF9A 2YBDA 4FLMA 3DYBA 1J07A 1VL1A 4H0NA 1O97C 4J90A 4MW1A 5HIJA 1L1FA 4IF4A 4J16C 5CAEB 3A4TA 3QBVA 1FUEA 1P0CA 4KRYA 3T7RA 4OIFA 1J1UA 3IDFA 1XFAA 3NT2A 3JQ6A 1Q20A 4BFLA 1GRCA 1OASA 4KYIB 1DKUA 3LBNA 1JDNA 2ADMA 4WKPA 3O9VA 5LVAA 3E1SA 4KAJA 1DJNA 1WCIB 2OTCA 3NV7A 3OIFA 5BSVA 4HHEA 1XAGA 1P0FA 3EXG2 4G24A 2FJUA 4LE1A 4L22A 1EB9A 4UCWA 5BNZA 4E31A 4WV3A 4E2FA 1Q95A 2VJCA 1M2FA 1N5JA 2NPOA 3R6TA 2VYVD 4HMQA 2M2IA 4N4AA 4OF4A 5E1OA 5SYMA 4C6TA 1VLQA 1PR2A 2W42A 4RIIA 4ZAYA 4UVHA 1XL0A 2VP0A 3OFKA 4YJGB 3A36A 1W2HA 2Y1FA 4EKNB 2X7HA 2QJOA 3BRWD 1KDZA 1J5XA 3M4ZA 1GSIA 1MQ8B 3JZFA 5TRTA 4IIJF 1SR8A 3FPEA 4W5HA 1X1RA 5AJWA 3N2EA 3TIVA 3BTUA 5L3QA 2AV6A 1PL0A 5DM1A 1BX3A 5ALVA 5FLXA 4MW0A 1NVKA 1XN1A 1KI3A 4KO4S 2Q3JA 3R6LA 3TE6A 4AO6A 5ED0A 5CB4B 5CFPA 4PZUA 5DF1A 3AUXA 2PX4A 5BY2A 4TS9A 3IE1A 3ND8A 5ULLA 1T35A 2VL7A 1JIJA 1T8RA 1G19A 2WIAA 4KGZA 4C2BA 2XCLA 4E1AA 2FP4A 3PT9A 2BONA 2X1VA 1DJQA 1VLMA 3FCYA 5EZSA 3E8SA 3MQ2A 3KUKA 2BGTA 2SNIE 3OPVA 2PAFA 3NHYA 2ZTSA 4HB0A 5FLEX 1LDNA 3PDIA 5JD5A 1XALA 3GI1A 1G9XA 1Z13A 3FAZA 4B3IA 4CMHA 4CMEC 4DSAA 5E6RB 2O5CA 3SSNA 4NDZA 1KYWA 3T0GA 2JAXA 1D4OA 1P17A 2A1TS 3RSSA 3VR2A 4EL0A 2PUBA 5JAIA 3BFXA 2X5KO 3HGTA 3WLLA 2SCUA 3EC2A 4IUCS 4OQDA 1T4DA 4F1JA 1RNLA 5JAHA 1IUPA 3ZGXA 1PRYA 4JR1A 4HNVA 2XVMA 1TLFA 5LJIA 1PT7A 1XPJA 2D5CA 4EY3A 1ZGGA 1YMVA 1OUMA 1TKBA 1U81A 2PO7A 4L3WA 3C6KA 2NQTA 4YXFA 3EVAA 5BQPA 1CBUA 4I1PA 4QGFA 2JIZD 3OQ6A 5CB6A 1K5GA 4URZR 2YVQA 1VJ5A 1UWVA 4LBVA 3DTVB 4PZYA 5FEMA 1USIA 2ZWPA 3GLIA 4DSOA 1O0SA 2J9GA 3OFND 1U94A 2C7BA 2HO4A 3CINA 3K0HA 1KIMA 3T3GA 3CN7A 4IUDS 3TOZA 4WBNB 1SHZA 1CZOA 5EJ6A 5KNBH 3VKGA 