4DM5A

Putative osmotically inducible lipoprotein osme characterization by xray crystallography
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
b'PVNYITFRNEPLVKDVEKGMSQQEVLRIGGTPSGTQKRLMKPGSCNSYILNKDGQQQPFYVSFDGSGKVDGSGFLSCSELDRHERDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osmotically inducible lipoprotein OsmE
publication title Putative Osmotically inducible lipoprotein OsmE characterization by Xray crystallography
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Unknown function
total genus 20
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 4dm5A00
2G2WB 2YH9A 5D0OE 3GMUB 3C7VB 1S0WC 5EKQE 5AYWE 1XXMC 3E2LC 5D0QE 4DM5A 2KXXA 3C4PB 1JTGB 3C7UB 3D4EA 3C4OB 2G2UB 2PXGA 2KM7A 3N4IB 3E2KC 2B5RC
chains in the Genus database with same CATH superfamily
2G2WB 2YH9A 5D0OE 3GMUB 3C7VB 3FVCA 1S0WC 5EKQE 5AYWE 1XXMC 3E2LC 5D0QE 4DM5A 2KXXA 3C4PB 1JTGB 3NWAA 3C7UB 3NWFA 3D4EA 4HSIA 3NWDA 3C4OB 3NW8A 4L1RA 2GUMA 2G2UB 2PXGA 2KM7A 3N4IB 3E2KC 2B5RC
chains in the Genus database with same CATH topology
2G2WB 2YH9A 5D0OE 3GMUB 3C7VB 3FVCA 1S0WC 5EKQE 5AYWE 1XXMC 3E2LC 5D0QE 4DM5A 2KXXA 3C4PB 1JTGB 3NWAA 3C7UB 3NWFA 3D4EA 4HSIA 3NWDA 3C4OB 3NW8A 4L1RA 2GUMA 2G2UB 2PXGA 2KM7A 3N4IB 3E2KC 2B5RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2W B;  2YH9 A;  5D0O E;  3GMU B;  3C7V B;  1S0W C;  5EKQ E;  5AYW E;  1XXM C;  3E2L C;  5D0Q E;  4DM5 A;  2KXX A;  3C4P B;  1JTG B;  3C7U B;  3D4E A;  3C4O B;  2G2U B;  2PXG A;  2KM7 A;  3N4I B;  3E2K C;  2B5R C; 
#chains in the Genus database with same CATH topology
 2G2W B;  2YH9 A;  5D0O E;  3GMU B;  3C7V B;  3FVC A;  1S0W C;  5EKQ E;  5AYW E;  1XXM C;  3E2L C;  5D0Q E;  4DM5 A;  2KXX A;  3C4P B;  1JTG B;  3NWA A;  3C7U B;  3NWF A;  3D4E A;  4HSI A;  3NWD A;  3C4O B;  3NW8 A;  4L1R A;  2GUM A;  2G2U B;  2PXG A;  2KM7 A;  3N4I B;  3E2K C;  2B5R C; 
#chains in the Genus database with same CATH homology
 2G2W B;  2YH9 A;  5D0O E;  3GMU B;  3C7V B;  3FVC A;  1S0W C;  5EKQ E;  5AYW E;  1XXM C;  3E2L C;  5D0Q E;  4DM5 A;  2KXX A;  3C4P B;  1JTG B;  3NWA A;  3C7U B;  3NWF A;  3D4E A;  4HSI A;  3NWD A;  3C4O B;  3NW8 A;  4L1R A;  2GUM A;  2G2U B;  2PXG A;  2KM7 A;  3N4I B;  3E2K C;  2B5R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...