4DMCA

Crystal structure of the cftr inhibitory factor cif with the e153q mutation
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the Mechanism of Epoxide Hydrolysis by the Bacterial Virulence Enzyme Cif.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Putative hydrolase
total genus 109
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dmcA01
5CT6A 5CT5A 3R0VA 4G4IA 3N0TA 2J4CA 2IIVA 1A8QA 5CW2A 1TAHA 3G0BA 4DSZA 3D0KA 4C4YA 3ANSA 3K9BA 3AFIA 4UBNA 5AM5A 4B6GA 5AH0A 2E3JA 3K6KA 4UBMA 5IKXA 1TK3A 3I2IA 3CCCA 4D9JA 3B3QA 1H2WA 2V97A 2XI4A 1HQDA 4PV7A 3TGLA 5HF5A 3R3ZA 5AKEA 5K3CA 2B20A 4G4JA 4RE5A 4E46A 1Q83A 4N8EA 3WIOA 2OQIA 4X6XA 5ALPA 4Y2RA 3H2KA 1AUOA 1ZI8A 4BVJA 1VA4A 1X70A 1GPNA 5AM4A 5AO9A 1XRRA 1CIJA 3WKBA 2XMSA 1TCCA 1YB7A 4QDUA 4CG3A 3CCBA 2RI6A 1G5FA 1CUYA 1IUPA 3WKDA 4XWGA 3FSGD 5LZ9A 3D2BA 4OB7A 2QVBA 5AKJA 1QO9A 2XUDA 3HZOA 3IUJA 4WFJA 5E2IA 5IVHA 4A16A 4ETWA 1PJAA 5JANA 5DNVA 2ZJFA 1VJ5A 1E8DA 5CXUA 4K5QA 4MYDA 4EY5A 2FJ0A 1BN7A 4DIUA 4K2AA 2BGRA 3PI6A 2HRQA 1K5PA 4AZ0A 2WG0A 5DNWA 2BKLA 2DCMA 1ZIXA 2OCIA 5DNUA 4MYSA 4BP8A 1C7JA 5ALGA 1HDEA 1WB6A 3Q8WA 3OPMA 3FOBA 2OAGA 2I78A 3DCNA 2AJBA 1ODCA 4X92A 3M82A 3PUHA 5HQ3A 3M3DA 1JU4A 1G42A 5JD6A 3FCYA 1AC5A 4C4ZA 4K6KA 1QTRA 4FOLA 3I2HA 2QOEA 4W1SA 3B12A 1N1MA 2J4FA 1XRPA 3IDAA 2PUHA 2H9YA 5LZ4A 4KACA 1A88A 1HKHA 5C8ZA 1CUSA 5LYYA 3W05A 2ZYIA 4UUQA 1DQZA 3AZQA 5HFAA 2WUEA 4LHEA 2V9ZA 1ZD2P 3I1IA 1Q0RA 2G5PA 3STWA 5I9IA 5DYTA 1LPPA 2H7CA 1QIGA 3G9XA 4GW3A 5LP1A 4G1FA 4LYEA 1VOTA 1ZJ4A 4X71A 5CH3A 3QMMA 4QLOA 4C87A 2PUJA 1XZLA 4XVCA 1WM1A 3UUEA 1BEZA 3WA7A 5JAHA 3DKRA 2HA6A 3HEAA 2EDCA 4Q3LA 1QLWA 2BGNA 2GBFA 1DX4A 1ZGBA 4FNGA 1P0MA 4OPMA 4B83A 5JAPA 1R4ZA 3ZWQA 3L1IA 1ETHA 1JMYA 1EDEA 4BP9A 4FTWA 2PU7A 1M33A 2VJDA 1F6WA 3KOOA 5AHXA 3ESBA 4DYHA 1VXOA 4WFKA 2PPLA 3LIIA 4RNCA 4J0HA 3BXPA 5JD5A 3M81A 4FFVA 1TRHA 3X3HA 5JZ9A 3I2KA 3C8DA 2WUDA 1MX1A 2WIDA 2Y2UA 1IZ8A 4EY7A 3WIBA 4FLFA 4P92A 2QKYA 4ZREA 1DWQA 3QYJA 4UBIA 3WZMA 2QTBA 1RWQA 1QTIA 1GT6A 3H2IA 1S8OA 1QIEA 4UBLA 1A8UA 1LPAB 4JNCA 3ZLUA 1ODTC 4G8DA 4PQEA 5EIHA 3D3NA 4X00A 1LPBB 5CT9A 1JU3A 1U8EA 3ZV7A 2HA7A 3VJKA 5AKXA 1XLWA 2VF2A 4MEBA 3WWDA 1TQHA 2Y6VA 3FLBA 4IH9A 1CEXA 1DT3A 3QH4A 2JGMA 4J03A 4CG2A 4OCZA 4KAFA 4QE3A 1EHYA 4U2EA 2O2IA 2OG1A 2WFMA 2XUHA 1QIDA 1MX5A 1UKAA 3ICVA 4H18A 4GXNA 4EY8A 3E0XA 4YX9A 5ALOA 3D5EA 4FBMA 2HADA 4ZXFA 3EF3A 2I03A 1ISPA 2OGSA 3FSGA 2WM2A 4LIPD 3OURA 1EA5A 5DYWA 3MUNA 1XKTA 2YXPX 5SYMA 2WIFA 4X6UA 1BCRA 1BCSA 1OXMA 3GELA 1YS2X 2PSEA 1R3DA 2GZRA 3PICA 4BCCA 1GZ7A 1AMNA 5BWCA 4Y2QA 2WTMA 4H35A 5AP9A 4L72A 1CUCA 5SYNA 1HL7A 2PM8A 3O0DA 2DQYA 3QBJA 2IX9A 2FUKA 4OSEA 2WFZA 3W04A 1H2ZA 2XUQA 4G5XA 2XQGA 2BFNA 1C7IA 4FNMA 3WZLA 2CB9A 2VQ6A 1F0NA 3AILA 2VJCA 1CLEA 4OYLA 5E4YA 2VJAA 3FVTA 4UHDA 5HQ3B 4MWSA 4XX1A 2HA2A 4TPKA 2WKWA 3C43A 1UKBA 1JT2A 1P0PA 2FJPA 4AO6A 5EHNA 2C0QA 3VISA 4BZZA 4P93A 5JIBA 1Q84A 4Q3OA 1XZGA 4QWMA 2AXEA 2YASA 4G4GA 5ALEA 1H2YA 3ESDA 4GI1A 2Z3ZA 1XQVA 5DWDA 4KAJA 5C7YA 4Y7DA 2ZVDA 1B6GA 1FSSA 4HXEB 4NVRA 2WFLA 1LPNA 1TCAA 1U2EA 3DDUA 3WK7A 5EI5A 3QM1A 4W9RA 1L7QA 2XMZA 1MTZA 3LLCA 4BRSA 4HTAA 5FXMA 4U2DA 5IH7A 4QLAA 2XMBA 4A5SA 4IQ4A 5ALSA 3NWOA 2HA0A 3G9TA 2ZYRA 2R11A 3E3AA 3G0GA 3A70A 4NZZA 2G4LA 5DTIA 3WKEA 3I2GA 3QVMA 4C89A 1W6RA 1SOMA 4U2BA 3MVEA 4IH4A 1CUFA 4F5ZA 4IHAA 1L7RA 4FDMA 3IIIA 3DJYA 2QXUA 1VE7A 2QUBA 2AJ8A 4BTVA 2H1IA 4M0MA 3AZPA 2RHWA 3A2MA 3WK6A 1CUUA 5E4JA 4FLMA 5A7GA 1LNSA 2C5FA 2FX5A 1XKLA 4EZIA 1C4XA 3A2NA 3WK8A 1UK7A 4KYVA 1G4HA 4JH0A 1F0PA 4N5HX 1WHSA 3A2LA 1MAHA 4QDOA 4X97A 3RKSA 4J7AA 2JGFA 1EX9A 2O2GA 2PSHA 1H22A 2OGZA 5D3KA 5AIAA 3HSSA 4I4CA 5AKIA 2PBLA 4EA6A 2XT0A 3V9AA 1MO2A 3FYTA 2ROQA 3O4GA 2ZSHA 1K63A 5AI6A 1XQWA 1BRTA 4KR0A 1ZD3A 1R88A 1XROA 4B82A 3FLEA 4WCVA 1FJ2A 2I3DA 1ZIYA 1CV2A 1TCBA 3V1LA 1WB4A 5IVIA 1JMKC 1VE6A 3QPAA 4LXGA 2HFKA 4X94A 1DINA 1ZI9A 2WTNA 2DFPA 2VA9A 2WJ3A 4BBZA 1YA4A 1CUGA 5LKAA 3O9VA 3F96A 3FAKA 3BJRA 3R41A 4AMZA 1ZGCA 2QT9A 3U1TA 1UWCA 3HLKA 1J2EA 1LPMA 1WB5A 4ZWNA 1Y37A 1X2EA 4UFPA 2HU5A 2RHTA 2D5LA 5HF9A 4QZVA 3BL8A 4KE7A 3KWJA 1MT3A 1QE3A 2VATA 3LP5A 4HAIA 1CUJA 4KE6A 3R3YA 3D59A 2HU7A 2WJ6A 1CVLA 4UPDA 2XQFA 2AJLI 5ALQA 3BJMA 3E1GA 4S0XA 1JKMA 1HLGA 2VAXA 5FDFA 3ZLTA 5LZ7A 3HYSA 2CMFA 1WPXA 5AIBA 2Y1KA 1SC9A 2O7RA 3WWCA 2QXTA 2XUJA 3FYUA 5ALRA 1IUOA 1K6EA 3WWEA 4M0FA 1XQYA 4F0JA 5JALA 4H77A 4F60A 2Y2VA 5AOBA 1CUZA 4Y2UA 5K3BA 2Z5GA 2OCGA 3PFCA 4H7EA 4J0KA 2WIGA 5AI0A 2WUFA 4FHZA 5ALJA 2VEOA 5ALNA 2IITA 2YYSA 1E8NA 3IVMA 3RK4A 3WL8A 1GQRA 1MX9A 3FNBA 4LYDA 4QA9A 1E89A 4V2IA 3ILSA 1HPLA 4OU4A 3PF8A 4PF1A 4LKOA 5HF6A 3C45A 3I2JA 3GBSA 1YSCA 4ROTA 1KEZA 2WSLA 1ZD4A 4CCWA 2WG2A 4N8SA 2C4HA 4MXDA 4BE4A 3CN9A 5ISMA 3C5VA 1VA5A 3PUIA 1I6WA 4QEKA 4B9EA 5A2GA 1LZLA 2QJWA 3FLAA 3DKKA 4X6YA 1CR6A 1UT6A 5ALFA 2ONCA 1RP1A 5ALHA 5ALKA 5AI9A 4GBGA 2CBGA 3SK0A 2BAGA 2JGIA 3WL7A 2ES4A 3JWEA 2ORYA 2WJ4A 3I1YA 2BCEA 3FCXA 1VXRA 4JYPA 5HFNA 5FP0A 3CXUA 4L9AA 4KRYA 4OYYA 4CG1A 1R9MA 2K2QB 