4DMFA

Crystal structure of the cftr inhibitory factor cif with the h177a mutation
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
293
structure length
293
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWAFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Inhibiting an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa Protects CFTR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 111
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dmfA01
4UFPA 5HK9A 1CUYA 3QPCA 4UBOA 5ALVA 2I03A 2RHTA 4KAFA 5EGNA 1WCYA 2CB9A 2LIPA 3KDAA 1LBTA 1ISPA 2OAEA 4MXDA 5I8PA 1CV2A 3WI7A 1I6WA 2Z8ZA 1ACLA 1N5MA 1GT6A 4IQ4A 5FDFA 4UBMA 5AKHA 1UZAA 4J03A 5DYWA 2B61A 3H2JA 4Y2PA 2GBFA 5DTIA 1BRTA 1NU6A 3C5VA 5CXUA 5AM3A 5HK8A 4BRZA 1TK3A 1CUHA 1K8QA 4BP9A 2XUKA 4G1FA 5HCUA 5AO9A 4S0XA 2HU7A 5ALNA 1ZGCA 5CT4A 3KOOA 4AO8A 2HA4A 2C4HA 3FLAA 4JUIA 3P2MA 4LIPD 1WHSA 3HI4A 3F8SA 1SCKA 2GYWA 2G5TA 4E14A 5A7FA 3V1KA 2VATA 1AURA 1DWPA 4AN1A 3QH4A 3AIMA 2BGRA 1L7QA 5T4BA 5K5EA 1MN6A 3SX4A 1JMYA 2OQIA 4A16A 4Y2QA 4I4CA 3HXKA 1Y7IA 4NVRA 2QJRA 2Z8XA 1MU0A 3ZLTA 1WB4A 2C5GA 1ZI6A 5ALGA 1WHTA 1EINA 1H2XA 3X3HA 5EHXA 5ALZA 1LPAB 4BRSA 5E4JA 2OG1A 3GA7A 1RYYA 1FFBA 1K4YA 1SOMA 2VF2A 3AJAA 4YK7A 1THTA 3MGAA 4UHDA 1ODCA 3WA7A 1QIMA 5JAOA 3WL6A 4H35A 4QWWA 3RLIA 4TGLA 3N2ZB 2BUAA 3PF9A 2PUHA 3WMRA 3WKAA 4AZ0A 2PL5A 1UWCA 5CT6A 5LKAA 4B85A 4LKOA 2QXUA 1W52X 4X3CA 3H2IA 3I2HA 5I9IA 2W6CX 4H7DA 1H23A 4KAJA 4C89A 2JGKA 5DYYA 3O4JA 1XQWA 5FKJA 1HQDA 2PBLA 4ZWNA 3HSSA 1KU0A 2WFMA 3QZUA 1HPLA 4KE8A 2WIJA 2QMQA 3PFBA 2OGTA 5JARA 4OCZA 1XRQA 1YAJA 2HA2A 5K3CA 4J0GA 3O9VA 3I1IA 3EQ9A 3VDXA 5AM0A 2PU7A 2PSJA 4G5XA 2XQFA 4DMCA 1R9NA 2VJAA 2VT6A 4L72A 2XLCA 3DKRA 1MNQA 3K6KA 4Y2VA 1H2YA 1FFEA 3Q8WA 3WYDA 5HQ3B 5AKLA 4H77A 4HXFB 1LGYA 4Q3KA 5ALIA 4DYHA 2HU8A 4GW3A 4AO7A 1J1IA 2X76A 1D07A 2XMZA 1WOMA 5KBYA 2YASA 3HC7A 2PM8A 2H7CA 3IVMA 3UMJA 4H7HA 2I78A 3FCXA 2HA3A 1YCDA 5HQ3A 1UOOA 4AN0A 2XUPA 1R50A 3D0KA 1C7JA 1FFAA 4HS9A 3WA6A 4XJVA 1JJFA 2X5XA 5AI5A 4QWMA 5CXXA 1QFMA 3STVA 1CPYA 1DQYA 5JYCA 5AM5A 2YXPX 4AQDA 3QITA 1XZEA 2OCGA 1R3DA 3OM8A 4UFNA 1YB7A 2OXEA 2EDAA 3TJMA 3AZOA 1MX1A 5LP1A 5ALFA 5IKXA 3QM1A 3FYTA 3AFIA 1JFRA 3F98A 4BP8A 2Q0XA 4UHEA 4UBLA 1XZKA 3C6XA 3OG9A 5LZ8A 2C5FA 3HLKA 1YA8A 5AICA 1R1DA 4G4IA 2CZQA 2E3JA 1AMNA 3V1LA 3OC0A 3WWCA 4XWGA 1LZLA 5AIAA 1XROA 1BU8A 4RGYA 5JADA 1EA5A 2GBIA 4QDXA 2ACEA 2Y2VA 2BUBA 2VQ6A 4HZGA 4Q3LA 1DWQA 3DQZA 2ES4A 4OB6A 3QMMA 4X97A 4Y2JA 1G66A 1QONA 4OYLA 1OXMA 3BF8A 1BN7A 1O6GA 1VLQA 4EZIA 3KD2A 2BFNA 2XDWA 1DWOA 5JZ9A 3F97A 1ACJA 1USWA 1CQZA 2RAUA 5FOQA 2Y6UA 4LXGA 2VAVA 1LPPA 4B80A 3B3QA 4IH9A 5CRIA 4GLBA 2OLEA 3AILA 4DLNA 3WL5A 2J4CA 4JYPA 4RE5A 3HRHA 1XQYA 4WY5A 4X00A 2WIGA 2PUJA 3C45A 2VSQA 1B41A 3H19A 4G4GA 2DCMA 1Q84A 3W2TA 2B4KA 3I28A 1ZIYA 1ZD5A 3IBTA 5D6OA 1GPNA 3E4DA 1LBSA 1P0IA 3L1IA 1CEXA 4KACA 3VKFA 3R3XA 3GELA 2WSLA 4CIBA 4G4JA 3MVEA 1RWQA 1IUOA 5DTJA 2QR5A 3BJMA 4BB0A 2WJ3A 5K3AA 1UK7A 1FJ2A 3WWOA 1Q0RA 4NS4A 4TPKA 4Y2XA 4N5IX 3FAKA 2AJLI 5HF8A 1HKHA 4TVKA 2XQJA 5ALXA 4EY5A 2J4FA 3SK0A 3W9UA 5E2IA 4GEGA 4JH0A 3G8YA 1KEZA 1PV1A 2QM0A 3YASA 4W1QA 5E4YA 1MT3A 5ALKA 1MJ5A 4O08A 2RI6A 4LYEA 1U2EA 1SCQA 1ORVA 4BTVA 4DTCA 1X2EA 5ALOA 1W76A 5AKEA 1ZICA 3GUUA 5CURA 1QOZA 3U0VA 4FFWA 1GGVA 4Y2UA 1E8MA 3MUOA 4FBLA 1LPSA 1VA4A 1W4LA 4X91A 4BCCA 3H17A 5LZ2A 4I3FA 3R3VA 4CIAA 3R41A 3V1NA 3E3AA 5SYNA 3KWJA 1CUFA 3I6YA 4MQMA 4WY8A 2WM2A 4Q34A 1VE7A 1QTRA 4BAZA 5JZSA 1CVLA 1MNAA 3D4LA 1MAAA 1QIJA 1GQRA 2CMFA 4G8BA 3I2GA 3BIWA 4FDMA 4UBNA 4L0CA 4QDUA 4MYDA 3DOHA 3I6MA 2PVSA 4WFIA 4GBGA 5AKXA 5J3JA 3T4UA 1JU3A 2EDCA 4QE3A 5ALPA 4ZREA 1AKNA 2Z5GA 1XRNA 4E11A 1VA5A 4J0KA 5A6VA 2Y2UA 3IUMA 1CUCA 3KSRA 4ARAA 1JJBA 5KWIA 4OPMA 1Y37A 3JWEA 1CUAA 3RM3A 1ZD4A 4OUKX 3R40A 1X2BA 5CT9A 3IUJA 1T4MA 1IUPA 3TGLA 5FLKA 5DNWA 2OPHA 1HDEA 5AI9A 4NZZA 4C87A 5D3KA 3IURA 2VJDA 1QO9A 5AH0A 4BDSA 4X6UA 1Q0ZA 4B9EA 4W1RA 1CQWA 1C4XA 1LNSA 4I19A 5BOVA 1YB6A 1QGED 4N8EA 3WZMA 1XKTA 4L9AA 1ZI9A 2V98A 2XUQA 4HTAA 3NOXA 1IUNA 4KYVA 4W63A 2QOEA 4WDRA 3IDAA 2BKLA 1WB5A 1MPXA 2BAGA 3WKCA 3BJRA 3PUHA 5KREA 3VJLA 1IZ7A 4EB0A 1N5RA 4KE7A 3H1BA 1P0MA 1OILA 4ZV9A 3G0GA 1R4ZA 3GFFA 4KEAA 2XUGA 3GBSA 5D7BA 5HZGA 1YSCA 1NU8A 1YA4A 5CT5A 4Z49A 2OGZA 2JEZA 2G63A 3NWOA 5CBKA 1JU4A 2QTBA 3FVRA 1XZDA 3VJMA 4PNZA 4EY6A 4UBKA 2GZSA 4MQLA 3BWXA 2OAGA 3ESDA 2AXEA 4N8DA 3ZI7A 1XZAA 