4DMFA

Crystal structure of the cftr inhibitory factor cif with the h177a mutation
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
293
structure length
293
Chain Sequence
b'AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWAFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
molecule tags Hydrolase
source organism Pseudomonas aeruginosa
publication title Inhibiting an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa Protects CFTR.
pubmed doi rcsb
total genus 111
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dmfA01
2R11A 5JAHA 2XUDA 3DEAA 3WIBA 3TJMA 4KAAA 3I2IA 1XROA 3D5EA 3QPAA 4BAUA 3WKDA 4S0XA 1UK9A 2C7BA 4BZWA 2J3DA 3DKRA 1E8DA 5AKEA 5AP9A 1YB6A 2ZYIA 3I28A 1N8SA 2J4CA 1UK6A 4PNZA 1CQWA 1ZI8A 4KAFA 2I03A 3ESBA 5HK8A 4Q3KA 1E66A 1R9MA 2ZJ7A 2V9ZA 5K3AA 2WIKA 4MJ3A 4AO8A 1LPBB 4QZVA 4WFKA 3PF9A 3IUQA 1CUZA 1B41A 3UUEA 2OGZA 3MVEA 1JT2A 5AKKA 5AM5A 4K6GA 4ZXFA 1X70A 3FYUB 3LCRA 3Q8WA 3ZLVA 4C88A 2GYVA 5DTIA 4A5SA 3WZLA 3AIKA 4CIBA 4GXNA 1IUPA 3GA7A 2PSFA 5JZ9A 1QIJA 4PSUA 3QBJA 2NW6A 4CIAA 3OC0A 4Q34A 3F97A 3H17A 5CXUA 2XQJA 1G66A 2XUPA 2DFPA 2JGLA 5JZSA 2WU4A 1HQDA 4WY8A 5HQ3A 4HRYA 3IUMA 3O9VA 1MTZA 5E2IA 1EDBA 1XFDA 2UZ0A 5AKHA 1WOMA 5A6VA 5JALA 4MEBA 1SFRA 3F9CA 2XUOA 2HIHA 4DM7A 3WL5A 2R8BA 5EHZA 3H2HA 1OILA 1VKHA 4K5QA 4X00A 4DMKA 2GBFA 4B80A 3C8HA 5AO9A 4AB1A 5AI4A 1ETHA 1MJ5A 5JASA 4E11A 4LKOA 1XRNA 5FOQA 3VJKA 5DLPA 5AK5A 1AKNA 4AN1A 5AI5A 1Y7IA 1P0PA 4C89A 2WG1A 5ALMA 3B3QA 5CBKA 4U2EA 3FYUA 2OG1A 1RYYA 4CCYB 1DX6A 3OURA 4X90A 3L1HA 1O6FA 1CLEA 4X6YA 1Q83A 5AM4A 3HJUA 1XQWA 2GZSA 2WTMA 4IQ4A 5AKYA 4XWGA 3G7NA 5K5EA 2PM8A 3LLCA 2JBWA 1IZ7A 4DMCA 1CUFA 4ZV7A 2GBCA 1EVQA 3WKCA 1Q0RA 3EBLA 4C4XA 4H7EA 3T52A 2XUGA 2IX9A 4X71A 4IH1A 1VE7A 4HZGA 5A71A 3KSRA 4G8CA 1F6WA 3G9UA 4QDXA 1QIKA 3ZPXA 1K5PA 4B9AA 1CUGA 2WM2A 1HDEA 1H2WA 1DT3A 2C5GA 2QMQA 1BCSA 2DSNA 5DYYA 4GW3A 1XZEA 3DNMA 2CBGA 1A8UA 4H7IA 3WWOA 2OCGA 1AQLA 3WLAA 1CUHA 2BCEA 1UZAA 2WHPA 1XQVA 4J0KA 5KWJA 1VJ5A 1QIFA 1JMKC 4H7FA 2PUHA 5AI9A 3C45A 2WUDA 2HA7A 1USWA 5AK6A 1W1IA 3FVTA 4MWSA 2AJDA 3WWEA 2ROQA 1GGVA 4L72A 3ESAA 1J07A 4DGQA 1U65A 3DLTA 3KOOA 4W9RA 4Y2YA 1F0PA 4LXHA 1U8EA 1RWQA 3IURA 4YASA 4LIPD 3U1TA 1QIMA 1EXWA 1A7UA 2WJ4A 4C01A 5FLKA 3MUOA 1CIJA 2VT6A 3H1BA 1XRQA 3K9BA 1BEEA 5ALOA 4WDRA 3WQHA 5K3CA 4BAZA 3HXKA 4RE6A 1XZBA 2WHQA 4U2BA 1VE6A 4I4CA 1XQYA 2XE4A 5ALTA 1W4LA 3KDAA 2G5PA 1YS2X 2GBIA 3OPMA 2XQIA 2PSDA 3AZQA 4X93A 1DQYA 1OXMA 4UFOA 2Y2UA 5CXXA 1CR6A 4U2CA 5AKIA 4Y2RA 1E89A 5JZBA 1WHTA 3WK7A 1VZ2A 4BB0A 1EK1A 1XLUA 2OLEA 4B83A 3STWA 4BDTA 1ZD4A 4HXEB 3WJ1A 5BWBA 2JEZA 1G42A 1KEZA 3OTQA 4OPMA 3VISA 1SOMA 1XRRA 3AJAA 2K2QB 2Q0XA 4EZIA 5LZ4A 4CI9A 2QVBA 1BCRA 3O4IA 1QO9A 5EHQA 4UBIA 2XUQA 1QZ3A 4KE9A 5CH5A 3WYNA 4UHFA 2QJWA 5DNWA 5E4YA 1BN7A 1L7QA 4OD0A 5AKLA 3IULA 2JGMA 5E4TA 3H2JA 2GBGA 5LZ2A 3OG9A 3PDCA 4ROTA 4J0GA 5ALFA 2FJ0A 3D2AA 2Z8ZA 1XZJA 3HABA 5KBYA 1LPOA 4AZ0A 3B5EA 2AJCA 3NUZA 3M3DA 3RK4A 1MNQA 2FX5A 5C8VA 4ZWNA 4ARAA 3EF3A 2J3QA 3STXA 1WCYA 1I6WA 3K6KA 1THGA 4H7KA 3N2ZB 2PL5A 3G9XA 4JYPA 3RKSA 4B6GA 1UT6A 2WIGA 5DWDA 3W04A 1R3DA 3M83A 2W22A 2DHCA 5LLSA 5EIAA 3AIMA 1N1MA 1GZ7A 3O9MA 2QXTA 1CUBA 1ZJ4A 4H18A 2OAEA 5DJ5A 5ALEA 1HLGA 2HU8A 1QONA 3V1NA 2CMFA 1PFQA 2QUBA 4J0CA 4XX1A 1ODTC 4JEIA 3I2HA 6YASA 5ALSA 4DSAA 1IZ8A 4X95A 2BUAA 2VEOA 5CTAA 5C81A 1YB7A 4FBMA 1EDEA 2QT9A 1HPLA 2OQVA 3WA7A 2DHDA 3O4HA 1CEXA 3O0DA 2ZYSA 2WG2A 2Y1KA 2HL6A 4FLMA 1LPAB 5HFNA 1R4ZA 2XMBA 3STUA 1XKLA 4J0DA 1EDDA 4I3FA 5EFZA 4G8BA 5CT4A 4N8SA 1UKAA 4CCYA 4Y2QA 3H1AA 1CUCA 3FSGA 1LBTA 1ZD2P 5HKAA 1AUOA 2QS9A 5A62A 4UBLA 4Y2VA 2OXEA 1CUAA 1M33A 3BJRA 3D0KA 3R3XA 3VJLA 5A7GA 5CT9A 2B9VA 4F0JA 1JJIA 1FFBA 1R50A 5AOAA 2ES4A 2VAVA 2I3DA 5EHXA 4U2GA 1BE0A 1P0QA 1TKRA 4RPCA 3DJYA 2PSHA 1FFDA 3QM1A 2O2GA 3U0VA 5AK3A 5JATA 2JGKA 5AKZA 4QLOA 5AM0A 1EK2A 1DINA 1FJ2A 4DNFA 3D59A 3ZV7A 3DL7A 3OM8A 4YK7A 4EY8A 3V9AA 1GKKA 4DYHA 2WJ3A 2HA6A 4FHZA 4LHEA 1YA8A 1GQSA 4D9JA 1AMNA 3I6ZA 2C58A 5JAPA 1CUXA 4BVKA 4J0HA 4Q3OA 3QPCA 5C8ZA 3BL8A 3V1LA 2XLBA 3AILA 3D2BA 5ALXA 4ETWA 3K2IA 2VTVA 2RONA 4PQEA 5ALGA 4AQDA 4Z49A 3EIOA 2C0PA 4E46A 3DS8A 1SC9A 1ZI9A 1QIGA 4NZZA 2QOEA 4P93A 2OPHA 2GYUA 3SC2A 2VF2A 1RP1A 5IVIA 1MN6A 4QDOA 3VVLA 1QIIA 4Y2JA 3A70A 5IKXA 5IVDA 3WK8A 1R9NA 3BE8A 3A6ZA 2WIDA 3W9BA 1K6EA 1AZWA 1CV2A 1WM1A 5FPQA 4P92A 1LPSA 1H2YA 2ZYHA 4ZV9A 2XMQA 3CN7A 2OQIA 2H7YA 5HQ3B 2FJPA 3G8YA 5LZ5A 5ALWA 2X76A 4KACA 1FSSA 1ZIXA 2WFZA 1W76A 3H0CA 1CUVA 3I2JA 4G4IA 4KEAA 2WUFA 5ALPA 3BDVA 5DNVA 4ARBA 3I1YA 4C4YA 2XUHA 1EI9A 1P0MA 2VJAA 5ALDA 3DYVA 3TGLA 2VJBA 3ESCA 1TRHA 1LLFA 4M0EA 2JGFA 5AICA 4G4GA 4IO0A 5EIHA 1A8SA 1CRLA 1EB9A 2VJCA 2XLCA 2HRRA 1BS9A 1JJBA 1MO2A 4FDMA 4C4ZA 1EINA 1CPYA 2I3ZA 3HACA 3LIIA 3FBWA 1ODCA 5EHNA 5AM1A 3I2FA 4C6HA 1UOPA 3O4JA 4GDMA 2XQKA 5HZGA 2PU5A 4CCWA 3ZWQA 1MX1A 2G4LA 2QXUA 3T4UA 3BF7A 3HEAA 2WFLB 2P8SA 5CW2A 1TIBA 1YR2A 1ZD5A 5BOVA 4DMFA 4L9AA 5ALLA 2OCIA 1ZICA 4QLAA 3I1IA 2WSLA 2XUIA 3IBTA 2OGTA 3QMMA 1JKMA 1UWCA 3DYIA 4U2FA 