2XUIA 1ZOIA 2BUAA 5ALLA 1EINA 1Q0ZA 3W06A 1SCQA 4DNOA 3DD5A 3T4UA 1NU6A 5C8XA 3SC2A 1NU8A 4W63A 1SCKA 4RE6A 4OB8A 4EY6A 2QZPA 5JD4A 3LS2A 2PU5A 4AB1A 4UHBA 4J3JA 2OGTA 2Z8ZA 1UFOA 4LXIA 1PFQA 4L0CA 1UOPA 3F8SA 3R3XA 2ACKA 4K6GA 4Z49A 2C0PA 1ZICA 1QIJA 3STTA 3H17A 3YASA 4DMCA 4NMWA 2ACEA 1UK8A 1EXWA 3GA7A 5AK3A 3BIWA 1PV1A 2VT6A 4H7KA 4BVKA 3V1MA 5I8PA 4J0DA 4ZGBA 3O95A 1YS1X 4CCYA 1AURA 1XRLA 1J07A 5AKYA 1CFJA 4J0IA 1EB9A 5A71A 1YAHA 4RGYA 2C58A 2PSFA 2GYUA 4J0JA 5EHXA 4Y2XA 5AI4A 1AX9A 4AN0A 3SWWA 5LZ8A 1UZAA 1P0QA 1THTA 3KWFA 5A7FA 4BTLA 1BROA 3K2IA 3C5WP 3OC0A 5T4BA 2WHPB 4GWLA 3NGMA 3G7NA 2XQIA 5LIPA 3WWPA 4Y9SA 2HA3A 4WJLA 4DM7A 5JYCA 3F97A 3MGAA 3WJ1A 4UBJA 4AO8A 1QFSA 2JGEA 4L3WA 4BRZA 1CUBA 3AINA 3VJMA 2JBWA 2OAEA 5DTJA 5AM3A 2RAUA 3C8HA 1QFMA 4P08A 3EBLA 3F67A 2XUKA 1CUWA 3H2HA 3H0CA 1N8SA 2Z8XA 5AKGA 3PFBA 2HRRA 1R1DA 5C8VA 2WIKA 3S8YA 3STUA 4DMFA 4G8CA 3WQHA 3DYIA 3TEJA 2WIJA 1L7AA 1GPKA 4BC1A 4BZWA 3C6YA 4C88A 3N2ZB 3RM3A 3WJ2A 1UOOA 5HF8A 4CI9A 1E5TA 2WILA 3ESCA 1JFRA 3DLTA 2ZJ6A 1HBJA 2VAVA 4B9AA 5KWJA 5AOCA 1QIIA 5T4EA 4DNFA 1MPXA 1N5RA 1GXSA 5BWBA 2QUAA 1GKLA 1E66A 3BE8A 1XZAA 2I3ZA 3BWXA 3LCRA 4PSDA 3OM8A 1G66A 1QZ3A 1IUNA 5C81A 3WK4A 3HRHA 4DLNA 4UBOA 1T2NA 4TVKA 1ACLA 4Q05A 4KE8A 2QM0A 1NX9A 2B9VA 4W1PA 5AICA 2GBGA 3VXKA 1YB6A 3BF8A 3WMRA 1THGA 2QJRA 3I2FA 5JATA 1DTEA 1LBSA 1B41A 2OXEA 2QRUA 4UHCA 1XZJA 2RIPA 1DT5A 3TRDA 1W75A 2JEZA 4AXBA 1CUEA 3ZLVA 2H7YA 4BDTA 1OILA 1W1IA 2XMGA 1GPLA 3G8YA 4DMHA 2WHQA 5E4TA 5ALXA 5ALUA 5LZ5A 4OU5A 2RONA 1GGVA 4BCDA 3G9ZA 3B5EA 3AUKA 1CUDA 5AM1A 1A8SA 2PL5A 2X76A 3FBWA 5CBKA 4KJXA 2DQZA 3HACA 1BN6A 4MEAA 3ZI7A 1ORVA 1CUIA 2HA5A 2O2HA 4BAUA 2W22A 1ZJ5A 2XMQA 3NUZA 1QOZA 5CT8A 3BF7A 1X2BA 1XZFA 2BUCA 1LPSA 3PF9A 4XJVA 5A62A 4WDQA 2DHEA 5CH8A 2OLEA 3DOIA 1W4LA 1JJBA 3TJMA 2VSQA 4PSUA 1LLFA 3H1AA 1OCEA 3WYDA 3IUMA 3WI7A 3ESAA 1EH5A 2OCLA 5CT4A 7YASA 3V1KA 1KU0A 3E4DA 5HZGA 2XQJA 4FMPA 4FWBA 4DTCA 3HABA 4W1QA 1UOQA 3R40A 4C01A 5ESRA 1WOMA 1MJ5A 4X93A 3O4JA 4MWTA 4MQMA 2V98A 1UK6A 5JAOA 4HVTA 5ALWA 4HRYA 1Y7HA 2ZYHA 3C87A 4FKBA 1CUHA 2OCKA 3G0IA 1ACJA 3I6ZA 1H2XA 1H23A 1MNAA 5HK8A 2JEYA 4AO7A 1XRMA 3H18A 2OPHA 4QDTA 5ALMA 2PSDA 4E15A 4WDRA 2HHAA 4ZV7A 5EIEA 4GDMA 2QS9A 2PKYX 2QR5A 1EDDA 1EK2A 4GLBA 2P8SA 5AK6A 5J3JA 1SFRA 4I19A 4EBBA 4C6HA 4KE9A 3D4LA 4X7BA 2JGKA 3BDVA 4BVLA 3NOXA 1WPRA 2VT7A 1SCIA 4U2GA 3IB3A 3FVRA 4G8BA 3DS8A 5ALYA 2XE4A 4IH1A 3DNMA 1EDBA 4LXHA 4I3FA 3UUFA 2XLCA 1CUVA 4WY8A 4RPCA 4BDSA 1K4YA 2WHPA 5DYYA 1CRLA 5BOVA 4UHFA 1R9NA 3OOSA 5AK4A 5D7BA 3ANTA 4INZA 3PDCA 3MUOA 1MAAA 2LIPA 3FYUC 5ALVA 4C4XA 1FFAA 1WCYA 4AX4A 2O7VA 5CRIA 1MNQA 4OB6A 1FFCA 1VZ3A 5AM2A 4CFSA 4X90A 3WL6A 3QZUA 3CN7A 2DHDA 3W9UA 5FKJA 5AJHA 1FFEA 3H2GA 2JIDA 3DEAA 2AJDA 1UKCA 1FFBA 1U65A 4FBLA 5EGNA 3W9BA 1O6FA 4DMKA 3GUUA 4G9GA 3QPCA 3D2AA 4BCBA 1DX6A 4B84A 1AKNA 2XUOA 3H19A 1J1IA 1XZDA 4B0OA 2XUPA 4X95A 3FWHA 1ORWA 4YPVA 2B61A 1YA8A 3WWOA 2WG1A 4H7DA 4XIIA 4DSAA 2ZJ7A 3M83A 3L1HA 5HKBA 1LBTA 1MN6A 3A6ZA 5I7UA 1TIBA 5JZSA 4J0CA 1GQSA 4KEAA 5KWIA 4H7IA 3IULA 4ITVA 2NW6A 1VLQA 3KSRA 3C6BA 4HS9A 4O08A 4ZRDA 3JW8A 3VJLA 5HCUA 5EIAA 1J06A 2HU8A 3F9CA 5HKAA 4PNZA 3C6XA 3HC7A 2J3DA 2ECFA 4E11A 1YAJA 1XRQA 2Z3WA 2XUFA 5AOAA 3WLAA 3AZOA 4M0EA 2JGLA 4YASA 1USWA 2XMDA 4FFWA 1DQYA 4UBKA 5DLPA 2H7XA 4DNPA 2EDAA 5JAUA 2PSJA 5FPQA 4QWWA 1BEEA 1JJFA 1JJIA 4EHBA 2BUBA 3RLIA 1Z68A 3VVMA 3VVLA 2WQZA 1XZKA 3I28A 1DWOA 3G02A 2XMRA 3HI4A 5IVDA 4PW0A 3PE6A 4DNQA 1QIFA 4HXFB 1ZD5A 2CEKA 5F4ZA 4FLEA 4B85A 2ZYSA 1Y7IA 5IVKA 2B4KA 1BS9A 5EHZA 2VJBA 2R8BA 1BE0A 2CUTA 4AN1A 4QDZA 1XZEA 2BJHA 1DU4A 2G63A 4A23A 4WFIA 5CH5A 5ALDA 4ARBA 1P0IA 4CIAA 4JUIA 4OD0A 4BE9A 2RGUA 3VKFA 2XDWA 2DR0A 4B0PA 5FV4A 1AZWA 1R50A 1IZ7A 3D7RA 1LPOA 4G9EA 4WY5A 5FPPA 2HFJA 1XQXA 4BAGA 3QMWA 1EB8A 4UHHA 3BDIA 2ZSIA 3H2JA 1CQZA 4UHEA 1XLVA 2V96A 5A7HA 5CXXA 4H7JA 1QO7A 1AQLA 4ZI5A 3FYUB 3V1NA 4EUSA 1CUXA 1W76A 1UXOA 3G0CA 3QPDA 4BB0A 4Y2JA 4GEGA 5ALZA 4IO0A 4BC0A 5FLKA 5LLSA 1EI9A 1XZHA 5A6VA 1ZI6A 4GECA 5FOQA 4AQDA 2GYVA 3H04A 2JF0A 2HIHA 2C7BA 3EQ9A 2GZSA 2WUGA 3H1BA 3IA2A 1YCDA 2X8BA 3STVA 3AIKA 3O9MA 1AGYA 3STYA 4EB0A 4AMYA 4H7HA 3GZJA 4HXGA 3UMJA 3BIXA 1XZCA 4B81A 3R3UA 2DHCA 1N5MA 4B80A 5K3DA 5JARA 3U0VA 1IVYA 3ICWA 3G9UA 2VTVA 3DOHA 2D0DA 2GBCA 5K3EA 5EFZA 2Y6UA 4W1RA 3IUNA 4N5IX 4HRXA 3P2MA 3LIPA 4TGLA 1JI3A 2W6CX 4F21A 2JGJA 2X5XA 3QITA 1BU8A 5ALIA 5AKZA 4Y2TA 5AKHA 2YH2A 1E8MA 5K3FB 1FFDA 2AJCA 4UFNA 1O6GA 2XUGA 4Y2PA 5KBYA 3WA6A 4P9NA 1XZMA 5DJ5A 2XUAA 4HZGA 4OUKX 5FRDA 3I6YA 2PVSA 3ZPXA 4QNNA 2GBIA 2OQVA 4CIBA 2XB6A 3IUQA 3R3VA 1XRNA 5D6OA 1CQWA 5JASA 2HL6A 3DYVA 5K3AA 3DQZA 4X91A 2CZQA 2J3QA 3JYHA 4EY4A 3F98A 3IURA 3EQ7A 2XMCA 4B7ZA 4Q82A 4PSCA 1UK9A 4BYMA 1RYYA 4JYMA 5EHQA 5K3FA 5CURA 1QJ4A 5K5EA 3EIOA 4NS4A 4Y2VA 1W52X 5YASA 4H0CA 2G5TA 1IMJA 4Q1VA 1ODSA 2WHRA 1VZ2A 5FUMA 4ZV9A 1XFDA 4KAAA 1LGYA 1LZKA 2HM7A 3IBTA 3EQ8A 3STXA 3AIOA 3WYNA 5JADA 4X85A 5D3ZA 3OG9A 5AM0A 4BAZA 4E14A 5LZ2A 4KRXA 1XZBA 3WKAA 5AKKA 5H3HA 