3O95A 1H22A 3ICVA 1XZJA 1CUDA 3DLTA 1XZGA 4KRXA 4B0PA 2Z3WA 4BE4A 4YX9A 1DT3A 1TKRA 2WQZA 7YASA 3EQ7A 1E8DA 2WU3A 1ZIXA 4BYMA 3K9BA 4LYDA 4UHHA 4FNGA 2CBGA 4G8DA 2ZYSA 3WK7A 4F60A 5AIBA 3RARA 4C6HA 4WFKA 1QO7A 2XT0A 2O2GA 1E66A 1EX9A 1UOPA 1CUSA 4IHAA 3PI6A 5HFNA 1CUJA 1GXSA 1NX9A 1BROA 1A88A 4UFOA 3RKSA 5AK6A 5IVKA 2CEKA 2WIFA 4JNCA 1YASA 4JYMA 5AKIA 1UT6A 3HYSA 4J0HA 3CCBA 1F0PA 5K3FB 4BVJA 1AZWA 3CN9A 3UUEA 4J7AA 3BIXA 2EEPA 5HKAA 1VKHA 3D5EA 2BGNA 3PICA 2H1IA 1P0PA 2HU5A 4C01A 5LZ7A 2H7XA 2ONCA 4UPDA 4F21A 2BUCA 3FNBA 3CXUA 2RONA 3M82A 1THGA 4PQEA 5EI5A 4GECA 4FFVA 2H9YA 3ESAA 4X90A 4BZWA 4X71A 5K3FA 3DL7A 1E8NA 4GHWA 2B9VA 4J3JA 3ICWA 3WK6A 5AKJA 2DR0A 5HFAA 2YYSA 5HF5A 5ALYA 4D9JA 2OCLA 4FNMA 4CG3A 3C6YA 4DNOA 4J0DA 1EHYA 4QDZA 4A5SA 1LLFA 4Q1VA 2HM7A 1DTEA 4DMFA 3FWHA 3HABA 5AOAA 3WLAA 5IVDA 1JMKC 1YS1X 1SC9A 5SYMA 2ZYIA 4UBJA 5AOCA 4DM7A 1QLWA 4XIIA 5LZ4A 4FKBA 1AC5A 2JIDA 3G9UA 3G0DA 3T52A 3QPAA 5AHXA 4DSAA 1N1MA 3FLBA 4DNFA 3WWDA 4J0JA 2PSHA 3H04A 3PDCA 2JEYA 1JKMA 3STXA 4OSEA 1TAHA 5FRDA 5I7UA 4K5QA 1DQZA 1EVEA 3HEAA 4J0IA 5AM4A 1A7UA 3DL4A 2C0PA 4FWBA 1KU6A 3AUKA 3O4HA 4QNNA 5AI8A 5D3ZA 2ZSIA 3DKKA 2HRQA 4CCWA 1GZ7A 2ZVDA 3BXPA 2PKYX 5T4HA 4B83A 3ZPXA 1BE0A 5HF9A 1XLWA 2XUAA 5AM1A 2I3ZA 1CUVA 4XVCA 5EIHA 2ROQA 2FUKA 3FLEA 2XMBA 4FBMA 1CUZA 2CUTA 4UHBA 5AOBA 2G4LA 5BWBA 1U4NA 2PSFA 5JD6A 2WUGA 5LYYA 2UZ0A 2AJBA 1ETHA 2BCEA 4P93A 5DJ5A 2B20A 1JI3A 3D7RA 1EDDA 5ALMA 1XRPA 3HJUA 4OU4A 5C8VA 2CKMA 3QYJA 4CG1A 1YAHA 1VZ2A 5JD4A 3IUNA 1O6FA 1ZJ5A 4BZZA 2WFZA 2WHPB 3H2KA 4RNCA 2DHDA 3WKBA 3TEJA 1SCIA 2WJ4A 4K6HA 3WK8A 1DX6A 5AK4A 5ALSA 1G5FA 1XKLA 1GPKA 1A8UA 2XMSA 1HL7A 1LPOA 2WG0A 3WIOA 2HA0A 3EQ8A 1K5PA 1J2EA 4CG2A 4EY8A 1PFQA 4RE6A 4BCBA 6YASA 5AM2A 4BC1A 2V9ZA 2JGMA 1EXWA 2WHPA 4X94A 1MX5A 4K6KA 1XRMA 3ZLUA 2DQYA 1WPRA 4QEKA 4HVTA 3ANSA 5DYTA 5ALWA 5LZ5A 3DYIA 3WL8A 4QZVA 1QIDA 1FFCA 5JZBA 4CFSA 1PJAA 5DNUA 4C88A 4BVKA 4LXIA 3DJYA 3IIIA 5AI4A 1ZI8A 4W1PA 2WJ6A 1AGYA 1XZIA 1F6WA 3EIOA 4H7FA 5AK5A 1QIIA 3I2JA 2V97A 1QTIA 3PE6A 1QIKA 3LP5A 2J3QA 1HLGA 5AJHA 1ZJ4A 5FUMA 3G0CA 1A8QA 1UOQA 4FHZA 2WG2A 2FJPA 2WKWA 5FXMA 4V2IA 4OD0A 2R8BA 5CMLA 5ESRA 4FOLA 4B0OA 1ORWA 2VJBA 4LXHA 2QXTA 1VXRA 2HFKA 1ODTC 1YS2X 3ZV7A 2J3DA 2FJ0A 2VTVA 1EK1A 3KXPA 3WKEA 4UHCA 2WTMA 4X85A 1UKCA 3QMWA 4YPVA 5EHZA 1FSSA 3FCYA 4WJLA 3UUFA 1XZHA 2WTNA 2JGJA 4ZXFA 2WU4A 1F8UA 3WIBA 1CUWA 1K63A 1MAHA 4DMHA 5KWJA 4C4YA 3G0IA 3S2ZA 1SFRA 3O4IA 4DSZA 1XLVA 4Y2YA 1W6RA 3LCRA 4CCYB 4FMPA 2PSEA 3WK5A 3MUNA 3E0XA 4Y7DA 5JALA 1A8SA 2VAXA 3STYA 4EY7A 4BAUA 3E1GA 4XX1A 3AINA 1WB6A 1UXOA 2PPLA 2QUBA 5AP9A 4H7JA 2OGSA 1XZFA 1HBJA 2FX5A 4RPCA 4QLAA 5A2GA 5CW2A 4CCYA 3LIIA 1ZD3A 4HXGA 4M0FA 3KWFA 1ZGBA 3DCNA 3WWEA 1G4HA 4ZI5A 1QZ3A 4PSCA 4GDMA 3F96A 4U2BA 5JAUA 4C4XA 5LZ9A 3CCCA 2XB6A 3PUIA 2WIDA 4G9GA 1TCCA 1XQXA 3TRDA 4DGQA 3G02A 4M0EA 4IH4A 4B81A 2AJCA 3IUQA 1AX9A 3R3YA 5ALLA 1GKLA 1CR6A 4EA6A 1EB8A 1EH5A 3VXKA 3OPMA 3V9AA 1XQVA 5EIEA 3G0BA 3H2HA 2XMCA 2RHWA 4Y9SA 3F67A 5EFZA 5BV7A 1TCBA 3A6ZA 2WUDA 2PX6A 2GYUA 1IVYA 3F9CA 5ALJA 1E89A 1UKAA 4QDOA 3OTQA 3O9MA 3DOIA 4U2FA 4HRYA 4GI1A 2NW6A 2XMDA 2WILA 3BDVA 4BTLA 4ZGBA 1VXOA 2GBCA 1C7IA 3BE8A 3FYUB 4U2GA 3R3ZA 4DNQA 3STTA 2IX9A 3DD5A 3STUA 2XUJA 2ACKA 3LIPA 4FLEA 1IZ8A 4IO0A 5CT8A 1CIJA 4Q82A 4G8CA 2HIHA 3H18A 3WZLA 3FYUA 3QMVA 3DEAA 5EHQA 3H1AA 4H7EA 3A70A 3ANTA 2I3DA 4ZRDA 1CUXA 3EF3A 1UK8A 5JAHA 3G9XA 5EHNA 1CUUA 1QIFA 1WM1A 3I1YA 5HF6A 3W9BA 1B6GA 2WHRA 4FTWA 3M83A 5FPQA 5FP0A 4H18A 1L7RA 1EI9A 1R9MA 3WK9A 3DYVA 3QVMA 4WFJA 1VZ3A 1Z68A 1MTZA 4P08A 4B82A 1JJIA 3HACA 1H2ZA 1UKBA 4M0MA 1QE3A 3DS8A 4BCDA 2VT7A 4AB1A 1BCRA 1CUEA 1BN6A 1QIEA 2HDWA 2O2HA 5CH3A 5E4TA 4G9EA 2RIPA 1XRRA 4B9AA 1XZLA 2P8SA 2R11A 3R0VA 2QT9A 3V48A 1CUIA 1X70A 3I2IA 1BEZA 1TCAA 4WCVA 4BC0A 2HA5A 4UHFA 1AQLA 3W05A 3AIOA 2ECFA 4KAAA 1OCEA 3FVTA 5F4ZA 2ZJ6A 1BCSA 1LPMA 3IULA 2JGIA 3I6ZA 2VJCA 3VISA 2XE4A 4AZ3A 3PF8A 2DHCA 4PSDA 4H7IA 3G7NA 3WWPA 4N5HX 4AO6A 1UK9A 4K6GA 1QFSA 1RP1A 4Y2TA 2XLBA 3A2LA 2QJWA 2WLSA 4MEBA 2QS9A 2C58A 2GZRA 5C8XA 2QRUA 4PSUA 1DX4A 4EBBA 3G9TA 4L3WA 5JAPA 1VOTA 5CTAA 1VJ5A 2C0QA 1MX9A 3FOBA 1CUBA 5C7YA 3O4GA 3STWA 2QVBA 2CJPA 1VE6A 2V96A 3ESBA 4AMZA 1CFJA 2AJDA 4CI9A 3VVMA 4QLOA 3AZPA 4WDQA 4OYYA 2IITA 2XQKA 4AMYA 4UBIA 3C8HA 5H3HA 1Q83A 5AI6A 1J07A 3EBLA 5ALUA 2C7BA 2HRRA 3WKDA 5LKRA 4INZA 3HZOA 3WJ2A 4AX4A 5T4EA 3BF7A 4X6YA 4DNPA 