3D7KA 1PDOA 1RACA 2W6IA 2ZRMA 3FCUB 1WHSB 3IP5A 1G5TA 3UYLA 4P3OA 3WMRA 3BG5A 1HR0B 1Z7WA 2HF7A 2JHGA 3CB4A 4RVFA 4DXAA 3DAGA 2EKZA 3B60A 4IZ6A 3HB1A 4K03A 2DZDA 4N6GA 2C0CA 3RLFA 2WU3A 3DGFC 3RJ9A 2IEGA 3FSJX 3CF2A 1AGPA 1CF2O 1CRZA 4MCJA 4P4UA 4FDVA 4MGHA 3RJMA 4TLBA 3S8EA 2CL6X 2Z8YM 2NP6A 4UASA 4YP9A 3V1KA 2VJLA 1D4FA 4E12A 4OUDB 3B82A 2I1LA 2QY9A 3HBNA 2DYKA 4JJKA 2BISA 4LGVA 4XYMA 4MQ5A 2C9DA 4K9PA 4TPKA 5KTNA 3U1BA 4K81B 5ARDA 1BXRA 4D9IA 1ZVMA 3Q10A 2ZSJA 4UBNA 2DLDA 5BSUA 1IXRC 4A73A 4LVOA 2R7KA 2VKQA 3CLRD 4RACA 2CLEB 1R3DA 4BLSA 4URHA 3PU6A 1T25A 4LGYA 4M54A 1O94A 4NG5A 1TAGA 2JASA 1L4LA 2J5BA 4CIAA 3C8UA 1I6WA 1XKQA 1CB7A 4F9TA 2FZ5A 4TSKA 3WX0A 4TLLB 1ZEJA 3SC2A 1CP3A 4CPDA 2C4UA 3ESDA 1CZLA 1XZCA 5L4SA 3WGZA 2P78A 3NH6A 1AXRA 3D64A 4XWTA 4Y0NA 5LQMA 3HR7A 4XDHA 3QXGA 3UY4A 4BBPA 2VPYA 3M1AA 2HLPA 5E9QA 2Z4TA 2GVZC 1Y6JA 3R6WA 5JCOC 1ZL2A 2XEDA 5BN1A 3CRW1 4JB3A 4QBTA 4LRTB 4IIUA 3QMVA 2NV2B 4F92B 2F1JA 3UZUA 1Q7EA 4XGRA 5E4JA 4RADA 3SYTA 3UJAA 1NVBA 4FS8A 3ZWPA 1LC3A 1OX4B 1P60A 2QLLA 1U0TA 4BNJA 2IRWA 4KTTE 3TOCA 3IBCA 4UUAA 5LD2C 1MNQA 3PFGA 1FJXA 2WU8A 1A9OA 1L4YA 4U7PB 2QL6A 3C7DB 2YVLA 2OO5C 3QVWA 1ULHA 1X1EA 1XTKA 2EX1A 2YV5A 3COVA 3B6JA 3BGDA 3MAAC 4TGLA 3F2IA 3FCAA 4OREX 5DI3A 2FW1A 1EWYA 1YJCA 5JYCA 1U0FA 2VPPA 1H3EA 1Z4IA 2ON6A 1L4BA 2QOEA 4JNKA 1Q84A 5CBPA 4QZVA 1SXQA 4C2AA 3KBBA 1IJBA 2A9OA 3LWDA 2GN8A 1LLQA 3PQEA 4NBNA 5FAXA 1Q21A 3STYA 2NVWA 1JLMA 3B1FA 2PNJA 4A9AA 1TM5E 1JKJA 3OKAA 4K7JA 2A3RA 2F64A 4JKOA 5J2TA 3MGKA 1SIUA 3T3EA 4RTRA 3A1SA 2Z9BA 3L0PA 3IV9A 3RGGA 1Y3DE 1A5SB 4EG0A 3IJRA 4RK7A 2XT9A 3A26A 3KQLA 2HRCA 3RW9A 1TF7A 1Q3HA 