4DMFA

Crystal structure of the cftr inhibitory factor cif with the h177a mutation
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
293
structure length
293
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWAFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Inhibiting an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa Protects CFTR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 111
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dmfA01
2WHPA 4DNFA 3LLCA 4KAJA 2P8SA 2VT6A 3I6MA 3QYJA 4B0OA 4AZ0A 3UUFA 4C01A 4EA6A 3WKBA 2BKLA 1CUVA 2AJCA 4P92A 3FYTA 5T4FA 1IVYA 1N5RA 3QMWA 5A71A 4FLFA 1R1DA 1KU6A 3O4HA 1CRLA 3HXKA 4C4ZA 4X95A 1WB6A 2PSJA 3VJKA 1QIHA 2HA3A 1H2YA 1JT2A 5I7UA 1CVLA 3C87A 1VA5A 1MX1A 1CFJA 1DQZA 5ALMA 4Q34A 3HEAA 4P9NA 4CCWA 5CURA 3F98A 3IURA 1EB9A 2XQFA 2R11A 3ZV7A 4FMPA 4GDMA 4GECA 3WQHA 3DS8A 4EY4A 3GROA 1XLUA 4L0CA 2XMQA 2EDCA 5K5EA 3DYIA 4F21A 1RYYA 2H9YA 4H7KA 2CJPA 3GA7A 3I2IA 3F8SA 1BCSA 3QMMA 2PVSA 4EY6A 3G0DA 1T2NA 6YASA 4NVRA 4B6GA 5LKRA 3G0IA 3AIKA 5LIPA 5AH0A 4EZIA 3H1AA 4H7FA 3B3QA 5AKJA 5LZ2A 2VJDA 3WL6A 3ZPXA 3R0VA 1GZ7A 2FX5A 3V9AA 1XROA 2JGIA 3OPMA 2PSDA 3AUKA 4PSDA 1N1MA 1QFSA 3ZWQA 5AK3A 2X5XA 1WPRA 4B85A 2HA7A 3D5EA 2Y6VA 2XQGA 5DTJA 2QTBA 2XUKA 5JAPA 4XIIA 3L1HA 4GBGA 4Y7DA 4OD0A 4M0EA 4CCYB 4CCYA 1ACJA 1MX9A 4RNCA 2WHQA 1HLGA 4G8CA 1CUYA 1F6WA 1XFDA 2QXTA 5F4ZA 3L1JA 2JBWA 4K6GA 1AZWA 5ALPA 1DU4A 1EA5A 1HPLA 1WM1A 1M33A 1UWCA 3BDVA 3E3AA 5HF6A 3UUEA 4FFWA 1CUIA 3O4JA 5CMLA 4Q3KA 3AZPA 3UMJA 4N5HX 4UHEA 1U2EA 2CMFA 4XVCA 2DHEA 4IO0A 3G7NA 1FFCA 1ISPA 5EGNA 3S8YA 5ALJA 2O2HA 5CXUA 5C8XA 5HK8A 1VXRA 2VA9A 1YA8A 4BVKA 4ZRDA 4Y9SA 4GW3A 2C5GA 2QJRA 1BEEA 1XZBA 1NU6A 1N8SA 3WIOA 5DNVA 4WDQA 3PICA 1L7QA 2AJLI 1WCYA 3FLBA 2B9VA 2XQIA 3C8DA 2VJBA 5AM5A 2QT9A 1TKRA 2VATA 5CT8A 3NUZA 1JMYA 3M82A 1CUHA 2QOEA 4RE5A 4Y2SA 4BP8A 1X70A 4B81A 1ACLA 5AI9A 4WY5A 1CUXA 1WPXA 4CG3A 1O6FA 4INZA 4OU4A 3PFBA 3W9UA 2AJDA 1R3DA 3D2CA 1CPYA 4W1RA 4X3CA 2WU4A 4M0FA 4F60A 1H2ZA 2V97A 2FJPA 4QEKA 3R3WA 1L7RA 5CH5A 3KD2A 2XMCA 2ACKA 1VE6A 4Y2VA 1LZLA 3D59A 2HIHA 3WK8A 1GXSA 4BRZA 4JNCA 5AKGA 5JATA 2B20A 1LPOA 1XRLA 1E89A 1VLQA 4IH1A 4J0KA 5CT5A 4Q3LA 5IVDA 4A23A 3H1BA 1CUDA 2PU7A 3MGAA 2WJ4A 4XJVA 5ALTA 3WK5A 4UBMA 2BUBA 2CEKA 3C8HA 4G5XA 4QWWA 5ALOA 3WZMA 1DX4A 3U1TA 5ALWA 5JD6A 1XZEA 4BAUA 5ALNA 4AN0A 1XZJA 4X6UA 4L9AA 1UKBA 1A7UA 4KEAA 2WG1A 1C7JA 3STWA 3DQZA 2RIPA 3EQ9A 4NZZA 3WJ2A 3QZUA 5H3HA 1XZLA 2XB6A 3G9UA 3C6ZA 3QMVA 2BCEA 2WIFA 5FPQA 4K5QA 4B84A 1BS9A 1LPNA 3QH4A 3D2AA 1XQWA 4WJLA 5I8PA 2XLBA 3QBJA 2I03A 2FJ0A 4E11A 1LPBB 1LBTA 2PU5A 4J03A 4B7ZA 1IUPA 3HLKA 4EY8A 5K3BA 3WKAA 4ZXFA 3QPCA 2PX6A 2VEOA 4QDOA 3PE6A 4BB0A 3TGLA 1DQYA 1E66A 4UHFA 1XRMA 5AIAA 1IZ8A 2JEYA 3I28A 1J2EA 2W22A 1DT5A 3M83A 3WWCA 4ZGBA 1IUOA 4UBKA 5ALRA 2WG0A 1GT6A 2OG1A 5LKAA 4PNZA 4LYDA 3C6BA 2HU5A 5AICA 2ZYRA 2VTVA 1QIDA 1HL7A 3G0BA 1U8EA 1R9MA 5E4JA 4CFSA 4FKBA 4J0IA 5AM3A 4GEGA 4ROTA 3FCYA 3O4GA 2QUAA 2ZJFA 4UUQA 3E1GA 1UFOA 2QM0A 2CBGA 4CG2A 2NW6A 5K3FB 2WTNA 1Y7IA 2JGFA 1EK1A 2OGZA 3PI6A 3B5EA 1XQYA 2OGTA 4J0CA 3STVA 3HI4A 1DINA 1NX9A 1UK7A 3H18A 5HK9A 4XX1A 4PSCA 1L7AA 5HQ3A 1CUFA 2YXPX 5LLSA 3M3DA 5AKEA 4FFVA 3VVLA 3QVMA 2DR0A 3HZOA 4LKOA 3H2KA 2WQZA 3HRHA 1YSCA 4MQMA 4U2FA 2RHTA 2DHDA 3PF9A 5CT6A 3KXPA 1GQRA 4EHBA 5IVKA 1XZKA 3HYSA 3B12A 3R3YA 2ZVDA 2O2IA 5ISMA 1XZIA 1LLFA 3WA7A 2CB9A 2ACEA 2ZSHA 3WZLA 1CUAA 4OPMA 1AX9A 4IQ4A 3DL7A 3TEJA 4KE7A 5E4YA 5HF9A 4GWLA 1CUCA 5ALYA 4X90A 2B61A 2OQVA 2GBCA 2ZYHA 1FFEA 4KRXA 1ZD2P 2HHAA 2XI4A 5A2GA 3C45A 1CUUA 5AOBA 3CXUA 3FWHA 4HRYA 4WY8A 2G5TA 1MAHA 5FOQA 3QPAA 1AUOA 4E14A 1K6EA 1C4XA 3FVRA 4UBOA 5DWDA 2AJBA 4OCZA 3O9MA 4BP9A 1QIIA 5AK6A 3ESDA 1EVEA 5DNWA 4DM7A 1UT6A 4U2EA 5YASA 1H2WA 4ZREA 2GYUA 4JYPA 1YCDA 4DNOA 5EFZA 4X94A 3F97A 4KYVA 4EY7A 4DYHA 3I6YA 4MJ3A 4AO6A 4GLBA 1R9NA 5AKHA 1H2XA 3ICVA 2WU3A 4KRYA 1JJBA 1GKKA 2WKWA 4H7IA 1MX5A 5JIBA 2I3DA 3EF3A 3IUQA 3H2HA 1AKNA 3U0VA 5T4HA 3F9CA 3RKSA 3PF8A 3BJRA 4M0MA 2ES4A 4NMWA 1TAHA 2W6CX 2QRUA 4B82A 1CUSA 5HFNA 1W76A 3QPDA 1U4NA 1XZFA 2HRRA 5C81A 4PQEA 3H19A 1G5FA 4C4YA 2HU7A 1ETHA 3R3UA 2QKYA 4DMFA 2HU8A 3PFCA 5SYMA 4MYSA 4ARBA 3KWJA 1ODCA 3LIPA 5ALDA 2VF2A 5AM2A 4N8DA 1GQSA 4BBZA 4N5IX 3FSGD 3CN7A 3G9ZA 3G9XA 1LZKA 4PO3X 3KOOA 4CI9A 1AMNA 4UHHA 4E46A 2EEPA 1VZ2A 2V98A 4UFPA 1SOMA 3V48A 3H17A 1QE3A 4ZV9A 4MEBA 4J7AA 3LCRA 4H7EA 4DIUA 1P0MA 2VJAA 4TVKA 5HKAA 1AURA 5DJ5A 3WK9A 4ETWA 4EUSA 3WWEA 2XUQA 5DNUA 4J0GA 4F5ZA 4J3JA 2HA0A 4PF1A 4G8DA 4BE9A 1H22A 3K6KA 3ESBA 5LZ4A 3AILA 3DLTA 3KWFA 3WKDA 1O6GA 1CV2A 4RPCA 3IDAA 5IH7A 2WSLA 5LZ7A 3A70A 3D0KA 3C6YA 3WWOA 4TPKA 4B83A 2OAGA 3MVEA 3N2ZB 4H7JA 5CBKA 2WILA 2OAEA 5JYCA 2VSQA 2Q0XA 1W4LA 5LZ5A 2VJCA 1BN7A 4C4XA 5BWBA 1ZICA 2Z3ZA 3JYHA 5LP1A 4DMHA 1TRHA 4BDTA 3W04A 2XMZA 5AK5A 4MQLA 2G63A 2DQZA 2ORYA 1FFBA 1TK3A 1CLEA 4V2IA 3DL4A 1LPAB 4DNPA 4UPDA 5AJHA 1XLVA 2XUOA 1MU0A 1Y37A 4WFIA 4ZWNA 3WI7A 3DKKA 5AKYA 4H7HA 4I3FA 1DX6A 2OPHA 4MWSA 5EIEA 3AZOA 3FLEA 3DNMA 