3ILSA 2D5LA 1FFDA 3I2FA 5AI0A 1QIHA 4GXNA 3R3WA 5ALQA 1J06A 2O2IA 1XLUA 1K6EA 5ALTA 3OOSA 5JASA 3NUZA 1EB9A 5ALRA 1R88A 2X8BA 1E5TA 5ISMA 2Y1KA 4HXEB 5JANA 3JW8A 4U2DA 2WFLB 4IH1A 4PO3X 3V1MA 3C70A 5K3DA 2OCIA 1P0QA 2JBWA 5ALHA 4U2EA 2ZJ7A 3D2BA 5AKZA 3D2AA 2DFPA 3C5WP 1UFOA 5ALEA 2WFLA 2O7VA 2GBGA 2XI4A 2XMQA 3H2GA 4FLMA 1BS9A 4MWTA 1LPBB 1TRHA 5IVIA 2Z3ZA 5AKYA 3O0DA 3JYHA 2W22A 4A23A 3K2IA 1GQSA 2HA6A 2HFJA 5DNVA 2XMRA 1T2NA 4OB8A 3S8YA 5A62A 3B5EA 5T4FA 3LLCA 4N8SA 3N0TA 2ZYHA 3DNMA 2OCKA 2ORYA 3SC2A 4U2CA 4HAIA 3D59A 2JGFA 1S8OA 3IB3A 1EK2A 3BL8A 1UK6A 3WL7A 4B84A 4PV7A 4PF1A 1DINA 4X95A 2WUFA 1W1IA 3RK4A 4H0CA 3WQHA 3BDIA 4ETWA 3L1HA 5JATA 1LZKA 4OB7A 4PW0A 4J0CA 2Y6VA 2QUAA 2GYVA 4KE9A 3LS2A 5LLSA 5C8ZA 3AIKA 4B7ZA 4E15A 5AKGA 1BEEA 3D3NA 1AUOA 5FV4A 1U65A 2DHEA 3G9ZA 4W9RA 3B12A 4AXBA 3WYNA 4BE9A 1YR2A 2XUDA 3W04A 2H7YA 4BVLA 2WG1A 3D2CA 2DSNA 1EDEA 4Q05A 1GPLA 2WUEA 4FLFA 1CUGA 4F0JA 4P9NA 2XMGA 4MYSA 4E46A 3ED1A 2XQGA 2XUIA 2JF0A 2HA7A 4ROTA 3QBJA 1CRLA 1LPNA 1XZCA 2D0DA 5CH8A 3VJKA 1N8SA 4B6GA 4H7KA 5JIBA 1E3QA 4OU5A 2YH2A 5YASA 4ARBA 4QDTA 3R3UA 5A71A 4LHEA 2HHAA 1QJ4A 4QA9A 4BAGA 5ALDA 4MWSA 1QIGA 5IVHA 2ZYRA 3Q0TA 3PFCA 4C4ZA 1XZBA 4MEAA 4Y2SA 4JEIA 5K3BA 1H2WA 3C6ZA 5DWDA 1XFDA 1EVQA 1JT2A 4BBZA 5AK3A 1DU4A 5FPPA 4KE6A 1IMJA 4MJ3A 2XUHA 4ITVA 3NGMA 3FSGA 3M3DA 3A2MA 4EHBA 2HL6A 4BATA 4KRYA 2DQZA 4ZV7A 1W75A 5LIPA 4KJXA 4X92A 4P92A 3M81A 4X7BA 3GZJA 5CH5A 2JGLA 4K2AA 2QZPA 2HADA 4HRXA 1Y7HA 2G5PA 3FYUC 2PU5A 2ZJFA 3WJ1A 1F0NA 3DDUA 4Q3OA 4W1SA 5BWCA 3SWWA 5DLPA 4BDTA 5IH7A 2RGUA 3WK4A 4F5ZA 3I2KA 2AJ8A 5JD5A 1G42A 2JGEA 3ZWQA 4EY4A 1XZMA 4DMKA 1WPXA 3ESCA 2O7RA 2XUFA 4YASA 1L7AA 5EIAA 3FSGD 1U8EA 1EDBA 1DT5A 1TQHA 3FBWA 3CN7A 3C43A 1MO2A 1GKKA 3C87A 5C81A 3C8DA 3C6BA 1ZD2P 2WIKA 5K3EA 5AKKA 2IIVA 4Y2RA 2PSDA 2WHQA 3ZLVA 1XRLA 3L1JA 3IA2A 3W06A 4GWLA 4NMWA 1M33A 5A7GA 4EUSA 3AZQA 2XQIA 2BJHA 4DIUA 3QPDA 5A7HA 1TIBA 5HKBA 3A2NA 2QKYA 1ODSA 4X6XA 3GROA 2OQVA 2VEOA 4X93A 3VVLA 1ZOIA 3OURA 2K2QB 3H0CA 2ZSHA 2XUOA 1CLEA 4UUQA 2VA9A 4KR0A 3U1TA
chains in the Genus database with same CATH superfamily
3BIFA 4TL7A 4EYQA 1CUYA 1G41A 4G41A 4KN8A 1VHLA 4ALJA 3LY9A 1QCCA 1RYMA 3R7LA 4Z7JA 4C3VA 2PH7A 2XD9A 2CSXA 1F2DA 1T10A 1RRCA 2YZGA 3VMFA 1TUBA 1RZVA 3PQFA 4KQJA 4I4TA 2OZPA 4Q6BA 4QQRA 1U9YA 3TWOA 2CWDA 1TFUA 4YMWA 3F3KA 4G1UC 3FNFA 2FSGA 3S4YA 3VSCA 1EJBA 4DCMA 2CLSA 1Y6RA 1QPGA 1X19A 2P78A 3KK0A 4CLRB 4DR3B 3DMPA 1SD1A 3EFEA 5FQOA 4Y6OA 3LCCA 4F3NA 1XHEA 4HVAA 3ZHCA 1BNCA 1D9XA 4BHTA 5EJEA 4RXTA 3LTNC 1KDRA 3P2YA 3WI7A 2Z8ZA 4MKZA 4N5DA 3RLFA 3CUTA 1ACLA 1KH2A 2ZI3A 4QBHA 3DMYA 4PICA 1IJEA 1B2LA 1AY0A 1ND5A 3K6JA 2GM5A 3Q6MA 1EA7A 4I08A 1CW2B 1F9EA 4P98A 4PANA 5B58T 1E79A 5AKHA 1G0OA 1TD1A 3RYCB 2X7HA 1APBA 3T15A 2P0AA 4JU9A 3OHSX 3WIEA 2HEIA 2QTLA 1MQAA 4LMPA 3RSSA 1PL7A 5DYWA 4YAIA 3PUWA 4CLRA 2M6LA 2FPKA 4Y2PA 2FDXA 3SZRA 2J6CA 2O0HA 2GBFA 2OP1A 1JL3A 1Q0HA 1WMSA 2CNBA 1HO3A 2ORVA 3IP5A 5F2NA 2VHYA 5EHIA 1GL6A 1NJGA 2RHLA 2J5KA 2A14A 3ADOA 2N1MA 3C5VA 3JZIA 2C78A 2I2CA 3H42B 5LD2C 2YKGA 1BOFA 2AYYA 4D9IA 4M7WA 1H3FA 3HCNA 3FUVA 5AM3A 5IUJC 4B44A 2AV6A 1WHSB 2G04A 2YJ6A 3SKVA 1IOVA 3HBAA 4QBIA 3CGWA 1L7BA 3AEXA 3ECAA 4C7OA 4BRZA 3NBFA 4LSZA 2ESRA 4LQ4A 4WNYA 3VUEA 5ENDA 5FTJA 4CLXA 4LZNA 4BP9A 4CLEA 1SA0B 4NZ9A 1UBEA 4K03A 2P0YA 3CRNA 4AIIA 2G5GX 1OD6A 4D42A 3BN3A 2NTJA 1MENA 4OI1A 5DGHA 1G2PA 3NVKI 1RSZA 3OPNA 1A5AB 1GNLA 1WP9A 3KOOA 4X8HA 4K0KB 5BV0A 1FMCA 2HA4A 1TAUA 3DOOA 1K7YA 1T3GA 2BKAA 3QUCA 4DYDA 1WQ1R 1XEAA 3EAFA 4XVUA 4R6WA 4JUIA 3P2MA 3BSWA 3I0MA 3UBMA 2QTRA 3C6QA 1WHSA 1VPEA 3WGIA 3UJ6A 2Q3FA 3U44B 3F8SA 3UJCA 2XOEA 5MHTA 1Y82A 1JT9A 4HLQB 5A7FA 3OOEA 4RVCA 1P81A 1Z4LA 2W2TA 1AURA 1ZHFA 4EJFA 1XYGA 1SA0A 3F7OA 4AN1A 1ZNWA 4M1MA 5KX5F 1MTOA 3IVAA 3LWZA 2JCGA 4OQFA 3UGTA 1IBMB 1JIXA 1FBNA 5KSZA 4NQRA 3HG7A 1LSUA 4ZCTA 5I3CA 1JMYA 1G0NA 2J7PD 4ZPXA 1WVMA 2OQIA 3TAHA 1RJDA 4XYGA 5C4MA 2ZI5A 3IV7A 1E79D 1M0TA 2CLDX 2QN6A 4RVGA 5FIUA 5CDUA 1JWBB 2BI8A 2ZS8A 2QI9F 4JL6A 3RF7A 3A6GA 1GPYA 1M8KA 3PUVA 3UJ7A 4DQKA 1BJKA 3CRW1 4YT2A 1BVHA 3T99A 1Y7IA 4MVJE 3U44A 1JSXA 5A1TA 2QJRA 1C14A 4Q3CA 2ATVA 2Z8XA 4MQEB 5DNYB 1P2DA 3EODA 1WB4A 4M1OA 4RIGA 1KOGA 1A72A 1BKYA 1JHUA 1GOTA 1PLLA 1EQUA 1V5WA 3BFXA 3H3FA 1JJ7A 2I2DA 3RYTC 3WLPA 3AWDA 5BMVB 3NJ8A 1H2XA 3GDGA 3OO0A 3X3HA 1M0EA 1A9QA 2X4LA 2EBFX 4B34A 5K20A 4BRSA 3B6EA 5B55A 4BFZA 2OG1A 