4BC1A 3S2ZA 2JEYA 3D7RA 4BRZA 1UK8A 2BGNA 4N8DA 3E0XA 1JJFA 1XQXA 3O95A 4DMHA 1DT5A 1TQHA 1IUOA 1E3QA 5LP1A 3G9ZA 1EH5A 2WILA 3GUUA 1WPXA 3D2CA 2ORYA 4CG3A 2PUJA 1ISPA 4EY5A 4Q05A 1MT3A 4GHWA 5ALRA 5AM2A 4XJVA 4BVLA 2XMZA 1ACLA 2LIPA 4EUSA 2IITA 1ORVA 3I2KA 4KE7A 2CKMA 1DWQA 1KU0A 3HSSA 4HRXA 2H7CA 3JYHA 4BAGA 4LXGA 4LYEA 1GQRA 1VXRA 1CUIA 3GBSA 4BTVA 5DNUA 2HU5A 2CJPA 3RARA 2EEPA 3PICA 5D7BA 4GLBA 4GWLA 2OGSA 3R3ZA 5ALJA 1XRLA 3C6BA 2H7XA 4H7HA 1SCKA 3V48A 2PPLA 5T4HA 1AGYA 4EY7A 4N8EA 5HCUA 1CUEA 1CUSA 3HZOA 3DL4A 2IIVA 1FFCA 3GROA 2QRUA 4K6KA 1B6GA 2ZYRA 3NWOA 1O6GA 5K3BA 4MWTA 3LS2A 3DOIA 1A8QA 4W1RA 3QITA 4EHBA 1IMJA 3AIOA 3NGMA 1MAAA 3FCYA 1ZD3A 1MPXA 4BVJA 2E3JA 5JAUA 4X94A 4GI1A 5LKRA 5IVHA 1NU6A 1ZGCA 4BCBA 1JI3A 3F67A 3AUKA 2DHEA 5JYCA 4KAJA 3V1MA 4UUQA 5A2GA 2WUEA 5D3KA 1H2XA 3I6YA 1ZOIA 1XZKA 5AOBA 4H7DA 4KJXA 2JF0A 3ESDA 4OU4A 1TK3A 1HL7A 4X7BA 1ACJA 5LZ9A 3KWFA 3AZPA 1CFJA 5JD4A 4DNQA 4AO6A 5AI0A 1CVLA 2QM0A 1HBJA 2WUGA 1CUJA 1GPKA 1AURA 1LGYA 5IH7A 2XQFA 5CH3A 2I78A 2PSJA 2XMSA 3ED1A 3G9TA 1XZHA 4UHEA 1ZI6A 1CUYA 1DTEA 1LNSA 4TGLA 1XZCA 5K3FB 2WLSA 2WHRA 5T4BA 1LZKA 1T2NA 3G02A 1GPNA 2RGUA 3WL8A 5ESRA 5ALUA 1ZJ5A 2JIDA 1FFEA 2AXEA 2QJRA 3N0TA 3FVRA 2WIJA 4X6UA 4G4JA 4OSEA 5A7HA 1J1IA 1YA4A 4FOLA 3BJMA 4Y2SA 4NVRA 5HKBA 1X2EA 4X97A 2RI6A 4BYMA 2XT0A 2Y2VA 5AI8A 4E15A 2BJHA 2HA0A 1R1DA 4OUKX 4ZRDA 2AJBA 1WB6A 2QR5A 2J4FA 2CUTA 4G1FA 5T4EA 3I2GA 4MQMA 5SYNA 3W06A 4BTLA 2VJDA 5AJHA 2Z3ZA 4TPKA 5CT5A 4UFNA 4WJLA 3HLKA 4W1SA 2Y6VA 3WK6A 3WKEA 4M0MA 1DU4A 1WB4A 2H1IA 5I7UA 1K8QA 3UMJA 4G9GA 3R0VA 4UHBA 4G5XA 3IA2A 3MUNA 3AZOA 5LIPA 2BFNA 2ACKA 2ZVDA 2RAUA 5LYYA 2O7VA 2WG0A 3CN9A 3HC7A 4WCVA 4PSDA 5FKJA 2HFJA 4FNMA 4CG1A 1VLQA 1XZGA 2XMRA 4UPDA 2YASA 4QWMA 4PF1A 3UUFA 3C87A 1Q84A 4UHDA 1WPRA 4B81A 4X92A 5ALKA 3DD5A 4AXBA 3C5WP 4EA6A 2Z5GA 4HXFB 1L7AA 3C43A 3WKAA 3C5VA 4ZGBA 4QDTA 4FLEA 3R3UA 5ISMA 1CUWA 2HA2A 4HXGA 4TVKA 1LBSA 1G5FA 4FMPA 2C0QA 4A23A 3VVMA 4G8DA 1ORWA 2D0DA 4DTCA 3E3AA 3IVMA 1BN6A 3PUHA 4C87A 3BIWA 3ZLTA 4E14A 2B4KA 4AX4A 2WFLA 4FBLA 2XB6A 3WKBA 3P2MA 2YYSA 4P9NA 4FLFA 3VJMA 3AINA 3LIPA 5AM3A 4J03A 5LKAA 2PBLA 3MGAA 4XIIA 1G4HA 3YASA 1TAHA 1E8MA 3C6ZA 3TEJA 4RGYA 2O2HA 2HA3A 1W52X 1J2EA 4X3CA 2DR0A 1P0IA 3W2TA 2HHAA 4J7AA 4HS9A 1X2BA 5EI5A 1DWPA 3V1KA 5FUMA 2BUCA 3DDUA 3FYTA 1GXSA 1QOZA 2AJLI 5CRIA 2PSEA 2V97A 4FFWA 2WHPB 3VKFA 3H04A 3B12A 2GYWA 2RHTA 4QDUA 3X3HA 1QIHA 5JIBA 1CUUA 3IDAA 3GZJA 3L1JA 1IUNA 4UFPA 2WU3A 3R41A 4UBMA 2X5XA 4MYSA 5CT6A 4UHCA 2RIPA 4X85A 1C4XA 3GELA 3R40A 4MEAA 1PV1A 4OB7A 2XUJA 1EVEA 1JMYA 4BATA 5AOCA 4IH9A 1VOTA 4MYDA 1YS1X 2C5FA 1QLWA 2BAGA 3H2IA 4BC0A 2ACEA 3ICWA 3PF8A 4KYVA 3KWJA 4XVCA 4MQLA 4EB0A 5KREA 3FNBA 4DLNA 4BRSA 3NOXA 1QGED 5HK9A 1FFAA 4UBOA 5BWCA 5I8PA 4FKBA 4QWWA 4WFIA 4Y9SA 5AKGA 4UBNA 1XZAA 3FSGD 3PI6A 3BWXA 1QFMA 5CURA 3F8SA 2QKYA 3H18A 3LP5A 4F5ZA 4Q3LA 5ALYA 4OU5A 4BE4A 4J3JA 3FCXA 1YASA 2JGJA 1S8OA 1H22A 5JAOA 1Y37A 3I6MA 1MX9A 2GZRA 1N5MA 1ODSA 1NX9A 4M0FA 1UOOA 2WKWA 3FAKA 4J0IA 3G0DA 1KU6A 4DNOA 1QE3A 4PO3X 2ZSIA 4H0CA 4JH0A 5AKJA 2CEKA 4J0JA 1QO7A 2XMCA 1GT6A 2WQZA 3CXUA 4JUIA 4LYDA 5FP0A 5ALQA 3WK5A 2XUKA 5FV4A 1UXOA 4WDQA 4F21A 3WWCA 5FXMA 4FFVA 3H2GA 4ITVA 2RHWA 3BF8A 1GPLA 1OCEA 2WFMA 2V96A 1UKCA 2ZSHA 2PX6A 2Y6UA 5AKXA 3WA6A 1R88A 2ZJ6A 3WL6A 3WI7A 3A2LA 4BCDA 1MU0A 4UHHA 2BGRA 4YX9A 5E4JA 1QJ4A 4NMWA 3SK0A 4P08A 1XZFA 5HF5A 1EB8A 4UBJA 3ILSA 4Y7DA 3L1IA 3HYSA 3WK4A 2YXPX 2QUAA 4B9EA 5I9IA 4A16A 4CG2A 5YASA 4BZZA 4INZA 3R3VA 2XI4A 1SCIA 1F0NA 1MX5A 1XZIA 4AMYA 2JGEA 4HAIA 5JARA 3OOSA 3VXKA 5LZ7A 1TCBA 1TCCA 1J06A 4G9EA 2HDWA 5HF6A 2XMGA 1AC5A 4OCZA 1ZIYA 5HFAA 4PV7A 4LXIA 5EIEA 1UKBA 3WZMA 3PFCA 1D07A 2VAXA 4QEKA 2DCMA 4QDZA 3QVMA 4AZ3A 5T4FA 3S8YA 1LPNA 5CT8A 3Q0TA 4OYLA 2O2IA 3ANTA 5EGNA 1QTIA 2XQGA 1CUDA 4UBKA 3FYUC 2HA4A 3STYA 2HM7A 4B7ZA 1QIDA 4RE5A 4EBBA 3W05A 1WHSA 2EDCA 3WL7A 2Z3WA 2ONCA 3IB3A 3FLBA 5KWIA 3G0GA 4KE6A 1XLVA 1NU8A 2B61A 3BXPA 2HRQA 4Y2XA 1U4NA 1LPMA 1QFSA 4B82A 1TCAA 4DIUA 3WIOA 1XKTA 4DNPA 1BRTA 1JU3A 4Y2UA 4RNCA 3FLEA 3ANSA 3E1GA 5K3DA 2VQ6A 2WTNA 3RM3A 1YSCA 4W1QA 2X8BA 3WK9A 1T4MA 2VA9A 4HTAA 5C7YA 3QMWA 4KR0A 4F60A 5FDFA 3H19A 3IUJA 5ALZA 3PE6A 3QPDA 1EHYA 4WFJA 1JU4A 1VXOA 3C70A 4KRYA 4FWBA 3GFFA 4V2IA 4OYYA 1DX4A 4Q1VA 1L7RA 2CZQA 1ZGBA 5CMLA 5F4ZA 1AX9A 3HRHA 4H77A 4Y2TA 3SWWA 1PJAA 3STVA 4IHAA 1EA5A 1A88A 2EDAA 3KXPA 4B0PA 2OCKA 3O4GA 3C8DA 3HI4A 5K3FA 1YAJA 4H35A 2XUAA 3IIIA 5AK4A 3PFBA 1QTRA 3CCBA 4PW0A 2VATA 3DKKA 5JD6A 4OB6A 4GBGA 5K3EA 1MAHA 3E4DA 2XUFA 3R3WA 2OAGA 4QA9A 2W6CX 1BEZA 2PVSA 4B84A 1UFOA 3FWHA 2G63A 3ZLUA 5HF9A 1XZLA 5CH8A 4FTWA 5DYWA 1WB5A 4U2DA 2DQZA 5JADA 1C7IA 3W9UA 4Q82A 2C4HA 1XRMA 4BCCA 5HF8A 5SYMA 4PSCA 1UOQA 3WJ2A 4QE3A 4L0CA 3DQZA 4BP9A 4EY6A 4AO7A 3KD2A 1QIEA 3EQ8A 3G0BA 3D3NA 5FRDA 2Z8XA 4ZREA 5H3HA 1YCDA 3FOBA 1HKHA 2QZPA 1H23A 1U2EA 2HADA 5D3ZA 2BKLA 2FUKA 2PU7A 3TRDA 3DCNA 1BROA 4WY5A 1MNAA 5JANA 4NS4A 3FLAA 4N5HX 1Y7HA 4BBZA 4BP8A 1VZ3A 3C6XA 1N5RA 1GKLA 4MXDA 3RLIA 3AFIA 4KRXA 3EQ9A 