2CUTA 4WFKA 2XUIA 2E3JA 4CG1A 1ODTC 1W75A 2Y2VA 1QIFA 4RGYA 4AQDA 3F67A 3O95A 3EQ8A 2XE4A 1LPMA 5E2IA 4FLMA 3ZLVA 2G5PA 2WM2A 2WJ3A 2QJWA 4BRSA 5ALIA 3RM3A 1QOZA 1WB5A 2HA2A 2G4LA 2K2QB 1F0PA 3G02A 1ZI9A 3M81A 1VZ3A 1G42A 3WWPA 1J1IA 5FPPA 2V9ZA 5DLPA 3P2MA 1VA4A 1SCIA 3AJAA 1EHYA 3TJMA 2HA6A 4FLEA 4I19A 2ROQA 5HCUA 1GGVA 1R50A 5ALSA 3CCCA 3ESCA 5E4TA 1B41A 3O9VA 5FRDA 5T4EA 4HAIA 4WDRA 1YA4A 3TRDA 3KSRA 2DQYA 4QE3A 2GZRA 3JWEA 5D3KA 4WFJA 1F0NA 3AFIA 4FBLA 1ZIYA 4JUIA 3WWDA 4Q3OA 1BROA 2QR5A 1X2EA 1VE7A 1WHSA 1QIMA 5EHZA 1QTIA 4U2BA 4G4JA 2DHCA 4BZZA 5AKZA 4N8EA 3R41A 4A5SA 4BDSA 4J0DA 1MTZA 4GHWA 4KR0A 1DWPA 5ALUA 1UZAA 4BE4A 3FBWA 4L3WA 4WCVA 4BCBA 3STYA 1CUJA 5AKXA 1HQDA 5ALHA 1C7IA 1BE0A 2HM7A 2GBFA 3FOBA 5SYNA 5AOCA 1A8SA 2C7BA 5JD5A 3KDAA 4JYMA 5HF8A 4YASA 1BRTA 2WHRA 1YAHA 2HA4A 3PDCA 5AI0A 4CIAA 1QJ4A 4LHEA 5CW2A 4B9EA 3EIOA 2HFJA 1BEZA 1MNAA 2JGLA 1ORWA 3FLAA 3GUUA 1E5TA 3NWOA 3IUNA 2VAVA 2WFLB 2WFLA 3O4IA 1YS2X 2DFPA 2XUJA 1EI9A 1YAJA 5D6OA 2HA5A 5FKJA 4KAFA 1FFAA 2OCLA 4F0JA 2AJ8A 1XRNA 2CZQA 1BU8A 4FHZA 3AIMA 1CEXA 2XMDA 5C8VA 1IZ7A 4AO7A 5A7HA 2QXUA 4OB6A 2Z3WA 1X2BA 4BAGA 1EDDA 3PUHA 1DWQA 3W05A 1XKLA 2OCKA 3A2MA 3YASA 4BAZA 4QA9A 4ZV7A 4HS9A 4B0PA 4PV7A 2RGUA 3WYNA 4AMYA 1USWA 5D7BA 5BV7A 2Z5GA 2V96A 4IHAA 4X6XA 1A8QA 2H1IA 2IITA 5ALQA 1QIJA 4DSZA 5DYWA 5ALFA 1PV1A 1ZD4A 4HTAA 2WFMA 1QLWA 3R40A 4ARAA 1ZD5A 4QDTA 3GFFA 4C6HA 3GBSA 1EK2A 5ALXA 2YYSA 3C5WP 5FP0A 5KBYA 4QDZA 4C88A 4OYLA 1W1IA 4EY5A 4X97A 4G8BA 3QM1A 1E8NA 3IUMA 3T52A 1SCKA 3D3NA 5AKKA 1G66A 1XKTA 5K3FA 3WMRA 3IB3A 2EDAA 4ITVA 3IBTA 4H7DA 1YB6A 3FSGA 4OB7A 1RWQA 2WTMA 1Q0ZA 4KJXA 3K9BA 4MYDA 2BAGA 3OM8A 3DEAA 2PL5A 1JJFA 2QVBA 1CUGA 2JGKA 3G0GA 1K8QA 5AKLA 4E15A 2XT0A 3A2LA 4UBIA 4PSUA 2DSNA 2OQIA 4BCDA 4Y2RA 4Y2QA 3V1MA 4DMKA 3DDUA 1THGA 5AI4A 2JF0A 5EHQA 4QZVA 2OCGA 3S2ZA 1G4HA 3EQ7A 3GELA 1MPXA 2WIKA 1GPKA 3QITA 2WUFA 1XZHA 4H77A 2Z8XA 1F8UA 5ALVA 1B6GA 4QLOA 4Q82A 1RP1A 1P0PA 3AINA 1HKHA 2UZ0A 5ESRA 1ZGBA 4HXEB 4QDUA 1P0IA 5AOAA 1MAAA 3D2BA 1OCEA 2HRQA 1XQVA 4UBNA 3Q8WA 2CKMA 4AMZA 1FJ2A 1UXOA 1JKMA 2X76A 4HXFB 2XUGA 3AIOA 3WLAA 2YASA 1ODSA 3BWXA 3IIIA 2HADA 2JIDA 4UBJA 3BF7A 3VVMA 3IVMA 3SWWA 1A88A 4MWTA 2J3QA 4B9AA 3GZJA 3K2IA 4DMCA 1KEZA 4S0XA 1EX9A 1MJ5A 3RK4A 3VKFA 3I1IA 1QIEA 1Q83A 1K63A 3H04A 4X85A 1UOPA 4FNGA 1UKAA 3VISA 1DT3A 4QNNA 1A8UA 4JEIA 5K3AA 3OTQA 2IIVA 5LZ9A 1XRRA 4Z49A 4TGLA 2PUJA 5AP9A 2BUAA 2PKYX 5A7GA 3C43A 3EBLA 3AZQA 5JANA 4K6KA 4Q1VA 5K3DA 1OILA 5DYTA 3BF8A 2ZYIA 5JARA 4NS4A 4X91A 1TQHA 1YR2A 3I2GA 5FLKA 1UOQA 3STTA 5AM4A 2OGSA 2R8BA 2C58A 2GYVA 4EB0A 1IMJA 3ED1A 1TCCA 2XQKA 1CR6A 5JD4A 3I1YA 2RONA 2XDWA 1WHTA 2XLCA 4KE9A 1UK6A 4X71A 3I6ZA 1VOTA 1VJ5A 5FUMA 2RAUA 4G4IA 4HRXA 3PUIA 4AZ3A 4FNMA 2LIPA 1QO9A 3C6XA 1K5PA 4DLNA 1XZAA 3WYDA 5AK4A 1KU0A 3ANTA 2OLEA 5ALEA 2Y6UA 3R3XA 2WIJA 1Q0RA 3D4LA 3T4UA 4MXDA 2O7RA 4J0JA 2XMGA 3FYUB 1EDBA 3FYUA 5KWIA 5J3JA 2XUFA 5CT9A 5CXXA 2PPLA 5EIAA 2PSHA 1ZJ5A 5CH8A 1ZIXA 3ZI7A 4QLAA 2PM8A 4YK7A 2C5FA 5EHNA 2XUHA 1VKHA 4JH0A 1LPSA 1XZDA 4G4GA 2WJ6A 4Y2XA 1JFRA 5EHXA 2C4HA 4KE6A 3SC2A 4O08A 1WOMA 2PSFA 2GBGA 2ZSIA 3RARA 4Q05A 1DTEA 2JGEA 3HABA 5ALGA 2QUBA 3D7RA 4K6HA 4OYYA 2VT7A 4J0HA 4KE8A 1XZMA 2O2GA 4LXIA 3CN9A 5JAHA 4L72A 4LYEA 1S8OA 4OUKX 5I9IA 1J07A 4DTCA 1CIJA 3SK0A 1EINA 3A6ZA 4BCCA 4KACA 3LP5A 4HVTA 2VQ6A 3ANSA 2FUKA 1W52X 2PUHA 1J06A 5JZBA 1T4MA 3OURA 4BTLA 5EIHA 3F96A 4AN1A 3HACA 4UBLA 2QS9A 4FBMA 3DOIA 4KAAA 3WL5A 7YASA 3FVTA 4LIPD 4OSEA 4EBBA 5AI8A 3I2FA 4G9GA 1GPLA 4G9EA 1AC5A 2QZPA 3N0TA 3IUJA 2WUGA 5JZSA 4U2CA 1YASA 1JI3A 4FOLA 4OB8A 2J3DA 3VXKA 4CIBA 4BTVA 2AXEA 2XMBA 4D9JA 5HF5A 4HZGA 3DJYA 4ZI5A 2BGNA 2OCIA 4UFNA 4BC0A 5KWJA 1ZI6A 5IKXA 1AGYA 3ZLUA 3ESAA 1QTRA 1D07A 1JU4A 2GZSA 1EH5A 3JW8A 3FCXA 1SC9A 3I2KA 1ZGCA 4W1QA 4W9RA 1MO2A 3WK7A 4DGQA 2YH2A 1R88A 3BIXA 2WUDA 2WG2A 2C0PA 4LXGA 4C89A 1EXWA 3BIWA 5AIBA 4YX9A 3BXPA 1UKCA 4BC1A 2PBLA 3V1KA 2RI6A 2H7CA 2GYWA 3FYUC 3SX4A 1Y7HA 1BCRA 1JJIA 3FAKA 3V1LA 5AM1A 4BYMA 3O0DA 1UK8A 5A6VA 1YB7A 1JU3A 4AB1A 2Z8ZA 3A2NA 5FXMA 4AX4A 4B80A 1GPNA 3ILSA 4YPVA 1LPPA 2JEZA 5T4BA 4GXNA 1FFDA 4Y2TA 4FWBA 3G9TA 3WIBA 5K3EA 2I3ZA 2J4FA 2Y1KA 5EI5A 3LIIA 4W1PA 5BOVA 3IA2A 4IH4A 5JALA 4QWMA 5LZ8A 3W06A 4I4CA 4X00A 4U2GA 2JGMA 5DYYA 1CQWA 3NOXA 5CH3A 3MUOA 1E3QA 4BZWA 3BJMA 1EB8A 2WLSA 2RHWA 1HDEA 1GKLA 4Y2PA 2D5LA 1CUZA 1XRQA 3H2IA 3E0XA 1QZ3A 3CCBA 5DTIA 3W9BA 5C8ZA 3BDIA 2ZJ7A 3X3HA 2WIGA 2X8BA 2H7XA 1XRPA 5A7FA 5HFAA 1TCBA 1P0QA 2DCMA 1CQZA 3OOSA 4UHDA 1YS1X 3R3VA 3BL8A 2J4CA 1MNQA 2ECFA 2WUEA 1E8MA 1I6WA 1Q84A 3LS2A 5AKIA 3L1IA 3HJUA 2XMRA 4PW0A 1XZGA 1ORVA 4UHCA 5ALLA 1PFQA 5JAUA 3C70A 5AHXA 3WA6A 4FTWA 2H7YA 4U2DA 3ICWA 3VJMA 5A62A 4BVLA 4AO8A 4H0CA 4UFOA 1ZJ4A 3ZLTA 4X92A 4X6YA 5FDFA 3VDXA 2BUCA 2HDWA 3DYVA 1EVQA 5JAOA 2C0QA 3BE8A 4DNQA 2ZJ6A 4UHBA 4FDMA 1LBSA 4BATA 1VXOA 1PJAA 3V1NA 3WJ1A 2HL6A 2Y2UA 3STXA 3DD5A 5BWCA 3OC0A 1THTA 4DSAA 3Q0TA 5CT4A 1DWOA 3I2JA 1H23A 3RLIA 5HZGA 1QONA 1QIGA 4K2AA 2IX9A 3HSSA 4BVJA 3OG9A 4A16A 5JADA 