3EMKA 1HA3A 4FS8A 1WMBA 1J9GA 4QG3A 3BWCA 4MUBA 4CIDA 2RARA 1CF9A 1SOMA 2W2LA 1L5HB 5T6BA 1DVRA 5BV1A 4MGHA 1FDSA 1VHTA 5BV8A 4MQEA 2I2WA 2OO3A 3Q3IA 1THTA 1N0VC 4B76A 1YZUA 2FUCA 3AM5A 5JECA 3FKSA 1YZHA 2GA9A 2ZRAA 5CFPA 5BMVA 5KNCH 1U2GA 3QSYA 2XGJA 4PFSA 4O8ZA 1B8NA 2C07A 2HDOA 2NV6A 1FYEA 2ZI7A 1JXAA 1IHDA 2PUHA 1GDDA 1UDRA 3WMRA 3ZWKA 4C7MA 5HPYB 1VKZA 4Y6GB 2B1IA 1WDWB 3WKAA 3U3XA 1YRAA 1L1QA 3ZVMA 1PD0A 3BZBA 3T1VA 2OO5C 5T3YA 2NO6A 2VCEA 3H05A 4BQIA 3RH0A 4OGGA 4RJJA 1KSHA 2D1RA 2P7HA 4MB2A 1Q7GA 1R6VA 5CT6A 5EXSA 5K2MA 4Y9DA 1QQTA 1YGPA 3G5TA 4XUGB 3GAFA 1L5HA 3MNFA 4EDHA 2A3NA 1TB4A 2QRMA 4EKYA 5JROA 4Q48A 1IRIA 3H2IA 1XGKA 3TRJA 4OQLA 4DXHA 2GHQA 2O23A 5C5CA 1QH0A 3I2HA 3GFPA 5IF3A 2I54A 4BXOB 2VCYA 4JSYA 1EFVB 3RK1A 1A5TA 2YHSA 3RCBA 1KEUA 2CCJA 2Q2NA 3LLSA 4OBEA 2XVAA 4YH1A 5T6MA 1UZLA 4HGYA 2O05A 1RM0A 1GUAA 3KKZA 1XQWA 3INGA 2OZEA 3NJ4A 1HQDA 2A5JA 4LV6A 1Z6QA 3T54A 1PQUA 4ZWNA 4A8JB 4EB3A 1JQEA 3NKFA 5JWOA 3HSSA 1JDZA 4LSWA 3HVKA 1KAQA 1KU0A 4AJ1A 1SB8A 2BTOA 2WFMA 2HBYA 3HGTA 4KE8A 5KYNA 2VP0A 1W4AA 2PS0A 3NHRA 2I6UA 1A82A 3V8BA 5JARA 4JC4A 4LRTB 4GMXA 4ND4A 2HA2A 4Z1MA 5EMJA 1M8PA 3CNEA 5K3CA 3EN0A 5FWYB 2XVXA 4GL4A 3SEZA 5U1PA 5I47A 2YDYA 3JPWA 5J59A 1JKXA 1IATA 4JI3B 4A8HA 2P2YA 1EFVA 3ANXA 2E4ZA 5DBGA 3L40A 2E18A 3VDXA 2VSNA 4TLMB 4MPRA 1DELA 4A1FA 4BMYA 4EUHA 2A0UA 3S44A 2Z8YM 1TECE 2PU7A 4G5XA 4XGIA 4NYMR 2OHIA 3A6HA 2VZEA 2FQWA 3A36A 3FUWA 3NHYA 1R9NA 5CXSA 1B3BA 3IGFA 1FPQA 2BZSA 2VJAA 2VT6A 3WIVA 3HCWA 4A8JA 3RG2A 3GFQA 3ZDEA 5A9RA 1P1HA 1GARA 3DKRA 5EE5B 2GK3A 1FMJA 4GNRA 4Y2VA 3VRHA 3K4HA 1WMFA 2WINI 4IDNA 2ZUTA 5AKLA 3FKSD 3KTDA 1JTVA 3BWEA 3WG9A 3RSGA 2GBLA 5ALIA 1XTJA 2W7TA 1Z88A 4IZOA 3WADA 2HU8A 4CV0A 3NHUA 5FWYA 4B6QA 1UINA 3MTQA 4BQNA 1J1IA 3ITDA 3VPDA 4DAOA 4M86A 4UCFA 1EYZA 5IRCD 4EKIA 2XMZA 1MLDA 3PC3A 1QC5B 4RO0A 4OM8A 5KBYA 3WQQA 1JDPA 4NOJA 1A2BA 1NUQA 2ZJZA 3A05A 3LVBA 3N8KA 3T7SA 2CXXA 4MHTA 4O4JB 4Z4IA 3DDNA 4KWHA 2XF8A 5F5LA 3UMJA 3GDOA 3MOGA 3P9IA 4D4KA 1VKRA 1U2PA 3ZWNA 4AZTA 4DANA 5F33A 1OUMA 1Q57A 1YCDA 4K46A 2AEFA 2HIGA 1UOOA 2OBBA 2ZRGA 3QPWA 3QUTA 4N49A 3VR4A 4AN0A 1O9GA 1FFAA 5G0TA 2XAAA 4URFA 3ZCPA 4XRGA 4Y0AA 4DQDA 2C97A 5AI5A 2CXSA 1KYVA 3ZWAA 2R5NA 2J3MA 4I9FA 4PLTA 5CXXA 1P2BA 3GU3A 3STVA 2IFTA 4D3ZA 2G09A 2NV0A 4G5FA 3C3JA 1QC5A 5H7XA 3PR3A 4PG8A 4G0XA 1A2KC 3TGPA 3QITA 5AHRA 2OCGA 5H9VA 5DM2A 2PT5A 3TINA 1G18A 4UDOA 4UNIA 4Z1MD 1QGYA 3R5KA 4O4JA 5AUNB 3NHLA 1M74A 2OXEA 3IVXA 4JT2A 4NAUA 1USVA 2EDAA 3OUZA 4Q9NA 5FL7A 4U9HS 2NU6B 3SEQA 3TJMA 1N3YA 5IKXA 3VR3D 5JI3E 2IY7A 1ZXLA 2H1RA 1WXXA 3GUYA 3B7GA 4PLFA 3NAMA 3WYGA 2WZDA 2Q0XA 2XE6A 2B8NA 3ECCA 4NL4H 4TS4A 2R6CA 4WADA 4YV0A 4C03A 3OG9A 4GL2A 1AV6A 5I7HA 1H3EA 4CDMA 4UTPA 3Q7QA 2XCIA 5IAOA 1VIAA 3I34X 3HLKA 4BFWA 1GNTA 5EKTA 3TUJC 4JI1B 3HXQA 2KBEA 1NPDA 2A7XA 1S2OA 2CZQA 2WICA 3I58A 4PZZA 1UBCA 4A1OA 4D5GA 4JITA 1H4QA 3DW3X 4Q4DA 3HVUA 3OC0A 4PYIA 5T41A 1V3VA 1KI3A 4G2NA 4RF2A 1MZVA 4J1NA 1JB1A 3WB9A 2VKTA 4MUXA 4EO7A 1FDRA 3IR7A 4G0ZA 1B0UA 1EE9A 1BU8A 2NU6A 3EMBA 2V45A 2JI7A 1YRHA 2GBIA 2HO4A 2FFAA 1A9OA 2EW1A 3GGJA 5FI1B 5K0SA 4EPTA 1I2MA 3TPFA 5L4LA 1GTVA 1VRCA 2YJ5A 2Y68A 4WACA 3PKZA 4AJ4A 3CUVA 4Y6QA 1VB3A 1Y4AE 3IMGA 4WK6A 3I64A 5EJ8A 3OQ1A 2VFAA 5L3VA 1QO0D 1J7JA 4LX8A 4MJXA 2ODPA 2PKXA 1J7KA 4ZVVA 9MHTA 4Y67A 1RACA 3RUIA 1UZMA 4X97A 3S40A 4B3TB 3T0IA 4PHHA 4BLPA 1ZWLA 1HZZC 3LPNA 1NN3A 3WRXA 4UCXA 3TO5A 2G25A 2H1LA 1KEWA 4RK7A 1T2EA 1U2SA 1VC2A 2EBHX 4Q3AA 2W6ZA 4YAFA 3R0JA 4CL2A 4BMOB 3GJZA 2WWVD 4OP1A 4AJPA 3TKAA 1U9ZA 1NQVA 3TMKA 4EZIA 1G9XA 2B83A 4JBYA 1K4MA 1LRJA 1YO6A 2I7CA 2NXCA 3EUEA 3QK7A 1OY1A 1USWA 4ZICA 5EP2A 3UZUA 5JMOA 2GLXA 1P6UA 3ACBA 5FL7D 2EJBA 4RD3A 4RELA 3HJAA 4WXHA 4BGVA 1HNZB 1JSRA 4LXGA 4FJ2A 1PJ2A 4DMLA 4B80A 4RY8A 3F0TA 1BHSA 4Q7KA 4MLCA 3A1EA 3GJSA 3NTVA 4N39A 5CRIA 4B32A 4FU0A 1KZ6A 2AN3A 2FWNA 3JQBA 5ERXA 2R68A 4DRZA 2C9ZA 1GY8A 4GLBA 4PZ9A 4CL8A 3FFBA 3LTEA 3JQDA 3ZTYA 1GQ2A 3MS7A 1WZCA 4AKEA 1GRNA 2QTAA 1QYRA 2JJ2A 4DLNA 3EYAA 5GTDA 2AZTA 1ULHA 1YRBA 4TSFD 2CVHA 5KHLB 2R3SA 3GVHA 1YDGA 4R51A 4B17A 2PQMA 4JB2A 3UT6A 3VHRA 2XR1A 4FHGA 3C45A 4AU1A 1PJTA 5CLIA 4ZOBA 4L8FA 2O54A 1Y1SA 2FYTA 3HYCA 3U4CA 2B4KA 2VXYA 3I28A 4WKNA 5EZ6B 1GT91 6CHYA 2ZPAA 3HY6A 1D2AA 5G0SA 1YBMA 4GP6A 3DP9A 5I7AA 4DM3A 3FWYA 4PZEA 1GPNA 3C16C 2VHZA 1P0IA 2ZVQX 1J99A 1SIWA 2C1ZA 1PJ3A 4KACA 5M3BA 3VKFA 4KFSA 3IXQA 4M0PA 