3OTQA 4Q34A 5JZBA 1A7UA 3DL4A 2UZ0A 3WK9A 6YASA 4UFOA 3Q0TA 2CJPA 3QMVA 1YR2A 3WK5A 5LKRA 4CCYB 3C70A 2XQKA 1QIHA 3AIMA 4U2FA 3R3WA 3V48A 1E3QA 5T4FA 3C6ZA 3SX4A 3O4IA 1T4MA 4YK7A 4J0GA 3KDAA 3T52A 2WLSA 5CTAA 4GHWA 3ED1A 4MQLA 3W2TA 1CPYA 3O4HA 5HK9A 5BV7A 4U2CA 4MJ3A 4K6HA 4DGQA 4BATA 3GROA 5KREA 1D07A 3HJUA 4Q3KA 1VKHA 4Y2SA 3WL5A 1KU6A 3HXKA 1DWPA 4N8DA 1QIMA 3KD2A 2EEPA 2QMQA 2Q0XA 3S2ZA 3RARA 5AI8A 3G0DA 2PX6A 1XLUA 4AZ3A 4PO3X 3D2CA 1QONA 4Y2YA 1EVQA 4JEIA 2CKMA 1QIKA 4QDXA 5T4HA 1EVEA 1F8UA 5ALTA 2WFLB 3DL7A 1CUAA 5AKLA 3KXPA 2WU3A 2HDWA 4ARAA 1MU0A 3I6MA 3L1JA 2DSNA 2XLBA 4X3CA 3VDXA 2WU4A 1K8QA 1GKKA 3GFFA 5CMLA 2GYWA 1QGED 1U4NA 1YASA 1XZIA 3AJAA 2HA4A 1EK1A 4H7FA 3WKCA 1WHTA 1TKRA 5AK5A 2C5GA 5AI5A
chains in the Genus database with same CATH superfamily
5CT6A 4G4IA 4POAA 3N0TA 1W48A 1WEHA 4QM7A 1TEXA 3W5JA 3R8FA 3H4TA 1AU9A 1EU1A 3Q9LA 2ZZMA 2NVUA 1PP4A 3F71A 3IR7A 1KAEA 3G7UA 1ZUHA 4HOYA 3HM9A 3AFIA 2QUZA 3L4BC 5AM5A 4B6GA 1SZDA 1D4FA 1SO8A 2C0CA 1P1HA 3SXJA 4DMRA 4XLLA 3DUFA 5BMVF 3EVGA 3K6KA 1II0A 1X7XB 1CJVC 4JKIA 4R84A 4DJTA 4CTNA 4HQ0A 1GGKA 1N7GA 2ZTUA 4GOOD 1WLSA 2Q6LA 4TT8A 2RKBA 3ZWCA 3QU2A 3WGZA 2V97A 2XI4A 4PV7A 3QYFA 3ZY2A 1LNQA 3R3ZA 4WQMA 1ORIA 4DIKA 1N6HA 4KGDA 4W8GA 1QQBA 1TTTA 1Q83A 4N8EA 1J0DA 3U7GA 1LXCA 1WW2A 3CJRA 3P2YA 4U7PB 2O52A 3R77A 3C41J 4MVYA 4NATA 5EL0A 4KPFC 5F2NA 1X7DA 1E1QA 1N32B 3QXHA 4Y2RA 4C5AA 4MV9A 1C0KA 3UWOA 1A50B 4JI7B 1G6KA 1A77A 3NFRA 1UC5B 3USZA 1NBWB 3NPMA 2PX8A 4EG4A 4DV2B 2QPTA 2IYLD 2X3YA 3DEIA 1X3LA 3QYPA 4RF2A 1VMDA 1E1DA 3WGKA 1FF9A 3RU2A 1CR4A 3N87A 5B1YA 1WW3A 4DHWA 5AM4A 1U5BA 2BEJA 3A9TA 3FM9A 4YT5A 3RAPR 1G5HA 4P2GA 1XRRA 4HYQA 5DDIP 5F1OA 4A8JA 2DJIA 3OWXA 1Y1PA 2JVIA 1PBNA 3GL9A 4AJNA 3OQIA 5B64A 3HJBA 1FFHA 1YB7A 3WOVA 4K9MA 4BO1A 5KI6A 3FKSD 5BSWA 1AUPA 1UBHS 3EFOB 4M2LA 2CW5A 4KN6A 4QBGB 2G70A 1JR3D 3F47A 4TT3D 4F3CA 2O8FB 3RR2A 4ZC8A 4Y9TA 4FXPA 3Q3VA 2G80A 1I24A 1AB5A 1KYYA 3PFWO 3RLFA 4C4PA 3WX0A 3E7WA 4E2WA 4LY0A 3WKDA 1RLIA 2I2CA 2UV8A 4BNMA 2X8JA 4RDXA 1Z16A 3FSGD 5TGDA 5JBQA 2R60A 1XTRA 3PC3A 5AKJA 4CUJA 1TIPA 2WD8A 3OIWA 3HZOA 4G1MB 1YU9A 5KNCD 4UW9A 1T3GA 1U81A 2ZJAA 2IY8A 3K4HA 2D00A 3NQ41 4O0MA 4RACA 4RD6A 4OQEA 2IV3A 3FTEA 5JJKA 1EUZA 4RM2A 1H3FA 4EYSA 4DR5B 4XYBA 1X9GA 1Z33A 2YWGA 5SY6A 4A16A 4BZQA 5F2KA 1M2KA 3A9CA 2ZFUA 5DNVA 1YQGA 5F9HA 4ZJYA 5M34A 5TPWB 3EG5A 2VSFA 1E3IA 1SH7A 1F4LA 1U02A 2WVJA 3ETJA 3R7AA 4E1BA 6REQA 1W19A 3G8BA 1ZNQO 3G5TA 4BMCA 3FTCA 3OP1A 1I3CA 2YUTA 1BG6A 3R7WB 1PUJA 3ZHZA 1KRXA 1C9YA 1E8DA 4DMLA 3KS9A 3HPQA 3I4LA 1HK7A 2FJ0A 2Q5QA 1Z7WA 2ATXA 3G2PA 3NHKA 2AZDA 2AW5A 5IBPA 4IZOA 4K2AA 2BGRA 5GWXA 1KKLA 5FA8A 2ETXA 3T0FA 1NSFA 1O89A 2HREA 3PI6A 2OENG 2WTBA 4RJIA 2HRQA 4B6PA 3UHFA 4MP8A 4PCUA 4B7CA 1GLVA 4MUNA 1K5PA 3B70A 4MPJA 1AV7A 1MMFB 5DN6D 1V48A 2DUNA 3VH4A 2CFCA 2WG0A 1A1VA 3HJAA 5DNWA 1NXVA 3EULA 3LH5A 4R8RA 4XR9A 1R8QA 2OCIA 4Y18A 3FGNA 2QD3A 3WRWA 2OHXA 2ANCA 2ZT8A 2WF6A 3FPFA 5AWFC 4YR7A 2WPDD 2CFIA 4DBLC 3SE0A 4D3XA 3AW8A 3F8WA 3LJKA 2VBCA 5AVJA 4BP8A 1YZVA 2BSQA 3OLCX 1HFEL 3GMDA 2XMPA 5H7XA 5K0TA 1SUBA 2QG4A 4FHEA 1NONA 5IJZA 3L8FA 4H2DA 3W6PA 1NVBA 1GGEA 1X15A 3CR7A 1ZW6A 3KAPA 4CTMA 4W5OA 1BDMA 2AJBA 4AUMA 4QBIA 1R7RA 4X92A 1XMOB 3M5WA 5JMPA 4QGSA 2BMJA 2A9OA 3FJYA 3A4MA 2OP1A 4S0ZA 5E8RA 5EP3A 3TQSA 5EMLA 3OZEA 3PHIA 1YDEA 1IWOA 1FP6A 1G2OA 4O2BF 2W71A 2PGAA 4HUJA 3RJMA 1C2TA 2A5JA 1WCIA 2CJFA 2ECKA 1GNVA 2O2EA 3CUYA 2YL2A 1Y1QA 1Z56C 3OU7A 4PNPA 1AC5A 3HG7A 4C4ZA 4JXXA 1DARA 3GX1A 1EZ4A 3QTTA 4B2LA 1DELA 4CL2A 4GPEA 4P35A 2CDBA 1E2PA 4FOLA 5C4IA 3F6RA 4C14A 4BX9A 1KEVA 3I2HA 2GCOA 4W1SA 3WJAA 3B12A 2A67A 2J4FA 3HUUA 4HMQA 1XRPA 2GB4A 1PF7E 1F12A 1M73E 2XOXA 2HJ9A 3JZFA 3KV3O 4GMHA 5DSTA 4YIKA 4NZNA 1SXJB 4RZQA 4CV0A 2NPOA 3F5DA 3T9BA 4ENVA 1OE0A 4PRLA 1EUYA 5JOQA 2ZSFA 1EFRA 3C8MA 1UBEA 2ZYVX 3AJ9A 4UVDA 3W4KA 3WTCA 4R9VA 1H2BA 3LBNA 4LCEA 1UC9A 2ZRDA 2RKWA 1L4EA 5LYYA 3D5TA 3FPJA 2BM9A 1PWHA 1NBHA 1TE2A 2MT9A 3UZUA 1PFYA 3K16A 4UUQA 1JQLB 2BYTA 2WYIA 3AZQA 3C14C 3VNUA 3IOCA 3KG2A 1LRKA 2O0HA 3OP4A 4QPCA 1Z38A 2FFBA 1ECLA 4DLAA 3O2JA 4K9QA 4CQMA 2V9ZA 5EMMA 2CXOA 4B3IA 3I1IA 3OD5A 1YOBA 2HJRA 3OM1A 2NTNA 3SG0A 2IIQA 2BONA 5DYTA 2H7CA 1L5FA 1IM2A 5I7FA 2XTMA 4RIEA 3UCXA 3GQBB 4GD3Q 5H80A 4UKDA 2OFWA 4GW3A 3ONEA 4N3GA 2KPOA 3AUAA 1OZGA 5L4SA 5LP1A 3B1FA 2W5UA 4PLFA 4OL9A 1EWTA 1VB3A 4Y6RA 3K9GA 3VHLB 4ND6A 1ENOA 4LYEA 1VOTA 3KL4A 4MVXA 3CEHA 4KVAA 5KNDD 1E0JA 3EQ6A 2HCTA 4KUGA 4YHHB 5ELXA 1MO6A 2A59A 2PZFA 1Y5RA 1N6KA 5CW1A 4AW9A 1XXHE 4O0LA 1O0BA 3GFGA 2WR8A 1X74A 3PQ8A 1I0ZA 3KPWA 4GOMD 1A8IA 3IP8A 3UY4A 3I9NA 4QPZA 3NGXA 3IQEA 5FA5A 4XVCA 1WM1A 3JSXA 1EGVB 1GNLA 1CX9B 3N9IA 1BEZA 1KY4A 3PGKA 5IBQA 5TE9A 2GLXA 2HEGA 5F3WB 3ZBTA 2QUIA 5BUSA 1UMCB 1G7RA 2QRLA 3UAOA 2PFKA 4HDSB 3IPXA 3TOCA 2IY7A 2KLHA 4GKAA 4AL4A 1RR6A 4Q3LA 2QRMA 2GBFA 1DX4A 3UWSA 4ZQGA 3EHDA 1E9RA 1XCGB 2VOEA 3G85A 2ZI3A 3MT8A 3DWEX 4JC5A 3BXOA 4UJ3A 2WJGA 1W4RA 3A6DA 1PK7A 3DE7X 1FMTA 3FH0A 4B6FA 4CMKA 2FR8A 