3IULA 5CRIA 5CTAA 5HQ3B 1N5MA 4N8SA 5ALKA 5ALZA 1U65A 4X93A 5IVHA 3WL8A 1OXMA 4OU5A 3WKCA 4IH9A 3WK4A 1QGED 3DCNA 2GBIA 1QO7A 3VJLA 3W2TA 1XQXA 2VAXA 1ZD3A 1AQLA 5LYYA 3NGMA 1TIBA 2XQJA 2XUDA 3WKEA 1ZOIA 4C87A 1EDEA 4W63A 4Y2YA 2D0DA 2WIDA 2XUAA 1HBJA 2B4KA 2OXEA 3H2JA 1ZI8A 3WK6A 5KREA 1UK9A 4Y2UA 2BGRA 4P93A 2XUPA 4GI1A 1FSSA 5AI5A 4HXGA 2QMQA 1BN6A 1SCQA 2ZYSA 1W6RA 3G0CA 3WL7A 1QFMA 1IUNA 2JGJA 1LGYA 4P08A 5JASA 4RE6A 4W1SA 1QIKA 5AM0A 5K3CA 1Z68A 4QDXA 3I2HA 5HKBA 1CUEA 1LNSA 1MN6A 4LXHA 5AO9A 2I78A 2PSEA 1K4YA 1SFRA 1WB4A 4MEAA 3E4DA 2WFZA 4Y2JA 2HFKA 3R3ZA 5C7YA 3HC7A 5JZ9A 4X7BA 3H0CA 5AI6A 3DKRA 2O7VA 1CUWA 1JMKC 1XZCA 3C5VA 2XMSA 1TCAA 4H18A 1CUBA 3MUNA 1NU8A 4AXBA 4H35A 1UOOA 1XLWA 2ONCA 4XWGA 3STUA 5IVIA 5FV4A 2BFNA 3FNBA 2BJHA 1MT3A 4G1FA 1E8DA 3H2GA 1R4ZA 5D3ZA 3DOHA 3G8YA 2WHPB
chains in the Genus database with same CATH superfamily
1KYWA 3H65A 4K6CA 1OZ0A 2JD0A 5BQ3A 2X7XA 1XEWY 1N0UA 2P8SA 4F2PA 1VGRA 3QYJA 4EUKA 2GVZC 2QK4A 4WINA 5CYFA 4JV5B 3GNTA 3B13B 3U19A 1Z2CA 4J0EA 1J42A 1KYXA 1ZITA 3IDOA 4HH1A 4LSGA 3SFZA 1YCGA 4XWOA 2QMEA 3T1YB 2IEGA 5BV2P 1U98A 4ZIRA 4OP1A 2JBAA 2QMYA 4C7OB 1IULA 2FSVA 1T4CA 1CUVA 3HJTA 4HH4A 5A9TA 5TVKA 4NEQA 5TVGA 3U4DA 5B3LA 3GCDA 3OE7D 4ZT2A 2HPAA 3DFFA 2ZT5A 3EIFA 3MJHA 4KBFA 1MQAA 4B3JA 5KINB 5KNBH 1JXOA 3A32A 1PL7A 4FS8A 5A71A 1ODLA 1KU6A 1NV8A 3JD0A 3WLLA 5DBFA 1CRLA 5FYDA 2IYFA 4JR0A 2FMXA 4F3TA 1MB2A 4TXLA 1WB6A 3BK1A 3EVCA 3N2KB 4Y9RA 3VJKA 1QIHA 3I2YX 2HA3A 4WADA 2HD4A 5ICMA 4XDZA 2RHBA 2ZJYA 4PSVA 1YBHA 3E2IA 3GA0A 2O7SA 8ABPA 3IQZA 1CVLA 8LDHA 1NG1A 5FTKA 2JIRA 1KJWA 3DZFA 4G81A 3OZDA 4PGMA 3REFA 1T6YA 3L02A 3AKYA 1FUIA 3VSAA 1E5QA 4DEVA 4DIDA 4XM1A 3BAZA 2EWVA 2XE8A 3Q2OA 4CKXA 3RGWS 4AAYA 1IBSA 3HEAA 3I42A 5F3WB 1R4MA 2AX3A 2MSLA 2Y8EA 3KE9A 3BL6A 2H4WA 4J0FA 4L3VA 4V3CA 3T7CA 2A9KA 2GSDA 2YMQA 4GLLA 2ZRGA 3DDOA 1S2IA 4LRYA 2GN0A 1Z33A 3HDQA 4N0DA 1MJFA 3CUVA 1QVVA 3B2NA 1AS3A 1DOHA 4HD8A 3TE7A 4A6DA 3IAXA 2A67A 3JWJA 3O83A 2LV8A 3DS8A 2Z0MA 4O2RA 4CM3A 1OTHA 3UPDA 1NIPA 4L0CA 3BGDA 4NECA 2RHJA 1SKUA 1R4NA 1U8FO 2VDUE 2XMQA 2ORIA 5LQSA 5LUBA 3RFXA 1G20B 3DYIA 1YI0A 1UQRA 3K7EA 4F21A 5JFOA 2H9YA 3F4LA 3H9GA 4I2NA 4TTJA 1V16B 3TXXA 5MGNA 3WLKX 4KGVA 4NH4A 5FWAA 2J33A 2FDCA 5J2UB 1G8JA 3O8DA 4FEEA 1CVRA 1JZQA 2XNDD 3THSA 1GRNA 4JLJA 3PJGA 4EMSA 2PMBA 3K09A 4Q3AA 4KPUB 5JWRA 2M6SA 4B6GA 4RQTA 5ICCA 2QTHA 4G84A 5JW6A 3GLRA 5SV2A 1B15A 2FZVA 3GEHA 4CLXA 1TPZA 4R6XA 1Y9EA 5IM4F 3X44A 3F90A 2W42A 2RJNA 1WU7A 3ACDA 3AIKA 4J6FA 4TVOA 2OILA 4KGDA 3H1AA 3B3QA 1HYBA 2WW8A 1KMIY 5AKJA 1XDZA 3JVDA 4H7PA 1AHHA 5TQ2B 2E49A 1WUKS 3LO5A 3WNDA 3WL6A 3I34X 1AF7A 4ZOAA 3GYGA 3SBXA 2CHFA 3U4GA 3F6CA 2Q5EA 2VDQB 3U37A 4KDFA 2CK3A 4B7AA 3FPAA 2ZJZA 5AW0A 1LVGA 3R0VA 4UAJA 5JRJA 3A06A 4TQGA 1WXEA 2FZCA 4QHTA 1EWYA 4PTYA 1OAAA 2C8VA 2VJMB 2WF5A 3CRW1 3EVDA 1V95A 3EZGA 1R0ZA 3V2GA 5JT1A 4QVIA 3OEYA 1TB4A 2ZUEA 2ICAA 3DKVA 4NYIR 3ADPA 3NIWA 3QU5A 3WHLA 2A1UB 2PZ8A 3AUKA 5GAJA 4ER6A 2PBZA 1Q3TA 5CFOA 4GX5A 3FXAA 2IZ6A 4I6JA 4PSDA 3RBXA 5KOJB 1NMSA 2QVLA 3LG2A 1PGNA 2X5XA 1WPRA 1GWNA 4B85A 1KI6B 3VNQA 1W44A 2Y1FA 3DMRA 1KS9A 4E2XA 2Y6VA 1PL8A 3SOPA 3TNDA 1M6VB 5AW3A 4P58A 2EKLA 1GPH1 1JFSA 4EG0A 1KFBB 4FCVA 1CSEE 1PK9A 4MMXB 1VI6A 2X58A 2ACVA 2CWDA 3D7LA 3QWFA 4RK6A 2VZ8A 4XIIA 3L1HA 1E1RD 2ZB8A 2Q3HA 4AIRA 1RWOA 4GX2A 4Y7DA 3WLPA 2Q1UA 3HN7A 3SQLA 3ZXXA 3TG2A 2AK3A 1FX0A 3GGDA 4OD0A 1VCOA 2OD7A 3VSEA 1RIIA 1UBNA 4BNWA 1UEIA 1YBAA 4EFDA 1N32B 1ACJA 1MX9A 1HWYA 1QVAA 4EKIA 2GA8A 2WOOA 3EUWA 1IL0A 1CUYA 3G79A 2AKAB 2FPIA 1F6WA 3HJBA 3PI7A 4IGKA 4PHFA 2NO9A 4RMGA 1K97A 4GT1A 2VT2A 3MJDA 2JBWA 1D4ZA 1TCVA 1OAOA 3BFXA 5ALPA 1DU4A 3FNGA 1KOFA 3CG4A 1OC2A 5F76A 1HPLA 4EF6A 2P75A 4I50A 1WM1A 2XCIA 5HF6A 4D4MA 3CQ9A 4LAFA 1B93A 1D0SA 1ES9A 1FBNA 2Q3DA 3G89A 1AHIA 1PIWA 3KLOA 3UFXB 4Q3KA 3HUTA 3GT7A 4M1WA 4BFSA 4EVIA 5BY2A 2HWWA 4HEQA 4F93B 1E9EA 3HXTA 2JCSA 4MWEA 5BYBA 4JHXA 2G72A 4CJXA 3NYQA 4OG2A 2X0IA 4OMFG 1P0CA 4UHJA 4BLTA 2EVWX 4RK7A 1SXJB 3T3DA 5A2QA 2DYKA 1YJCA 3I45A 1ISPA 4Y0NA 4HSGA 3UJNA 1H5UA 3LX8A 4X1KB 1G5RA 1UEXC 1WSAA 1YJXA 4LGCA 2XH8A 4EFKA 2FQWA 2IS1A 4Z9AA 5JVDF 3IMGA 4PWYA 4BXOA 5FEUA 4RJKA 2B4AA 3HEMA 3ZXYA 1VXRA 1Y8QB 3NHFA 2VA9A 5AW9A 1YA8A 1OIWA 1BWQA 4ZT4A 4QTXA 3T3HA 3UA4A 1OLSB 4G0VA 2OFXA 3TN7A 2JKZA 2NQ8A 5U9CA 3K05A 4GW3A 3A1CA 4H9GA 3CB4A 1KJJA 4NE9A 2HLDD 1E94E 5I9BA 4ZTUB 1GPBA 3INRA 4AIIA 3N86A 3JYQA 3UWPA 2C59A 1OUMA 5E0KB 3ZJ4A 2W0SA 1F2TA 1N8SA 2Q8PA 3ETLA 5IT5A 1TM4E 2W2QA 1G21E 1XTSA 1XV5A 5FO1A 1Y1KE 4ZANA 3G2JA 4L4RA 2C96A 3V6LA 1BSVA 3JX9A 2GN8A 5A5EA 3EMBA 1E4OA 1EUYA 2P4UA 1RADA 2P9GA 2E1RA 4K9SA 2CKDA 3FPEA 4LTNA 2WYHA 3VGJA 2Q1WA 3BBLA 4I9NA 5AK0A 5HEKA 1OMOA 5AM5A 1LJUA 3FSRA 4J6EA 1O6CA 4OBEA 4QUAA 2ZI5A 3MIIA 1O95D 2D7JA 3OTIA 2JJ2D 1RYBA 3O1HB 1CUHA 3KXKA 2Z9BA 3THRA 5AVSA 4RA6A 1S4QA 1T2FA 1R0SA 1RE1A 3ZG6A 1UIMA 1J2RA 2GZAA 3UOAB 4JI4B 3V8MA 1Z73A 3THWA 2F48A 5DNEA 4BV2A 2C9MA 4BFVA 1L4KA 2AUMA 4G07A 4HX2A 4DXAA 1EESA 5DMXA 5AI9A 4WY5A 5TMEA 1L7MA 