5G0WA 2GN0A 4GRIA 1KVUA 3H5TA 4B40A 5JV5A 1NC3A 1PBTA 1YUMA 3DBVO 4LUCA 5TEWA 2WKWA 3V42A 1AUVA 1VG1A 5JMPA 4QO7A 1JHRA 4MR8B 2W2LA 3ZNOA 4DLAA 4I99A 4Z9AA 2BEWB 2NTYC 3QVJA 5KTOA 2PUJA 1UMBB 1ZN2A 2OZKA 4EGQA 3IELA 4PANA 5BV7A 3VSCA 1NVUQ 2JGAA 3P9RA 1S9HA 4GPIB 3RJTA 3B7PA 4EHLA 1QSGA 1NR7A 5FR2A 1EP2B 1QLJA 3HFJA 1O5IA 4UVEA 3FROA 5HBGA 4B74A 1OFHA 5CLFA 1GZ4A 2OC9A 3DF7A 1I4LD 3M1LA 5H02A 4MWDA 5DOZA 4B31A 3WGUA 4LDNA 4I9UA 1I0LA 2XGSA 4LHZA 2BJHA 4HB4A 1A50B 2HD4A 3Q0IA 3LFTA 5C0OE 2G0NA 5HFAA 1JNXX 1JEJA 1OXBB 3G2NA 3U39A 1DT3A 4BE4A 1XGKA 4JQSA 2YXLA 4B8ZA 4MEAA 3P8ZA 4ZVKA 4NEHB 1CW2B 3D6VA 4K40A 1Q7RA 3L8GA 4IOMA 2XT0A 1AX9A 2YWBA 1D1PA 2HQBA 1L3CA 2ODNA 1RHUA 1KP3A 5KI6A 2QR2A 1ZHHA 3A6KA 4DB4A 2ID8A 3OLQA 1T6NA 2QWXA 2Y99A 1SU6A 1PK8A 3EDQA 3OX2A 4AP6A 3TNYA 3IQHX 2CMKA 2B35A 5LP6A 9ATCA 2IPAB 1VTKA 3LPLA 5EXSA 1EESA 4YP5A 3NTOA 1RZRD 3WLHA 3HVHA 4EARA 4P81A 4FSDA 4B4DA 3II6X 4JI6B 1YQQA 3LO5A 2OCXA 1RRMA 3HJUA 2J3JA 4GLFA 4B83A 1B41A 4E4YA 4X54A 4EFMA 4NONA 5JRZA 5KVVA 4ML3A 3RRBA 1NF9A 1H66A 1L5HA 2PXAA 4F4FA 1JR3E 1GV1A 4ZQFA 4R01A 1UBNA 4TKZA 2ODBA 4Z0HO 5I4IA 1ADGA 2FUNB 3OQNA 1T1IA 3SJAA 4CN9A 4ZOAA 3OKFA 1O6BA 3MTQA 3A6ZA 2PYIA 3G79A 1QV6A 5EP2A 2FZGA 4BZXA 1S8FA 1N6LA 3AZPA 3GMTA 4MYHA 5C8VA 2GASA 4I9NA 4KDEA 4B4OA 1SELA 4F9EA 4RSMA 4IXWA 1G8PA 1M8KA 2UUPA 4S35A 4KBFA 4UUMA 4XOUA 2VDVE 5CB0A 1Z56C 1G8KA 5FOVA 1L5RA 2YHUA 2I67A 2B8NA 5EHQA 4HJXA 4ZAFA 4OJYA 2OV4A 3ZDAA 5MN6A 5CVVA 3MWDA 2XVYA 1A9RA 4XSGA 2GYUA 3H9UA 3PR1A 3T4EA 5JQGA 2C7QA 3G6WA 4YEDA 4FC7A 4FYWA 2R79A 2CJWB 2YXDA 4P33A 4R2HA 4LTNA 2GFQA 1KQGA 1SG6A 2FGJA 3U4MA 3ABSB 1Q44A 2CMGA 