4QKQA 4G56A 3BRQA 1NI5A 1EDEA 4PHHA 4BP9A 3EZ7A 4FTWA 5AVWA 4DA4A 1M33A 1RXCA 2VJDA 5HBGA 3SHWA 4K40A 1YT5A 1ZUWA 3L0BA 1S3GA 3Q6MA 3SSOA 4JC0A 5AHXA 4NJOA 1KH3A 1RAEA 4K9DA 4ZI7B 3ESBA 1NP7A 2UZ1B 3DVSX 2V6IA 4WE3A 1UL1X 3KXLA 1UBOS 4RNCA 2VC2B 5CGZA 5A3VA 4J8PA 5JRZA 3TNYA 1A82A 1BXKA 4AMGA 1VJDA 4BO9A 1U3WA 3FPAA 5DCUA 2PFSA 3FTPA 1KMQA 5TS2A 4RVOA 1TRHA 4RETA 1NJ6A 3EVBA 2GYYA 2QM8A 1MJNA 1E1NA 3L46A 2WUDA 3MF4A 2F1RA 1IHDA 2BRUA 2WC1A 1DMSA 2WIDA 1F8YA 2W4MA 3EXIA 1WA5A 1QFJA 3K0BA 1SK8A 2O6LA 4GNKA 5LBUA 2D13A 3WIBA 3ZY6A 3W5DA 1E96A 5IVPA 1AKUA 4ZREA 3CF6R 1SG9A 3QYJA 1XHLA 4UBIA 2G07A 1U0JA 2QTBA 3M5DA 1ESEA 4MRPA 2D8MA 2VH1A 5EPEA 4B2YA 3ZDCA 1M34E 1TFRA 4DF3A 4G09A 3SQXA 3A05A 2XOKA 3IQXA 4YCAA 1Z4PX 3DTVA 5F1PA 1Q19A 2XA1A 2WLTA 1M83A 3A4VA 3E7PA 1DCTA 4JKYA 3ZGLA 3K0SA 1M66A 2OD9A 3V1TC 1IK4A 4UBLA 2MSDB 3S2UA 2EZ9A 1JB9A 3E2PA 5FORA 1CB0A 4P82A 2QLJA 4G5OA 5JCOC 2G7ZA 4E08A 4PYOA 1J5PA 1ODTC 5C3UA 2ODEA 2R4QA 4J29A 3PNVA 5EIHA 5TGZA 3GEEA 2XEDA 3AR6A 3HYLA 3KQNA 4U7TB 1VDZA 2W70A 3UJBA 4AWAA 4BRSA 4R8SA 1RXIA 3PB3A 1X1CA 1L7OA 1U9ZA 1RAHA 1ZUD1 2RARA 3PCTA 4NJMB 3GP3A 4AJKA 4JC4A 2B7LA 2BR4A 2W6JD 2QJOA 3EE6A 3SQDA 1ZFNA 1JU3A 4Q39A 4NEHB 1LH0A 2J3JA 3KR9A 1WV0A 3CH7A 3QXGA 1U8EA 1NXPA 2XXAB 5BSUA 4MP6A 3L04A 3N70A 2IS2A 2HA7A 3VJKA 3ZWXA 3A3KA 4MPRA 3T94A 2ADOA 1PJSA 3GMTA 3U80A 3H83A 3WDLA 2WRZA 3WWDA 1AS0A 3H5IA 3HCWA 1G3UA 4D96A 4ER7A 3IVRA 1G59A 1VE1A 3K9HA 2J5QA 1GYQA 4I8DA 4JVLA 4XPIA 1T6YA 1Y82A 2GAIA 4EDHA 1BQ4A 2GK7A 3LZDA 4IIVA 4CG2A 5ITSA 3TEMA 3GRPA 2WI8A 2PPVA 1K6MA 4X61A 3ZLJA 1L7BA 4KAFA 3K8OE 4U2EA 4CLRA 4D81A 1YVRA 1LA2A 4OAPA 3WSWA 3EZGA 4M87A 3OKFA 3IUBA 4R3UC 1PD1A 2BMWA 5BYAA 2FZ5A 2GUGA 1QIDA 5LA6F 4ZPXA 1DTSA 1I51A 1PK9A 1XXHA 2QTHA 2ZRIA 3OWOA 3P4UA 4FONA 3ZW7A 4H18A 4BASA 1JEYB 1NX6A 3RRFA 1DC5A 2PKXA 2LTAA 5I9SA 3OCVA 1KI4A 2R8RA 5ALOA 4LSZA 3E58A 1JFLA 2CHVA 4AC9A 3IXMA 4RHUA 2XAAA 3H8SA 1ZXXA 2MSKA 2X2EA 5BR8B 3B53X 4Z4CA 2ZIZA 1QRSA 5SZHB 4NI5A 3KKQA 4IGIA 2VHVA 3OURA 4LJ4A 2HPAA 3WRXA 3AONB 1FTQA 3ZIAD 4M7RA 1PR4A 3DC2A 5SYMA 4GC9A 2GEKA 5HE8A 3T5CA 3TBFA 3ZCTA 5P8WA 4DS3A 1LF0A 4DA6A 3MWYW 2GJKA 3F49S 3AYXB 4Z7OB 3VOBA 4RK6A 4WNCA 1Z2CA 1BCRA 4Q4AB 1B8PA 1WABA 3VFDA 3G5MA 4I8XA 1NDHA 1T36A 3E9MA 3LHFA 1SUDA 1SELA 2HAEA 2J87A 4KR6A 3TQCA 2I2FA 2XD4A 1GZ7A 3I5XA 5TPZD 1QVWA 2YN2A 2BI8A 3DBHB 4BJHB 4ZYYA 4UASA 4Y2QA 2WTMA 3KLNA 1XJWA 2SNIE 1AO0A 2P5YA 2ZW9A 4GBED 1UKVY 4OIFA 3VNBA 2BDTA 4NZYA 1ZK1A 4FFPA 1KAOA 4OBBA 4MVJI 5AVRA 1ZZGA 1HL7A 3O0DA 1DG3A 2TS1A 3AHIA 2JHFA 3R3SA 1YRHA 3CG0A 4HDKA 4O2LA 1PN3A 1WMSA 2IX9A 1GUAA 3BD6A 3CF4A 2PH3A 4PLYA 5G0SA 4ALJA 2O19A 1BWRA 2WFZA 1RWWA 5BMVB 4RQTA 2NSYA 3LHDA 4BUCA 2XUQA 3SJAA 4HF7A 4R8MA 4HJRA 1OW3B 1JJAA 4PC1A 5DGTA 5BORA 3RFTA 1OH5A 1Y1TA 3N74A 2QI9C 2IEDA 1NQAO 2E82A 3FOZA 4AJHA 5DM1A 1F20A 1UP7A 2VWHA 2XYRA 1QX4A 1KP3A 2JH3A 3B6JA 4JOCA 4S2UA 5U4QA 3DBIA 1FFYA 3RKUA 4BGVA 3NBMA 4NDNE 4B43A 1F0NA 3MUFA 3C7KA 3AILA 3DNFA 3CV3A 3DZCA 3O94A 1GR0A 3RUAA 1JSXA 2IHVA 2Z5FA 3K92A 1I4OA 3ER8A 3H5WA 3LC0A 4P31A 2CLEB 1OA1A 2H11A 2VHCA 1QU2A 3VM6A 2BEUA 1GRRA 1NE7A 1T3LA 3KSMA 4WN9A 5E4YA 4LSGA 3SEZA 4G0WA 1U0TA 1DMRA 1J8VA 2VJAA 3FUXA 2CXUA 4UHDA 4LXXA 2PMKA 4WCFC 4DIBA 3U56A 3I92A 2HNAA 2CNWA 3PR3A 3UK0A 1EFPA 1BGWA 1PR6A 2WKWA 2FPSA 1PX2A 2MWMA 4XPIB 1QVRA 2JI9A 1T24A 3HTXA 3JALB 4AO6A 1DBWA 1PT5A 5EHNA 3OJ0A 5G4KA 5J2UA 1FDVA 3TXXA 3VISA 3VH2A 4XGIA 1BHQ1 4QJ5A 2QUKA 1MDBA 4XDZA 3BCHA 3PWTA 4MV5A 1HDXA 1Q84A 1GYRA 1WXQA 4QLBA 3CR8A 1UFRA 5IF9A 3FWZA 1G38A 2WB4A 5DO9A 1K8XB 1W0CA 3PWSA 3KAQA 1REQA 4QUEA 5EOVA 1Q6YA 3CRVA 1Z82A 2YASA 1OQAA 1O0SA 1JSLA 3DR3A 3KQVA 4N3CA 5ALEA 3KKOA 4OGLA 1QG6A 4PBSA 2ZEJA 5TMEA 1UC4B 2DBYA 4H59A 2AQIA 2H0AA 3GYGA 1XDGA 3GT0A 3MHPA 5EN4A 4F9TA 4FGJA 4JJGA 1LVHA 5F64A 1G19A 3TI7A 4Y7DA 4ZIRB 3PLRA 3SIPA 4F4HA 1JHMA 5A4MS 4HXEB 2GFHA 3PUXA 2PIDA 4QODA 1G7TA 4V0LA 4QSHA 3HY4A 3TLBA 1U2EA 4A2PA 1AKYA 1KHTA 3PBKA 4B4VA 4R2KA 1X9HA 4PANA 2C4MA 1ZR4A 4JJ8A 3DTYA 1MKYA 3PXEA 4W9RA 2M6KA 1L7QA 2XMZA 1PNTA 1XEXB 2HJSA 5IAKA 3RAEC 1V41E 3EAQA 2PUVA 1UDXA 4JLKA 4PLZA 3B2QA 4UM7A 4CMEA 1U9JA 3WNDA 1Y6RA 2VHUA 3K0FA 5D5PA 4O3MA 4N5LA 2RGEA 3IILA 4XJSA 3GBPA 5IJAA 4CMHA 3DONA 1WW8A 2P5UA 5ALSA 4CMBA 1SD1A 3K0KA 1A9ZA 1Y7LA 2ZYRA 4JLOA 2ZITA 3E3AA 3SR3A 1POWA 2Z0MA 4PQGA 1J0EA 1RVV1 1QQ6A 4BNYA 1J2RA 3U39A 3UK7A 3CNQS 5H59A 3A9WA 4NZZA 3V9PA 5L6MB 2G4LA 3AUFA 1EVZA 3LLVA 2GK3A 3ILVA 2ZJOA 3HDQA 3PNPA 4O4LF 3WKEA 1YF3A 1VIYA 3QVMA 2YX1A 2ZI4A 1E79A 2NT4A 4U2BA 1L8AA 1V1RB 1HYQA 4HBGA 5I7OA 2Q1UA 1CUFA 3OICA 4AWBA 3K1ZA 1H8HA 4R69A 4BQNA 2VTDA 3IIIA 3DJYA 4A1OA 1OAKA 2FDXA 4NBKA 1DQSA 1F14A 3N6VA 3LBIA 3GPIA 3OLVA 2VHEA 2Z6AA 4JQSA 3VU9A 4PIVA 1DLJA 4E4RA 4KUHA 4F6LA 1GL6A 4DE5A 4BTVA 3AHFA 2I2BA 4BNTA 4GMGA 1XHEA 4OOEA 1DX9A 3CIOA 2YC2C 2IPLA 1KH1A 1PJ8A 1BSVA 2BKAA 4HGRA 2B4TO 1OTHA 2A7XA 5E4JA 4AU1A 2I4OA 2CB0A 1ATZA 3FDXA 1JPUA 5CB4F 2Z6QA 4Q4AA 4X3PA 3OFVA 1DSSG 2D2FA 4ZANA 3CKLA 4PE5B 4TTTS 3ZJVA 5E9AA 