4CL8A 4PSAA 2Y71A 1L4UA 1WPXA 2AZ4A 3LL7A 3ZIAA 3RU7A 2G80A 1N6OA 2F3TA 1L1FA 4INZA 3W9UA 4CT0A 3E9YA 3KM0A 4DDKA 5KEIA 3L4JA 1QFZA 1U0OC 5IJAA 4BNYA 3D2CA 2ZI6A 5DE3A 3CFYA 4B3RB 2ERXA 4A8JB 4JELA 2GZ1A 4YP1A 1CPYA 2ETXA 1I9CA 5K1ZA 1NXVA 4H59A 3GX1A 1RQ2A 4FIDA 2PBFA 3GIWA 4W1RA 5EQFA 2WU4A 3UCXA 2P69A 2Q4OA 3JZFA 4ZVTA 4CMIA 4D4HA 5JBNA 1XU9A 1F12A 2EJCA 4UREA 3DLBA 1G8SA 3WHKA 4AN4A 1CEEA 5K0GA 4L9SA 3LQYA 5DHRA 1XTJA 1BFDA 1ZC3A 3OIVA 3LT0A 4JP1A 4NEHB 4XRGA 5B57C 2KBEA 1A5BB 3THYA 1Y48E 4LEIA 5EWMA 2J9RA 5JPIA 1WO8A 5IYZA 1EFVA 1UPBA 1T8SA 2BFFA 2EP5A 4U7HA 4HC4A 3OX3A 1EEHA 2ZAOA 3D59A 1WHSB 1E1CB 4O3MA 1WDTA 4B76A 1YMQA 3K9HA 4PIMA 1GXSB 3GMDA 3STHA 1K1EA 2DJIA 5IAGA 2A58A 3VR2D 1N4AA 1EFDN 1LA2A 1LPOA 1XRLA 2O1SA 4W8HA 5H4GA 5JDIC 3V4SA 1JDPA 1CZUA 1VLQA 2FUEA 2AE1A 3C3DA 2JVIA 3H87A 1MBZA 2IPAB 4J0KA 4M86A 4EUFA 1A9OA 1QQ5A 1G1AA 1ZW1A 16PKA 3DO5A 5KTYA 1HORA 5IVDA 3P71T 4TYPA 1NATA 1GUYA 5BW8A 4OQDA 2SKEA 4OQZA 3QEMB 4IINA 1RXCA 1QFYA 10MHA 3MGAA 4X62B 1JQKA 1ZUHA 2WJ4A 4B3DA 4EYSA 2ET6A 3H13A 1G59A 3V8VA 1EFPA 4RVFA 5C4MA 3PTAA 2GBLA 3PWZA 1JH8A 1RMYA 2ZRCA 3OE5A 3PXCX 4FNOA 1E9AA 3T5CA 4KFCA 3A6LA 2ZPAA 5LYJA 2GAJA 2LIVA 5ALOA 2C97A 3SLRA 1FYXA 1LC0A 4RBNA 1DX4A 3U1TA 4DYDA 5K51A 1WW8A 4B6OA 2BEWB 1TJ4A 1PR9A 2HJWA 1XTQA 2ZSAA 5M2QA 3QY0A 3JU3A 2LBPA 1XZJA 1FZTA 2LNDA 3NP7A 2XWPA 4J75A 2AJTA 4L9AA 2B25A 1KZ6A 1MO5A 4KR7A 2ZYDA 2X41A 2C99A 4C5BA 1UXHA 2IEZA 2Z2ZA 2WG1A 3JD2A 4KEAA 1L6RA 1X7WB 4L8WB 1RXVA 2Q0QA 2RIPA 3MCTA 4RCZA 2HBYA 4YTEA 3EQ9A 3PE4A 5FI3A 4RPIA 5AQEA 3G9QA 1CDEA 3HUUA 1EFRD 5HKLA 5H3HA 4QXOA 2DBZA 1DUVG 2KBFA 3WFJA 3ZD8A 3DD1A 5JJIA 4ZFNA 1U0HC 3I5XA 1PFVA 3EPPA 3LKZA 4W9NA 4Y6PA 1XK7A 3K35A 3GFRA 5IBPA 3RHFA 4S05A 3HDYA 3OP4A 3ZE9A 1N1GA 4OXKA 3TLGB 1EXDA 3BRWD 1IPHA 3C6KA 4B5LA 3B36A 1G6Q1 5I4KA 2R8RA 2C4NA 2MHCA 4Z4FA 4H3KB 2Y9PB 1PEAA 3PPXA 1FXWA 3KKOA 2JZOA 1M66A 2Y1LA 3N3AC 4QOHA 1LPNA 4RWEA 1SXJC 1Z5VA 2JFHA 3USCS 5CFQA 5KTMA 3IT3A 1RZRA 1DC4A 3AR7A 3RTDA 3EGCA 1C1XA 2DF8A 2O2SA 3T95A 5BVHA 3KQUA 2AEEA 4PZCA 4I3HA 5G4LA 3QKSB 1OFIA 4GWKA 4DG8A 3REQB 1SJ9A 3ZXIA 4AG6A 3V00A 1LJ8A 4E11A 3DZBA 1XL1A 4PONA 3AP2A 3LPDA 4I9FA 4OJYA 3C7DB 3D4PA 2KM1A 2FTKE 3QVJA 5LPNA 5H81A 4L27A 1LBHA 4NFSA 2DPLA 2GLXA 4JJ6A 3OLQA 1M2EA 1MRZA 5JJLA 2JJ1A 3WKAA 4W7SA 4LPSA 4ZXFA 5JEDA 1NUTA 3QPCA 4L6IA 3KHUA 3ZQ6A 1E59A 3PRYA 1DIRA 3O1LA 4JLBA 1BRMA 3R7WB 4B34A 1E2HA 4D25A 2IYRA 3TDKA 4RHXA 4Q7KA 1L8XA 3ZY4A 1S3SA 3JQ7B 5ER9A 3TNJA 4FPXA 2M6KA 4P4NA 4A0SA 4LWOA 4BB0A 3CONA 2Q5FA 2ISQA 2K7ZA 1GVHA 1AKUA 4IMPA 4I4IA 3MCUA 4YV0A 3F74A 3GLGE 2R6FA 2XYPA 1UMBB 1XKXA 2OYRA 2GCEA 4ZZ3A 2WJZB 2QD4A 4A2CA 4XQGA 1F5NA 3RYHA 3N0RA 2R47A 4UHFA 2QZJA 1PT8A 5AIAA 2X0EA 4C89A 3SYRA 7MHTA 4L28A 3GA5A 2JEYA 2VJOA 2XVXA 4PPYA 5CEFA 1J2EA 4LF6B 2JLBA 4TRJA 1DKOA 2ONYA 3N07A 2PD6A 3NOVA 4KVFA 5J4VA 3M83A 4XTRA 3L4BA 1Z8DA 1U2QA 2GCPA 1GPWB 2IVZA 5LKAA 1II8A 2A5DA 2NSYA 2CUKA 4RENA 1NXOA 2ZRDA 3Q7TA 4WKGA 3PPYA 3C6BA 2W48A 1Z06A 3I5MA 2HPZA 3JALA 3DP9A 3T0GA 1ZVMA 2HU5A 4FKMA 5AICA 1ZQ1A 2P9QA 5MF6A 1XNRB 3TIIA 1JU9A 3R44A 2DG2A 3OQ6A 4FOOA 3G0BA 3MSCA 4YAEA 5CU7A 2NVWA 4LDQA 4E5DA 2PUDA 3ACBA 2VDWB 4EF5A 1Z0AA 2HDHA 3BA6A 2R1VB 4XLZA 1DJQA 4J0IA 1C41A 2CLHB 3OT1B 4ALIA 4AX8A 2HF8A 1PD1A 4UUQA 3U3JA 4M83A 3ZW8A 3KSAC 3C5EA 4QVKA 3KWMA 5TT1A 4GUDA 2WVJA 1KMHA 3I83A 5IAOA 3VUEA 4XIYA 5KOHA 4Q47A 4QPNA 3THXB 1WF3A 3WOHA 4CG2A 2NW6A 3AF4A 3VO2A 1SZCA 1Y7IA 1AT1A 5KC9A 2OGZA 3AEQA 4CKWA 3DZJA 4M4SA 2Q49A 3L6DA 3B5EA 1XQYA 4H6XA 3W5IA 3STVA 1NNSA 1ORIA 2BEVA 1SXIA 3LBNA 5EXDA 1NX9A 5I51A 4M0LA 3PPVA 5EZYA 3OJWA 4QECA 1GPDG 3R0ZA 3G1WA 2GZHA 1HLDA 1I01A 3T3EA 1V1JA 4JU9A 4CM8A 1GU0A 4F91B 4YXWA 5EIBD 3S1AB 1KYQA 3TSCA 3LT4A 1N34B 2A1TS 2X2PA 5ETJA 2AR0A 5HQ3A 3FH0A 3NJ4A 4NBVA 3QX8A 4B45A 1BTOA 2JFNA 1QOPB 3W1EA 1XDDA 3VVLA 5T67A 3P2YA 3R9XB 3CR7A 2BKAA 2ZTHA 1DQSA 3D7NA 2V65A 2WQZA 1MVOA 1TW3A 3V4FA 1UDBA 3LOQA 2DLCX 5AJWA 3BH0A 3KDSE 4IUBS 3C3MA 4R71A 1G3QA 4L22A 2PYDA 5HKKD 1BVHA 3HFSA 5AVKA 3PTLA 2CL7X 1QHIA 4LZZA 3RSFA 3A4IA 4CQLA 1BXGB 1G38A 3M9XA 4UZFA 5JU6A 2F6RA 5IVKA 4PG8A 2WJYA 4GGOA 2Z5VA 5CCBA 3ZU5A 3HVJA 3HYSA 3WXMA 3B12A 1KJZA 2FWRA 2VDVE 2NO6A 2V6MA 2XVYA 3SMQA 5ISMA 1JSZA 2FZWA 3GMTA 3LCJA 4U8HA 3S1AA 1YE5A 4R9NA 4TLBA 4TTSA 3ID6C 5EHQA 4V1CA 3TAXA 4YCMA 2QE7D 4JVSB 3RC7A 1G18A 1CY1A 3TLBA 1BX1A 1W96A 3U9TA 3HP7A 5CB4B 1VE9A 3G23A 2QYSA 3TK1A 3LOPA 4FGKA 4DMGA 4EX7A 1QP0A 4D26A 3DLIA 4RJJA 5JC8A 1AKMA 3NM6B 4WLEA 5HMMA 2QT1A 2J6IA 2OHJA 2ZSHA 4HEA1 1JXQA 3BTSA 4JB8A 3LYAA 3EVGA 4LYHA 4ANFA 1YI8A 5JSZA 3EHEA 5FADA 1CUAA 3L2OB 3LC7O 2I99A 3DZGA 3D1LA 3F9RA 1NBWB 1ZO8A 4PVDA 4RCVA 1Y3AA 3UT6A 3DL7A 4TSKA 3TEFA 4OFBA 2REQB 4N6GA 5TPWA 2QTTA 3UUGA 3ZV6A 1KEEA 3JRWA 3OPYB 3J81A 3TSZA 1FQKA 5A05A 4MA0A 5IM5A 4NP6A 4EL0A 3MBOA 2OQVA 1YTLA 3M1YA 1P1BA 2H06A 3HB5X 1G9TA 2B82A 4NYJQ 2A9JA 5DW3A 1PJQA 4Q0MA 3VYRB 2GKOA 3R77A 5A2GA 1MB3A 3RBAA 1LF5A 1PGQA 2DBVO 4MPJA 3FWHA 4HRYA 1J2TA 4MI3A 5EJEA 5FOQA 4XWTA 3GJ6A 4B7XA 5JY1A 