1K4YA 4JNCA 3SX4A 1Z68A 2H9YA 2AJ8A 5FPPA 7YASA 2PKYX 5A7FA 4KE8A 3ICVA 4K6HA 2ZJFA 4BE9A 1Q0ZA 1LZLA 2CB9A 2QTBA 4FNGA 1W75A 3WWDA 4AN0A 3BDIA 2ECFA 1LPPA 4K2AA 4JYMA 5C8XA 1F8UA 3QMVA 3QYJA 5ALNA 2OCLA 3ZI7A 4B85A 2BUBA 5JD5A 1DQZA 2YH2A 4QNNA 2VT7A 2V98A 2O7RA 4DSZA 3PUIA 3H2KA 2JGIA 4IH4A 4EY4A 4YPVA 2HFKA 4AMZA 3CCCA 1VA4A 3VDXA 5BV7A 5D6OA 3A2MA 4O08A 1EX9A 1YAHA 1K63A 1UK7A 5AHXA 1C7JA 3JWEA 3DOHA 1THTA 4B0OA 3R3YA 4W1PA 3WMRA 4N5IX 1XLWA 4H7JA 5ALVA 1BU8A 1XZMA 5AH0A 3WYDA 1DWOA 2VSQA 1IVYA 3IUNA 5ALIA 2HA5A 3QZUA 3BIXA 3JW8A 1H2ZA 3QH4A 5J3JA 3F96A 3C6YA 1E5TA 4X91A 4Y2PA 2WIFA 2XMDA 1W6RA 1JFRA 3EQ7A 3G0CA 2XDWA 1VA5A 2D5LA 3D4LA 3A2NA 4HVTA 4I19A 2G5TA 1SCQA 5LZ8A 3M82A 5AI6A 4X6XA 4OB8A 3F98A 4L3WA 4W63A 2WJ6A 3G0IA 5DTJA 4ZI5A 2B20A 4GEGA 5DYTA 5AIAA 1XRPA 3STTA 5IVKA 5AIBA 4GECA 3WWPA 2DQYA 5ALHA 1CQZA 2HU7A 3M81A 1E8NA 4BDSA 4CFSA 1XZDA
chains in the Genus database with same CATH superfamily
1FU7A 1NV8A 4MKZA 1ZK2A 2I5PO 2R11A 3DULA 3F5QA 4PQFA 5CLFA 5A4DA 2YWBA 5GMOA 3WIBA 3IEIA 4OKSA 3W34A 2GJ9A 2J1LA 2OFFA 1NF2A 4M9QA 3CH6A 1XROA 3PPVA 3ANYB 4MUJA 1YS9A 3I2YX 5F51A 3ZWDA 16PKA 3LUCA 3JY6A 4Q7JB 4ABTA 4P5PA 3GJ0A 4PIPA 1Q14A 1ZKMA 2VQSA 3WKDA 1AH2A 3KDSE 2IT1A 4BZWA 4Z4HA 1E1QD 1JEQA 1TO6A 3DKRA 3MT8A 1L1EA 3WDMA 5CG2A 3MUEA 3PXUA 4H1HA 3GG2A 3PSHA 2XT9A 3WL3A 1PGOA 1IK6A 1YB6A 3HRKA 1KJQA 4NYMQ 3CTPA 2Q2NA 2O5CA 2J4CA 3H6KA 2YJ6A 1H94A 1YFKA 1A97A 1ABFA 4EVQA 4NV1A 4IUYA 2B8EA 3C1AA 4OXXA 3TDNA 5BR4A 5KX5B 1PX2A 1PX0A 1KP3A 1CQWA 3VUFA 1IZZA 1V6SA 2PL9A 1RLTA 1O89A 2I03A 1TW3A 3ONDA 4Y30A 2QUJA 2PH5A 4KOAA 4KIWA 3W5DA 4Q3KA 2WVGA 1R9MA 1V95A 3I9LA 4Q7EA 1RLMA 4FYKA 3PGKA 1XVUA 1ULZA 1ND5A 1YZLA 3RQSA 4AT1A 2RBEA 4I5FA 3SR0A 3VX4A 3IUQA 3T1HB 2F8TA 4ZA2A 2VG8A 4RH3A 1JQBA 3HBJA 3LP6A 1CUZA 5F2KA 3UO8B 3UUEA 4A6EA 5CA1B 3MVEA 1O94A 3TK1A 1YVRA 4RD4A 2C9MA 3TW6A 2HMVA 3EF0A 3O1LA 3E03A 5DKFA 4TV8B 3FYUB 2XWPA 3JAMA 1LTHR 2NLOA 3Q8WA 4XGQA 5LOVF 4YQZA 5DOVA 4HNHA 3WQRA 4P32A 2ZJ1A 4G4SO 4JZYA 4NULA 5DTIA 3W5JA 1T8SA 1JFVA 3AR7A 5FCDA 3WZLA 2QRGA 3GP5A 4OXRA 3BGSA 4QUBA 1K5GA 4KVGA 1CZUA 3M3HA 2DERA 3FHOA 2VEDA 3AIKA 3W9SA 5JCXA 5KTNA 3WLEA 5LU8A 1UAAA 3HYTA 4GXNA 1IUPA 3GA7A 3MUFA 3V1TC 1ML3A 2AD1A 3FR7A 3PJGA 4B7AA 2PSFA 4JBWA 3I62A 4HUQB 2BTQA 3FFAA 1QYDA 4FJ0A 4Q34A 2NZYA 3F97A 3KK0A 4XB2A 3STHA 4ZCLA 1F2UB 4X20B 3X0DA 5CXUA 1D8AA 3P2OA 4E51A 3DO6A 3Q9UA 2PPVA 3VU9B 1L6RA 1G66A 1OLSA 3LW8A 1RJ9B 3A7EA 3KKLA 1NW8A 4TV8A 4ENVA 3QFRA 1LBEA 3AOEA 1NBAA 3G5AA 5E9JA 4H1TA 2BGMA 5F1YA 3WVNA 5IYZF 3LVBA 4PINA 5HQ3A 1HH4A 2PJZA 4LRSB 4LYJA 4B8WA 4LCJA 4MPDA 4UJ3A 3RS8A 3T3HA 5BNTA 4RVCA 3D8NA 2HRZA 5DV9A 4UE2A 4LRWA 4BFLA 1L5QA 4DR7B 1Q50A 2H2WA 2GFIA 1EDBA 1YJ8A 3MMNA 1WUJS 4ZYVA 3BA6A 2ZU6A 4CFZA 2LKCA 1XN1A 5DGXA 3Q3GE 2WW8A 1GV1A 1WUIS 2QW8A 1SIBE 4AMUA 2ZUFA 2AFIE 2UZ0A 3KZKA 4G65A 3R74A 5AKHA 3KKNA 1WLSA 2VRNA 4YBRA 5JALA 3D8HA 3VPDA 1XB2A 2WD7B 1TO1E 1ZY2A 3H87A 2QUHA 1B43A 1U7XA 3HCFA 2Y05A 1RVV1 3ZD6A 2FR0A 1SG0A 3FDZB 4XYBA 4K81B 4F45A 4P3OA 2L19A 1YKSA 1P61B 1OC2A 4QOHA 3LWBA 4EB6B 1KJZA 3H2HA 4JOQA 4UARA 1VKZA 4GBJA 3SNKA 5HWSA 3TM5A 1YDGA 1ZL0A 2HLHA 4K5QA 4MCAA 5FTWA 5IAKA 3L4JA 1Q11A 2C7GA 3C8HA 3HUEA 4AB1A 1GRRA 1PT5A 1ZDMA 1MQ8B 2I3GA 4ZDIA 1OI4A 3TAUA 2LWIA 3NH9A 4TMWA 3BRCA 3U44B 4LRXA 1XRNA 5FOQA 5EN4A 3MCWA 4QSHA 2MHCA 2P41A 3EGIA 3MLEA 4WNCA 5FFFA 3HSYA 4JB8A 4M49A 3U4MA 4AW9A 4JGIA 4Q18A 5E38A 4ZVQA 5K8VA 4RL4A 4ZEWA 1EE1A 1DKMA 2QR3A 1Q95A 4WK0B 3WQBA 4Y1FA 2WG1A 3O9ZA 1GGMA 1OYYA 3FZEA 4AULA 3N8GA 1PG2A 1I4TD 3BXEA 1A27A 3AHCA 2AWOA 2I6QA 2J6HA 1RPAA 2NZUG 2EKQA 3GI1A 1P62B 2OG1A 1GSIA 4RCVA 4CCYB 2Z0MA 5FI5A 3KJFA 4M7PA 4ZQIA 4HP8A 2XCLA 1K7YA 1OZHA 1QH8B 2G1JA 3V8NA 1O8CA 3RSSA 1X1EA 1SUCA 4GI7A 2X7HA 1V3TA 1SKYE 4G1BA 5B2FA 3F1KA 3V7WA 1ZN9A 4YJ2A 3C3DA 1MBZA 3L6CA 4ITRC 5DGHA 1XQWA 1UJ6A 2FMHA 3VZPA 4V0SA 1AMUA 4WJZA 1QRUA 2RGBA 2PUTA 4EF4A 4EHJA 1PD0A 2JKVA 2YDXA 4FUTA 2G70A 4O2BF 5E6RB 3N2GB 1PGJA 3GZTB 3AEKA 1T91A 1DB3A 1JZSA 2AH5A 1NXWA 2OZKA 2WTBA 3DV9A 4YWHA 2WHYA 4L51A 2ZE7A 2JLBA 3Q7TA 3A6DA 4PNPA 1RKVA 3IEXA 2R00C 2WSSD 4E3WA 1TTHA 2AVNA 1RM3A 4ZVMA 1EVQA 2H5LA 1PWHA 1WCWA 1Y3BE 4EYGA 3WKCA 5BV1A 2KWIA 3CSUA 2DPGA 4FQ5A 2IHYA 2XSZA 2B83A 3M6FA 3OE7A 3VZBA 4CKBA 1ZUNB 3GNTA 1XCBA 2H31A 3L8ZA 4W6QA 3U9SA 1YKGA 3ZLJA 2BEJA 2HWXA 3RRXA 3T5TA 4UTRA 3Q3HA 4P82A 4AMBA 1R10A 4XE5A 2Z30A 2JHGA 1T6XA 1HDXA 4EKGA 2RHJA 4XFJA 4I50B 1JZTA 4XPIA 1ZMRA 1EUDA 3RIHA 5B6IA 3S2FA 2N46A 2D1SA 4PQRA 3NHUA 5A71A 4EEKA 1K89A 2QD3A 1L4LA 3KT0A 2XYVA 1QVWA 2Z4SA 1SG9A 1NN1A 3ZPXA 3G68A 3UBTA 5FI1B 4B9AA 2R1UA 1G8HA 2GB4A 4A7PA 2F00A 2X2OA 1IY9A 1QU3A 1CUGA 5HKKA 5F12A 5JJBA 1CF4A 2PJDA 2G80A 5JH7A 2OO5C 2ACVA 4TTSA 2FUCA 4KFSA 1PJBA 1M10A 3N87A 4E6PA 1AE1A 2OV4A 2YZGA 1GQYA 2JFUA 3GV0A 4ZT7A 1ZWKA 3HUDA 3VMMA 3W4IA 4UMDA 2VHVA 2DSNA 2MSLA 3L8HA 3MWEB 5DYYA 4DILA 4CNQA 5IC4A 3QLUC 3UB2A 1R3UA 1KQFA 2GN6A 1WB9A 5HPYB 3SXJA 3C1UA 1SXQA 1GN9A 3DNMA 4POOA 3GG9A 1Q7CA 3GJ5A 3KHTA 5BSGA 1ID1A 4NX2A 3WWOA 3H0EA 3E2MA 