2YVUA 5LMZA 3NT4A 5K05A 1WS6A 5DBHX 3N2GA 2OCGA 2ZWMA 4MV7A 1Z73A 1N2XA 3JQGB 1FPMA 1WUYA 2BD0A 1MA0A 4MTCA 4DLBA 2FG7C 5DEOA 3KDAA 1CC1S 2Y1KA 3BXEA 4ILKA 5BYAA 3DLPX 3JTMA 2JAQA 4FVTA 4YCLA 3EVCA 3EIXA 3HFGA 5NULA 2JK0A 1OHHD 1FLAA 1U9IA 2H2AA 3N2YA 4LRXA 1E63A 2J59A 2RH8A 1EZZA 3A05A 2C3PA 3Q9UA 5F1KA 2O23A 2R8RA 1RHKA 3KJHA 3CEJA 1N2GA 3NM4A 4MPPA 4E4TA 3L82B 4PTLA 4XYEA 1EFRA 4ZAZA 3GLGA 1FXUA 4H1TA 3L7NA 2PU5A 3T35A 4BNVA 4ZMSA 2GDJA 4B71A 5KOJB 5EIWA 2JFOA 4ARIA 4XM0A 4GF5A 1M1UA 3GUUA 4RZIA 2UAGA 2BGMA 4W1RA 1U2DA 4WQMA 1YE3A 1XL1A 1O6ZA 4EPTA 1PG5A 1H2AS 4Z4QA 2I2FA 1EWRA 3S2ZA 4P8RA 4A03A 1CUUA 4IVRA 1U2EA 4IDOA 2XQFA 3ESBA 4ZO6A 3HJAA 4OBXA 3W9BA 1QIGA 3OM9A 4LDJA 4UNQA 4DA7A 3LHSA 2BIFA 4JXJA 5BSRA 5KYXB 4HNGA 4DNOA 4Y18A 4O2AA 2IUYA 3R8XA 5K99A 2PRZA 5K3OA 1H65A 2DG2A 2JRCA 1O08A 2P5TB 1L7OA 2WFZA 3G2MA 4E3ZA 5HR5A 1E32A 2FWNA 1WHTB 2J5XA 1GFWA 1Z7EA 1B6GA 2AJLI 4ZZ0A 1QTRA 3DDNA 4QPDA 1ZOSA 2FG5A 5HCNA 2HCFA 1YZTA 3NAZA 1E7SA 3IB6A 1HYHA 1LZLA 3AEYA 5H3CA 3G89A 5JU6A 1X74A 3EGEA 4M1KA 2R7LA 3ISTA 1C41A 1SCUB 4JQCA 4QLBA 5BUSA 3G5UA 4TYWA 3FA2A 4ABTA 1VI6A 1DQPA 2QPLA 4KBYA 4IIGA 2Z4RA 4ENWA 2ZAMA 2HDOA 2KSQA 3F4BA 4MKXA 2AKAB 2DQSA 2BUBA 2PD3A 1YCDA 3NUQA 3EEQA 3L5KA 4IS3A 3K0SA 3GLTA 4I4NA 2UUCB 5F2KA 4NBUA 1KPHA 4JR0A 3S29A 4ANFA 3MMZA 2H8KA 5LA6B 1RR6A 3CX3A 2D8AA 3N3BC 2HIGA 1PV2A 4X00A 2IELA 4YXWA 1QHFA 2C7PA 5I45A 2OSBA 4CXMA 4L8FA 3COJA 3ROKA 3IIJA 5B1DA 3BXPA 4NNJA 1LNQA 1XVIA 3M4XA 1T9CA 3DC7A 2J87A 1OX6A 4BMNA 1WL8A 1KL7A 3RFFA 1XZDA 3L04A 3Q7TA 5F7ZA 4B0OA 2POCA 1ICIA 4OXRA 5BW6B 5KWEA 2CE7A 3NBQA 2I66A 1L7BA 3QKSB 2HMAA 3Q4GA 4PPQA 1R0WA 