2Q5CA 1CNMA 5E1BA 4PAOA 1SIUA 3QPAA 3QFFA 1Q3HA 2VUSA 1P29A 3SYMA 5AXBA 3QU4A 4LX8A 3SHWA 3PB3A 2QX8A 3IMEA 3SBOA 3KRTA 4MI9A 2ZJ0A 1GU1A 4TKMA 2G1UA 2WWFA 3W8DA 1Q50A 4K1LA 3I39X 3FFTA 3H9CA 3U31A 4M8SA 2AJBA 1EQUA 1D2NA 2O8CA 4OCZA 2ENUA 3O9MA 3BMOB 3JQ8B 1E2KA 5K0LA 4CKCB 1YE8A 2CLCX 3ORFA 2VTKA 3N39C 2GBPA 5AK6A 3RVQA 3UICA 4MI6A 1EVEA 2H9IA 3Q7RA 4UZEA 3WLFA 4URVR 1NM5C 2BBOA 1RHKA 2HJGA 3BH6A 1K88A 4U2EA 3PA8A 5D01A 5G1PA 4C3OB 3ZHRA 1I1HA 4C2BA 5DI3A 2IH4A 2I8LA 1IEVA 3JSAA 3MILA 2DTEA 1JDNA 1G8FA 2XZTA 1YZHA 2ZJ5A 4FFOA 2GYUA 1MQ9A 3EGOA 2UYOA 2O8FB 1ULAA 1YCDA 2RBGA 1P1CA 3X0DA 4EYEA 1ZISA 1NXWA 1HK7A 3TVTA 3UXEA 1KEKA 4CM9A 1ISJA 2RK3A 3AESA 3AYZB 3F97A 3KD3A 3MMSA 4KYVA 3THOA 4DLXA 4RKEA 4C1NA 4DYHA 3K1JA 3C8MA 2GNAA 3D3WB 2UUAB 1J00A 1DBVO 1R9NA 2GVNA 2D1RA 3V4RA 1RLUA 4DQDA 1IRXA 2E82A 1QE0A 4UNQA 3KQTA 1JJBA 4ND5A 3U0BA 2HPVA 4MVWA 4BFUA 1MX5A 2RIRA 4HJXA 5P8WA 4J1SA 3EF3A 4I55B 5EZSA 3IUQA 1W19A 3FCUB 2ACWA 2BSQA 5CA1A 2B83A 2I66A 1KTVA 1ZN8A 3F9CA 1GZVA 3CPJB 2CJFA 3F7NA 2QSJA 4CLRB 1Z07A 4Y0AA 1YS6A 3UXYA 3VPFA 5JLAA 4ENUA 5DM70 3JTMA 1EGVB 2ES4A 2R1TB 1S6YA 2RMKA 4M0MA 5EVCA 1OC4A 4DPMA 2Z6UA 3PL5A 2JASA 2V7EA 1LB1B 3C3WA 1GITA 3CO0S 3JASA 1TAHA 2IYTA 2V7GA 1XCOA 3DBRB 2G4CA 5EXPA 3DPIA 1Y4UA 4MP8A 5IKOA 4XIJA 1CUSA 1YA6A 4BLQA 5HFNA 3RJ9A 3DXXA 3IE1A 2B0JA 2R0QC 1U4NA 4B3MB 2H65A 4D99A 3ZVNA 4A03A 3JQAB 3JAMA 1JA9A 1JG2A 1DTWA 4H27A 2HU7A 5CB8A 2JJYA 4YHBA 3TW4A 2JANA 2RHOA 4E94A 3QVKA 1KERA 2Z43A 3DDSA 4G0UA 1YWGO 3H4TA 3OX4A 1KWGA 5DM0A 1M8FA 1SIOA 3JZMA 4FSDA 1YZNA 1LX7A 3SYKA 4JJ8A 1H6DA 1P9LA 1BWSA 1RPZA 5A4FS 4DIEA 5JAZA 2LPMA 1ILEA 1VYTA 4NU0A 2I8CA 4HFRA 4B31A 4Z8YA 4WZBE 3TCNA 2QE6A 4K28A 4IIVA 4AUEA 4TZ6A 1B6RA 2OHGA 2B69A 3OFKA 3I5UA 3CNHA 1ODCA 5NLLA 3UW3A 3VFDA 4AICA 2VF2A 3B9QA 4PICA 1U7WA 4BB6A 1MQSA 1QRDA 4CV1A 1VPDA 2GN4A 2FB9A 2IU4A 1U90A 2Q99A 3LYHA 3P5SA 3PK0A 4NULA 4ZEXA 5EYPB 2HK8A 4BBZA 4DARA 4EX6A 3B1WA 3W9SA 3G9XA 1X7XB 4U7PB 5CG1A 4PO3X 3U7QA 3T38A 4R7ZA 1VRVA 4OATA 2R6CA 2VYNA 4AY6A 4MUAA 3N70A 1KXJA 2Q2QA 3H2BA 2GCIA 3E7XA 4HN2A 1JEOA 2ZJ4A 4N7RA 1AMNA 4K9QA 4UEKA 4Z6KA 2A0UA 4TQAA 4A3SA 4E46A 5CDYA 1VZ2A 3KEOA 1SHTX 2B6HA 3F8WA 4GX1A 1SUIA 3NV9A 3ZWOA 4M21A 3EWIA 4AJ1A 3BIOA 3BG5A 5JCXA 1EP9A 3OEHD 1VPTA 5JR3A 4AT1A 3OKFA 1SVLA 2WHEA 2HN9A 1CY0A 2NV2B 2QLMA 3OP1A 4AZ3B 2IVFA 3CVXA 3WGUA 1AQIA 4TVKA 5FWXA 4B2IA 3ZWDA 1HZZC 3WK9A 3DBLB 4LA4A 4XYEA 4JLSA 4J0GA 2B37A 3OCCA 3U7JA 4UTVA 2WFAA 3ISVA 2VQDA 5ADUS 3UIEA 1SN7A 2HA0A 4J3JA 3RVJA 3PVCA 1LWNA 4PF1A 3HKDA 3WISA 2H1WA 1BNCA 3K6KA 3CRVA 1U2GC 3MCAA 2C2KA 2FQXA 3DLTA 3SQOA 1A9ZA 3FF1A 1RRVA 4MVJE 5BRNA 4KBGA 3LH5A 4ES6A 1XVTA 4YV7A 5KNCH 1Q14A 2PS1A 2YC2C 4RHUA 4UVDA 3QG5A 1K92A 3IVCA 3DP7A 1NKTA 2H4XA 1AH2A 4MQEB 2C4WA 2QI9F 4CQMA 1AMOA 1GTG1 1B0AA 1EWTA 2I6UA 5DGTA 4D9MA 2AHRA 5DEOA 3ENQA 2GJ4A 4L73A 4US0R 2V4MA 1M5TA 2PIDA 4RPGA 1CR1A 1OH7A 1G3RA 2JG3A 1L7DA 5EKUA 5C7YA 2W6ZA 3DAFA 3F6YA 4QICA 4MHSA 4BMYA 3N2ZB 2FWNA 4FMDB 1G3MA 1B3RA 1V3TA 1DXHA 2PVCA 2Q21A 4YYEA 4ED9A 1XVLA 1DGQA 2WILA 5F3DA 3OTHA 2EX4A 1XEXB 1UKZA 2VSQA 5LYJF 2UXDB 3S2EA 2NNWB 2PH3A 1Q17A 2YZMA 3FMVA 5LNK1 4OAPA 2C4VA 4GPBA 4RLSA 4GOKA 1RBQA 3LX6A 1U9CA 1DRUA 1V26A 2DJ5A 3GQBB 1Z3IX 3U16A 1EFCA 2PWBA 2R8EA 4C4XA 1A4IA 3UH1A 2HI0A 4IJ6A 2IKQA 5BWBA 4DC9A 4DM3A 4FJ0A 2Z3ZA 1WVGA 4CLDA 1QYRA 3H1EA 2MYPA 1FUEA 2FRDC 3CUYA 4BDTA 1ZONA 3WYCA 1STOA 5GV8A 1SHUX 5AK5A 4E31A 4U3JB 1GV0A 2DQZA 3A31A 5FULA 2O19A 3M1LA 3ZS8A 1MDFA 4PSKA 1TK3A 4C0WA 1NXSA 4PYJA 1CLEA 4P1ZA 4V2IA 2ZWOA 1SCUA 2AOXA 3G49A 4L57A 4AS3A 5A9RA 3NB0A 1I6MA 1T4DA 3R1IA 1ISHA 4FZJA 3ZR4B 3DL4A 1A2BA 3CZQA 1C9JA 4V0LA 4EGCB 3DLHA 1MFZA 4UPDA 5AJHA 5FWDA 4DNPA 1JYEA 2CV1A 5KWSA 1GQYA 3VOBA 4S1NA 2OV8A 1KP9A 1TT7A 6Q21A 3BWYA 1FXWF 2UUOA 4C0QC 1U28A 3CLHA 3NYWA 2WC1A 3C4VA 4CMAA 1BJKA 4YJFA 1MX3A 2JIZA 3EEIA 2YZGA 2VQSA 3WHPA 2H6EA 4PZZA 1FA9A 3URMA 5IBRA 4I3FA 4DR6B 2P30A 4QUDA 1W4CA 1NUQA 4ZHQA 5A0VA 1FU7A 2FMKA 1OZGA 3OJEA 4LWZA 3QE4A 2L19A 3AZOA 5EUQB 5EIEA 2C88A 3FLEA 3JWGA 1T1SA 4IFEA 1B2LA 1AGPA 2RCNA 5T8KA 4NBKA 4H31A 3PCRB 3W3AH 2XE4A 5IJXA 4FLMA 1SOVA 3EMVA 2RARA 5TX7A 4PR3A 3D4IA 3KFLA 5FUXA 3SZ3A 4MS1B 4ZPXA 1P5JA 4C14A 3HJHA 1VCHA 4JLNA 1HT0A 4QNRA 4U9IS 2BTOA 1TYZA 4MR9B 4X84A 1OT5A 3ZLVA 1GPUA 4DDHA 3ZHVA 4HBGA 1IOVA 3MG9A 1ONOA 2G5PA 2OBNA 1T8UA 2PAAA 4RD1A 3ROGA 5F64A 4WLOA 2N75A 3QHQA 2AV6A 5DI9A 3UCFA 2QJWA 4UTRA 1RJ9B 1QOZA 4GNKA 4L8LA 1WB5A 2WNHA 3H97A 2GTPA 1PD0A 2VPQA 5DTRA 3WLHA 4UCFA 1QR6A 3R6GA 3BWEA 2W71A 2UYCA 1OYVA 3V46A 2Q4RA 2QPOA 2Y1GA 3OIYA 5G41A 3KQMA 3N05A 5FWYB 4POOA 2W00A 3QPVA 3WWPA 1NWHA 4YH1A 2YXBA 3M7IA 2ADMA 3PNLA 1GYQA 3BWVA 3PNSA 1XTKA 3ND7A 4ZVSA 4NU5A 5EAIA 1VA4A 5CW1A 5CA0A 2P3SA 3NATA 1P2FA 4XFDA 5HXAA 1EHYA 2ZAIA 3PUVA 3O93A 4IICA 5H4HA 3M4NA 1TZCA 3W5BA 2HA6A 2ZUTA 3EOBI 3OHSX 3RIEA 3SVZA 5HVNA 5JAQA 2P67A 1A9TA 2P0AA 4HLDA 4A15A 4RNDB 1R50A 1E0AA 3EDMA 1G2PA 4FDTA 4NPAA 1IWPB 2P90A 3C14C 1B41A 4L5AA 4LDZA 3T5PA 4WDRA 1NG9A 3F3MA 4CF4A 4PO1A 1NUAA 