1COWD 3MW8A 5CPFA 2ATEA 9LDTA 5H16A 4HPWA 3SX0A 3IT0A 4CV1A 3F90A 4AY5A 1Y6FA 1WOYA 1V9LA 1KK1A 3PQ2A 3ZC3A 4WSOA 4CMEA 5LP6F 2PUHA 3KQMA 3ZVMA 1ZGHA 2B1RA 1Y48E 1CP3A 3ZDAA 3DW3X 1G20E 1TVMA 2W6OA 2VYCA 1C3OA 1E5LA 2C2YA 3M49A 4HF7A 4L75A 4LSWA 3AU8A 4Q9IA 4GKJB 2VCYA 4FHGA 4RF2A 1J1ZA 3OZVA 4B4DA 4DDTA 3FOAA 2BDTA 2WJVA 1CD5A 4EJSA 2CT8A 4NBNA 3ZWMA 1J9EA 2XCSB 3QX3A 5C8YB 3CT4A 2PGIA 6PFKA 1NUPA 1YS6A 1J4AA 3C8MA 3P2YA 4MIKA 2LZ0A 1W1IA 3NT5A 1EBUA 4MVYA 3PITA 3VO9A 3KM0A 1F4PA 3IQGX 2LCFA 1XVLA 4MQFA 4OO3A 4PHFA 1RE1A 1Z0UA 2GK7A 1YE5A 2JPDA 4Z8XA 4CQMD 2CMKA 3QVUA 4R01A 1F7VA 4DC9A 1KMMA 2XZPA 4QYIB 5C8DA 1N9KA 1K68A 2FN8A 3ESAA 3MRXA 4FS3A 2DTDA 2R6JA 4L72A 1TM7E 1U65A 4DGQA 3KOOA 4M9ZA 2OBYA 4KR6A 2BFEB 4Y2YA 2REOA 4KW7A 4LXHA 4B34A 3MWLA 3GLVA 4E7PA 3FHLA 4BV3A 3IURA 4Q3CA 3DBHB 3U7QB 4BWFB 3U1TA 4FWTA 4Z9YA 3DVAB 3EEOA 4XQ9A 4TLBA 4LOAA 1A7UA 5K3OA 3RTCA 4C01A 3QE0A 5FLKA 1XPOA 2RG7A 4B32A 1XPRA 1M0TA 2GMWA 3VPXA 1CIJA 1VIMA 1DDIA 1JQLB 3KXIA 3H1BA 2PMKA 1BWSA 1CR2A 1L7BA 3FZNA 3QW4B 3RHTA 3ZN2A 4HFMA 4V24A 3E0QA 4B31A 2G4VA 4N6NA 5EXDA 4OG2A 5FBKA 1KA9H 3X2FA 3WQHA 3ZHXA 2IH2A 3DE5X 4B3IA 4ERXA 2DE0X 3BD6A 1MXHA 2WHQA 3HXKA 2ZR7A 4U2BA 1B73A 4RIGA 4Z7QB 1EZ1A 3I01A 2Z6AA 2NSLA 3JQDA 3RWMB 5TQ0A 5I7VA 5FBZA 4KPYA 1L4FA 4MQ5A 1U0HC 1U2GC 4RZHA 4URHA 1OFTA 5KOJA 1A5SB 3DMTC 3PNPA 1W4LA 2YWFA 3NAQA 3UJ8A 4PFKA 2Q27A 3JYLA 3KDAA 2C96A 1Y1SA 2PL3A 5HS6A 3ROTA 1UH5A 1YJ5A 3NGXA 1NM5A 5LYJA 1BVYF 3IPXA 4AKSA 3AZQA 2IXTA 4PIMA 1M2EA 2HSGA 3U19A 1RXSA 1QOPB 1V48A 4ENQA 4MKXA 2W71A 1BCRB 1IY2A 1E2HA 2L2QA 1Y5IA 1FB5A 3QOXA 4AECA 4RLFA 4TUYF 3BXGA 3A1TA 1H6AA 2HEIA 3I3SR 2GI4A 4BN4A 4KIJA 1XOIA 1NAHA 1VJGA 5FUBA 3DPSA 1D2AA 1JIIA 2BMVA 3BBPA 5JZBA 5K4HA 2XWQA 4FEYA 4BB0A 4FI3C 4QHSA 3ST7A 3ZD7A 1KZ6A 3CKYA 4KXQA 4Z1OA 3STWA 4ILEA 5KEIA 2OZLB 3IRVA 1MJNA 3MZ0A 1W0KD 2OO7A 3I4CA 3IJRA 4DRZA 5J9FA 4CEIB 5BWBA 1M8FA 3RSQA 4GSYA 1AXEA 4I1RA 1XXHE 1G42A 4E21A 5EIBC 3QY9A 3T5DA 3WHPA 1DC8A 4IDHA 1KEZA 4DQVA 2VYVA 2J9RA 3VISA 3KYDA 2FLWA 1XRRA 2QROA 1PNVA 2NYVA 2WEKA 1QYIA 1J23A 1Q91A 2ZYAA 1EGVB 3AJAA 4N6OA 4MVJH 5KVQA 3CW2A 1TTQB 5JVDF 4MOWA 4C9BA 2EW1A 1BCRA 1YJAA 2FPUA 2QVBA 2OKGA 3O4IA 3QLVC 1W96A 4B4VA 5BUZA 1DRWA 1QRSA 3DUFB 5EHQA 2J59A 4R8RA 4HR7A 3OF3A 5CIWA 2NO0A 3RUCA 2QN9A 1ZH8A 2QI9C 2XW6A 4KBFA 4EG7A 2QRMA 4N9QA 5BYAA 2ZAMA 2VUSA 1T3TA 2QJWA 5EPEA 1WDWB 4LJKA 1CDOA 1BN7A 4JC4A 4JITA 4TLLB 1FRZA 3R7LA 3KCNA 1KOFA 3AWDA 5KJ6A 1KSHA 2IVZA 3V42A 1R4NA 4BFTA 3AB3A 4EF6A 1KBQA 4RY8A 4C7MA 4QOFA 3IULA 1TUEA 3H2JA 3MWDA 5SY6A 5IF9A 2V03A 3C7DB 1R8SA 3C3XA 1Q74A 3USES 1HNXB 2J0QA 3Q3CA 3MTQA 3B60A 1FYXA 1MZVA 1HWYA 1ZOLA 3GOHA 3QV1A 1JKFA 1Q0TA 1G20A 1SRRA 2JCVA 2H63A 5JDIA 2OWDA 3G0OA 1O77A 3PDCA 2F3SA 2JHFA 4PLFA 3OX2A 3JSXA 2R7MA 1QE5A 5JRDS 1X19A 2EP5A 3JQ7B 4JWKA 2YCLA 2YQ4A 1HTTA 2C42A 3HABA 2H00A 3M6VA 4AZ0A 2C94A 1EP3B 1W0JD 2AJCA 1VFPA 4FFPA 2YV1A 3M3DA 1G16A 6AT1A 3WV5A 1X1RA 5K8CA 1QG6A 2XEXA 4IMIB 2X0EA 3GFGA 2QBYA 1KEKA 4X7PA 1HNWB 1LDNA 2EJWA 2JJ1D 2X23A 4JELA 4KWIA 1M66A 2X5KO 3EF3A 2D6FA 4NH0A 3STXA 3UQZA 3AC0A 1QLHA 1Z4IA 2WOJA 3BHIA 1T1RA 1I6WA 2EEZA 2PKEA 3M5DA 1XZPA 3ZU4A 1PUIA 1QX3A 1P1CA 3LSTA 4O1IA 4ZVRA 3RT1A 5FUWA 3H11B 3X2SA 2BWJA 4MULA 1BQ3A 1F2UA 1YQTA 4X20A 3NOQA 3AHEA 5CAEA 2V6JA 4JYPA 2FMIA 2XKJE 3IP1A 2GZHA 3EGCA 3QXHA 1YZFA 2GKOA 2I9PA 3U3RA 2D1RA 3W04A 1S7CA 2FPPB 1H9BA 1G21B 2H8GA 1HTWA 1R3DA 2XTMA 4KUGA 4R1OA 2AW5A 1VFNA 1BFDA 1N2ZA 1BXKA 1W2WB 2BCJQ 4P7KA 4C7BA 3TOCA 1ZJ4A 4C1BA 1Y81A 4Z9AA 4WN3A 2OG2A 3ZS9A 1TJ5A 4OFBA 5IZCC 2KMLA 5E7QA 3I30X 1WDMA 2FH5B 4S1TA 3B6IA 1V43A 2J31A 3OEED 2AC4A 5JG7A 3WMWA 4JXXA 4PAMA 3RKUA 5CFOA 3HXLA 2CMFA 4E08A 2QLNA 5JCPA 1PFQA 2HHHB 2QUBA 4GOOD 5BSTA 1BDHA 4GP6A 1BGVA 3T3OA 2YX1A 4JEIA 3HBNA 1L4EA 1MZPA 1DIBA 1SZPA 3WGNA 1RQNA 2EOAA 3G82C 3L07A 3CVUA 3LC2O 4RW0A 6YASA 2FTKE 4YMSA 5ALSA 2DWQA 4DSAA 4JB2A 3FNQA 3SS9X 4EHFA 2NVWA 3BGDA 2P67A 3K0BA 3ROQA 1RZVA 2BUAA 4JHLA 4DOMA 2WPNA 1U2QA 1AXRA 3D02A 2UUPA 4JGBA 4XJSA 2PZ8A 4FBMA 4NBSA 1U3WA 2WVAA 5T8KA 4TTJA 5T41A 5CLJA 4NABA 1EDEA 2QT9A 1T5SA 1W2HA 1XZ8A 1YU6A 2GK6A 1HPLA 3AERA 3GJXC 3OT1A 3IP7A 4X8MA 2CDRA 5EXPA 4N39A 5CLLA 5HTKA 3NFRA 2OQVA 5KYUB 5KKAA 3GJRA 2XA9A 3GJQA 4GM0A 1FP2A 1GJRA 1X7HA 3GLUA 4F86A 1CEXA 1N2GA 4A26A 3WLTA 4EG5A 1JEAA 4O4JF 2WG2A 5I9MA 1U2RA 2CFRA 2Y1KA 5CYGA 1FVOA 1PEYA 2HL6A 5BSKA 3E53A 2C7OA 4EABA 1XSEA 3AR4A 3EOZA 1TJPB 1ZUHA 2HIMA 3H9QA 5CJ2A 5BSUA 2FWAA 1BFUA 1I24A 3H6GA 3SM9A 4BGEA 5ITZB 5HNKA 3CIOA 3STUA 3PD7A 1JHXA 4Y0NA 1JQ5A 4J0DA 2J87A 3WGQA 4ZJZA 3FSRA 4I3FA 6REQB 4MP6A 3PA8A 4G63A 2A78A 1VKOA 4L8VA 5EFZA 2ZZKA 1BU5A 3HZHA 3ZE7A 4ZZ0A 3ZIAD 5FL7A 1AKTA 4BO3A 1Z3CA 4FPXA 4XVQA 1NASA 4DJJA 1V5FA 1UKAA 3EAQA 5F5XA 4CCYA 1TKCA 3TQFA 4FS8A 5H8WA 1GA4A 3H1AA 3ACBA 2HTEA 2JJ2D 2QMOA 1HE2A 3ZTTA 4ENTA 5F2NA 2JVKA 3QBVA 3AJ8A 5TV2A 2GFHA 1KAEA 2C78A 3EXHA 1AUOA 4FCVA 5DBOA 1FL9A 2FN3A 1AK2A 4Y2VA 3G7UA 3I6IA 5LA6B 2QA5A 3ZEIA 4EGAA 4Z7OB 3R3XA 4P4LA 1V7PC 4PPGA 4RUKA 5KOYA 3DDOA 5CT9A 