4O4HB 3UMFA 2AR0A 3U7JA 4Y30A 4FGSA 3DE7X 1EKXA 2B1GA 3DDSA 2Q3JA 3MZ0A 3OEEA 4LS3A 4CIBA 1SR8A 4HBZA 3DO5A 4G4JA 4IZ6A 5DE3A 4ZALA 3FNIA 2HIAA 2ZJ5A 1I7SB 3GLFB 1GSAA 3HXOA 2X5KO 3DVRX 2PA0A 1B6TA 3GPIA 3IJPA 3QBDA 4MKRA 3EHEA 2WJ3A 4C0JA 4EATA 4RJ2A 3W5BA 3OCVA 1CR1A 4HQ6A 2OK8A 5IKEA 3KU1A 1Q5PA 1OXUA 3JQCA 4ILEA 3ZH9B 2CB0A 2QR3A 1NVDA 1PJZA 1XTUA 2ZU6A 4JQYA 4RMNA 1O5IA 4Y2XA 2C7OA 2XUZA 2IBSA 2VTEA 1DTSA 4DZTA 1PWHA 4O4HA 3FAKA 3FHLA 2D4HA 4AW9A 1OBHA 5HF8A 2J46A 4POAA 2FXIA 3VR6A 2FRDC 2BTQB 2EYQA 2YYYA 2WTUA 4MCJA 1Q6ZA 4TVKA 4URXR 1QWOA 1LW6E 4JLAA 5C34B 3TXAA 3GLFA 4ZU3A 1Z25A 4RQUA 3S1SA 3W9UA 2B37A 3BXFA 1J25A 4BPBA 4NY1A 1SHUX 3MCVA 2JJ2D 5B7QA 2HI0A 1SEVA 2C4KA 2NSHA 1MPTA 2MSDB 3NV9A 3BT7A 4P32A 1N92A 2QM0A 2ZYAA 2PT9A 4MK4A 1C9DB 4CKYA 1QF7A 4BE7B 2C77A 4JP8A 4EUEA 5H70A 2AUNA 4ENVA 1MH1A 3DHEA 1HLFA 4ACAA 2HXSA 5JBIA 4L0MA 1W47A 1XA0A 1J20A 2Q9UA 4JYAB 1G291 4TVBA 3WGNA 1U2EA 3R2JA 3ZDZB 4RVOA 2BTQA 4BZXA 4QD3A 2JA1A 4HDKB 3N7TA 2YNMA 1G8KA 1HNWB 4DTCA 4NMLA 2JAHA 1LDBA 3CFYA 3RE1A 4A0SA 1TI7A 3TXXA 5F2EA 3CEHA 2Q3CA 4KR2A 3URMA 1VP3A 1Q7EA 1MRSA 1G8YA 4URUR 4RTMA 1JPVA 4RHXA 1XWFA 2R9VA 1L3IA 1RCTE 4LRSB 2GVZC 1OAKA 2F90A 3OEED 5AKEA 1AUPA 3A58B 2Z2KA 4ENSA 4MUYA 3T5MA 4M4SA 3TZCA 2I5PO 4DRXB 1PK7A 3IUYA 3KLPX 3LPCA 4JJIA 3U0VA 1FTQA 1UBSB 4Y2UA 4ZARA 3UG6A 1DBWA 2WYVA 1L8AA 2CVOA 3MUOA 3RRBA 4LF7B 4HDKA 1JR6A 1Y9DA 1M7GA 1LPSA 5GJWC 5AQ1A 1COWA 2C4VA 4X91A 2IOQA 5DLEA 4HB0A 3WHKA 3H17A 2ZI4A 3NCTA 3WXBA 4UEWA 5LZ2A 4I3FA 5CLHA 4R2HA 3U26A 4LF5B 1R0XA 1CERA 1EBBA 2ZBEA 4IDAA 5EERA 4EVQA 3R41A 4RVDA 5DDIP 4MS3B 1E94E 1Q44A 4MA4A 1T5LA 1RPJA 2AWOA 3Q85A 2ONJA 3VR6D 4EMUA 4WY8A 1N7IA 4KQ1A 2M6SA 1BSVA 4WBXC 5L40A 1VE7A 2I80A 2ZTVA 3OD1A 4WI1A 4E3ZA 2DJ5A 4DRXA 1KEVA 4I5IA 4GBED 5JZSA 2LGJA 3LL7A 1JWLA 2XA9A 4YFYA 2R96A 4MH0R 1QIJA 5BRNA 2C98A 1GQRA 1L7DA 1Y8QB 4MPPA 5GOZA 3X1YA 1A5BB 4FDMA 2C5SA 3LU1A 5H8WA 4L0CA 3H11B 2B6HA 3COZA 3DOHA 3DC7A 2PVSA 3I6MA 3DEJA 4G0YA 4MYDA 4TX1A 3K2BA 1UJ6A 5AKXA 1T9AA 3OBBA 3T4UA 4YO7A 2FN8A 2FR8A 3K8ZA 1Q3HA 2W6IA 1GDHA 4UXJA 3CX4A 4QE3A 5ALPA 4MS3A 4ZREA 3WLEA 1CZRA 1V2GA 4X20B 2DTXA 2A5FA 1VA5A 4E03A 1ZUD1 3SLGA 2YNMD 3OE4A 4YHBA 2QNRA 3K0CA 2Y2UA 1CUCA 1AN9A 2WU8A 5GQSA 3UXHA 4ARAA 5FA8A 1JLHA 3PNSA 1X87A 3RFUA 1Y8QA 1E1QA 4ERXA 1CUAA 2VTKA 5EJFA 1URPA 3RM3A 3HBLA 4EHIA 4RTOA 3H11A 4UARA 1PNOA 2O06A 1T2CA 3MQ2A 3TZLA 4CF5A 1IEXA 3A4TA 3TLEA 1I3LA 1XQ6A 1NW8A 2RK3A 4IX9A 3PNVA 1QBKC 2FZLA 3KCNA 4RD0A 5BN3B 5L4NA 1EBUA 4TV8B 2XYGA 4N54A 1GTZA 4WVLA 4XAQA 2ZU0C 1DOHA 4D9EA 3KSDO 4Q0MA 4X20A 1RVV1 3MRVA 2CZCA 4K26A 2GEUA 1ESNA 1QNFA 2ETVA 3F4BA 4ZK6A 3G8AA 1COWD 2II6A 4HFRA 3OZIA 4M8LA 4Z2YA 4NZZA 3EJ6A 1S2GA 4JLMA 1NXQA 4IFTA 4DIMA 3IURA 3ZGNA 3P4XA 4P0PB 4MVJA 5AYVA 2AG0A 4PG5A 1YJXA 4Z0TA 1YZGA 2HDNB 4E94A 2PUWA 2HQSA 3CLSC 4OMCA 4XR9A 1VBFA 4U5XA 1O8BA 2LCIA 2ZB4A 2C3PA 1LNSA 3M3PA 3A1FA 4TV8A 5BOVA 3KDPA 1BC5A 4N8EA 5AJZA 3WZMA 1XKTA 1X42A 1SOVA 3AM3A 3GY0A 2DWOA 4GD3Q 2J3LA 1EIWA 1T4GA 3Q41A 4MW5A 4JJ4A 3RVKA 5BSUA 1ZI9A 5GJBA 4E5NA 3THWB 4RPIA 4MW4A 2H1VA 4KZKA 4IUYA 4EHAA 4F4FA 3ID6C 3MLAA 3W7VA 5I5EA 1YS6A 1MUUA 3PHHA 3GCDA 3HJNA 3QFTA 2W6ID 4MEJA 4EF5A 1V1JA 2ZRMA 1F8XA 2P9QA 5BT9A 5LUBA 2R0QC 3QEKA 2EF1A 3R44A 4FGLA 5FLYA 4QTYA 5E3JA 1Y1LA 2XHZA 3IDAA 2HOQA 1NFQA 4YI3A 3VQTA 4ADSG 5ADVA 2IPMA 3O93A 4IEEA 1QXSA 1H2AS 5C53B 4TLLB 4DXDA 4A2WA 3CNQS 3SNKA 3S27A 5HHTA 2IOHA 4DUGA 5FOTA 4C0LA 2J9XB 4YMVA 3WKCA 3BJRA 5JI2E 1FRNA 3DGFC 3T7EA 2E21A 3PJDA 4IDBA 3DP7A 1E1QD 3IYLW 4P36A 4O3FA 4HMQA 1FRQA 3P2JA 2FV8A 4EB0A 5F77A 2HLDA 3THWA 1N5RA 4I66A 4NBLA 3EUFA 4CN8A 3ZS8A 3OMXA 3L79A 5KAPA 1VKOA 2UXCB 4I1SA 1RXVA 2AHOA 3F6EX 4B6OA 1IVNA 2CJWB 4H16A 4KEAA 3KKLA 5K03A 2CLIB 1NXVA 1PTJA 3K73O 4F3TA 3C3MA 5DTEA 3KPUA 4ENWA 3IEVA 4PWYA 3S2IA 2ZBVA 2QN8A 4MGEA 4ZTBA 1LFDB 2G1KA 5TMDA 1XZQA 1YSCA 3TBFA 2WOJA 4R31A 1OFGA 3IKJA 3IEKA 3Q7RA 4YRGA 1I3MA 1UMKA 1JGTA 2FF5A 3FPLA 4PE5B 4XSHA 1YDHA 2OGZA 4BN0A 1RFGE 4MVJD 1ZN8A 4DA4A 1HF3A 2CXUA 4WV3A 4JBIA 1EWTA 5FH9A 4AF8A 2PUGA 1MOPA 4LOLA 3RSCA 1EEHA 2C2ZA 3GG2A 4OHFA 3QXXA 1X1DA 4JGGA 4ZQIA 4LJ5A 1KJZA 2PD6A 3NDBB 3P94A 2CJWA 4FHFA 1SUWA 3VJMA 2DWPA 4HAYA 3J7AC 5AW0A 4H0FA 5EE9A 3X1DA 4Q4LA 4EY6A 2P35A 3E6AA 1YULA 1TLFA 3HBNA 3IIEA 4MQLA 3BWXA 4AG5A 4HLCA 1GNRA 2OAGA 3ESDA 1N6IA 2AXEA 3HUUA 4FVTA 4N8DA 4F71A 2MU1A 1SUCA 4I9NA 4URWR 4TVOA 3UJDA 5KI6A 4B8ZA 