1Y9JA 4JT2A 4KDRA 4QE3A 1DC5A 2GZRA 1FJHA 4MUKA 1SBNE 2HXYA 3A6DA 3KYBA 3O75A 3EULA 1N3LA 1OWLA 2BGIA 1HTTA 4JLUA 5B58T 3BYZA 2QIPA 2NVOA 2XZPA 1ATZA 2Z4TA 3QUSA 2UZ4A 4MTLA 2OBMA 2NSDA 3EEOA 1W9HA 1PZFA 4IPTA 1V9SA 4GC5A 4DIOA 3WWDA 5H3LA 5J4KA 4M8LA 5EZYF 6CHYA 1JLLB 3CNEA 3H6GA 3KKEA 4Q3OA 3PFGA 1TUIA 3QTTA 1PJZA 1E6MA 1VE7A 3VMFA 3VYUB 3N58A 4FQ8A 4EA9A 5K0TA 5FBQB 2ORWA 2G6TA 2IE0A 3ICCA 5AVOA 4EVSA 5BWNA 3R0QA 1ZYUA 3THXA 1VIAA 5CG2A 2JAWA 1SB9A 3HBNA 4D0LB 4X9XA 2QUKA 1QYVA 2FPPA 1L5RA 1QGUA 3K1YA 1OD6A 3MNFA 3ML1A 3D8RA 4MEJA 4RS4A 3OD1A 1P1IA 2X4IA 4NAUA 3RFFA 1MRSA 3DFIA 2FSIA 4BL5A 4HB2A 3I6QA 4YBRA 3DUFA 5GWXA 5BQFA 2FF7A 4MPDA 4N8EA 4F2HA 3C97A 3KOWA 4POAA 1XNHA 1LK0A 2Z1NA 3R41A 4A5SA 1EUCA 3BEDA 3CEPB 4ZALA 3WFIA 4UTPA 3B52X 1ZMXA 3A58B 4UM9D 3CTPA 1X1AA 1ARZA 3TE6A 3OO0A 3WAGA 2ZIXA 1BX0A 3HKBB 5DZSA 1WF6A 4GR9A 4HUQB 1CBUA 1Q6YA 4LI0A 2RHRA 2EFYA 3A6HA 2WF7A 3FBWA 3IP8A 4XJXA 4XYMA 4CTMA 4KV9A 3VX4A 2YYYA 3ENVA 3OD5A 1AKVA 1QWOA 2IP1A 3CVYA 1A8HA 1RQRA 4OJNA 3STYA 3DFMA 3A05A 3BILA 1TDJA 4TMXA 2CNBA 1CUJA 1T9ZA 2COKA 2GPTA 3AM3A 1ATIA 2J59A 2P9FA 4LK3A 3DE7X 5AKXA 4YCLA 3IKTA 2EXXA 3IHLA 4LC1A 4CRWB 4DQUA 4Z4HA 1CDOA 1Z83A 3W0LB 3BSFA 1HE8B 1N0HA 1T9BA 3B5JA 1G5QA 3KDAA 4RJ2A 4R40A 4M8KA 4G09A 4TLAA 2C3MA 2BP7A 3BD8A 3FUUA 4MAFA 2FDXA 2WNIA 1OB5A 1M6HA 1CJBA 4KHZA 1OLXA 1YAHA 3R6DA 4DWVA 4ZI7A 4CEJB 4MGIR 3GUHA 1DEHA 1I14A 1XCGB 3BMQB 3ON5A 3PENA 3T5BA 1KDYA 4REQA 3GGOA 2YY6A 3WRXC 4L07A 2BN4A 4TROA 5BR4A 5LMUB 1RBMA 1U9ZA 3K9LA 4O6VA 5AHOA 2FZEA 4MRMA 5HILA 3WOVA 4KCGA 5AVYA 4XH9B 3CLRD 2JGLA 1ORWA 3OWHA 4HAWA 1SD5A 3O8QA 1E5TA 1PRYA 3NWOA 4TLCA 4B46A 5HPYB 4NJMA 3OQPA 4NX2A 1EQAA 2IDJA 4WK2B 3E48A 3O4IA 2B8NA 4D74A 4C2AA 4ZYLA 2AVNA 4ZVRA 2DFPA 2XUJA 1IN4A 3H11A 2Q9BA 4N7MA 5BN3A 1QQBA 1SVMA 2GPBA 2P77A 3QBTA 4KP7A 5FKJA 5H59A 3SQWA 4C4SA 4C76A 3RC8A 4WOJA 3RBVA 4M9SA 5FUYA 4FNAA 2C00A 1JJAA 2XPCA 3AIMA 5D87A 3SNKA 4EAAA 1KTIA 4WECA 3KPVA 1HR0B 4JC8A 1Z88A 5C8VA 2BJVA 3TTUA 3VHXB 4W5RA 3OO1A 4D9IA 2EBHX 4DCCA 1IZ7A 5C7OO 1PHRA 5CITA 4G0ZA 3RRMA 2Q7DA 3U7GA 2QXUA 4J3NA 4OB6A 1KHHA 4CMKA 2QWXA 5J2TA 4LSMA 2CMHA 3CGGA 2QMUA 1EDDA 3HCEA 1AZSC 4KQ9A 4N3AA 1OV6A 4DRXB 1K08A 3UW1A 1VJCA 2Z08A 2CDNA 1H6CA 4N03A 5JVDB 4Z99A 2BY4A 3YASA 1PR0A 4BAZA 4EGAA 4QA9A 3I8XA 2PR2A 2R65A 5EZQA 1QHYA 2BGTA 4DGSA 2PRJA 2IUYA 2CLLB 4N6OA 4ZV7A 2WU1A 4Q01A 3SF8A 5BNFA 5JC1A 3CB2A 3L0BA 4WOPA 3WYNA 2VXYA 1DQPA 2CL0X 1RQNA 2BEUB 4AMYA 3HU5A 3RT7A 3I62A 2O06A 4TKVA 2ZXEA 3LA6A 2GARA 4B8WA 2QSYA 4RVCA 5K8JB 1QKJA 4KO3S 4RYDA 3Q0EA 3DULA 1A8QA 5BMOA 2IITA 2XR1A 3D8UA 2X0RA 3QELB 3H2SA 5CM9C 8ADHA 2EF0A 1EUDB 1Q0LA 3PFIA 5DYGA 1PV1A 4Q1VA 5CYPA 3MPUA 4ZQEA 2GHTA 1NMYA 3AUSA 2ZKIA 4J2TA 4TX1A 5BMVA 1U2RA 5EPOA 4J43A 3ZW9A 4RKWA 1WG8A 1P44A 1ZD5A 2PUAA 1XEWX 5A4DA 3DV0A 3TTWA 4EG1A 2REBA 3GBSA 4TYNA 1OY1A 4ZP1A 1RLOA 1Q77A 5FL7D 3C5WP 5FP0A 1PKXA 1VHTA 3R6WA 4QBFA 1PLJA 4BWFB 2F3SA 1G17A 4PCVA 3IAHA 1I7PA 4DIKA 8MHTA 3RVPA 621PA 2BRUC 4QDZA 1FDOA 1IN6A 4W6ZA 2KMLA 5B4TA 4C88A 1KY2A 4D4IA 3LX4A 1OZAA 2EFHB 3HY3A 1QP8A 2W11A 2NZ2A 4HQKA 2QUHA 3BEOA 3TLYA 5ARBA 1YBMA 3LVQE 4BVEA 1MEJA 4GKBA 1T26A 4EY5A 3KYCB 4G8BA 4BYGA 4RXTA 3IUMA 3CVVA 4L5YA 3OM9A 1SCKA 2H2DA 2EKQA 4WSOA 4QUHA 4WGFA 2C2ZA 1RWVA 2BGJA 3C4QA 4KO1S 8AT1A 3LE8A 4I9HA 2A33A 3WNVA 4CTNA 3RRNA 5JRZA 1GO2A 4YUAA 4YT8A 1RWBA 5FOWA 4MW4A 2XYVA 1YB6A 4PPFA 5EUCA 1TM5E 3GAMA 4ZAZA 3JTEA 5KYXB 2NZUG 3AFGA 4ZZIA 1XT6A 2QW0X 3FZEA 1U7OA 4HVAA 5KYTA 1U6JA 3ROPA 2J9FB 2ZBDA 4EDHA 4A82A 2C5BA 4QQNA 5K0ZA 4FOSA 3TTYA 2PO7A 3P96A 5GGXA 4TKLA 5TMPA 1XK6A 2BAGA 4AC9A 2J5BA 1O97C 4DAOA 2A84A 1TMGE 2EZUA 2PL5A 3COWA 4ZYTA 3OQIA 1IMOA 3K9NA 2FHPA 4DUGD 4BNDA 1NULA 5C1BA 1NJ6A 3MS2A 1AY0A 4IOKA 5HJ7A 3CWZA 2RDMA 3JPWA 2PIAA 4DY6A 1WCIA 2QTCA 1T8YA 4ZYVA 3DO8A 4YXFA 1N9ZA 1NBIA 1QK3A 2E5FA 4FT4A 2V0NA 4JY7A 3WGKA 4B3CA 3UMMA 5FPTA 2EBFX 3PVZA 3NBQA 2IDZA 2AD1A 3GXOA 2JJ8A 3FNFA 5JRDS 2QROA 1R8YA 2C92A 1BKSB 4Y2QA 4BUCA 4ZK6A 4TWIA 1DC3A 5DM2A 2AI2A 3KTAA 2GD2A 3OESA 3V4ZA 1THGA 1FL9A 2GCGA 3FOCA 3JZAA 1OF1A 1AKQA 1P9RA 2PSSA 3OUUA 4FSHA 5L45A 4J9UE 2C5EA 1DL5A 2YWBA 1WUJS 2FPOA 3C3KA 3EZ9A 4IEIA 4JB3A 4QZVA 3U3DA 2OV1A 5FWNA 3TQHA 2GFQA 1IVSA 1X1QA 4KQEA 3PNVA 3OAAD 3TLMA 1XD2B 3EDRA 5K20A 4DR1B 3SSMA 1LI7A 1T6ZA 2VDOB 1CF2O 1YKSA 5BRAA 4PFSA 4TL8A 1E6KA 3GELA 1MPXA 3IEIA 2P62A 4ZVOA 1Z82A 3AERB 4BJ5A 2PH7A 1S2LA 2X7HA 4ZAWA 4Q16A 4G0OA 2PRYA 3R8CA 3KQLA 1PDVA 1XZHA 1NF2A 2IF0A 2IWHA 3FYSA 4GKAA 5MFPA 1JXAA 1K4MA 3O26A 3ORRA 4YR9A 3B82A 3FR8A 2YKGA 2HK9A 2PNFA 3B3AA 4JBGA 2YRFA 3DNFA 4NK5A 1P0PA 4EG7A 5B64A 5CBPB 1HKHA 5ITZB 3E3MA 1GGJA 4NKRA 1ZGBA 3E8XA 2NUTA 3BQMB 2BI8A 2ZITA 4QDUA 5FUBA 6PFKA 5L3QA 3EPHA 4KXUA 2WMDA 4AI6A 4A1FA 3ZGYA 3WV5A 1Q5PA 1FDTA 1FSFA 4IKOA 4RH0A 1SK8A 1SY7A 3D2BA 3GUZA 3JD1A 4CI0B 4D7AA 4LMPA 2VSXA 1XQVA 2OHHA 4TYQA 4UBNA 3E15A 1NF8A 2CKMA 3QKTA 4AMZA 2PA3A 5BSFA 3VKGA 3EQ6A 1W8IA 3LLSA 2AMYA 4BX0A 1DS6A 1JIIA 1O94A 1WDLA 5B12A 3PX3A 1OLOA 2ZYAA 5KCMA 4D9NA 4MRSA 