1FS4A 5B1HA 1V11B 2ZBQA 4F0JA 3W5CA 4IIBA 2A0FA 1NXOA 3DOUA 1FFBA 2H1FA 2VAVA 1H05A 3B6ZA 4QFDA 5CGZA 3WISA 5HVNA 2NU6A 1KRHA 3B6EA 4Q39A 4A5OA 4GRIA 4GX2A 3IUSA 2HGSA 4CKEA 4EHDA 4EKIA 1QQTA 3UIEA 1JR3E 4GEKA 1EIWA 1PZGA 4MA5A 2P75A 4P84A 1TKRA 1BSVA 4GX5A 3DUWA 1Z73A 2B4YA 4H3VA 3DJYA 5E8RA 3BL6A 3R7BA 4JUAA 1NX6A 4NAUA 1JHRA 1FFDA 3ZOZA 4EPWA 4KUHA 1QDUA 3MS2A 4TZ0A 1T2CA 4KDRA 1M34A 1Z45A 3SSOA 1RPTA 4BQEA 4N0QA 3C3JA 5AK3A 5J1TB 4WUVA 2A9QA 4ZP1A 2OB2A 2YV4A 4J76A 1UFRA 2Q21A 4YHBA 4QAJA 4WASA 4QPCA 4QLOA 2JVJA 3BWVA 3RIMA 3TFWA 1LY1A 2BEKA 2IS2A 1FJ2A 2WJZB 1IJEA 1GAEO 3EXEA 3ANNA 1EZZA 3AW9A 3D59A 2A5GA 4PYMA 4ZD6A 3BTVA 5IAGA 2VXYA 1RR6A 4OATA 4I0WB 4G0WA 4L8LA 3OU7A 4YRQA 1IN7A 4YK7A 4B35A 5I7WA 3H9CA 1AM4D 2GHTA 1GKKA 4HDSA 3V9AA 4WBNB 3AJRA 4K05A 1B8OA 4DYHA 3O2NA 3DLCA 2HA6A 4FHZA 1JBKA 1N0VC 3OFNA 1MH1A 4URZR 5FOVA 3REOA 2BHTA 1D1PA 4JP1A 4IW3B 3RW9A 1P72A 1HX7A 4D9JA 1B8NA 1TQ8A 3HDHA 4EEZA 1E4OA 1GU1A 1QP4A 2PA0A 3KQTA 5TMBA 4BMXA 2C58A 2MIIA 2FW0A 1TMOA 4IQGA 2OBNA 3TNLA 2IX3A 1XELA 3DXZA 2COEA 1IWPB 2YQ5A 3HHEA 5D3MA 2E48A 2BZ0A 2NUPA 4LZWA 2UYHA 5C8ZA 2G67A 1L5HB 3BBLA 1I1QB 1O1YA 2OL4A 1XJ0A 2B7CA 4KXLA 3ADCA 1ZN2A 4Y2GA 4PM4A 2RONA 2YMMA 3KYCB 4RKEA 1G2OA 4JBHA 1QTNA 1QHYA 5EWMB 3EEQA 4M21A 2NU8B 4B2YA 4A73A 4F2WA 1CBUA 1QWSA 4RK4A 3SZMA 3VBCA 5HS4A 1PSWA 3NNSA 4XB1A 4FFLA 3D6HA 5KNBA 1SC9A 4NYIQ 2SKCA 1OZ0A 1QIGA 2G1KA 2R4UA 1JI0A 3WAJA 1Z5PA 4JZKA 2OPHA 5HIKA 5IT9A 1FMFA 2XCQA 4YMTA 3HRIA 3IR6A 2O8EB 2AOTA 2NSHA 3L7NA 3R7WA 1GL3A 4M37A 1MN6A 4RL6A 4RXMA 1XEWX 3CEHA 4QDOA 1CX9B 1JLLB 1NXPA 1T1SA 1JHQA 1FU4A 2V7EA 3FPLA 4HEA1 4MR8B 3EZLA 2OBLA 3L92A 3WDKA 1UQUA 1KPGA 4J4BA 4Y2JA 1EKXA 1ONBA 1U2TA 4C3ZA 5BUQA 1RMYA 3PR1A 4ZRNA 1U2ZA 2WYHA 1M8JA 4AJJA 4G0QA 4INPA 1YVEI 3TPFA 1FW8A 4GUDA 1K6IA 4WNYA 3BE8A 1FS5A 3A6ZA 4PYKA 1DTWA 3NAGA 1V8ZA 2WK1A 2P2CA 3UJ3X 4RZ3A 1AZWA 1TECE 1WM1A 2Q3BA 3EZNA 1RMQA 3I42A 4OLHA 4OP3A 1ELOA 4K1LA 5HFJA 4MCHA 3OTIA 1DKPA 3GVCA 3ND6A 3CN7A 2VJKA 5FJIA 3R8CA 3QSYA 2VJPA 1GGFA 1YL7A 2REXB 3DAYA 3HVUA 2ZJ2A 3G8YA 3GFVA 3P9CA 5IT0A 5ALWA 2PDAA 1YZHA 2EYUA 4FHFA 1QHGA 1KL7A 1TJ4A 4ADSG 1FSSA 3FDIA 4JQOA 1GQFA 1CUVA 4R8VA 1J8YF 1Z4QA 4EP1A 5K20A 1GPWB 4IINA 4ND4A 1GKUB 4IVRA 4R98A 1JIKA 3OZWA 4X62B 1X7ZB 1V1JA 1BMTA 4LDAA 4RPJA 5DGCA 1Q2XA 1A2OA 1V47A 4BMOB 1OLUB 2J0UB 4ZOQI 1ZK3A 3H8SA 2VTBA 2J8ZA 2X3FA 5CNMA 5BN5B 4BXOA 1FLNA 2P8JA 2C4VA 1P0MA 2JVIA 2IEDA 4GKVA 2H6EA 2VJAA 5IEBA 1DG3A 2GH1A 2NVOA 4LOLA 3GK3A 2QP4A 3O2SB 1EFRD 4TSKA 2ZRFA 3KJZA 4KNVA 2PMEA 4NAHA 3AG5A 5EJIA 1GFIA 1U4SA 3KETA 4D3DA 3EUFA 2VKTA 4RVUA 3MGGA 3OZFA 3L93A 1IIBA 5IBRA 1BS9A 1DVRA 1F2VA 1PW7A 4KH0A 4CM3A 4E1VA 4D96A 4KGDA 5IBQA 3T3PB 5HM8A 1ZOOA 2EX1A 3QVXA 4LNAA 2BKAA 3IDOA 1ULUA 2Q5FA 1NBIA 1ODCA 3H2ZA 4TSRA 1PT6A 4KOEC 2H29A 4NFYA 1J2JA 1QZTA 4NDZA 2I0FA 3CF0A 3ZWNA 3M4NA 1GZ3A 2AZ4A 2CBZA 1NNSA 4C6HA 1OLUA 1UOPA 4JHXA 5B3JA 4LF8B 2AMLA 2F4NA 4B3SB 3O4JA 4QPZA 2PAFA 3Q40A 3WBBA 2XF8A 3GX1A 3X44A 2XZDA 4GOMD 1RKQA 2Y1LA 2VSXA 4L4RA 5CFRA 2HDHA 5HZGA 2PU5A 1TYCA 3NRBA 3AHHA 3N7AA 5EIOA 4CCWA 4GO1A 1WZIA 1WKBA 3JQ9A 3HP1A 4AJ4A 5DBEX 4YFYA 2ZRCA 5CFNA 3B1JA 1RFGE 5LM3A 2PUDA 1DXYA 2WAAA 1JR2A 1S02A 3MWEA 4OJQA 3RIEA 1H1LB 2I55A 2C5LA 3B3GA 4M1EA 3LHKA 5J43A 3OCCA 5HE9A 1YR2A 4DMFA 3LXMA 4X6LA 1B0AA 1MB0A 1Z13A 4GR4A 5F76A 3FTQA 4B2LA 2AN3A 3W6PA 4BEBA 4JBXA 4MJXA 4ND6A 4WK6A 4M53A 3ETHA 1I1HA 1LBIA 1JGTA 3OEHA 4RORA 1L5LA 3WJ7A 1HGXA 4ODIA 4FMBB 3S2IA 1YQWA 2W2QA 3DXYA 3I9V1 4PZLA 4V0RA 3AYXB 3T7KA 2J9GA 4CMCA 3I61A 4I6GA 2GM9A 1OWPA 1PHPA 1SK8A 1TM5E 2CHUA 1INLA 3IBTA 4KK3A 1RHRA 5CD9A 3L06A 2OGTA 5I8WA 3ZZ1A 3NLLA 2DR2A 3QMMA 2CJYA 1GNSA 3EF1A 4I1PA 1EUCB 2FLKA 4ZOLF 3NHJA 2J5BA 1JHDA 3CY6A 2ENWA 3LVRE 3NJRA 4JLVA 5AUQA 3V4LA 5L51A 3CKKA 1T36B 1E1MA 5IARA 1BTOA 5BVGA 1YIDA 2DTEA 2QK4A 3IILA 1BG6A 3K0AA 3CWZA 1SCDA 3FPHA 3K4QA 1OWLA 2INGX 4FSHA 2C2WA 3C4QA 5ECGC 3TR0A 3V4ZA 3V8MA 3NTLA 1UUFA 4RA6B 4O25A 1KDVA 3C0KA 3D7RA 3FFBA 2D8AA 3F8WA 5EKSA 1OT5A 4UNRA 5DLYA 4PANA 4QT0A 2QG6A 2IUEA 1E20A 3BE6A 4BNKA 3I5AA 3EARA 4B7UA 5CCDA 4U8GA 1VRCA 2CLDX 1SHTX 1YE3A 3JRWA 1ADJA 3ES9A 3OKAA 3QKSB 3TCNA 1TVKA 3H2YA 2WA2A 3DOJA 3EXG1 4EMSA 3QYPA 4EGJA 5KNBH 2SECE 2VBGA 2YMQA 4DUGD 5LR6A 3E8SA 1Z5OA 3KQSA 3RUHA 2HI0A 4NEGA 4NK4A 3D4OA 3QU7A 2F6RA 5DSXA 1D7AA 2QT1A 2XYQA 3DLAA 1WAMA 1XWFA 5JV5A 3MOIA 1JPJA 3RVKA 2P9QA 3TR6A 3WNVA 3LDFA 2LIPA 4JYBA 4AQ7A 3ZGVA 4WLUA 4BLUA 4XGKA 4JR1A 4TMXA 5U4XA 3WLKX 4C0HA 7REQB 2D06A 1SUDA 4YP9A 4YJ2F 3I2KA 5KOJB 3FI9A 1N9ZA 1IYZA 2EQAA 2IHTA 2Q49A 1ZUIA 2NUTB 2OC9A 2R3SA 4MW9A 3QG1A 3SZRA 4DV1B 5B6PA 2G0AA 4HRXA 3G5LA 3JYHA 2AD5A 2DKFA 2QN1A 5D01A 4MWGA 2HCBA 1MX3A 1TM3E 2ZIFA 3E84A 3IUPA 2I8AA 4MS1B 1DG1G 1IONA 1GQRA 1EVIA 2G40A 121PA 1CUIA 3M4YA 3MC1A 1GKYA 2RGDA 1FDUA 1YDFA 1KNQA 4HUJA 5JXIA 1TJYA 5F2OA 2SNIE 3GMTA 2E6KA 1VG8A 4BTVA 3IQWA 3ZNQA 3ZKAA 1W47A 3AVYA 3U62A 3QE3A 3WYCA 5I3ZA 1OKKD 4BNXA 4G0YA 1ZK1A 5I45A 2HDOA 1T8TA 1Y1PA 4LMPA 1OTXA 3DEIA 3JATB 4RY2A 3UMMA 3HKCA 3K1ZA 4MSUA 