1LDEA 1WDMA 1I4DD 3T5BA 1XZGA 4KRXA 4BE4A 4YX9A 3UWKA 1TK9A 1TKRA 4KXYA 2J8ZA 2PZLA 1WSAA 3LF1A 4KMSA 4QL3A 3ZZNA 4RK1A 2FRVA 4RV4A 3TLZA 2WU3A 5LDHA 4BYMA 4CQJA 4ID3A 1M2NA 2HLDD 4YUVA 1B14A 3LC0A 3TQQA 4PN7A 2I34A 1EVJA 1KTIA 3OX3A 3D81A 3MCTA 4I6JA 4IP0A 4XVRA 1ADJA 4X66B 3VHQA 1GXSB 3AVVA 1H2RS 4BQEA 3E48A 3H8JA 1UDBA 3DAFA 1TUGA 4XD7A 5AW5A 1A77A 3A6DA 2BBWA 3RARA 1ZSNA 3AM4A 3BGWA 4HDQB 4F60A 4WFKA 4CXMA 1KMCA 3CEMA 3QW2A 1GG5A 2QP3A 2O8VA 4E12A 1L8QA 2PGIA 3HXPA 4IICA 3VU9B 6REQB 5AVYA 1X80B 1LVUA 1DS6A 4C3OB 2XT0A 2IPNA 1CR0A 1SUAA 1E66A 4TN1A 3V34A 2PS1A 2FPGB 3FF1A 3AKDA 3U4MA 1WSBA 1JW9B 2A5DA 1ISMA 2V7BA 4HPWA 4LK2A 2GKSA 1X77A 5DGDA 3B9PA 4PYJA 1L8LA 2ZBDA 4AMGA 3HRIA 4Z7QB 1YACA 4DDUA 5JS1A 1HORA 1PZFA 1T9GS 3CMMA 3TKYA 3AM1A 2G6TA 1GXSA 3I52A 4BWVA 1NQAO 1TVKB 2C82A 3I05A 1G19A 2OL4A 3BWYA 4XQ9A 3PEFA 4ZVOA 2R8RA 3DULA 4ISCA 3KJEA 4PS0A 1H2BA 4AK9A 2WTBA 3SU8A 2CEKA 1PQ4A 3VU9A 6REQA 1X80A 2X86A 4EQZA 3F5FA 4FD2A 2R00A 4QG7A 4PIPA 3SYMA 1MXHA 4JYMA 2FPGA 1FP7A 2RGDA 3BB4A 1IEVA 3PWKA 4HGQA 1HRDA 1UBHS 1EUZA 2HQ1A 3FVQA 3SBEA 1TMKA 3H75A 3NYWA 1CVIA 4N03A 1AB6A 1XCMA 4XD2A 3OAAD 3V4OA 5KJFA 4RZXA 4Q15A 5AW3A 1G3QA 2CNKA 4ZO7A 1AMUA 4UPVA 1RQLA 3KB2A 3LSTA 3RFTA 3BIXA 1Z0UA 1IE3A 5D5HA 2JK1A 1IZ9A 3CUEF 4FYVA 3RSQA 5B2FA 1VKHA 5HKAA 1TVKA 2PZBA 5I9NA 4JN6B 4RACA 2SKCA 1RLUA 4F91B 1CZHA 2H1IA 2IPLA 2K7FA 2F6RA 4Q4HB 4DUYB 1FMFA 2HU5A 2VSFA 2IJGX 4C01A 4TKMA 3OQHA 4NE9A 5TC4A 2NAPA 3HEBA 2V8OA 4RK6A 2WUVA 4A4DA 3FNBA 4PNPA 2LR0A 3CXUA 2RONA 2B21A 3MILA 2WZCA 4U39A 5E0KB 3DAPA 4XD7D 3U39A 4FFVA 4L28A 4Q1FA 5AXCA 5AJYA 4E2FA 5JD3A 1L5OA 4F84A 4DREA 5JDIA 1MB4A 3SQMA 5DP1A 1DG3A 3DL7A 3BFVA 1QHNA 2QM3A 4QGGA 1E8NA 1B8OA 2IKSA 3L7BA 2JZOA 4IDCA 1YT5A 3ICWA 2D74A 5L3SB 1YQDA 1B93A 5D1NA 1KTVA 3OIFA 1VPLA 4MV8A 4Q4HA 1SAYA 2G40A 2OCLA 3G5AA 4N0DA 2EP8A 2PRJA 3P9CA 4TTJA 3FKQA 3PFIA 5AVRA 2GVNA 2IHNA 1H2EA 1L7OA 2V6FA 2KWIA 1HDGO 3HY3A 5EZQA 4DNOA 5HRAA 4J0DA 5DSZA 3WBKA 4A5SA 1WSDA 1DIOB 4WW0A 4BO7A 2BGGA 4MUIA 4OF4A 2EFEB 3C3YA 3IAM6 3NM5A 2VLBA 4HX9A 4LC9A 1A9TA 4MRMB 4KXVA 1LWNA 5DZSA 5FUYA 2G8NA 2IODA 2A35A 4FDTA 1O8CA 2Y99A 1E1DA 3KL2A 3NLLA 4FIDA 5CLGA 5AOAA 2CWWA 1J24A 2H52A 2PV7A 3SSOA 3HDHA 3U1BA 2V54A 4H59A 5L3SA 3O94A 1VKJA 2ZJ8A 4K8OA 2Q49A 4DLAA 5CG2A 2EZ8A 1HNXB 2G80A 5SYMA 4RGVA 1M7BA 2RH8A 3CBGA 3P2OA 1L3BA 4DM7A 1Y34E 4B40A 5AVKA 1T0JB 1DRWA 3IAFA 2YUIA 2SCUB 2FOLA 3WL4A 2CMHA 1N25A 3IODA 4MRMA 1JH8A 4XIIA 1NMZA 1AC5A 3G9UA 3NTQA 1SGWA 3IT0A 3JWIA 2WU0A 5AHXA 2FZKA 4JZKA 3E5HA 2GPYA 4EHLA 4DSAA 1B1AA 1PT7A 3N8IA 5AMXA 1Q17A 2BE9A 2KE5A 3DMTC 5CLFA 2IYPA 2X42A 1TFRA 3DHVA 2BMWA 2D7DA 1GGHA 2G70A 1JEAA 4RVHA 5BQ3A 3M0EA 1DBIA 1N0IA 2YWBA 3REFA 1I7LA 4CV1A 2JEYA 3IFSA 2CLLB 1WEHA 3QWBA 1JKMA 3STXA 4F7DA 1KYXA 1QCYA 1Z75A 4UEJA 1W2WB 5J2UF 3ZXSA 3GUVA 2WHXA 4UUNA 2SCUA 4KNYA 1T6YA 4EF4A 4RTNA 1DQZA 1QE0A 5K45A 1E3JA 2JFHA 1KI2A 1M9NA 2B9EA 3K0AB 5LMCA 3WYEA 4J0IA 4ND3A 2RD2A 2VBIA 1ESCA 1CJCA 1S8AA 4XYLA 4WZZA 4W9MC 4DADA 2C0PA 5KINB 1XVTA 1CJUC 4IF4A 3OIDA 4FWBA 3K09A 4MDFA 3IR6A 4KG7A 4QUDA 5CITA 1QP8A 4HLUC 1PL6A 3O4HA 4CMGA 1E5QA 2H2IA 1GKIA 1FE8A 1R0BA 1NYLA 2SBTA 3PWSA 2B99A 5ESWA 3OLXA 3U5TA 3AVTA 1JA1A 1P29A 1QLJA 3CVVA 3BJIC 1AQIA 4L6CA 1ORIA 1AN0A 4L5IA 6NULA 1D6NA 4M1WA 1YIAA 4UVEA 1TT5B 5D86A 1B43A 3NC4A 3U9SA 3TNLA 4FOTA 4REQA 3UANA 5CPFA 1SZJG 2ZVDA 3QKTA 4HK4A 5KVVA 2DHRA 2Z2YA 3K0AA 1A04A 4B83A 3ZPXA 2R4QA 4DV6B 1T8TA 2W6JA 2GJ9A 2EKDA 3MHPA 5FTWA 1KWGA 1IHXA 3D7KA 5B3AA 1U8UA 4I5DA 1O89A 3A0UA 4WAUA 5AM1A 2P5YA 1XELA 1N6PA 1S9HA 2I29A 4LI3X 1QJCA 3QE3A 1Z74A 2VXBA 1QUEA 3ENQA 3N07A 1GTL1 5EIHA 5C3UA 3K2EA 2ROQA 1Z4NA 1KPIA 2FUKA 3FLEA 4FGKA 1Y1PA 2CE2X 3OKFA 4TUYF 3TZBA 1CUZA 4K81B 4CL0A 3VOAA 5C1OA 4J0QA 4PRYA 2VHJA 5B58C 1RXYA 3T06B 1TT5A 4O25A 3M4NA 2GFQA 2F9FA 5IULC 2WUGA 3FN4A 1AO3A 4Y7CA 1YMUA 3H0EA 3V4ZA 1G59A 5B5SA 3THXB 4D26A 8ADHA 3IIMA 4L5JA 2AJBA 2R8ZA 2JLBA 3CPHA 4OH1A 4Q02A 1AKRA 1X0XA 2CBZA 2R1VB 3DSRA 4MULA 4P93A 3TDNA 4BLVA 4RVUA 4OLAA 2IYUA 2XTNA 1QYWA 1O03A 3RTGA 3M49A 2A92A 1PEAA 3LQ1A 3G13A 4QPCA 3EEQA 3AVUA 2ISQA 4AZSA 1IMOA 3GJ6A 2JFVA 2DF8A 1T5TA 3OCYA 4KWEA 3RFFA 3OHPA 3VPHA 2Q3MA 4JJ7A 5CDSA 5ALMA 4KIWA 4J7XA 5KJ1A 1Q1BA 1HYQA 4YV2A 5KSYA 4DTIA 5KU1A 2WV7A 3R8FA 2X0NA 2IH5A 2ATCA 1Z36A 2CKMA 2PLNA 4CG1A 4CT5A 3THXA 2K87A 5JD4A 4RCYA 1HTTA 2R1VA 4V39A 4YECA 3K6RA 3RFVA 3U4QB 1RP7A 