3T3GA 1JA1A 1TC1A 3TLZA 4TMTA 3NEAA 3O91A 5I9TA 3U40A 4ZZ1A 1NNUA 3HJRA 1ODSA 1Q12A 4MVJD 4MLCA 3DT8A 4PHHA 1HDOA 3RPEA 3NOQA 3ADBA 4GRIA 3R23A 4ZO7A 5ICFA 2ZSUA 2VDLB 3DQQA 4YDSA 3RU2A 4INJA 3TCKA 3OBIA 3ZCQA 4F6RB 1TEXA 4U4AA 1LEHA 2G83A 4XA8A 3EIHA 4TSRA 3VOTA 5EKDA 3WGHA 1YRBA 1TYDE 3KO8A 4M89A 3DE1X 1DX9A 4IIYA 2ST1A 1T8RA 3GLKA 1TUGA 3BCSA 3MT7A 1F9EA 1GNPA 2QYHA 3Q5DA 4LJKA 4B8YA 2AW5A 3P1JA 4KV7A 3M6UA 1Q44A 3FGZA 4I1IA 1WP4A 2ZZNA 2P9CA 1NJ1A 1E2IA 2B1JA 1Z6GA 2J3QA 2UVPB 3GLHB 1R5BA 3OQHA 4GPAA 4U8GA 1G7RA 1HSZA 5DGXA 5BV1A 2PMDA 1Z3CA 1EXNA 1KEZA 3ZJVA 1DJMA 4MUIA 2G1AA 1O96A 4ZU6X 1TU3A 3TS1A 1IUKA 1P0FA 2GILA 2IODA 3LDUA 4YUZA 2WIAA 3Q9SA 4BNMA 5HKOA 4L8GA 3VKFA 3K6SA 1QIEA 2F7SA 4X5OA 1IIRA 2BL4A 1W7AA 4ITRC 2QMOA 1LXCA 4ODIA 4I3GA 1TAQA 2BT4A 1WB9A 4M0CA 3DF9A 5E8RA 4YRLA 3RS5A 2AWOA 4X85A 2EAUA 3Q7QA 4KXMA 2MMCA 4OBWA 4IIXA 2AGVA 4FYIA 4RQAA 3ONFA 3DTTA 1GRVA 4IV0A 4ZGGA 1Z5GA 1A8UA 1Z0FA 3L6EA 1ESEA 3N6XA 4K1XA 1NUSA 4B3SB 3DLPX 5KJ6A 4RVOA 3OTQA 4WCFA 2R00A 2FGJA 4Y1RB 1XRRA 3G5AA 2X9QA 1LQUA 3GJ7A 4LHXA 4NL4H 4OL9A 4W5TA 3KOYA 3FMPB 1D7AA 3VR5A 3PQ5A 3V1YA 1JEQA 1ISFA 1AHNA 2Z6VA 3CHYA 5CAEB 4DY4A 3I92A 1OI2A 1O8BA 5LUAA 3NUGA 2ZKLA 4ZYUA 1ZM2A 2RGGA 4OXNA 1M34E 4Q21A 2GI4A 2VJLA 1DKPA 1KIFA 3H0KA 3OA0A 3DEYX 4F96A 2BH2A 4K6KA 1L5ZA 6REQB 2KLBA 1B0PA 3T1OA 1T1GA 5SZJA 4QJ5A 1NI4A 1OILA 2ZULA 4KMRA 4WN3A 3PGXA 4BO5A 3DF7A 4ZIRB 3EZ7A 1F14A 2WE7A 4IOLA 4JMPA 5DYTA 5EJFA 5TPZD 5CDSA 2H1OA 1T4CB 2BLLA 1WSBA 1D2HA 4IV8A 1W87A 4E5VA 3FFBA 5CFPA 5JARA 1YQ9A 1TQHA 1YR2A 3I2GA 4RVHA 3DEIA 1UOQA 5FLKA 4DOMA 2EFCB 1F8XA 1A0OA 4WERA 3DA8A 1E98A 3OOEA 4RSMA 4AY4A 5AM4A 1B8OA 4P36A 3KJEA 2QG6A 2BM1A 4YQFA 4ND8B 4TRNA 2HXGA 2ZWIA 1W0JA 3KTDA 1GKIA 1PZXA 1WMEA 4IKEA 3CRQA 1JG6A 1GDTA 4MLPA 2C2HA 3RNLA 1TL7C 5JNSA 3T5AA 1GTSA 2W2XA 3I1YA 3TPZA 2XDWA 3JAWB 5DBEX 1HO3A 3ZTWA 1M1YE 2DSTA 4AG5A 4KIGA 1UK6A 1FTQA 3EOAI 4TLLB 1YCHA 4QRHA 5LXTF 1CRPA 1R4MB 1VJ5A 1HE4A 1O9GA 4P3PA 4BIIA 1QRSA 3KSMA 4UNNA 3PUIA 2Z3VA 1TJYA 4ARSA 3K70B 3BHJA 3ANLA 1QO9A 4KRGA 1T0HB 3MXOA 3QHAA 4GVPA 1FXUA 3NT4A 3Q1LA 4A9AA 4NR0A 1PBNA 4CEHA 3JWPA 2Y68A 1XZAA 4IDFA 1GRQA 1XU7A 4ACAA 1JZSA 3V2UA 4MB0A 5TGTA 4FZVA 1R64A 3CE6A 3O8OB 2QP3A 1PJ2A 4F92B 2VJNA 1K7YA 4FR2A 2HHLA 3IEMA 4LJYA 3ZWNA 1Z2AA 4BNXA 2WIJA 1Q0RA 4QFMA 3PQCA 1PJ4A 4G1VA 1TQDA 1URPA 3EY9A 4LVOA 2BVNA 2XMGA 3VH4A 1V6AA 4X7PA 2IELA 3FYUB 1EDBA 3PITA 4M0PA 1JKJA 3G6KA 2FU5C 3C98A 3O5AA 5CT9A 4PN3A 1P5RA 3S7ZA 1E2NA 4FFLA 4H6WA 3ZK9A 1G63A 1ML3A 2RGEA 4TTQA 1MW9X 3IUPA 2GD6A 1C4OA 2QL7A 4NARA 1XJWA 3EWSA 1UT8A 2IZ1A 1NBME 4C1BA 4Z2YA 2QV7A 5AWFC 2J3IA 3NO4A 4IW3B 1P74A 3TQQA 2GHIA 2QU8A 4OQLA 4ZMBA 2I2CA 2WUWE 3MINB 1M2OB 3QW2A 1XZDA 3N28A 4I14A 1AA9A 3RUDA 4HDKA 4J1QA 4NQZA 4RKYA 2NLOA 1FP7A 4D44A 2ZWMA 2O2YA 5B1EA 3O3OB 2VPYA 3GLIE 3MJSA 2HLNA 5EHXA 1U0TA 4O3FA 4UPVA 4P3NA 3SC2B 2O5RA 3IA7A 1BGWA 5HTKA 4O08A 4JLDA 3LT2A 2HNAA 5AJVB 1YFZA 2YJZA 2EKPA 1UUFA 1WOMA 3ZWPA 1V7PC 1DDOA 1TM1E 1KEUA 3MYRA 2GBGA 4EW2A 2II6A 5C52B 5FLXA 1FLDA 2W6QA 1LW7A 3BIJA 4UAVA 1O77A 3GGCA 2VXBA 5ALGA 3KIPA 2VK2A 1IZZA 1UZMA 3F5DA 4UE6A 2IBTA 2PTGA 2VPWA 1DUSA 3S8EA 1ZIDA 3KUXA 1NT4A 2VT7A 4YA6A 3VNVA 1NAHA 1LNQA 2QPTA 2YOGA 3IP3A 3PUKA 3QBEA 2EFJA 2JDIA 3A27A 3H9QA 4KE8A 1NJFA 2HF7A 4P7BA 4E7PA 5IT0A 3VNUA 3KBOA 3BFKA 4WN9A 3KX2A 4ZO4A 4Y1GA 1S8OA 3SBDA 2JLWA 4OUKX 3L7IA 3AL2A 3TIGA 1IEXA 1YBFA 1JFFA 1WZEA 3DNPA 1EK5A 1SOAA 1UP4A 3I6IA 3ORYA 4MCIA 4PHTA 4X3PA 4DTCA 1IAVA 2YDXA 1IHYA 1R0XA 1CIJA 4B7UA 1EINA 4QTUB 2O5VA 1G0NA 1FX0B 1I3KA 4IQGA 3SF0A 4BNTA 4Q00A 4ZICA 3L41A 5KKCA 1UDCA 2KB0A 1K89A 2WDZA 4HVTA 2F64A 5KYVA 1A5ZA 3U17A 3UXMA 3GP3A 3HBLA 3RQIA 1NN3A 4LJSA 1KP2A 3WBJA 4EFLA 5KX5B 4PXYA 4C6TB 5JCPA 2RHHA 3MLAA 4KXQA 2FUKA 4DE5A 4HWRA 3CX4A 3BB4A 4BKRA 1Y8RA 4TTIA 5T6BA 3M5PA 1GYPA 2IW1A 2YTZA 2PUHA 3M6VA 1J0EA 1GV1A 1J06A 4TL6A 1US8A 3K6RA 2I3GA 4XD2A 5G53C 3ZQ4A 4EJSB 3A3NA 3WRYC 2F3PA 4DWJA 1U4OA 1Q0SA 5KNDD 1GN9A 3OURA 1TVCA 3LY5A 3F96A 1VSQA 2YWGA 3MWGA 3HACA 3N7AA 3PYMA 3ZHUA 3AF6A 5ILGA 2H1HA 4RA9A 4KAAA 4AM8A 2PEZA 2R7KA 2J85A 1U8XX 1N5JA 3LNCA 4FOPA 5HBGA 1PT6A 1YQTA 1GPYA 2BEKA 4QQ8A 5AI8A 2PKXA 3V8EA 1GTJ1 2HSJA 3F46A 3I2FA 3GG2A 4GQIA 4O0LA 1L4FA 4P81A 2P4QA 3FPSA 4YAGA 1MPTA 4RSRA 2IPMA 1FFXA 4ND3A 1XMIA 2PT7A 2Q3EA 2HV9A 2W2KA 4CNQA 1G8YA 2ZUCA 4YAKA 3ET4A 4LTMA 2V3WA 3NOOA 1JE1A 1Z7BA 4DL9A 2XDAA 1UANA 2BDUA 1I33A 1KKLA 5E38A 5JE8A 2JAXA 3IELA 3TH5A 3M4XA 2J5QA 2BF4A 1WMSA 1BE8A 3QYFA 4NLLA 4XTCS 4CIBA 1Y6RA 2ZJ2A 4FE4A 2NNLD 4KFSA 2G8NA 5DXJA 4BTVA 3CRRA 4EM6A 5IS2A 1A71A 1HH4A 2Q8QA 5K2OA 3L8CA 2QV0A 5JS8A 4HZGA 1ZINA 2PLRA 4KLRA 1F2TB 3KL2A 3DG9A 4E5MA 4M49A 5G2OA 5BMVF 3GJTA 1WZ2A 1GTL1 5G1NA 4UFNA 4BC0A 3E5MA 1H0KA 1QNLA 1AMUA 3G82C 3NQ41 4ZVQA 1SEPA 3IXMA 4N0PA 1VL0A 4PPGA 4EAQA 2CLMB 5F9FA 5H1YA 4Y9TA 1A7JA 1OXSC 3RJZA 1HDGO 1MUUA 1PE0A 2DUMA 3PUJA 4GPIB 5DTEA 4AZVA 1Q1AA 1FUKA 3ZBUA 4Z1MA 3U7IA 1PHPA 3W2EA 1NVFA 4M7WA 3JW8A 3ROZA 3FCXA 4UKDA 4D6XA 1ADGA 1BXRA 1ODFA 3C3EA 