5CFLA 1RWVA 1Z0UA 4PNHA 1QOQB 5HJ2A 4LFBB 2BMVA 4ZOLF 1EFVA 3FTEA 3I9V1 1K06A 4WK0B 1Z12A 3L7IA 5HIIA 2Q99A 2BZ0A 2K87A 3PTZA 2XRYA 3WQBA 1MD9A 4WOKA 2GD6A 5CUQA 3RC3A 3X44A 3SP1A 1ECFA 2QTRA 5C3UA 4J1QA 5DHQA 3UJ9A 3B1KA 1LQUA 1LPAB 2BFCA 2PZMA 4GQAA 1P80A 3H9EO 4ZXPA 2DSNA 1GUDA 1K75A 1SNYA 2AYXA 1IXZA 3GRAA 3FJYA 5E4FA 1ZD9A 5SYNA 1ZGCA 4MVJD 2Z8ZA 1QHHB 1T9DA 4X92A 3DAFA 3WA7A 4EIWA 2DBZA 1C7RA 1DC5A 1EVZA 1YR9A 4NJMB 1KI9A 3O8OB 3DG9A 4PFJA 3H3JA 3OLXA 4WERA 5JFOA 3EA5A 3H11A 1NUAA 4B3FX 5CXUA 1I7DA 1XHFA 1T2CA 3H9BA 5SY9A 5EWMA 1C0KA 5KWVA 4FDTA 2VSQA 3AF1A 4I9FA 3D8TA 1YQ9A 2PVPA 5CFQA 1YC2A 3IPXA 4N8SA 2JGKA 3UHOA 4D6YA 2GXAA 3VH1A 2RAFA 3W2GA 3PUVA 1NYRA 4G81A 3U44B 1QLWA 1W4BA 2OVFA 4XASA 1S7CA 4HQOA 2L18A 4Y2PA 2TMYA 2BHTA 2HJWA 1C8KA 4HQ6A 4G1EB 4XRGA 3L7LA 4URFA 4E5DA 5FA6A 3JCZA 5J4YA 1LI5A 3AFHA 1JDTA 3SMVA 1T13A 4TRNA 1A71A 2FNAA 4X60A 1O94C 2C5EA 1ACLA 2AW3A 4ZQEA 3L6DA 4FQ5A 1F2DA 4CHGA 2AMLA 1DQRA 3A3PA 2KMLA 1X87A 2UZAA 3O1IC 1U2GA 3A6JA 4J3NA 3G8DA 3KB2A 2OUIA 3GYBA 3TQTA 3RYIA 4Z51A 1J0XO 2LCFA 3ENQA 4GX2A 4F1KA 3QPBA 2PRJA 3F2VA 4CLRB 1KU0A 3K0AA 1N2HA 4QDXA 3W78A 1RKUA 4PG8A 1LBQA 3CY6A 1DAIA 5ERYA 4RLFA 4WY2A 5DH9A 5LQCA 4DRYA 4W4TA 3H42B 3NAGA 3PC8A 4CKCA 4Y7CA 5IFKA 2JVJA 3GFFA 3W6OA 2QPTA 1DZIA 4W99A 3RS8A 5GZ3A 2ZJ4A 3NWOA 1WSWA 4KX3A 2P41A 3IR6A 2ECPA 1MJNA 3ZV7A 4BNGA 1THTA 4N6NA 2DPMA 2OG1A 5C81A 4A26A 1J97A 2K2WA 4E88A 1DEKA 1GGNA 3LX5A 3LGSA 3USCS 2JJ2A 1E2BA 1KNXA 2C9ZA 2R97A 4JYMA 3C4JA 3EVBA 4O2BB 1W2WB 3FHLA 2NO7A 1GUZA 1ODFA 1VI5A 1IK4A 2RI0A 3GUVA 1YB1A 1Q0RA 3NBAA 1M74A 4ENVA 5JH7F 3L4BA 2FA9A 4XD7A 1AXGA 2JLYA 3OEED 2YNMD 