4AY2A 2C5FA 3D3WB 1U9IA 2H59A 4GZMA 3Q87B 1NV9A 1T0UA 2PS9A 3MM4A 1A2KC 1C30B 4LISA 1L5GB 4F9GA 5EJGA 3WYGA 4QOEA 4ACBA 1DBRA 3V8VA 1TJYA 3QQ5A 4KYVA 2LD4A 1G4HA 3EQ2A 3A1CA 5ESDA 2Q2WA 4ZO9A 1P9LA 3U7EB 4MX8A 4EPRA 1IDOA 2C2KA 1OC2A 3CB2A 2V9CA 3BWEA 1Q1ZA 4V02A 2SCUB 1WHSA 3VR4D 2GO1A 1M7BA 4B71A 1JLLA 1FRNA 1IOVA 2GZMA 4CDMA 4QDOA 2CHUA 4E5KA 1WSAA 1BGVA 1GLGA 2H4JA 3HKBB 3RKSA 3HWX1 4C4SA 1LK5A 5IJWA 2HCRA 2GZ3A 4B31A 3RGWS 4AECA 2GM9A 2RGDA 1XAHA 5LN1A 1X9IA 2JFGA 2O2GA 2NQ2C 5KVVA 4IS2A 2CWWA 2PSHA 2ZKLA 4F56A 4ZAVA 5FOWA 1M9NA 1H22A 2IEZA 2CE7A 2OGZA 3IALA 5AHOA 3HSSA 5AKIA 3L7OA 1P7WA 4YO8A 3GQBA 2PBLA 3K0CA 3OQPA 4YXFA 4DR3B 4ASUA 5IYZA 4GI5A 4II2A 1FVXA 3MZ0A 1SMKA 2CCKA 3ZVMA 3T1VA 1FX0A 1XT6A 1UPCA 1T4CA 1UXJA 4C30A 5HSGA 2QF7A 3OJCA 2ROQA 1GWNA 2BFOA 2JLRA 1DL5A 2VHXA 1IRXA 3O4GA 4ZI7F 5AI6A 3PFGA 1XQWA 2XHZA 1BRTA 4KR0A 1TJ5A 5FR1A 3S2IA 3UT0A 4TRMA 3CZMA 3UHPA 3QE9Y 3QMPA 1XJCA 3TLCA 5JJCA 5JVDB 5FTNA 1WDLA 2LP4Y 3HYTA 7ABPA 5JNVA 2DF8A 2NTYC 1VLLA 4B82A 2BP7B 3K09C 4XH9B 2CUKA 3NTLA 2FEOA 1K7SN 5CTJA 3TTXA 1CV2A 4CJXA 1RYHA 1XNRB 4F85A 3KXDA 1WB4A 5IVIA 5JISA 3LYHA 4UNNA 5AUOB 3VZCA 1SCBA 1NW4A 2GCOB 1KJJA 3WMWA 1QYXA 1VFNA 2WTNA 4WV3A 1SUEA 2ZTHA 3EVDA 4IFBA 3EGIA 3QKSB 4YRBA 4EJFA 2C3UA 2X15A 1HO3A 1Q1AA 2CNNA 2YY5A 4JQYA 4MHOA 2JFQA 1YA4A 3LLSA 2YJGA 3S0JA 1UPUA 1E5VA 1J33A 3GUVA 4MW9A 2XBMA 3TVTA 1I6LA 2A84A 1JPNA 1NOIA 1VMEA 2YR0A 4DSTA 2C2WA 3ZZ0A 4DR4B 2PRJA 4GQBA 3WTBA 4C3OB 3LRPA 4AMZA 1ZJJA 1ZGCA 5AD1A 1EZZA 3RCBA 3ZE2B 3G2IA 4EF4A 4Q3AA 3ABQB 4EHIA 5EXPA 4JQCA 1GD1O 3I83A 3FKJA 1UDAA 1YWGO 3B5IA 4JT2A 2QSUA 4J1SA 4WN9B 1JQEA 1CNMA 1YS4A 2DB3A 4W5RA 2RK4A 2HC9A 3WDSA 2AK3A 3RBVA 3MXOA 2AA3A 1ORHA 3IHLA 1CY1A 3C6MA 4I55F 1PDVA 4DT1A 4XYLA 1KYQA 5K0NA 5C7OO 5FTWA 5L51A 3SEFA 4UFPA 1BKSB 2OV2A 2ERCA 1OI2A 1P6UA 2HU5A 2BTQA 2R6CA 3DTNA 5KJCA 4K9NA 3BSWA 4A92A 1G16A 1KEWA 2Z3VA 3G9QA 1XVLA 3OCZA 3A25A 3TZQA 3CZQA 4Q9KA 2WPNA 4NEGA 2PUBA 3T5MA 2ZBDA 3T5AA 3ZK8A 4RV4A 4E2XA 3COPA 4O6VA 2AD5A 4IYRA 1MIOB 3RSSA 1GKIA 4DG5A 5AVVA 2PS0A 1P7PA 2Q2OA 4LFCB 3O0TA 3HYNA 1SXHA 2HU7A 3R6TA 1BKYA 3M6WA 1CVLA 4KOEC 1F7VA 2AJLI 2Q4DA 2R7KA 3H9JA 3QG1A 4LC1A 3SVZA 1WDMA 4YI5A 4OXKA 1O6ZA 1N3BA 1JKMA 3DBLA 3GLHA 4A0QA 5JC8A 1HLGA 2IX3A 1USGA 4E07A 1BS1A 4MVJH 3I1JA 3PJDA 2UAGA 4PGFA 2GVZC 2C2HA 2C94A 3B8HA 3STHA 2DHQA 1PVDA 3PQCA 4XGQA 3T1TA 5BSHA 4B3SB 3JZDA 4LRUA 1QLHA 2FLWA 4EF6A 1TADA 4MARA 4Z7JA 1TAUA 1YVEI 1OBCA 4LQLA 4QG7A 2ZU6A 1KEEA 2PX0A 3ANNA 4EHAA 1TUGA 1AZLA 4B7XA 3W7BA 2QD2A 4CM4B 1K6EA 2ZGVA 4RSRA 1S96A 1TU4A 1UMCA 2EP5A 4OHMA 4MA0A 4MULA 3ZHSA 3QPUA 4EMUA 2YYYA 4QUJA 3VZSA 4V0MA 4RF4A 5CD1A 4F60A 1TD9A 1ZMXA 2LV8A 2P2SA 1P1IA 4YDRA 1SUCA 2WWIA 1ZWKA 1EK6A 1ZMRA 2K7FA 5AOBA 1CUZA 1Y8RA 3PHCA 1JAYA 2PRZA 2VH5R 4I0WB 5FQOA 4EAQA 4Y2UA 4A15A 5KX5A 5LXTA 1JFSA 3AHGA 5K3BA 5LR6A 3UJAA 1ZH2A 1TVEA 5DOZA 4J0KA 4MQ6A 4O5OA 2FEAA 4WKPA 4FHZA 4MYTA 4BKMA 1P5FA 3TKYA 2IT1A 5EJAA 2VEOA 5ALNA 5LB2A 2BM0A 3D8NA 4LFAB 1E8NA 3SR4A 4OHUA 2GR9A 3REOA 3FE2A 1N33B 1FP4A 4UQPA 3JPYA 1PQWA 4ZU3A 5CM8B 1VSBA 1BMFA 2CYBA 1HDOA 1MX9A 3ANXA 3FNBA 1ZM9A 3GLRA 3DL2A 3OPXA 3VNSA 3U7FB 4ZYLA 2MSWA 4A8JB 3AL0C 3G8AA 3DXZA 3IUYA 4BLTA 2DC1A 5TT1A 2QNIA 1RYNA 2JBHA 2MHCA 4NCKA 1QK3A 4GR9A 4AJIA 3IP7A 3NT2A 1RLTA 3MELA 1WXWA 3QTLA 4Z4HA 4KO4S 2PTHA 3TCKA 2W83A 1QGDA 3BTUA 3RNOA 5IFLA 4IRXA 2DLCX 2C82A 3WLJA 5H5JA 1IXSB 3O75A 1CJKC 4YP5A 4G25A 3GBSA 3DOFA 1YSCA 4CW7A 1XL0A 3OA0A 2GT1A 4GSLA 1DXQA 1N2SA 1RWBA 1KO8A 1XF9A 1P3JA 4M7WA 1IXRC 3S44A 2Y99A 1A9XA 2WSLA 4YJDA 5CYPA 1F48A 2JFVA 4BNLA 4OLFA 5K7SA 3U3RA 1SKAA 2IVFA 1P5ZB 2EHJA 4KO2S 5TB5A 3SS9X 2C4HA 3HEBA 3T9CA 2XCRB 1JQAA 4TOIA 5JE8A 2DRIA 3VPCA 1A95A 1DUSA 1DV2A 5I9TA 3UAVA 2YIDA 3E3MA 5JO9A 4DB4A 3KHUA 4JLDA 1TJ3A 1YFZA 2QK4A 3Q11A 4JI6B 4D44A 2EW1A 2Y77A 5EE0A 1ZCBA 1EHCA 4RX1A 4EHFA 4D5GA 5FL7D 1XN4A 2ZWOA 1TM4E 1Z07A 3E5HA 1WXGA 3E82A 4QEKA 2GM3A 4K81B 4PSKA 5JT1A 5A2GA 2QTNA 4LV6A 2G0NA 3FROA 3JQCA 4Q4JB 5JYDA 4C22A 2Z09A 3H75A 3IEXA 1LBQA 4NARA 3DKKA 4PG5A 1CR6A 2YJZA 4ZOLB 3Q7SA 4RK0A 4P6VF 4QFMA 2R7NA 1T5HX 2JLBA 1I2MA 4X7MA 4YQFA 221PA 2ZIGA 3L2OB 3MJTA 3SBOA 1Y8QB 4TTJA 1C80A 4A2CA 1PX0A 3VPSA 4QO7A 1OFHA 2Y1WA 1B1CA 2HK8A 2BAGA 2RG7A 2YOGA 2ZKIA 3EOZA 3JAWB 1W25A 5EEGA 4BMYA 1DEXA 4MR9B 4DBVO 1W4AA 1XXLA 1OXUA 3WL7A 5LJIA 1X7WA 2A78A 2WWVD 4B5KA 2VWGA 5A05A 4UM5A 3BWVA 2Q99A 3KQUA 3M4YA 4YCNA 3FCEA 2HK6A 5HTOA 1G0NA 2J9XB 3PHHA 2RH8A 4ONEA 5FP0A 3CXUA 1S02A 2V5AA 3DMPA 5SV2A 2NNWB 4KRYA 2HYDA 3SZ3A 3NM4A 2O5CA 3W2GA 4CG1A 4EK9A 2A1TR 1Z39A 4J94A 4KPEC 4Q01A 1R9MA 1W73A 1W5EA 3GCZA 3OHPA 4LHWA 3NBZC 1ZOIA 2BUAA 1EINA 2Y1LA 4L9WA 5BT8A 1CQJB 2WV7A 3GDWA 3HRIA 2QY9A 4MPTA 3HXPA 5HJ2A 1GNTA 1LDYA 2BTEA 3B85A 1JU9A 5C8XA 2L2QA 1E2QA 4M53A 5IULC 4KR2A 5AJYA 1NU8A 5HQJA 4MUJA 1GQOA 3EPJA 2C5BA 3PWKA 3ACBA 5MDHA 4RJJA 3KUCA 4GKBA 3TM5A 4RE6A 4MIOA 2JGDA 4D9HA 3TOVA 3TR6A 2GPWA 2QZPA 1YDWA 2RJ3A 3W3AD 5JD4A 2IS1A 3EW9A 4NCXA 4TSRA 3CVUA 3ZN2A 1GV1A 1I6KA 1RQGA 1T13A 