2Z57A 3MMNA 2G82A 4JJKA 4RA6B 3WIVA 5EKSA 421PA 4DV5B 4AJ2A 5GY7A 3NORA 1M8JA 4J4TA 4UXIA 1V0JA 2PE5A 3GFPA 3IBFA 2YH2A 2KI5A 2R44A 4IQ8A 1M0EA 4HDNA 3NETA 3O84A 4NNOA 5K4HA 5IFLA 2PYZA 4HQOA 1PGJA 3T0FA 3U7HB 2L69A 4V0NA 4FXOA 3I3SR 3QWAA 1ZMBA 5CVCA 4E08A 1K8ZB 5GZ3A 5HZMA 3KT3A 4G41A 3LFTA 3BTOA 2X4DA 3OTGA 4HXYA 1P7ZA 5CCDA 4DCSA 1HOXA 3HJCA 4F7DA 1D4FA 3FY4A 3KOUA 3GJXC 4MRNA 4DHEA 5A6SA 4NFLA 1JEYA 4XB1A 2OHOA 3H75A 1F3LA 1V4BA 2PDAA 3D6FA 3V1KA 2Q4DA 4RW0A 4CMIB 1JWAB 3O7WA 2GYWA 1Q3KA 3W9YA 3FYUC 1LS1A 4GIBA 2DWUA 3LC1O 4XR4A 3K09C 3RH0A 1U7PA 2Y4OA 3ZJTA 2JNWA 1KKUA 3THYB 2WWWA 2C1EA 5EWMB 3PL1A 5EA2A 4FFNA 3O0DA 3PDUA 5F33A 1EVZA 2NTJA 3GHHA 1ND6A 2DTDA 3KXIA 5FI0B 4GOND 1U9YA 4XVRA 5B37A 3QLTA 1P7PA 4Q3DA 4Q6BA 4P0TA 4N3NA 1CJSA 2AN9A 2CFRA 5EIOA 1PT9A 4M9CA 3MN1A 4LBYA 2NMVA 3AXTA 1ISMA 2J3LA 3LA8A 3P9XA 4OUDB 2HMVA 1GGFA 1GQQA 1KIMA 2AT1A 1B8NA 1GLNA 1L1QA 5EMMA 2QD2A 5G3ZA 3TJRA 4AKSA 2EIHA 4YPVA 3LPMA 2J0UA 4GXNA 5T57A 1KAOA 5LBUA 1PZGA 5C5CA 3X1YA 2O5CA 4L6AA 2JD1A 4AF7A 3FMGA 3IQGX 1Y1QA 1JFVA 2AEJA 1GZHB 2QG4A 3ILXA 3QVGA 2Q5QA 4UM8B 5HX7A 1ETUA 1E96A 1NW4A 3B20A 1QMPA 2IYOA 3ZBTA 2BFAA 1NVUQ 1W88B 1UWKA 2CNNA 2J4FA 1H0HA 3C8UA 4HX9A 4QUBA 4UNIA 5KNBD 4B6EA 2BMAA 3LIIA 2FK7A 1NW3A 5DXFA 2P7HA 3T3NA 1SB8A 1ZA2A 1N1EA 3A1TA 3PQ8A 5BOVA 1I32A 4YRIA 5LYJB 1I2ZA 3OE4A 2BR5A 4QWMA 4R68A 5EE0A 5JALA 3F3KA 1HFJA 5LZ8A 4EATA 4H3VA 3UJ8A 1MFPA 4FGSA 1ZNQO 1FP4A 4C7KA 1JQ5A 1SCDA 4G24A 1MB0A 2G17A 3W06A 4I4CA 4X1IA 1TGVA 2BYTA 4IDNA 1YS7A 3OM0A 3PVSA 5TQVA 2JA2A 3WLMA 4N12A 2QLFA 2NU9B 4IDPA 1YR6A 5TE9A 2CLDX 5DYYA 5HS6A 1M2GA 2X9GA 1P4JA 4Z9YA 2P78A 1G7CA 1XWIA 1HDEA 3H05A 2ZSEA 4I8DA 4RDIA 4E88A 4FWTA 4J91A 5HIMA 1Z5NA 2FWAA 1WDMA 2ZZKA 4ZYWA 2DTXA 1OAOC 1CUZA 1JHXA 2Q0SA 3FJOA 2CNWD 3G1UA 1JLSA 4TWAA 3U13A 1MC8A 1M8PA 2ZIEA 4QEDA 4EJSC 4DDVA 4TLEA 4KK4A 4DIBA 4AMUA 2J30A 2W2MA 4KMMA 4PPNA 1YQQA 4MW0A 2MCFA 1A72A 2QTMA 3GCZA 1U0GA 3CF6R 2OLJA 3GRCA 1BW9A 3WJ7A 3ONVA 2OV4A 2X8BA 4S2EA 2X1LA 1DIOB 2VYFA 3B38A 1Z26A 1ZGGA 3BOSA 4R05A 1UKVY 3KSUA 5IEBA 1VRWA 2G0TA 3EUAA 2Z5LA 5HFAA 1RWPA 5BW5A 3UGJA 4Y6GB 4JGIA 4WEQA 4B09A 1EX6A 3IUSA 3Q6IA 3C15C 5L95A 4YJ3A 3QUBA 4UHDA 3L8ZA 1F7VA 4BEVA 4D5EA 1XAIA 1V4VA 2CXSA 3FHJA 3T3IA 1DPFA 3UFBA 4OP2A 4EQZA 1CS0A 1V43A 3SR3A 2QRZA 5AUNB 1QH8A 2AYZA 2R60A 4P22A 4JASB 2B4RO 2D2IA 2ECFA 2FW8A 4GMKA 1DZIA 1YQDA 2IGTA 4DANA 4UUAA 3BCUA 1H4SA 3HVKA 1DC6A 2PAFA 4IQ0A 3ABQB 4M9RA 2P5YA 1CWUA 1UT5A 1C1DA 3LS2A 5LBTA 2XZDA 5AKIA 5ERGB 3L1IA 1SURA 3MCVA 4BQQA 4G65A 1KY3A 4GPEA 4PW0A 1G60A 2R6HA 4IRUB 4MYHA 4AWBA 5GIOE 4RELA 3DDWA 4F5YA 3VR3A 2G76A 3BN3A 4NZ9A 1AZLA 3S2GA 2VSFA 4FEAA 4FK8A 4GFDA 1AXGA 4OHBA 1T8WA 4WLFA 1U0RA 4FDAA 4E5UA 3KV3O 2YUIA 3VPCA 5L7YA 3ZKAA 3T3PB 3F8TA 1Z6TA 4KBYA 3OZCA 3X1WA 2VG8A 5EPUA 3ICWA 3LCCA 1OH6A 4HGPA 2Q41A 1P5FA 5FHQA 1V8FA 1UPTA 4D8XA 4QTYA 1E1DA 1G4AE 4MVCA 4XPIA 4OQ4A 4DIFA 1JKFA 4LRWA 1MJGA 1KSGA 4EFMA 2YNMD 4GSYA 1YOBA 1TUEA 1MJNA 2BEJA 2QTRA 3K16A 2Z4SA 3RRYA 1KFCB 1LV7A 2XA9A 3ZLTA 3URKA 3ZDBA 1P39A 4X92A 5IK2A 2CHEA 5AFSA 3HCBA 4N5DA 4Z1MD 3JSXA 4X60A 1EVQA 2RGRA 1E7WA 3E2MA 3HGMA 5K0BA 4YT5A 2C0QA 1ZGJA 4YRZA 5B7NA 821PA 2ZJ6A 4M0DA 3S44A 5IPFA 5JUWA 1WW2A 2D5CA 2OPBA 1CJCA 2V7PA 2ZRJA 4XSGA 4BFZA 3HSKA 4AY2A 2YMMA 1P62B 2IZ7A 2RE8A 3HZZA 2A3RA 4CM4B 3VA7A 4L5JA 2Y2UA 3P8ZA 1KRHA 1RP7A 1BMDA 4GXRA 1SOWA 1BC5A 4ER0A 4WLVA 4RLQA 3IV7A 1L5HB 3OC0A 1THTA 2GERA 3CT4A 4IMIB 4DSAA 5CT4A 3SJ7A 3QI7A 4FHCA 2VLBA 3KSBC 1LBQA 2YR0A 4ZCTA 3PR3A 1P61B 4KLCA 1H23A 3AEQB 3ZNPA 1USIA 4CKWB 1JIKA 2RKOA 1S8NA 4F4IA 5J40A 3DEHA 5IDQA 3WWYA 1Z16A 3PCTA 1QONA 5IX8A 1Q7EA 3RJTA 5BR7A 1LBIA 3HSSA 4A0FA 1KO8A 2J3MA 3EZXA 5EJMA 1QHHA 1XMSA 4LWPA 4CM8B 3ETDA 2UUPA 1ZRMA 2YOHA 2CYBA 3A11A 3OG9A 4O2BF 3IULA 2FN7A 1WXXA 5CRIA 2QXYA 1KJQA 5J1SB 4C0HA 5HQ3B 1L4NA 1NJ5A 3DE5X 1CDDA 1WNFA 1U7DA 1E2LA 2GZDA 3HRKA 4YP5A 1PQWA 2QI9C 4ZOLA 3GP8A 3Q7EA 1OGYA 2IYYA 4PYMA 5ALZA 1NMXA 2R5FA 3DTVB 1QRTA 2DHQA 4X93A 1BEUB 3DVLA 1DXQA 2GN9A 1OXMA 1CE8A 3WL8A 5A9SA 2VSYA 4DV7B 3A6GA 3N5CA 3C8ZA 2CSUA 5D7NA 2X8JA 4LYAA 4IH9A 2YZ2A 2GBLC 5IHPA 5CFNA 3VTFA 2KHZA 2AC2A 2W6JD 3MJCA 3UB2A 3VJLA 2X13A 4IMJB 3PD7A 4DKJA 1IN1A 1XQXA 2MSCB 1I4OA 4LXQA 3KJZA 2P5UA 3OPYI 3C6MA 4WESB 4F3KA 1T9GS 121PA 3ESZA 1BO6A 1ICIA 1AQLA 3WRVA 4ZYZA 4KH1A 3WYGA 1BJTA 2BFCA 3NGMA 3SI7A 4PLVA 1W59A 2GK3A 1Z0SA 2DRIA 2WYVA 3INTA 4TRRA 2ORVA 3FB4A 1PR1A 4V1CB 1VMEA 3E35A 1ZOIA 4ZO8A 5HOQA 3Q5GA 1EAYA 3DO6A 4NI5A 1VYUA 4KPYA 4Y2YA 2V7VA 1Q74A 1X1DA 1TLLA 2XUAA 3QXHA 1JPNA 1U8AA 2JGAA 4JUDX 4MQUA 3UHPA 4RAOA 2Q1YA 4NG5A 2CZCA 3H2JA 3HV0A 2I2FA 4PNPA 4BKPA 5JSZB 5KREA 4J76A 4DEXA 2XUPA 4GI1A 1J8MF 1ZH0A 4P35A 4CMBA 5JXHA 1NRXA 3BWCA 3TQTA 2Z04A 2R86A 2KLHA 1BN6A 2AEMA 1ZWLA 1KEEB 1WZNA 2R7NA 4LDJA 4YMSA 3ETHA 3KKQA 4CKEA 4GRDA 3NONA 2D3TA 3PGMA 4M1YA 3HR4A 1RAHA 2OD2A 3FKSA 3OMXA 1P2BA 4H1TA 4P53A 2AG8A 2DPMA 2PN1A 3SSNA 2JGJA 1IUNA 1PGPA 3QHPA 4FN4A 3TO5A 4BMSA 4U9HS 4W1SA 2VNAA 3WGYA 3GEIA 4RJLA 2VHCA 1RRFA 3NTVA 2AQIA