3EH1A 4WKNA 1WCIA 2JCBA 4DG9A 1NSFA 4UM8B 4EFKA 5AJXA 3FBGA 4NJEA 3ZY2A 2XQKA 4HZIA 2JFXA 2OSVA 3ETDA 2R5NA 4M76B 5AVYA 3MELA 1QGAA 4Z3OA 2Q3HA 4BP3A 2G67A 4AQYB 4HYEA 3PHCA 4HNAB 4DFDA 1G8SA 2XHZA 1H2BA 1ADJA 3KG2A 4IICA 5CRIA 5A71A 3WL4A 4QD3A 4FI3C 1UAAA 4YJGA 1G5HA 3T15A 4N03A 4RKFA 4X65B 3I1IA 5I9IA 1CQWA 1PYOA 3T3HA 5A3VA 3KQKA 3WK9A 4QXAA 3W7VA 5KOIA 3QU5A 4BO8A 1G8MA 3NVMB 4UDXX 5F64A 3OZVA 3GFQA 3GLRA 3CT6A 4PPFA 3DDUA 5JSUA 4PX5A 1YRBA 3PWZA 3SC3A 1RQPA 4U7WA 3TMYA 4DY6A 5HF9A 4AJIA 3IIEA 1KH3A 1KI6B 2VA8A 4HWGA 1DKMA 4CM8A 1Z37A 3W8RA 3ADDA 1DAKA 2UVQA 3VJMA 1Y8RB 3D9QX 4BMOB 1TIKA 4UU1A 5LZ9A 5C34B 1FSFA 4NBWA 2W6JD 1OI4A 4KXFB 4OI1A 3BMXA 4C4TA 4LXYA 5A5VA 1N77A 5LQAA 1QX4A 5TMDA 3VR6H 3UB2A 4F06A 3HLKA 2ZRKA 2PMFA 5DFAA 3UWOA 4JCOA 2WPDA 3PTLA 1AE1A 1L5OA 3O3MB 1R4MB 3QE2A 1G6KA 4LYGA 2OCPA 3MD0A 2CMDA 3F7TA 4MYTA 4WD3A 4MEJA 4OVKA 3RFTA 3IAHA 3GHHA 3M82A 3KFLA 2QX4A 2GBIA 2HR1A 3BQ9A 3ZCRA 1OIXA 5DGDA 1RLUA 4I4TB 5E6RA 4ADSG 4DC9A 1F6BA 3GQBB 1M1XB 2IIBA 2ZYAA 4UZEA 1Q50A 3CEAA 1C4KA 3DBOB 1M2OB 2XXBA 1JLLA 3C8DA 5JRJA 4EB6B 2YZMA 5DN6D 5K8VA 2R44A 1EE9A 4AWBA 4R9UC 1VPDA 3EJ6A 1VE7A 4O4JF 5JLAA 2BMEA 3FSGD 3RO7A 2X9QA 1QPZA 1KOJA 1SOWA 3CF6R 4HZUA 1N5KA 4OEHA 1Z0ZA 3EGCA 3EVGA 3TLMA 2VUIB 3LCVB 4HQRA 2HSZA 2CNBA 4ZODA 1AQYA 3P2MA 2EEZA 3AOEA 3AHCA 4ICIA 3PC2A 1JDZA 4MV1A 4O1HA 5IM4A 2YMQA 2CHUA 3KZ1E 1YD7A 4DJFC 3Q6IA 2CF6A 3I04M 1W25A 1ONOA 4IIVA 1HLDA 3FMGA 3IBTA 3V1YA 5LQSA 2IYZA 4FNMA 3ZX5A 5JNWA 5EINA 2HK6A 2VWPA 1TM2A 4EM6A 121PA 1CUIA 2VHVA 2I0FA 4DJDC 5DNUA 1MB9A 1IBRA 2GJKA 3EYWA 4WBNA 2JI4A 4WIAA 2EOAA 4I50B 4ZAWA 4K6CA 3DOUA 2BH2A 3CGWA 1WHSA 