1DI0A 4UHBA 5IZ4A 1WBBA 4MV6A 2OTCA 4RPKA 3TK1A 3JD0A 1CY8A 2GILA 5ELMA 2PD4A 1Q3TA 2O1XA 4L0CA 4EVIA 1MBZA 1T15A 1HR0B 3F78A 1IBMB 2XWPA 2ACKA 2ZIFA 1L1RA 3M1AA 2Z8YA 3Q15C 3EBPA 4YGYA 3Q7TA 3NOOA 2GRAA 3H99A 3ADDA 2I3BA 1U28A 5DN9A 1QB7A 1YQWA 3VKUA 1SBIA 2CHFA 2Q7OE 2JDID 4FHDA 3U7JA 4G5QA 1RKUA 2JFHA 5SZJA 1O96A 4GEKA 4OFZA 5KAPA 1IZ0A 3TDNA 2F9LA 1SU4A 1OH6A 2X6RA 1OWOA 4XVUA 1GTMA 1NJ1A 1XTJA 2VNHA 5DHPA 5C1PA 3GA7A 5AK3A 5BOSB 1PV1A 1R18A 4GT1A 4YPFA 2Z8YM 4GRIA 3OQIB 1QAMA 3ROMA 4DMGA 2ODWA 1MVNA 1NF2A 1X13A 3MPOA 2IS4A 1CP2A 1RI3A 3BZBA 1ZVQA 3JARA 4BVKA 2O6HA 4JN6B 1U3DA 4J0DA 4ZGBA 3UJ3X 1E77A 1RXUA 2AE1A 4N0EA 4CKCB 4G8JA 16PKA 4U63A 5EJ8A 3E9DA 3FSEA 1A27A 2RGWA 2ZB8A 1K68A 3MSCA 1L4NA 3PRJA 4LBWA 4XCXA 5AVSA 4WKBA 1CQIB 5I6DA 3QX7A 2QR3A 3WIUA 4E7OA 3L43A 3EA0A 4UM8B 1QHHB 5FT9A 5KTPA 1ADJA 2ZSEA 2JANA 3A9VA 5JQGA 3K0EA 2EFEB 4MGHA 2ZYWX 5DWVA 4AJ1A 3L01A 1XMVA 3FW1A 1NBMD 1YAHA 3G5LA 4RGYA 2A2ZA 5A71A 7REQB 2V1UA 4MO9A 3N1UA 5DBOA 2PSFA 3B9QA 4GPAA 1Y3AA 3ABIA 4HLUC 3VHXA 3OT1A 5EHXA 1D2NA 1NXTA 4RYDA 1O95A 3NHJA 3UMFA 3JYPA 3OE5A 1CHDA 2QE7A 3IEVA 4YRPA 4QFBA 4PZ0A 3DC7A 5J2TF 3SWWA 1IWPB 1U1DA 5D3QA 2ZDHA 4LXYA 5LZ8A 1NR7A 3LWNA 1ZGAA 1UZAA 3FMVA 3BGWA 4KIWA 5JS6A 3IOMA 4DA0A 2WMDA 2HUPA 1EXDA 3S27A 3ZZUA 4YCCA 4NCAA 3DHVA 3QXCA 4C0LA 4Q3NA 2CHEA 4BTLA 4KQ9A 1NI3A 1MG5A 1U7OA 4QTZA 3SHOA 4LXTA 1QR6A 1W44A 3EWIA 1V5IA 2Q4BA 4RHCA 5T4BA 3HUFA 1JFFA 1SXJC 1YZYA 4FUTA 4GWLA 5AMXA 4CKEA 5LQKA 3NGMA 2EZTA 3E9NA 3G7NA 3P0FA 4PR0A 1RJGA 2P2DA 5LIPA 5CJ2A 4Q47A 2HQOA 1Z18A 3MCWA 3GH3A 2HA3A 4OIMA 2D1FA 4WJZA 2NZJA 2OG2A 1RRCA 1XZQA 3HI6A 1H6BA 1QYIA 4CU5A 2Y0EA 1A9RA 3MGAA 4M3NA 2PA3A 4UBJA 3X1DA 4DARA 3NV9A 4PC3A 2GCEA 4L3WA 3QF7A 2D1RA 4O4HB 5CJPA 5EIBC 4LG1A 3VJMA 1G20A 4X84A 4QPPA 9MHTA 1XG5A 2P78A 1EA7A 3FNIA 1L4HA 1M2JA 3BCRA 2MYTA 2AFVA 1A9QA 1V16A 4IVQA 4NMXB 5DTJA 4MLDA 2F1KA 3CNBA 4XTCS 4EMBA 5HR5A 5T57A 1QH8B 1SBHA 1QFMA 2XJ4A 2YN4A 2HDNB 1KMHA 1TUEA 3IDOA 3TCXB 2XNDD 1NWCA 4PLVA 5DE3A 1TPYA 4OH7A 3UKOA 4BKRA 5K8JB 3BRSA 3O1IC 4CIVA 1OWLA 1EIWA 3H2HA 1DV1A 2I6FA 5HOQA 1OXSC 1N8SA 3DVAB 4LCJA 5CNJA 2NYVA 1PO7A 2Y05A 3PFBA 4QSMA 4GZLA 4Z9YA 5EIXA 4XI9A 1DHRA 4A0HA 3AETB 4LZWA 4EJMA 3C6QA 4BVEA 5JEEA 1ZH6A 1ZNZA 4ZEWA 5JG7A 5JRJA 4AI6A 3ROQA 4MUFA 3ROEA 3G89A 2GN8A 2A1TS 1TA4A 2PKRA 3STUA 3SY8A 4DMFA 1FJGB 1L7AA 3SSNA 1QZZA 1H4QA 1Z88A 3EXEB 4FYIA 1F2UA 3I72A 4P53A 4R1TA 4ZGWA 1VIAA 1RHKA 3WFZA 1K7YA 2V4UA 3UG6A 1J1UA 1KZ7B 4BJ6A 1AXEA 3N2ZB 3RM3A 1GJRA 2MMCA 2I8AA 3WJ2A 2HNKA 3K31A 4RL6A 3JQBC 2VPQA 1SEVA 1MQSA 3I42A 1GZ6A 1PZHA 2X5NA 3ESCA 1RWVA 4BFVA 3KCQA 1F8FA 1T4BA 5LQRA 2ZPAA 3DLTA 4G1VA 2VAVA 3AV3A 4UCWA 4CMIA 3IYLW 5C32A 2DH5A 2EGHA 4M9SA 5KWJA 2X3UA 1Y7PA 4TKMA 2AMJA 2Y0DA 3UT5A 3GD5A 4Q37A 1QIIA 3TJRA 4DNFA 4I4TA 3LHKA 4CV2A 4WZBA 3O93A 1GARA 1W34A 2Y1FA 5JS2A 3NVDA 1W7AA 4HCJA 1FE8A 1NOJA 1Q5PA 3KD3A 2UVPA 3K9LA 5BWBA 1GKLA 4GF5A 2AG5A 4GKKB 3GB9A 1F0KA 4XFKA 4BB9A 3GD7A 1H1TA 1ZUIA 1ZM7A 2B8EA 3GUZA 4ZVPA 3EH2A 3UJHA 4B74A 4PVCA 2D06A 3LCRA 3REGA 1NGSA 5HQTA 3V8RA 1EQAA 1WXEA 5G41A 2PDAA 4I4TB 1G66A 2WVGA 4DXAA 1IUNA 2IP4A 2NSDA 2P1DA 1FYEA 4GKJB 1RIIA 1SXJE 1R0ZA 3X44A 1DCKA 2GKSA 4O2AF 1ZMOA 2AHOA 3V4ZA 1KK3A 2GAAA 1VJ1A 4BLWA 2AKEA 2DPHA 3FRHA 4AURA 2P4HX 2FKAA 4LBZA 3M1YA 5CX4A 3Q41A 1EYZA 2B4AA 4DLNA 4R2WA 5IK2A 5F78A 4GZ6A 3JWIA 4MLPA 5IC5A 4ZKEA 3NTOA 2JL1A 2X86A 1LK0A 4FVTA 4H3HB 3L6RA 3NDIA 4XYGA 3HCBA 3KDSE 1D0SA 1RKXA 1NX9A 3J80A 1M5TA 1V9SA 5KWEA 1XMIA 2B98A 4FBGA 4RQUA 4WK6A 1S1MA 1UM9B 1J8DA 2NM0A 2A9PA 2PJZA 2NGRA 4JLJA 5T3UA 1GZDA 3TFOA 2VJNA 3VXKA 4O4IB 2BR5A 4EEZA 1LRLA 3H5AA 2JJ2D 1I6MA 4NE7A 2NP7A 3FIUA 1FTWA 2P30A 2FOXA 4KBGA 4K9OA 4GYKA 4X1YA 3KJXA 3CUKA 5H8WA 1HFWA 1LLQA 3KJZA 2QJRA 4G0MA 2F3SA 3UUWA 3JAMA 2JIZD 4NAVA 2JASA 4BQQA 4OQFA 1Z6YA 2C04A 3VR2D 1EPUA 2WYWA 1QU3A 3LY5A 1XZJA 4MR8A 1D1QA 1M7GA 5ANRB 3ZEAA 3AKCA 3NVKI 2YDYA 4L4UA 1A9XB 1W75A 1T3TA 4XFJA 4YRNA 3QUAA 1MXHA 1CUEA 3SMVA 2H7YA 1CIVA 3U3OA 4LYJA 1HLPA 2WSYB 2WJZB 2C7PA 2YJNA 1P1RA 4TS3A 3WGUA 4BFTA 2XYGA 2WHQA 4JSYA 5BV1A 3WLOA 4CQJA 6NULA 2MR5A 2F3QA 3Q7RA 4XR4A 3EYWA 5K8UA 3Q7QA 5K8IA 2PXHA 4EYKA 3WLMA 1GFSA 1DC3A 4LJ5A 4EQ6B 4UARA 1XQ1A 5A3JA 1OZ0A 3OPNA 1PQYA 3VTFA 3ZTTA 2RONA 2BOVA 2DR3A 4FX2A 4RKWA 3QFTA 5ERXA 1K2WA 5HS4A 1RWMA 3G9ZA 4N5MA 4DMMA 3KZKA 1VLVA 4YUAA 2BMDA 4P3YA 4F9FA 4NU8X 1CUDA 2WMNB 5AM1A 3EASA 1ZINA 4BNXA 1KI6A 1P1KA 4D42A 3R7DA 4JB3A 4NOLA 1NNLA 5CCBA 2YNMD 1KPIA 3T06B 1G9XA 3HFJA 1TQ4A 3RSLA 4OQMA 4CF3A 3ROPA 3GAFA 5HW0A 5MFZA 4D1YA 5A1TA 4NYMQ 2CL6X 2IZ0A 1KYWA 5A3RA 4B3JA 1ZJ5A 3ZJ4A 4ID3A 3ZDFA 2XE6A 4WNIA 3T34A 4WK4B 4YVFA 4DIDA 3O8RA 1GDTA 2VDLB 3L8MA 1X7GA 5CT8A 3MHTA 1A3CA 4XQCA 3TSZA 4JNKA 2BUCA 1LPSA 3PF9A 4L51A 3MLAA 4C43A 2IU0A 5A62A 1LW6E 4WDQA 2PV0A 3OZCA 5CH8A 2X8WA 3B6MA 1QOPB 4HYTA 2ENUA 4J6FA 2C2MA 3TJMA 1H0KA 3NHWA 3X1WA 3KTFA 1RRMA 3ZW8A 4J07A 1U1CA 4P7FA 1HYHA 1C1XA 3BULA 4HI0E 3B1ZA 2YNMA 1J6UA 1NMQA 2P0YA 3KR0A 4CXMA 1DIBA 4L78A 1XX6A 2FVYA 