1O6FA 1DNPA 1O5TA 5BUQA 5H1YA 2KHZA 1ZJ5A 1ZZEA 3W7AA 5CB4F 3EYWA 4H6VA 5C37A 3LYUA 4OK3A 2ZT7A 4Y9RA 4LRXA 1VDMA 3H2KA 3LY5A 4X24A 5ERYA 4JKYA 3E3OA 5CIQA 1SCIA 3PQ5A 4KGVA 2OB1A 3WK8A 1DX6A 1G38A 4WINA 2XMSA 1NTOA 3Q5DA 3V7UA 4LOAA 1M2KA 2O8DB 3VFDA 4YCAA 4YRCA 1OWPA 4KVFA 4QFBA 3PRJA 5CR9A 3JVDA 1RWNA 3L49A 3IT3A 1ILWA 2ZSDA 1J2EA 4CG2A 4F6LA 1LNQA 4IOMA 1ND6A 1XAJA 3WGZA 4ASUA 3F6BX 2B30A 3U7IA 2F00A 1PFQA 2DT8A 4BCBA 4EY8A 1O3YA 1NUHA 2AOXA 2JH9A 3FHJA 4DLYA 3TTYA 4ZKDA 2D13A 5AM2A 2XQVA 1NP3A 2WMNB 5A0FA 5U4QA 3PITA 2YVKA 1OTXA 1GU0A 2M1ZA 2H29A 2Y1CA 5FNVF 2P1DA 3ANMA 3S3TA 1XRMA 1Z6YA 1G60A 3HFSA 4WKOA 3UK0A 3VJRA 3KJZA 1K08A 3PEEA 4W5HA 1DKNA 5EJ4A 3WO1A 2JGNA 3ZWYA 2R4UA 1NJ1A 1KK3A 2XT6A 3AF5A 3DVQX 5F2KA 3RTEA 4B5LA 3HR7A 5BWLA 4YCNA 2O8DA 5DYTA 3DEZA 5LZ5A 3LG2A 4BQRA 5FBWB 1RJWA 1SBCA 3LSYA 4PRLA 3RHFA 4F4IA 1PG0A 5DTQA 2FMTA 4FSXA 4RS3A 1WKVA 1P6QA 4KQCA 2FG7C 1FDWA 1OX6A 1PEDA 1EFTA 1PJAA 1Y42X 1OYYA 2ID7A 2OOSA 3CNOA 3CT4A 3HQ4O 4F86A 5LQMA 2C96A 3FNGA 3IRUA 2DXIA 3U31A 4PYMA 1K7EB 4DW8A 4EO4A 3G7SA 3OJLA 2WWRA 3HADA 3K70C 1Z5ZA 1XCJA 3ZVNA 3NDPA 1YB1A 3NC0C 2Q4BA 5DX8A 4NV3A 3EW7A 5HCIA 5I9SA 1AGYA 3TLYA 2VHEA 1XZIA 4V0LA 1JIQA 3DF7A 1VECA 3TW6A 4K9DA 1CYDA 3V5NA 1T3TA 4EECA 1Y5RA 5DLYA 3VTFA 3ZK8A 5A03A 1ULSA 1S0UA 2JLSA 2ZP1A 4K6FA 1QIIA 1X0VA 3PA6A 1I2DA 4CMHA 4RKEA 3VYVA 3I2JA 4CJXA 1VIVA 5DKFA 3RC2A 4AY2A 1QR6A 3N6XA 5JRJA 3FOZA 2WYOA 4ZEXA 1CIPA 1PUJA 2JFBA 2CNDA 2EC5A 2J3QA 2AZXA 2Q5EA 2ZYDA 4HR7A 1GVNB 1T1JA 2F1JA 4RU1A 1EE2A 4G86A 4XJXA 4BO5A 2V5AA 4FHZA 4CM4B 3L6BA 4F1WA 5KNDH 5KU7A 2VYNA 1AKUA 5JMWA 5EUCA 4FGWA 4QBTA 5DM60 1MMFB 1QUFA 2ZUFA 5AQEA 3NI2A 2CYAA 3K3PA 3TSYA 4AMUA 4WVFA 4KLRA 2HJ9A 3BGVA 3CF6R 3K70D 5IN4A 3PE4A 2A9JA 4ASUD 4C7VA 3L41A 3VU1A 1FXWF 1FPMA 5FHQA 1R6XA 1NWHA 2D8AA 5ESRA 1E0DA 1KRHA 1ORWA 2IYRA 2VJBA 4XDZA 2QXTA 5DWVA 5TQJA 5DM1A 1KARA 2ID4A 1T2DA 2Q9CA 2R6GA 1TLTA 3H9CA 3ZV7A 1T1GA 4KFTA 2VTVA 5HMMA 1ELOA 1KOJA 4EG6A 1NKSA 4PWZA 2HPVA 4TM8A 3ZZ0A 4MA0A 2QRJA 4NR0A 5G40A 4JEUA 3KXPA 3WKEA 3SC6A 2IGTA 4CM4A 5CLLA 5FFNA 4JBXA 1SXPA 3AL0C 3ZHQA 4D4IA 3BERA 1NVEA 1N8KA 4TQUS 4RNDB 3ZYZA 3VC1A 1XZHA 2D0OB 4J49A 4LZJA 4XI9A 3LHFA 1JDSA 4GPZA 2WU4A 4WLNA 3QBEA 2XKBA 3KZ1E 2DFLA 1QGAA 1TPZA 4N7BA 3PNQA 4HEJA 5ERGB 5FUQA 5B2EA 5BVHB 1CUWA 4N6GA 3WVNA 3RVJA 1ZRMA 2XJ9A 5BW5A 4Q7EA 5KWJA 4IOJA 1NW7A 2YWXA 2ZOSA 4UPEA 4LBVA 3N75A 1KE1A 1T9BA 5K0TA 3AHHA 1RBMA 2AB0A 2B4RO 2I6FA 4Y2YA 1W6RA 2Y0PA 5TJHA 3ZDYB 4OJKA 1PZHA 1VBNA 1TGVA 3LQRA 3CF2A 4FMPA 4E09A 1NRJB 4F56A 2PSEA 6PFKA 3SDSA 3U3DA 2CL6X 3IPRA 1Z15A 1IN5A 2BISA 2QMZA 3IKLA 3DZBA 2OENG 3FSEA 3OFNA 4IIGA 4UVHA 5IJAA 3TECE 4Z4FA 1CD5A 5JALA 2K2WA 4HT3B 5LMNB 1NBAA 3GUHA 5LA6B 3STYA 4EY7A 4UEOA 5AJUA 3UHPA 4D9FA 2YVAA 3WLNA 3W5DA 3LP6A 2C84A 4XGRA 4XX1A 5LBIA 1QK4A 2YJTD 1WB6A 2O2SA 4N5MA 5BVHA 4Z4EA 3DZHA 4X0EA 1OXBB 1KQOA 2VYND 1GCIA 1XDDA 4KITB 2OGSA 4DY4A 1JALA 1U2DA 2FFBA 1LK7A 4G85A 5H59A 2OYCA 3UQYS 1NFRA 3HYNA 1SC6A 4RPCA 4YRLA 2KX7A 1KQ3A 1SUPA 1UXHA 4YBRA 1H4SA 4OGKA 1ZNQO 3LIIA 3AW9A 3G2QA 5KJEA 1IBLB 2NO7A 3PXBA 4XWYA 3IBFA 4NBSA 1IONA 4M0FA 4U8HA 1E77A 1WBJB 3AOEA 5BN4B 1U28A 1Y8AA 3BQ9A 4A8PA 3KBOA 1LTKA 1SBHA 2JZNA 4WA7A 4YT4A 2VVTA 4KBYA 4FCVA 5LA6A 4CKEB 5K4GA 1G4HA 3JSXA 2X6RA 5KSPA 2EU8A 2IUFA 1GPUA 2P9FA 5DNEA 1Q21A 1QZ3A 1XDSA 4XIFA 4GDMA 4ZOEA 3F96A 1IEQA 3CRQA 3R5SA 1HI9A 3MT0A 2D59A 3QMPA 4HSEA 4Q3DA 5HJ5A 3KKNA 5JAUA 1I5OA 4P6VF 4C4XA 2GZHA 3CF4G 3JRWA 1JHQA 3II6X 3PUIA 1MRZA 2NVWA 3CZQA 3DD1A 5IARA 4NDZA 2R1ZA 2ZLBA 3BQMB 4GX5A 1RLMA 2DFTA 3OPXA 3NZEA 3ND7A 4ZQEA 3TLXA 2KLBA 3TRDA 2CDNA 4M0EA 4IH4A 1QBGA 3PFFA 1C9JA 4DLUA 5BN4A 4RORA 2QI9C 3ZE1B 4M22A 4YT5A 3IUQA 4WSOA 1RZRD 4YC7A 4CKEA 4L76A 4D57A 3LDUA 1XOIA 4GXRA 1NV8A 1GEEA 1GKLA 4PO1A 5LVAA 3KHSA 2Q8PA 5HM8A 5IWCA 4HF7A 1C5KA 4EKNB 1NN0A 4X5OA 1ABFA 3DTVB 4G4SP 5DRTA 4A5OA 1UEXC 2VJYA 3TM5A 1GRQA 2BV3A 2YINC 3AR4A 4S0ZA 5IJWA 1X8LA 4BOYA 3WGHA 1DBSA 2VJLA 2OMKA 3OFND 1KWKA 4KK3A 4YAWA 3B1VA 3VDNB 5J43A 2GXSA 4TXNA 2IZZA 3V9AA 1XQVA 3OE5A 4XSGA 3UAZA 1FFWA 1MJNA 4E4TA 4NCAA 4CODB 5I8WA 3CONA 3UOAB 1WBBA 4AY6A 2VOJA 3H2HA 4J1SA 4GKBA 4HNQA 1B74A 4MQFB 3ZIUA 2OSBA 4F4DA 4BP3A 2EX4A 3F67A 2QL7A 4YRZA 5BV7A 4FNOA 2OGUA 3Q3VA 1X9GA 3DEKA 2AK3A 3WRVA 2DBRA 3F74A 2IYFA 3MBOA 4MUJA 3CB2A 1UBGA 3C4QA 3L8CA 4KODA 1X8JA 5FD8A 1SNYA 1WAMA 1X14A 2IY9A 4MRRA 2Q1YA 3DTVA 1E89A 4B3IA 