1PWYE 3AEKB 3VNUA 2I65A 2NV6A 2YV3A 1VL0A 3GEIA 5CT8A 4CL8A 1G16A 2NQ2C 2HYIC 1DELA 2A5DA 1GRQA 5HGJA 2EZTA 2Q07A 3GGCA 5IT9A 4ZXFA 3GEMA 4JX9A 5DYYA 2IXTA 1HEUA 2O9JA 1LNZA 4N40A 4ZD6A 3SJUA 3ZBTA 5L7TA 5BW5A 1H2FA 3HZZA 1O87A 4MTLA 1N6RA 3JTEA 4OK6A 4A16A 1P3JA 1Z08A 5ITVA 3SC4A 5AM5A 4XVCA 4QGSA 4NXNB 3EEYA 1VOTA 4U5XA 4YRZA 4FFBB 1MAVA 4KR3A 1KY3A 2GPTA 4Z4CA 4OGGA 3VVMA 3ZLTA 4C6SA 3SJCA 2R84A 2R47A 5AD1A 4L2IA 4MGEA 1IM5A 2NTNA 1DHRA 1V26A 1R8SA 2XX3A 1F3OA 3BD9A 4AF7A 4HUQB 1CQZA 3C5EA 1EFLA 2HCRA 3PRKE 3MT8A 1XQWA 2XF2A 2LW7A 3AR3A 3FCOA 1NI3A 4HH1A 4QICA 4I1RA 1QO0A 3PJDA 1PHPA 1U9IC 2A57A 4M8NE 4P7KA 2K7FA 4N1AA 4AMUA 5CB4F 1L1QA 2WA1A 3ZWDA 1BWSA 4H1HA 3BCSA 4WMLA 4KOEC 5KO2A 3FRHA 2B8JA 3CF4A 2PV7A 2VDJA 4UVIA 3ROXA 4AULA 3Q41A 3SF8A 2V7XA 2C9BA 4D4MA 4E08A 5BWNA 2VAXA 2G0TA 4HXGA 1T2NA 5FTKA 1V3QE 4LXQA 5B2ZA 1THZA 2AN1A 1U2DC 2PDAA 3ND7A 4KLCA 3L79A 1IHDA 4P53A 2VHQA 4Q1AA 4FFWA 1OFUA 3DCNA 2H5IA 4BY9E 1OX4A 5K3SA 4M0EA 1H8ED 1HYQA 3ICWA 1ZGBA 2ISQA 2FLWA 4FDLA 5HTOA 4RJLA 1KP2A 2W2OA 3GUHA 3JYNA 3VYUB 1XLVA 1UUFA 2B4KA 3NOXA 2FSSA 3SZ3A 2GS9A 5CHEA 2Q0SA 1ENOA 2V59A 4OCZA 3G1TA 3ZUPA 5D85A 2ZRNA 3OCXA 3AHFA 1T34A 2QJWA 4L4XA 1XLUA 5CK5A 3BXGA 3KZXA 4RPIA 1SG9A 2QNIA 5KQMA 2R8BA 4GPAA 2G1AA 3TF5A 5HW0A 5KKAA 3LQ4A 1EA5A 2IHUA 4OYHA 4X7MA 3PJFA 2UUBB 3AEQB 3S2GA 1MIHA 2O4CA 4RJIA 1EBBA 2H85A 4HQLA 3AY7A 1J0BA 3KWMA 5CDUA 5K8TA 3OE7D 3F6RA 3LHIA 2ZDHA 1N5LA 1P9WA 2Q9UA 4IXDA 1KDYA 1U6JA 1QRDA 2B0CA 4L5JA 5KAMA 3H2HA 5BQFA 5C53B 3SQWA 3V4RA 2FPLA 3HTXA 3AI7A 1FS6A 1ODKA 4ZGWA 5BSFA 1ULAA 2V45A 1XD9A 4UE6A 3GD7A 4V0KA 4GMKA 5B64A 2AKEA 1KEPA 1T15A 2H29A