1IXKA 3D2LA 3IOEA 2YY7A 5JCJD 4Q12A 5ITZA 2GI4A 1VKJA 1NVTA 1I13A 3RVPA 2JLWA 2CMHA 1ENYA 4CFYA 3FGPA 3U61B 3Q88A 3T7KA 1WB9A 3EH1A 3ZU2A 2Z98A 2QBYB 5P21A 5HZGA 1JNXX 1NVAA 2EEZA 4PX2A 1YDGA 5FNZA 2X2FA 3DEKA 3UQZA 3IXLA 1ZAKA 1FYFA 4JWTA 1W93A 3T6KA 3WSTA 1U1IA 4KXQA 3NAMA 3HDVA 3D4OA 2I54A 3SCZA 5F7OA 2Q62A 3AQIA 4W6ZA 1K9SA 3NCTA 3RUIA 4C01A 1NL3A 5A02A 5JFGA 2UXDB 1A9OA 5EG5A 1O9BA 5ESRA 5ERYA 5MFPA 4EJ0A 4ZOEA 4MWTA 5BOSA 3EMKA 1UK6A 4NOMA 2IPAB 3T15A 4E5PA 4XWTA 3VKVA 3W5CA 1BYIA 2B25A 1NUAA 1WCV1 2BKUA 1JDPA 2X23A 2CEAA 4J1NA 3WGHA 1DIGA 1T2VA 4MS4B 3R75A 1DC8A 1GL7A 5I7VA 1MIOA 4RH1A 3ZDRA 3UH0A 1H2XA 1W49A 4EATA 3UAWA 1X7ZA 2XAUA 2OGWA 4BB6A 4UD2A 1DAFA 1A72A 4GG1A 2OORA 3MJEA 5I5GA 2JEYA 2ZCJA 3LC2O 5DX0A 4AO7A 3AG5A 2O7SA 1D1SA 2J0UA 3H18A 5ALMA 1WQ3A 1XB2A 3P97A 1XTQA 3OTOB 1GQQA 9ABPA 1ZONA 3EAFA 3ZHYA 2HHAA 3IIEA 2M1XA 3FTNA 4J9UE 2J8ZA 5JXJA 4EF5A 5FEMA 2B2XA 5FH9A 3KTAB 5HIAA 1VSQA 1WQ1R 2CXQA 3A26A 5L4NA 1YVPA 2G25A 1EK2A 1UKYA 2HWXA 3HJCA 1SUFA 5DULA 4E5UA 1RWOA 3QKSA 2DZDA 4XKJA 4KNYA 2P8SA 2F59A 2AKYA 2JAXA 2QL5A 5GZ6A 4C21A 3P9RA 1EUDA 3KIPA 2WHEA 3D8RA 3PPVA 4QBHA 1OD6A 2J3KA 2YZMA 3I09A 2RGAA 5AHWA 4K9SA 4GP9A 3RF6A 1P19A 4MI1A 3E8SA 4QARA 3BDVA 1Y5NA 4YYEA 1S2NA 1VL1A 4BVLA 3NOXA 1QQ7A 4OVKA 2EFDB 4PHTA 3ZU6A 5TF4A 3EFHA 1SCIA 5KJEA 1HDGO 4HHEA 5EUBA 1Z8HA 4ZHSA 4ZPJA 1UP4A 2RSLA 4IH1A 3FF1A 5E9JA 1EDBA 2FWIA 3BMQB 4RK4A 3I8OA 1RWXA 2XZDA 1N5OX 4I3FA 1Y63A 4IV8A 5DV9A 1TJPB 3CRZA 4BKQA 4Q1BA 1X7WB 4AKEA 1V7CA 2F43B 2ZRGA 4GUAA 3IL2A 1JPVA 3TH5A 4WY8A 3BZUA 4CUKA 4HY3A 4YRSA 3F8TA 4RPCA 4WAUA 3FI9A 4EVSA 4ZDKA 3RFVA 4MR9A 3DAYA 1SOVA 5I9MA 2ISQA 1YZNA 1FP4B 2AGVA 4NBLA 1YI0A 1CRLA 1KC3A 1LSOA 2RHDA 4JJFA 1NNSA 1PNRA 2OECA 2ZAMA 5AK4A 3U0BA 1KOJA 3N2IA 3TLGA 4UXHA 3VR3D 1FMJA 1HDRA 4WLNA 4X64B 2I34A 2Q7XA 1NLMA 4ZOLA 4RIIA 4E30A 4ZAFA 4R1NA 1CJBA 1YZLA 1IY9A 4S1NA 4D0GA 4Y3UA 2LIPA 2UXBB 1YACA 1FFAA 3LCVB 3U31A 1MZPA 1AK1A 4KBFA 4JHXA 4E5VA 2CVZA 3I4FA 2WINI 3EXFB 3MS7A 2R48A 4RXUA 3AEKA 3HWSA 1XCOA 4IXNA 4OB6A 3LOQA 1GG8A 3QRWA 3NBAA 1VZ3A 4QOHA 2BZSA 3AUSA 3QZUA 2BSXA 3JQ9C 1JDZA 3KOUA 1P29A 3ET5A 3H9UA 5AJHA 5GP1A 3TGWA 2X1LA 4PG6A 1FFEA 4DC0A 3D43A 5JXIA 1A8HA 1WXXA 3SDZA 1IM5A 1ZJYA 1VL6A 3KHSA 3H2GA 3TUIC 3UCFA 1X14A 2BY4A 3EN0A 4K86A 3GDHA 1IFXA 2PLNA 4C4RA 5IKEA 2CNKA 3CPEA 3QVXA 5AUPB 3LVRE 4FBLA 5GIPE 5IDYA 1DNPA 1U7HA 2VYND 2OYSA 1EGHA 2CV2A 2XUZA 3JTEA 1AK2A 5ICCA 4ZYZA 4TTAA 2UUPA 4DTIA 2C4TA 4GR5A 2VNSA 2ISCA 2YHAA 1PJLA 3BMCB 3CZAA 2VUTA 1AKNA 2XUOA 3DOJA 4IWNA 4MRMB 4RD1A 1JN0A 3T1QA 3TPFA 4B0OA 1SN7A 2AN9A 2VUSA 4MVCA 4X44A 2VJLA 4MRSA 3VNVA 4YPVA 2B61A 4A6EA 1SCUA 3WWOA 3HDHA 2O2JA 4H7DA 4IVPA 4Q4HB 2WQ6A 1RLMA 3BE6A 3DOEA 4F3NA 1OPRA 1T1SA 1THMA 3UG7A 1PEAA 4CKXA 3C24A 1NUTA 3X2FA 7AT1A 1XA0A 1R66A 4QPNA 5K3OA 3GLKA 2BJWA 2XR1A 2A4MA 2O2CA 1U3FA 2QZJA 4QL3A 2LNDA 5BW5A 2QUJA 3EIUA 1EM6A 4UU1A 1LBTA 4GX2A 5KX5B 5LXTB 4O4JF 4GM0A 4MRVA 1V7ZA 2P3SA 2QIPA 2E4ZA 4DQUA 2M1ZA 5HE9A 5I7UA 3VAAA 2ZBVA 3TZ6A 5T6MA 3ZYZA 4I55B 3JQDA 4WBSA 2EG5A 1NJ2A 1KAQA 1OASA 5EEHA 2VZLA 4KEAA 4X8HA 3J81k 1KI8A 1I7NA 2BF7A 4NIMA 5IRCD 3U7QB 3Q98A 3TIXB 3UMMA 1AQUA 5DYNA 2INGX 3QJYA 4ZCSA 3FOAA 4B8YA 2E21A 1XU4A 3AKYA 3K0FB 5AVXA 2PUAA 2Q29A 3JATB 3ZHOA 3WGGA 5BVGB 1L8OA 1PL0A 2O1WA 3C1UA 1JGTA 4ISBA 4XIYA 2FZWA 5TY0A 3QEOA 1E98A 2QJTA 2W58A 1ZPDA 1D6NA 1ZESA 4ICIA 5EKSA 3VO2A 1NQ5A 4LQ4A 3I9V1 2FXVA 2KSQA 2DTDA 1LSSA 3QA9A 1GOTA 5B3JA 5HKAA 1L8LA 3IOYA 2RGGA 1XA4A 4I66A 2CL5A 1C0EA 1IAVA 2YVQA 1S9HA 3KB2A 2JAUA 3PNMA 4J76A 4NG4A 2XXBA 3IQDB 4O3FA 5CVEA 1TO1E 2J3DA 4FYYA 1Q16A 2BGMA 2BP7A 3TSWA 1XVUA 4EMSA 2ECFA 3A6JA 3BILA 1YKSA 2VQSA 2GNPA 2FPOA 3KFLA 3HN7A 1RRPA 2QTMA 4FYVA 5G0VA 4E11A 1YAJA 2V7QD 3ADBA 3CZPA 3FRJA 5DW3A 4Q15A 3LG2A 2OMEA 3ND9A 4X62B 3ZGVA 5IS2A 2Q5LA 4MV7A 2REXB 3AZOA 1O2DA 3EYAA 4AY3A 1TK2A 1JYEA 3KZXA 3CIFA 3SYRA 3ROTA 1RWKA 3TXYA 1HTTA 4FR2A 4KQMA 5GV8A 2VQFB 1FQWA 2QRKA 2K87A 3KE9A 1O96B 4PYQA 5FPQA 2IH4A 5B4UA 1TF7A 3L8CA 4QUIA 3ZK7A 3QI2A 3I76A 3MJRA 4MI9A 1JJIA 1JHZA 2DULA 3HN6A 3P8ZA 1XDBA 4DGSA 3L4SO 4CVNA 2Q4EA 2WAAA 5HILA 2IUTA 1VFPA 2WQZA 3ZXIA 5K45A 1XZKA 3EZFA 3K73O 5IJ0B 1QGOA 3O8DA 5E8JA 1W85A 2IEYA 2VQDA 2RHOA 3TE6A 1U63A 4JIGA 1IXZA 4NSNA 2C4VA 4FJ0A 1DJOA 2G0TA 3REFA 3THWB 4ZZ3A 2DWCA 2XKKA 2BC9A 2O5VA 2VZ0A 1OGJA 2C07A 2X5JO 2XF2A 3NW9A 3WHLA 1JP7A 3I39X 4V0SA 2GJSA 3BAZA 3VI3B 1QIFA 1I5OA 3U44B 5DKFA 3ZCVA 3O83A 4ZYWA 1ONNA 4EI9A 2JFYA 4N6OA 1J0CA 1ZD5A 3UNXA 1WUJS 2CEKA 1EE1A 1JWAB 3IGFA 4B85A 2IBTA 4IVNA 4DYDA 1LQTA 1O3YA 1C1HA 3O91A 2B4KA 3ZXXA 4M54A 1H9BA 4ENSA 2YV5A 2FRDA 5JQWA 1URPA 2JGRA 4L7VA 3AVQA 3OMWA 2JG3A 2VYVA 2VJBA 3MWDA 4YLGA 1TUIA 5B2ZA 4CV3A 5EIBD 5GM2A 2IYSA 5EPUA 3F6EX 4QX6A 5B1DA 1O5TA 2FP4A 5KSWB 1KMNA 1KSHA 2BJHA 3GYBA 3FTFA 3KYDB 1B23P 2BCJQ 1I2DA 1X1DA 4E5DA 1DOAA 1DU4A 5J5VA 2PQ2A 3EBOA 1JH9A 1P0IA 1KJZA 1NJ8A 2Q3LA 4IMRA 1P80A 3H2ZA 3A04A 4HEQA 4LJYA 1MORA 3RABA 1YI1A 3ZHRA 4JLSA 1AGRA 4BE9A 5J58A 2QJFA 4PZ9A 2PQ6A 1C4KA 