3IPCA 4OA5A 5CJPA 1GD1O 2OGSA 3R3ZA 3HJTA 1JH9A 1KEUA 4LGCA 5AJUA 3GEBA 4GGPA 3RJ9A 3QA3E 3FUVA 3H4VA 5H70A 3QRWA 4MYCA 5E1OA 3HKBB 3I0ZA 4IEIA 1SCKA 1FUIA 4GPD1 4KHPB 3V48A 2PPLA 3G0HA 1RJGA 1Z4LA 4FU0A 5D1NA 2I4RA 1Y1KE 4DSTA 4L74A 5LL6P 2FUNB 1CUSA 1Z28A 3E6AA 1ESMA 2IIVA 3DL4A 3W7VA 3H1TA 3KT6A 4CODB 5TGTA 2D0PB 4K6KA 4TTPA 2QL6A 4MARA 3NBZC 5F73A 3RVBA 1AHPA 2ZSKA 5GADl 2IH4A 2ZITA 3W8FA 4MWTA 2FSIA 2AYYA 2PUVA 3KR1A 4ZAWA 1J22A 1ZC3A 3AR9A 3KSZO 1NONA 1K8ZB 2C9CA 3DOIA 3QITA 1Z74A 4KAXA 3JQ6A 5IDWA 4RHTA 4HWGA 3ZW7A 2ILTA 2R6CA 4N12A 4KQJA 4TXHA 3UVEA 3L7OA 5DRYA 5IAOA 1G9SA 1UBOS 3LRPA 3CSDA 3NGMA 3NNNA 3ZHRA 2FDCA 1E7YA 1G6KA 3AY0A 5FBRB 3QIAA 1EUYA 3EZ9A 3W77A 1GILA 4JP5A 4GZ3A 4LC1A 3WFIA 3UA4A 2ZRMA 1JVNA 2Y1OA 4H3KB 4BCBA 3DEHA 3F67A 2O2SA 3OQHA 4J9VA 4AG5A 1Y3AA 2BFPA 4MKRA 3NIFB 3P0HA 1CJVC 1BVRA 4CM4A 5ERXA 4WHMA 2XVXA 4OBBA 5BQ3A 5JYCA 5M04A 4DV3B 1BJKA 2HBQA 1GIAA 4XQGA 5FD8A 3H3XA 1K7CA 1T9AA 3V1MA 9LDBA 1D5CA 1PG5A 2IHJA 1I8TA 4N3CA 1W85A 4Q00A 1LI4A 5TVGA 4F8JA 4GZ5A 3EYAA 3FWZA 4KVAA 4H7DA 2Y99A 1Z0JA 3TIXB 4D6XA 3TRFA 5TT1A 3U16A 4MGEA 4KJXA 2O7QA 2BFBA 2QGNA 4BMSA 4D7AA 1MD9A 3HB7A 4GMKA 4IEEA 4F2GA 2GZDA 6ADHA 3IXLA 4ECEA 5K0EA 4PLPA 2C4NA 3ESDA 5IFLA 3RSHA 1TK3A 3FXAA 1MC8A 4X7BA 3ZJ4A 4DA8A 4NZYA 1O97C 4ZGWA 2DLNA 3SS8A 3T9CA 5LZ9A 1PZEA 1NLMA 4RO0A 1BE1A 1U9JA 2ZRJA 4MUEA 1KOLA 2H0QA 4BX8A 4HNGA 2DWPA 2PUAA 4G0VA 2QG4A 1U5BB 4E4YA 2ANCA 1I1OA 5EA2A 4JLOA 1KVSA 4V03A 2QM0A 1L8QA 3K0CA 4QGHA 5BYJA 3OJCA 2R2GA 4URXR 5GIPE 2B1GA 1YT5A 2O0KA 1CUJA 2IPXA 3BSWA 5D84A 4RTNA 1J42A 1AURA 1KEVA 2Q4DA 3L0DA 1MKYA 1RAFA 2BEVB 3MLAA 1QK5A 3NP9A 2C88A 2KS6A 1OR8A 2I78A 2JBHA 2PSJA 4BLSA 3ERCA 4C5AA 2W5UA 4CPDA 1VHLA 3B3JA 3N8DA 4LJ8A 1ZCBA 1ZW6A 1PR4A 1ZI6A 3CKLA 3MBKA 4YCCA 1VCNA 5A04A 3PCRB 2IOFA 2V9CA 1J9ZA 1PD1A 3M7IA 2R7LA 4CTKA 2QTLA 1VL1A 3G88A 4XDHA 4TVOA 3SEAA 1KJIA 1P17A 2IP2A 1OYOA 3GUZA 1XZCA 4NBWA 5ETJA 3CZ5A 1KWKA 2P0YA 2WLSA 2VUTA 2ZTUA 4S2UA 4O1MA 1E1RD 1LZKA 1I33A 1BGXT 3BFVA 3CRVA 1E60A 3F3SA 2DT8A 3PXXA 4NJOA 2J3EA 1LSSA 3BULA 2JKYA 4JLUA 5ESRA 3R7WB 2FR1A 1TKBA 4F71A 3NDRA 2W2NA 3M9XA 4DRXA 2ZJ3A 3N0TA 5BMVB 2D7DA 4PSKA 2IF0A 5JSHA 1UP4A 4CKEB 2DHQA 9ABPA 3AUJB 2WIJA 2AI1A 4X6UA 3TNJA 2VH2A 3S81A 2VJOA 2HDNB 2O5RA 2DX7A 3UB4A 1QU2A 1ULTA 4X1OA 3AKZA 3CRW1 3L7CA 4OSEA 2IDMA 5JYEA 4FOLA 4H17A 3BJMA 1MRNA 2COUA 5IRCD 5EP4A 4EJFA 3U37A 4G1UC 2FSUA 4NVRA 3UHJA 3MJTA 4JXKA 4YCLA 5JO0A 1T3LA 1U3VA 4DA9A 3CVJA 3FNHA 3DEKA 1RQXA 1Z6XA 3E9DA 3TL6A 2BM8A 1YZVA 2RI6A 2Z5LA 1ORDA 3MHPA 3TUIC 5JWHA 4BYMA 2XT0A 4JT8A 4WUTA 3QGMA 2RHHA 1XU4A 4KGXA 1SCJA 2R5FA 3HBMA 1YA6A 1JH8A 1PNQA 2PLNA 1P6UA 3ABSB 3LPCA 2GS9A 2C97A 2RDMA 2YOFA 1QP8A 3UK1A 3ZV6A 3TIVA 4HQOA 1KS9A 4YALA 3ZY3A 5B53A 3DE1X 1JRLA 4CV2A 5J4LA 3COPA 1QGUA 4PPQA 3IE2A 4G8JA 3HGMA 1A5TA 2Q7DA 4N7JA 3AEQA 3D7LA 3EJ6A 3EVBA 4OUKX 4R1SA 4ZRDA 4ITUA 1MABB 1YZ3A 2J0UA 2J4FA 2LXNA 3IJPA 1RXVA 2M2IA 3LL4A 5DX8A 5CJJA 4D26A 5IPFA 1KSFX 2NN3C 2VPZA 3I2GA 4I81A 4MQMA 3GJ7A 1TU3A 2CV0A 4ZN6A 1YB4A 3W06A 3LX4A 4A2PA 4CW7A 2OB1A 4DREA 4YMLA 5IM4F 1W73A 1KJ9A 3OUTA 4KWHA 5H83A 1E62A 3DAOA 5E6UA 4Q3NA 4D8XA 1FX0A 3PUWA 3LT0A 4E5VA 3DCJA 1F0YA 4I46A 3HLKA 3DKVA 4W1SA 2AOUB 4P4SB 4HNVA 3E9ZA 4O33A 2Y6VA 5EWLA 1F1JA 1M9NA 4R9UC 2F90A 1E4EA 2I6TA 4F6CA 4XGIA 4WGFA 3H1FA 3WKEA 4V1CI 1PVVA 1IM2A 4M0MA 5JHHB 1WB4A 1U3CA 2H1IA 3F5SA 1K8QA 2D0OB 3IOMA 3M1IA 4RAOA 3UMJA 4BQPA 1HNZB 3PNMA 3C7CB 4UHBA 2HCTA 4P31A 1HC7A 5AVQA 4UUBA 2LCIA 1KJNA 4JS0A 1MABA 2RJ3A 3FUWA 4BZXA 2ARKA 4OKIA 3IA2A 5F98A 1QE0A 1OH8A 1F51E 1JNXX 1U0EA 3AVPA 3AZOA 4PGHA 4TMFA 2OORA 4WRRA 3B36A 3VR5D 5BSVA 1BDIA 2JIOA 1H0HA 2OOSA 3SKVA 1DDOA 1QTQA 1SCBA 2FQ1A 3NBAA 1B6SA 1OAAA 3PGA1 4YMHA 2GT1A 2JDID 3OZTA 3V2UA 621PA 2NYUA 4TTAA 1YCFA 2WG0A 4TT8A 7MDHA 1FX0B 3SLRA 3VU8A 4KO2S 2FSFA 2GPNA 3I5UA 4QL3A 1Q1GA 3PNLA 3IPAA 1VLQA 4HN4B 4CG1A 2V7QD 4BJHB 3ND8A 3PFWO 2IXGA 4M98A 3ZXSA 2YASA 5C7OO 5HCNA 5SZJA 2BT4A 2BSAA 4MRRA 3FFWA 1MGPA 1UMDA 2OECA 4QD3A 3R2JA 4ID9A 5FUXA 1T35A 4LZLA 3T7AA 3P4UA 3THWB 1Q84A 4D8UA 5A1TA 1NVUQ 7ABPA 3CNBA 3QELB 4Y6QA 1SCUA 2V6MA 3K2QA 4KVFA 4BLTA 5GINE 1OY1A 3GRUA 2JHPA 3NBYC 2IYXA 3D2LA 4LF4B 1NQXA 4JQSA 4DCPA 3L8GA 4OHWA 1GZVA 1CY6A 1OXUA 1PZMA 4IGIA 2PS1A 3L8YA 4DSUA 4G3XA 2VSOA 1A4IA 2DG2A 2ZI7A 3BXFA 1OX4B 1PDVA 4JLSA 3SE0A 3WKAA 1I6LA 1GEEA 4KQWA 4TV8F 1ONOA 2YVLA 3GGOA 2B4RO 3ZHVA 3NM5A 1SUAA 3QKTA 4DZTA 1BKDR 3HVIA 4M0CA 3ZWWA 3LD9A 2DY1A 3JQAA 3FKQA 1G55A 4HMPA 2I1LA 3BWBA 3C5HA 4HCJA 3KB1A 2W2VA 4HXGA 4GYYA 4V0OA 2ADMA 4HK4A 4C0KA 1EESA 2JIQA 1EQUA 4BB9A 3TTSA 5JXWA 1OPRA 2UYCA 5C1OA 6Q21A 4R0MA 4QFBA 1TF2A 5FWYB 3PC7A 2J41A 2WAXA 1JP7A 2WWTA 3ML1A 2C0QA 2QVCA 3DOEA 3FCOA 4KXXA 1GRNA 3HEBA 3OC6A 1KERA 4R2XA 2OENG 1EGMB 1Y4DE 2OZEA 5H0IA 5FA5A 2YUTA 3EISA 4A1OA 4RLSA 4KQGA 1P1FA 4RQAA 1SU8A 4OHMA 4DTCA 4IZ6A 1DEAA 3D6UA 1A76A 3ZY2A 3AQIA 3VZQA 3RVDA 2R0QC 3RYIB 1L4NA 3LRXA 3RABA 1VG1A 4JKIA 4OHVA 1EX1A 4S1WA 1NVTA 2G7MC 4FEGA 2NYRA 2RIRA 2I4OA 3C3CA 5AW8A 3VV2A 2O07A 3Q7RA 