4R0VA 4TWAA 1KNQA 3MCUA 3RK0A 3VKGA 4JBYA 2YZGA 1SUIA 1ZD1A 1YULA 2QXYA 3D1JA 3TVDA 1TX4B 2QL9A 5C81A 3VV3A 3QVGA 3C7DB 4E3ZA 4FD3A 4Y0NA 1DFIA 1OBOA 1V47A 3GBVA 4YYZA 1IZ7A 3D7RA 1SCDA 1C0LA 2C7VA 3SZGA 3ZE6A 1E0AA 4RS3A 1Z6TA 3WL4A 4IEFB 1EX7A 3FNFA 3RVQA 4D4GA 5JNRA 1NNUA 1HFKA 2HB6A 1GN9A 4L73A 2FWJA 1QAQA 2XYHA 4OI2A 4WY5A 3W5UA 2DCUA 4BAGA 2RE8A 5K20A 3I5AA 3HGTA 5LD2C 2CF5A 5JS1A 3NVAA 3BDIA 2KLBA 4JELA 3CF2A 1VYTA 4JMPA 4YJ3A 3G23A 1RYMA 2HRBA 1WHSB 2FN7A 1NQUA 4UHEA 3KZOA 5DXAA 4QEDA 4LJ9A 1XLVA 2EFJA 4XUDA 5FAXA 2PZAA 2P68A 4K8RB 2V96A 4FNAA 4AIIA 4MB0A 5SYAA 1W2HA 2LUOA 1AQLA 3TN7A 3FYUB 3LQRA 5GY7A 2NQ8A 3V1NA 4D43A 3R20A 4ESOA 3N8GA 1IN8A 1UZLA 5KYTA 3N2GA 4EAAA 4B4UA 3UO8B 4LXUA 4E2FA 1W76A 1RI5A 3ECSA 5FTLA 1FZQA 3G0CA 4FZJA 2AH5A 1K66A 4ZIRA 2CLLB 4PIPA 5ILOA 3E1SA 1O1YA 3H1EA 2TMYA 4MGZR 4MP3A 2W7TA 4FKMA 1QHYA 4GE3A 5EZYF 3SIWA 2E7ZA 4PFSA 4QO8A 4RK1A 4N12A 1PLKA 3HB0A 4G97A 1XTUA 3KETA 3AR3A 3H97A 3D6FA 4IHQA 4B6SA 2V58A 4M49A 1BGXT 4EKEA 2FEXA 2ZYAA 1DBSA 4FGSA 3GPBA 1OROA 1ZI6A 3P9NA 4GECA 5C8YA 3SAJA 5LU8A 1TJ4A 3SS8A 2QLNA 1WBJB 4WVFA 4IBOA 2JF0A 4MR7A 1WMAA 2BZ0A 2ZUCA 1B6RA 2OBYA 4D9GA 1KIFA 2J7KA 4PPNA 1CF4A 1M6VB 3FZYA 4N0DA 4HV4A 3EQ9A 2GZSA 1XRJA 4FN5A 4IHJA 3ZNOA 5IJ9B 1YCDA 2X8BA 4B3HA 4TWBA 5JXGA 2P2ZA 2I1WA 4EEXA 5K6AC 1JIQA 1LDMA 1AGYA 1NV8A 2XA9A 3U7HB 2BMAA 3CISA 1G9SA 4X41A 4EB0A 4DBZA 4UTZA 3NIBA 4DLWA 1DKRA 3DAOA 2C2OA 2EU8A 3LX8A 2FPIB 1OXTA 4FYKA 2JLVA 2VF8A 3ANLA 4HXGA 3JYOA 3OCXA 3UMJA 4EO9A 1I9CA 2H9AA 1G3IA 1U0FA 4WZZA 5H68A 3TW4A 3FSJX 1N5MA 4TM8A 3RBXA 1AKVA 3K70B 4WNAB 5LQJA 5K3DA 3T4XA 3ZY3A 3KZ1E 3G2OA 1H2FA 3QSYA 3VSDA 3ICWA 3IIKA 3GDFA 3O47A 3QELB 4P86A 3ZDZB 3RU7A 1OTYA 3B2NA 4ZDJA 3GLIE 4DXDA 2PUFA 3OOJA 2BBTA 2C1EA 1EX1A 2VUHB 2EKQA 2O0LA 4Z0HO 2Y6UA 3DTVB 3GJXC 2X1MA 1KORA 3F7OA 1R8YA 4U3JA 3BHNA 4W1RA 2XT9A 4EJSA 4EGAA 4PLCA 4YMLA 1IIRA 2EJUA 2NYAA 3GY0A 3W1VA 2XTNA 3ZXYA 3RH0A 2YMQA 2A0YA 2W6CX 4M38A 4YFVA 1JMVA 3L9XA 5EJMA 3ZKAA 4PN7A 4MTCA 3S68A 1BU8A 1RIFA 1TT5A 3MMPA 5TR9A 2XJ9A 4P4NA 4Y2TA 1NBIA 4HAWA 3LF1A 4R1SA 3V8QA 1I9GA 1PZGA 3N3BC 4C7XA 3D31A 4WLFA 2IUUA 5JSHA 1SZPA 2H0QA 3CH5A 1A7JA 1ZC3A 3H65A 4ZTUB 1E8MA 1EK5A 4HGNA 2P3LA 3OZXA 1FFDA 3DBLB 4MI6A 4D82A 4K8OA 4MNTA 4DFDA 4UFNA 1L5HB 4IXMA 2XBUA 5J4LA 2DWOA 2XUGA 4OGKA 3O2SB 1CNFA 3FD8A 4ARUA 3WA6A 4P9NA 1EBBA 3WWZA 2JLUA 1T2AA 3C7TA 3QIAA 1QG2A 1I8TA 4HZGA 3C3PA 3F7TA 1YRBA 3K4QA 4EJSB 3N5KA 4UDXX 4JGGA 3F9RA 4L3OA 4M46A 2BFEA 8GPBA 2VK2A 3LCUA 4ZQBA 5FJJA 2VNAA 2BBWA 2GUWA 1T1IA 2XB6A 4YQYA 1VG8A 5E6UA 4CM1A 4EKNB 4ERXA 3HUDA 5BSFA 5JCPA 3MJ4A 1YRAA 3R3VA 5D6OA 1NPTO 1CQWA 4EL5A 5AT1A 3IP5A 4BKOA 4QXPA 2HL6A 1GPJA 1PL7A 1SKUA 4RLFA 5JNTA 5FFFA 3DQZA 1W0JD 2Q0SA 3KZCA 4XQEA 1YRLA 2GZAA 4C4TA 2NVBA 3KL2A 1GQ2A 4MVWA 3UJ7A 4GOND 3K70C 3A7EA 3QV2A 5DOVA 2AB0A 1Q0HA 2IP2A 2IHBA 5DM60 3V8NA 2FN4A 1DTWA 2ADMA 3EQ7A 1TPZA 3HDGA 2HW8A 3ISVA 5AQ1A 4L75A 5BMVA 1YBFA 4WMLA 3S7TA 3CHYA 3KFXA 4KB5A 3TLGB 4DLYA 5DMHA 3OEED 3W8DA 1YL7A 1P39A 1KQ3A 2FZEA 4N41A 5BMOA 1QNFA 2FMUA 1UK9A 1MPTA 3EF0A 1TMKA 2JI6A 3MWEA 4PC7A 1G1MA 4TXNA 4WL0A 2ADFA 4BYMA 4RFSB 4YMWA 3RK1A 2YFYA 3CPHA 4HNAB 3OSUA 1QE5A 2VP2A 2MSCB 4PZZA 2G9ZA 4JYMA 4QVKA 1GNPA 1TM5E 3LI2A 3BZWA 4FHGA 4OMCA 4YRMA 1VE9A 4PN3A 2FPGA 4CKZA 5K3FA 5CURA 1E9BA 4XE5A 5CFPA 4UE6A 4C78A 4F45A 1X7YB 1ABFA 1W0JA 5CG2A 4I9UA 4NS4A 1W52X 2EYUA 2TMDA 3SIXA 4BO5A 3L6EA 1QCYA 1IY1A 4DUGD 1JZSA 5LLTA 2WHRA 3MRXA 4OFXA 4RKYA 1SVWA 3KO8A 3DV2A 4YP7A 2CZCA 1W5SA 1M76A 3NCHA 1K7EB 2RGYA 1XFDA 1TF5A 4AULA 3GLFE 4JGIA 4FQ8A 3VBCA 3SMQA 4MMYB 4AUKA 4YMTA 3FA2A 5KJ1A 1M54A 3DJFA 2EFHB 2OB1A 1LZKA 3TSOA 4FJ2A 1H6CA 1MP0A 3EQ8A 5JADA 3HFSA 1HE5A 2B6NA 3VR3A 1GFZA 3AHDA 2IXEA 3IDSA 4DVJA 5KTYA 3KX2A 4EHKA 2NUBA 2H2DA 1Y9AA 4LZJA 1T0BA 1D8AA 4URYR 5AM0A 4JDUA 3BWMA 3WGQA 3DDWA 1JA9A 3WKAA 1B73A 6LDHA 2DBZA 3SJUA 1VYVA 2IA5A 3MJVA 4HFNA 3VHRA 3H3FA 4OATA 5B2FA 1NP3A 5DNCA 3I30X 1UH5A 3QNUA 2NO7A 3IC5A 1JLLB 1U7ZA 2A30A 4EA8A 3WK9A 1EGMB 4V3BA 5J2TB 1J8YF 4EYQA 1UJCA 2QU7A 3QMVA 3LAWA 4CLRB 1FRQA 5DNEA 3T7CA 4FYMA 4KN9S 3WK5A 3RYHB 2WY2D 1PJTA 1ZUNB 2XOEA 3T38A 5KTNA 4XVQA 1P7CA 1OR8A 4M9RA 1C30A 1NXOA 3BHJA 3WADA 5JS8A 3GIWA 3L6UA 3AG6A 4QYWA 2BJVA 4PFKA 3WAKA 3W9SA 2B94A 3C70A 3MK31 4H1WA 3AJRA 4D4MA 5AW6A 5IDQA 2IYVA 4KMMA 2VJKA 3V48A 1UDRA 2I80A 4YACA 4ZALA 5C1BA 3C6ZA 5CDUA 3PC7A 3SX4A 4NICA 1NR1A 1IG0A 5EGSA 1AN9A 4NZMA 1QM5A 2JFZA 2JNWA 4N6GA 1RHMA 3P52A 4F8YA 3KDAA 1DO0A 2WLSA 2H18A 4P38A 1IN6A 3CW9A 4TLDA 4EP1A 4WX2B 4GHWA 3GPCA 4QU5A 4RFVA 2B99A 3W2TA 3Q9NA 4C5BA 1BHO1 1ECBA 1MX3A 2I67A 2G17A 3FDZB 1E79D 2HF9A 2OZLB 2YV1A 3B3GA 4MJ3A 5L3RA 4K6HA 2J48A 1TZJA 2P0EA 3GROA 2QMHA 3BD8A 5KQPA 2J3LA 1PR1A 4YRJA 1V1RA 4EHLA 3O3NB 4KRGA 1A4UA 1L4UA 3IHWA 5FWYA 1CE8A 3NS7A 4HDCA 2G1PA 2CNOA 2VDJA 3LUHA 2PZBA 2HWKA 2JD0A 1US8A 3RASA 2V0CA 3CY6A 4RELA 2X9NA 2O8DA 5DLDA 4EUNA 5B30A 3AB3A 3ZJYA 3HNRA 4BX3A 4F6RA 1C1XB 2XH8A 5IJ0A 5FBHA 5TQ0B 1Y3IA 1TU0A 2Q0XA 1U0NA 4UEWA 3BK2A