2ZT7A 3PV0A 3RTAA 2XIJA 1HYBA 4TWBA 3OOWA 3J7AC 2OGWA 3DCYA 2B98A 3NWBA 4FE3A 3SS7X 4AX4A 4NXNB 3HYNA 2C1ZA 2WFLA 3D3WA 3WLPA 1P4HA 3WKBA 1Y8RA 2ZSJA 2YYSA 4WLFA 2NZ8A 2A2ZA 4US1R 2HBZA 3QW2A 3AINA 3HEMA 4J03A 1ML4A 3DYBA 4ZZ1A 4BNZA 4ZIRB 3OQNA 1ZVKA 3MELA 3NGLA 5I7EA 5FADA 3GUVA 2PBLA 5FPHA 4NBVA 2DZDA 2I8LA 4X1KB 2CNLA 4M1ZA 4EA9A 2KJQA 1TAHA 3YASA 1E8MA 2R1TB 3R75A 4F3KA 1SQ0A 2NPIA 3C6ZA 4IFBA 4XD7D 1GGJA 3PDIB 4EOGA 2O2HA 4ZPXA 2VDUE 1JE1A 1RYHA 1IY0A 1HDZA 5JJ5A 1EP1B 1HF3A 3LJKA 3BMQA 3TWOA 3ZS8A 4CR6A 5KYWB 4B5KA 1ISSA 4MB2A 2ZRLA 2O5EA 4I55F 3V00A 2DR0A 2QQGA 1YK0A 4Q21A 4HEJA 4X9XA 5KNDD 1NFFA 2CD9A 3M2PA 3TECE 3GCGA 1Z4MA 2ZULA 4J7AA 4X1YB 3VM6A 4EYEA 5JVDA 1ZM2A 4PZUA 2QUKA 1UBSB 3KQYA 2YWJA 4L57A 4LYYA 4OEHA 4F11A 4CIYA 5F35A 1M8GA 3DFUA 2ZLBA 4AWBA 1YOVA 4M1OA 3WIUA 5JY6A 1OFUX 2IYQA 4UTVA 2FOXA 3NHLA 3PCTA 3DC7A 1M5UA 5CRIA 2C9BA 3KQQA 4FFWA 1G64A 5GONB 4M1YA 2FR8A 1SM4A 3H04A 3N2GA 3B12A 3E7XA 3KUXA 3KR2A 4U3JA 3F8TA 2PK3A 2XGOA 3K9QO 2JIPA 4FX5A 4E5SA 3L40A 1YDMA 4RPKA 3U7RA 1PR1A 4ALKA 4GWKA 4EFLA 3KKMA 2W9XA 1E6LA 4PZZA 4DJTA 1ZCJA 2XTJA 4FEEA 3WGVA 3ZJTA 1UDCA 1SWVA 5AVZA 4RCZA 3L1JA 2W6ID 2E6UX 3VC3A 3VU1A 5E9WA 4OUDB 1IQRA 1J0CA 1KQ3A 3MGBA 4MYSA 4CFYA 4MIYA 4C3UA 1QVAA 1IIRA 1QV6A 4X1YA 3I53A 3H5IA 5IXYA 4IRXA 2RGYA 4X84A 1G2QA 1KDRA 3R40A 4GLJA 4IFEA 1DKQA 1Z33A 1JEJA 4Q9KA 4WLVA 5TRTA 4B3HA 2I7TA 5B58C 5KZMB 1BXZA 2Q1YA 5LBTA 1Z0IA 4A0SA 2V0CA 4YJFB 3V1UA 1GTSA 4K9DA 4XEHA 2EWVA 2BTEA 2XB2A 4D3XA 7MHTA 1YS1X 3FDXA 2ZUTA 2AA3A 2C5FA 1KC1A 4AURA 2UZ4A 2IYPA 2R6HA 2W00A 2C5BA 3VC1A 1S2GA 3PPWA 4LMBA 3JALA 2WJAA 2JI7A 4D9EA 2ZWPA 3QVVA 3ZWKA 2WC1A 2X3YA 2UZIR 5DMXA 3RD5A 4D79A 1P9RA 3CUEF 4HQKA 3PVZA 5KNCD 4KHZA 4MQLA 1A7KA 1RU3A 5K9ZA 4IRMA 4PPFA 3CUTA 1U9CA 4ZOCA 4MV0A 1P2GA 4ZAYA 2OWEA 4XSHA 3GT7A 2IODA 3TLJA 1FP6A 1UOEA 3L0OA 3U81A 4A8JA 3GYBA 5EHGA 3H83A 4WA7A 5FEUA 1L1RA 2BFDB 3F6SA 4A6XA 3NOXA 3DWIA 4YN3A 3I52A 4TXJA 5FR1A 1XP5A 3AFNA 3EPPA 4BO2A 4NXMB 1V16A 1W49A 3H75A 4YGXB 4B17A 3G85A 4UBOA 2HT1A 1HFKA 1ULSA 4WXYB 1M2WA 4Y9SA 1D2EA 4DNXA 3KPYA 1RPZA 3ZJVA 2J5XA 1LJ8A 3FSGD 4YLEA 1YU9A 5K4AA 3VU0A 4DDHA 2YHIA 4H31A 3PS9A 5HUQA 3D9QX 5CURA 2O8BA 3Q0EA 1ZFNA 2QKYA 3H18A 2RH8A 1Y1QA 4DARA 5B2ZA 1JPNA 4OU5A 5GM2A 1E4VA 1WTCA 4CIXA 2F64A 1ZU4A 4KLNA 3PDWA 2ZQYA 1Y37A 3DKPA 1KBOA 1ATIA 1ZZEA 1XMPA 1MX9A 3SZGA 2OOKA 1W1WA 4DLKA 4HGQA 1CC1S 2P2LA 2ZJ0A 1N6NA 4JFAA 1ZW1A 3H5VA 4ZO6A 3V32A 3DLIA 2ERYA 2V7UA 4BEJA 4BVAA 1EAYA 4RTOA 4DMMA 1JEYA 3EG9A 2WKWA 2C3PA 2E5WA 4R1UA 1J7KA 1Y4AE 1KU6A 1Q1EA 1U8YA 1WWKA 4IDAA 4CLEA 2GUWA 3Q41A 2GF9A 1C4WA 1QE3A 1XALA 1KK2A 3AM3A 2ZSIA 3QTLA 4LZNA 3WLIA 4A27A 3HU3A 1YE8A 2GN8A 2Z5VA 2BGUA 4J0JA 4EHKA 5K05A 2E21A 2E4UA 2MWMA 4M83A 1W4AA 4F3TA 4CM9D 3BGWA 3L0SA 2UYGA 1QGYA 4JIMA 4EUFA 3PRJA 4I3GA 3GFBA 1HDYA 3TSCA 2GSDA 3GHHA 4LYDA 5FP0A 1CZOA 3PFGA 2XHZA 3K6JA 3P52A 1FXSA 4D8TA 2XUKA 3H8JA 4NYMR 4RA6A 3FRJA 1W5EA 4HX2A 2PCLA 4QC2A 4D98A 3KU1A 3TVDA 2B8JA 4A0QA 3FSJX 2ZAIA 4FHEA 1UC9A 3GLSA 4PXAA 1T25A 3G2JA 2W6NA 3AKEA 4FYXA 3WWCA 2QMZA 5FXMA 4FFVA 3X1DA 4ITVA 4QUDA 5LIRA 1FP4B 5AVKA 1G8FA 1C7RA 2RHWA 1GCOA 2WAYA 3BF8A 3COSA 4RU1A 1G7TA 4XI9A 1FRQA 1LK0A 5CDFE 1V0JA 1RIFA 2D2FA 2NU9B 1TAUA 2BKEA 4KXYA 2EW8A 5J58A 1EFPB 4H16A 3K09C 5C3UA 2ZSHA 2WAOA 5I6DA 4PAGA 2Y6UA 2BH9A 2R6FA 1G41A 2GNOA 3IAUA 2ZJ6A 3M6AA 4B3RB 3WL6A 1AUVA 1US8A 3JS5A 3GGCA 3VSCA 3P9RA 5IXJA 2D1TA 3WLNA 1DFGA 3N5KA 3TW0A 1EM6A 3WI7A 1SKQA 1L1QA 4YMUA 3V4RA 5K0LA 5LQDA 2AV6A 2HJWA 1BWRA 2ZB7A 3R9WA 4LJRA 2GPYA 2E4WA 1PDOA 5C80A 3MQFA 1CZRA 1QH0A 1E94E 1WSWA 2BONA 4YMIA 5DCWA 3F4LA 4PGAA 3TZKA 3UB3A 4YX9A 5C35A 4MICA 4WEQA 5KQPA 2VJNA 4JQZA 1C8KA 1TYZA 1U7TA 3MHTA 2VNIA 4NLLA 2IOQA 2P35A 4WCDA 2FWBA 3DMTA 4CL3A 1Z5VA 2Q3JA 1NBWB 3QWFA 1EB8A 2HSJA 2BE7A 4U02A 5CR9A 3VR3A 3Q8LA 3GJTA 3S6JA 3V9PA 4JSYA 3L1IA 1RMTA 4AY3A 1B0UA 2GCEA 4C21A 4HWTA 3I58A 3WK4A 1DBPA 4GH5A 1GTMA 3TLYA 1WSBA 4A15A 1WLYA 2YXPX 2QUAA 5DP2A 4QVGA 2NPFA 3NHRA 4CG2A 4LBZA 1TAGA 4UCQA 1UBJS 1O5TA 4UMFA 2NSDA 4D3FA 1J2UA 4IOKA 3UJ7A 1O95A 2GJ8A 3VVBA 2HZ7A 1UJ2A 4FDUA 4M1MA 5IAEA 1F0NA 1Y42X 2EF0A 1M1YA 1NVXQ 3IMCA 1VMDA 2QPAA 3V97A 1XZIA 3CG4A 5A9TA 5GIOE 5CBPB 3L4EA 3FLMA 4KO8A 1OFVA 3C6KA 3DT8A 2OYRA 4BECA 2C8VA 1A0OA 2G06A 3LXUX 4WL0A 3ZX5A 2DKOA 2V6FA 1DKNA 1OB2A 2VL7A 4OLBA 3WIDA 2WP8J 2FEMA 1J97A 3RBVA 2PUFA 1KK0A 4L6IA 4ZVPA 2DLCX 1RM5A 2R47A 2FFBA 4JC0A 3CUVA 1TJNA 1WUKS 3LUAA 5JW6A 3QFSA 1OBHA 1X80B 4H1UA 4TUYB 3KT8A 4BKPA 2D7JA 2SCUA 5DI9A 4HMQA 5AJVB 4DL9A 2FSGA 2BHLA 3JD1A 3P5SA 3PGMA 1DAEA 2OEPA 3IQDB 4L2IA 4OA8A 2ODAA 3FBGA 4JSRA 3MEQA 1GLGA 3TIFA 3Q0TA 4DVJA 4DKJA 2HMSA 2JLWA 3L2OB 1S9DA 2O2IA 1GQOA 3DEJA 5EGNA 1UBLS 3FZYA 4MTCA 1N5DA 1H0RA 2GKSA 2P4HX 2H5JA 2XQGA 1ZXBA 1T2AA 1M1YB 2ODEA 2W0MA 1YDEA 2W8BA 4FYJA 4EL5A 5IEJA 3ISJA 5J2UF 1A9SA 3UJCA 5I9LA 3PFKA 2O1WA 3SVLA 3PJFA 3A28A 3FTFA 4ZOLB 1RYBA 1SY7A 2OHHA 4RNDB 1GYPA 1YZUA 2VHQA 3GXBA 5BURA 4KQ1A 4B4UA 1PTJC 2HM7A 2Q28A 5H7XA 2X0JA 5MGNA 3F2IA 3PUXA 2FRVA 1VMIA 5CNIA 3FNGA 4EGQA 3D7NA 3LLUA 1KRXA 1ENZA 2EGUA 4EBBA 1T5IA 1WHSA 3FTEA 1GA6A 4R69A 2VHEA 5FOWA 3KFVA 1NBEA 2YS7A 4QUGA 4ZT6A 3IB3A 1ZG3A 2LD4A 5DF1A 4Q15A 2CSXA 2RGCA 2ODQA 3TBFA 3VAZA 4P5EA 5CYFA 1XLVA 3OESA 1FJHA 3P26A 4F1JA 2IOYA 1DJLA 3BXPA 2HRQA 3OT5A 4RSGA 3TFOA 1QVVA 1SQ6A 5H4GA 3Q3VA 1KZ9A 1XK6A 4F12A 1IU9A 1UF9A 4G84A 4PZEA 3KAKA 2KYRA 2NP6A 1FPMA 2NZJA 4MYTA 1XKTA 1QJCA 2OFPA 2B8WA 1R27A 1ABEA 1NY5A 3FLEA 4F4HA 1AGNA 1VG0B 2QTFA 3E1GA 3BXHA 4NJEB 5LQAA 5CVVA 2ZBFA 1QHEA 5K3DA 4AC9A 1B6RA 4JN6B 2XV1A 4BBPA 4FFNA 9ATCA 1GTRA 2F1OA 3ZXYA 1YSCA 1ZXXA 2X8BA 3NW9A 4PX9A 3V2GA 2CYAA 2GZAA 3ISVA 4IIXA 5EIBD 4ESOA 5G0TA 3C7KA 4XXHA 3SXUA 3CTMA 6LDHA 5L3SA 1JSXA 1T1IA 3HCEA 3O4FA 5E3IA 1AQJA 3ZZUA 4D4GA 1Z39A 2X6RA 4JI8B 3DBOB 4KQ2A 1RJ9A 1W8DA 2EQBA 4HTAA 1EDZA 2Q5OA 1N7GA 1NYLA 3IVRA 1EK5A 4QGFA 4DIFA 4Q19A 1V7CA 1Q20A 3UHAA 4O0LA 1ECPA 4Y6OA 2Q6LA 3HZRA 4YRIA 1OI7A 4RTSA 2WZDA 3QPDA 3LUJA 1IDN1 1XQ6A 4BRWA 4DDMA 1MEOA 2Q41A 1VYVA 3E48A 5LYJF 4S2EA 1JU4A 4QQ8A 3LCUA 4XVHA 2X1HA 3C70A 5DM60 4WN9B 3FYCA 3VJRA 3NEYA 4P3XA 3RREA 1T34A 2B8TA 3F7TA 4FWBA 3GFFA 2BMDA 4ECAA 4WINA 1NT4A 1J0AA 2CZQA 2AFHE 3SQMA 2QD5A 2F67A 1NM5C 4X1KA 2XRZA 1ARZA 1AX9A 2ERXA 2Q2OA 4RS3A 1P4RA 3KHKA 2YFYA 4PRKA 5K0SA 1V4BA 1YVDA 3U3ZA 4IHAA 2RH9B 4B0PA 4RTRA 4RSMA 4NE2A 3FDZA 1R6DA 5COQA 4JLDA 5TDHA 1ILEA 3HI4A 1E9EA 5DPMA 2WU0A 1YAJA 3ZNPA 4D0LB 3OLVA 4F04A 1ESDA 1MIOB 1YQEA 1P1HA 2XUAA 3NOOA 3IIIA 4OI2A 2AR9A 3MPOA 2ZZNA 1XWIA 3TIGA 5JSQA 5JVDB 4GWGA 4ND8A 2PO7A 5I4BA 3NHSA 3WMGA 3DMFA 5AK4A 4Q3AA 4F9TA 3GEPA 1QTRA 1LSJA 3NKFA 2O8CB 3F1LA 2YFHA 4EFKA 4BFZA 4PW0A 1T5BA 2UDPA 1JQEA 2VATA 3PXCX 1L2TA 5G0SA 2ZETA 4C0XA 1BZYA 4LSZA 1KY5A 5CLHA 1LLDA 2AUTA 3O75A 4IR7A 4LAFA 2GM5A 2VF5X 4WBNF 2UZ3A 3PNBA 4BP1A 4CNBA 1K8RA 4MLZA 2W6JD 3QEMB 4MYHA 4L8WB 4PLWA 2XUFA 3R3WA 5ADWA 3Q5EA 3RHFA 3GHYA 1Z12A 2Z8YA 3PXBA 4DKXA 3A4MA 4KZPA 1NMSA 3T3GA 2W6CX 2IY8A 4HDMA 1VL2A 1BJRE 2R79A 2UUCB 4CCSA 4B84A 3L7DA 4Q4JA 1CG6A 1XXHA 1HNNA 3FWHA 3Q3EA 4OAQA 1YI0A 2WA1A 3P0EA 4RVGA 4XJTA 3CVYA 4DJ5X 5AJYA 3EH2A 4OFXA 1PFYA 3Q7QA 4GPBA 4U2DA 3H5OA 4ZAVA 3ZV4A 3IVAA 1ZEMA 3K05A 3LWNA 5HJ2A 2DQZA 3ZK9A 1JDZA 3DE0X 1KR2A 4DMGA 4IIYA 1VGRA 3W9UA 2NTEA 1GNQA 1V5GA 4E12A 4MQ6A 2A84A 1T2DA 2CNKA 2ID9A 2GJSA 3L3BA 1X77A 3AUYA 3ROPA 3FWNA 4NY1A 4Y1GA 3SAJA 3C1OA 1UBTS 4RJKA 5JJLA 2V4ZA 3H97A 1DHRA 1DUIA 1VL6A 2JD1A 2ZBUA 1ZNQO 1IDOA 2XR1A 3OQPA 3C24A 5L3QA 5LQJA 4LHSA 4QE3A 4L0CA 1DQNA 3DR3A 3NX4A 5ILGA 3NI2A 3G9QA 1F12A 3DQZA 4NV3A 5DB4A 4KQEA 3GPLA 1PYDA 4B2IA 2OD9A 2BJWA 3DA8A 3VFDA 2P4EA 5E6UB 5B7GA 3HJNA 2D5CA 2J3HA 2J3MA 3G2OA 3KD2A 4WZZA 1QIEA 3VR1A 1DLIA 2QNBA 3EY4A 5DIZA 2JLUA 3OAAA 1JR3D 2AOUA 2NO7A 4YT2A 4ZREA 1U8XX 1RZRA 4GPIB 2NO4A 3RSLA 5BQOA 4RVFA 3HK2A 1QQBA 1LA2A 2VNHA 4D80A 1ZLYA 1G5RA 2W2LA 4UAJA 3WLQA 3Q5GA 1CY8A 3BL5A 5KVVA 3QUQA 3U56A 1NY6A 1M0SA 2VOEA 3FOBA 3L0YA 3N8HA 5B57C 1HKHA 3D0OA 2HQSA 3KP1A 4DLUA 4CTMA 1JDBC 2ZIAA 4N5DA 4C4RA 1YZQA 1JBQA 2HF2A 1FDIA 3R0ZA 1H23A 5A6SB 5H68A 3UAZA 3V7YA 1Q0HA 3K2EA 5F7JA 3TB6A 3TLGA 3TRDA 2VWGA 3W79A 4E31A 2XGJA 1HXHA 1PVDA 3RYIA 4MVJF 3HPRA 1ES9A 4Q3DA 5JANA 1CKEA 2Q1UA 2CNBA 4JROA 1NG1A 3E9RA 4YRGA 3ED5A 2GRAA 3KLOA 4J6EA 4N5HX 3U31A 4BP8A 4NL4H 4CI0B 5LDGA 4AJPA 1FX1A 1H2BA 4E2FA 5BR1A 5JZMA 3CBGA 5DWQA 3ZW9A 1Q21A 1E2EA 2DUNA 2QU7A 3EIWA 3QHQA 1ZN8A 3UOWA 3HM2A 1CZLA 3PLRA 4JCOA 4MV1A 4F06A 3SBXA 4K6CA 3JTEA 4MV4A 3HCNA 3IELA 4E33A 4MZXA 3VZCA 1JQKA 2GZ1A 5EQDA 2P6MA 2HIGA 1Z68A 2RGEA 4E2XA 1GYQA 5DTRA 4IIDA 3IHTA 4JBNA 2O2ZA 2A57A 1FOEB 3CUUA 4OHCA 1IHUA 1PSZA 5M5BA 2XNCA 3M1LA 4L76A 1Y9EA 2Y0DA 1EP2B 2VH5R 2ZKLA 4XWWA 2QZ4A 3I5MA 3NYRA 4URYR 4HSEA 3A3OA 2ZJFA 3BERA 1I5OA 3NUGA 3PDIA 4S35A 5H4HA 4BP3A 1L9KA 1CS0A 2OR3A 5I9SA 2CB9A 1Z2EA 2QTBA 3RIXA 3QV2A 1DARA 1W75A 1IJFA 4XYGA 3KC2A 1PO7A 3WWDA 1UDBA 4JB3A 1Y3HA 2NG1A 5DW0A 4AWXA 2G72A 3CX7A 2WJHA 1VGQA 1VG9B 5FI3A 3OY2A 3KQNA 3BDIA 4UUOA 3RUEA 1NNUA 3EVDA 2FN4A 1EWVA 1N1EA 2HNKA 2Z8YM 3JVDA 2HN9A 1YZNA 4HT3B 5C8XA 1F8UA 3QMVA 3QYJA 5ALNA 2OCLA 3ZI7A 4NKRA 2Z1DA 2EARA 1FYDA 3Q85A 3TUZC 1C7EA 2G76A 4WXRA 5CD1A 2R4QA 2B4AA 2KPOA 1SBTA 3RADC 5AW5A 1PJCA 1C8BA 2V98A 1T9BA 1C4KA 1C1HA 5KCZA 1IQ0A 1JEDA 3RFXA 4I3HA 2UVPA 1KKMA 1CJTC 2HK8A 5AQ1A 1DO8A 1HDOA 2B9EA 3G2HA 3TH5A 5K03A 1P4SA 2GESA 1W88B 3KYBA 3ENKA 4L5IA 5LOVA 1IPFA 1Q7BA 1DUVG 3C39A 4EG6A 2ZKIA 1L4GA 4KFRA 5K09A 1G3QA 1X7WA 4YJ3A 2EFGA 5HE8A 3TZBA 3K71B 4A0RA 3EN0A 4AMZA 3AIIA 3ZJ5A 3EZ7A 2KW5A 4IJQA 5IJ0B 3ISTA 4V3CA 1B6TA 3UK6A 1TKAA 1R9GA 1DWUA 1T4GA 5BV7A 1NMXA 5JWOA 4BJ3A 3CNEA 4YCBA 4FXOA 3HJGA 1LBQA 4KFTA 2QL9A 3AUUA 4YJFA 1UK7A 2X7XA 2X9VA 3I9V6 4PX3A 3ZWCA 3C3EA 3K8QA 1NJFA 3O2JA 5EY5B 1E0JA 1Q57A 1QCDA 3DOHA 4PYRA 4YPFA 3UNXA 4U0KA 1MV5A 4B0OA 1Z2AA 1CQJA 2HSWA 4BU0A 4C78A 3R0QA 4A8HA 1NR5A 3CBQA 4P7JA 1WBBA 3GDOA 3FOWA 4YAUA 1JVSA 5EQJB 3QU2A 2W43A 1JHUA 1E18A 2ORIA 3IH5A 5ICEA 4QEDA 2Q9CA 2D1QA 4HYTA 4HGPA 4ZYZA 1E1CB 3BOSA 1UBUS 2XCIA 4BNTA 3EPLA 5B64A 1D6SA 1UC5B 2B1IA 2YWEA 5C5IA 1H6CA 2I65A 2VSQA 3CZR