1UKAA 2XKKA 1KP2A 4DPMA 3M9XA 4JODA 2CXRA 2GB4A 4OQDA 3O9MA 3PJRA 4E2XA 3CW8X 1XJ5A 2F59A 3G59A 4N0EA 1Z9BA 1BDHA 4G65A 1SZCA 2P9EA 4RJLA 5T8KC 4MQFA 1U1GA 3LGXA 1JNYA 1VM6A 2JFGA 1NBIA 5T3UA 1P4AA 1NMEA 2WZBA 3STHA 3T7AA 1YR3A 3TTXA 4RZUA 1WUYA 2I1LA 2GBCA 4H1HA 5EE1A 3ZE6A 1XXHE 1C7IA 3JQ9C 2IE8A 3M6FA 4F2WA 4FFSA 4ZHQF 2EJTA 5LBUA 4WEQA 4DNQA 4E6PA 2LKDA 3JATB 4E33A 4TL8A 3CVYA 3PDWA 1F5NA 2XUJA 3EVAA 2X9VA 4XIYA 5DHRA 3QVJA 5EMHA 2CJYA 5SZJA 1BJTA 1LX7A 3U13A 4ZQBA 4A0HA 4BNNA 1BIFA 4DB2A 1OZHA 4FMDB 3U60B 3CLKA 1ZGZA 3AKCA 1NW9B 5IS2A 4MGYR 5KVCA 3UK2A 2X1LA 3ELUA 2FVYA 3HWSA 3N9IA 4GP9A 5CT8A 4R4JA 4HB2A 3IEMA 2C2XA 1G5TA 4Q82A 2EJWA 1NRXA 1S2MA 3AKEA 3IIJA 2JI4A 4H27A 3DT9A 4IKOA 4KXLA 4MW2A 4K88A 4EHNA 1XZPA 5C18A 3ERCA 2X0JA 4RY0A 4YQFA 1AKQA 2XRZA 1JZQA 3QMVA 1L7PA 2PDAA 4JJ6A 4V3CA 4ZTUB 2QF7A 3H1AA 3SHTA 4FXOA 3JATA 3CNBA 4HADA 3PTAA 3ANTA 3I73A 5HIAA 4HI0E 5IAGA 2DWQA 1HX7A 4LCEA 1JJAA 3CHYA 4D8XA 4BO6A 3HU1A 3DPSA 4A6XA 1G5QA 1Z6GA 4ZRDA 2IV2X 1CUXA 1GQOA 3UHAA 2OYSA 2CVQA 3DTVD 3TSAA 1UK8A 1PQYA 5CD9A 5JAHA 5EHNA 3BE4A 1GQQA 2N9UA 1PI3A 3LKZA 2N47A 1EGMB 3RWBA 2HF8A 4B48A 4KX3A 5C1PA 4HEA6 3ACDA 1J8FA 3T9CA 3X2EA 3AI1A 4B43A 5LQKA 3L8GA 2YV3A 1NOIA 2JHGA 3TAUA 3UQZA 2WAYA 4U7WA 2VJOA 3PVSA 1FNNA 3AEYA 3W3AA 4YNBA 3V97A 2E6UX 2XAUA 3IALA 1YFKA 2VDLB 1S3IA 2YUTA 5IBRA 4LGCA 1MTZA 3BD9A 4U0KA 2GHIA 1KFCB 3BVPA 3CLRC 4G4SO 1W5EA 3HACA 1H2ZA 3N2NA 5C0OE 3WR5A 1JS1X 4LFAB 3D6NB 3HH8A 4V0OA 2NOAA 1UKBA 3RYIB 3G5UA 1V8ZA 1DJNA 3HA3A 3L0CA 4BVHA 2X2PA 3CUWA 3BK2A 5LL6P 2VT7A 1CUEA 1NGSA 3AL3A 3HUDA 3KYBA 1QGDA 2GLUA 1SKQA 4WJZA 4XOIA 1XNRB 2I0FA 3GWGA 3KOUA 4QHTA 2JKVA 2IRWA 3A3PA 5CH3A 4G9EA 4CCSA 4ANFA 3R6DA 2CYCA 4XUEA 2MTBA 1W0JA 1XRRA 4O4IB 2CJFA 1DKQA 5AW6A 2PKEA 2WP8J 4LFCB 4B35A 2A0XA 3V48A 3I3SR 4EI9A 1CUIA 1X70A 4WOJA 5TS2A 3HS3A 5DASA 4ZYTA 2B34A 3I5UA 2AN9A 2Z57A 3OCXA 4FOPA 3RYIA 3K0SA 2XCOA 4FW9A 2I3GA 1TMGE 1P4GA 3KT3A 4UD6A 3NYIA 3WNZA 1VTKA 4URVR 1LB1B 1I2BA 2ECFA 5E7MA 4MUNA 2BMVA 3SIWA 2DLDA 3UV6A 4J16A 1I33A 2BR4A 1DKOA 1LPMA 3CG0A 4FCCA 1KVTA 2FVXA 4IKPA 4R3WA 2Y66A 4NZMA 3SBXA 4CLHA 4EJMA 2JFZA 4RVSA 3IO5A 1GA1A 5DM70 4HWTA 4O4IA 1QF9A 3AXTA 3PF8A 4EX7A 1TNDA 1R00A 4OEHA 3TW8B 4FC7A 4H7IA 2A0FA 5KPJA 1X1BA 2CMDA 3TCKA 3IJEB 1TEVA 3G7NA 4AO6A 3RI3A 4WY2A 5JEDA 1UK9A 1U7ZA 1C3XA 1I3CA 3IUPA 4PTYA 4K6GA 1XNGA 1ZUHA 5HNKA 2XTJA 4HAOA 1O6BA 1AF4A 3W1VA 3GNTA 2AR9A 4YI5A 1L9XA 5ECDA 1ZC3A 2XWBF 4QGFA 5DCUA 2RGYA 2XECA 1JP7A 3PQ2A 3SZGA 5D00A 5AESA 2MT9A 1RCUA 3THOA 2QS9A 5M04A 2VZ0A 1PT8A 3PEYA 4MIYA 1Y6QA 2P62A 3EXHC 5DYGA 2R2AA 1N4DA 4P54A 1RHMA 1SK8A 2V1UA 3SZLA 4ZPJA 5C8XA 3TW8A 5ES3A 3BD7A 2Z9CA 4AYWA 4EB6B 2Q0QA 4PSUA 3N28A 2QMYA 4KGZA 4BJ5A 1IDOA 1G5HA 3ND8A 1W0JD 2AC2A 2HF9A 4NV1A 3L7MA 1YR7A 3P9QA 3A1WA 4QUEA 2PR7A 1H6DA 2AOTB 2C2YA 2R86A 2O3QA 5LQSA 5TQ0B 4OQXA 2ANCA 5KUTA 5K0JA 2C0QA 2GM9A 3ZUPA 3WSTA 3FOBA 5JS6A 2AD1A 4QPDA 3G0HA 5C7YA 2RAPA 3IAS6 5I7OA 3KJGA 1KI6B 1HMPA 3STWA 3WWZA 3W2FA 3C4JA 2IEIA 2QVBA 3I9JA 4GRIA 4P83A 3UVEA 2GEDA 5I8ZA 1A95A 1W5SA 2V96A 1JDTA 4OLFA 2AJDA 4EB6A 1XWWA 5FFFA 2E4VA 3C7TA 5ER9A 1UL1X 3AZPA 5HQTA 3ELBA 1T5SA 4WDQA 1K75A 2IC5A 5TXGA 4HNVA 4QELA 1P17A 1NSFA 1VPWA 2PMDA 2XQKA 1M5UA 1N7JA 1A5SB 3EFBA 4UBIA 3C8HA 3G2OA 5AI6A 2HKIA 1ZU4A 5H3HA 5TQ0A 3U48A 5JYDA 1L5SA 1RJFA 4ZO4A 4RWEA 3PX7A 1QTNA 2C29D 3GJ5A 3MT8A 4UVDA 2PA3A 2W2OA 2FR0A 2WU1A 2HK7A 1KQGA 5LCXA 3L7AA 2HRRA 3MWEB 3MXOA 5COQA 1E9AA 4BZQA 1D1SA 4Q4CA 5LKRA 1MKYA 2MSWA 1YE5A 3I12A 3WJ2A 1KI6A 4JIMA 4EIWA 4EFDA 2L17A 4AX4A 1USKA 3C6MA 5T4EA 1FP2A 4BMNA 5KYGA 4DIBA 4X6YA 1ESZA 3ILSA 2D5LA 4ETIA 1L4FA 1HLDA 1RJ9B 2NXWA 1Z0IA 3N8GA 1A9XB 4ND1A 2P3LA 1Q7CA 4QGAA 4TV9B 4XQGA 4YDSA 2NPOA 2A0KA 4GMKA 4GXNA 1PJSA 3FW1A 1E99A 1Y3AA 2O2IA 3EVNA 2WPDA 3SHVA 3JALB 5C32A 3PCRB 5LB4A 3WSWA 5LWHA 1K6EA 1MGOA 3OOSA 3AF4A 5ALTA 1K8ZB 2BDTA 3KD3A 1VRWA 3NUZA 4NCHA 2RH5A 5ALRA 1JAXA 1USGA 4G5RA 4EENA 2C3UA 3MWEA 4HYQA 3GEMA 3WY9A 2X5NA 1K8XB 4HXEB 3FMPB 1NR1A 1JQ5A 1FEZA 3BUSA 4PQYA 2OFXA 4WK4B 2XCQA 3DR3A 4WFQA 2OLJA 3Q1KA 2ZCJA 5A9TA 4DGSA 4K2HA 1TQ4A 2ISCA 1VLMA 3R74A 2PYIA 2ZR0A 1FW8A 1F0KA 1RJ9A 4R69A 1JEYB 1KSJA 3CIOA 2GM3A 2I2FA 4HDNB 4LJLA 4TV9A 2HHJA 3T34A 1A9XA 1ECFA 1DARA 2ZUEA 5JSZB 1XO1A 1U3FA 4CFSA 5LPNA 2JBWA 4MVJI 3JALA 2ODEA 2O5RA 2WMOB 4A26A 3A6PC 4KUHA 4BL5A 3MUEA 5EJIA 4EGQA 2XBMA 1X74A 3FYSA 2EQBA 4Y2HA 1RM4A 3B6KA 3D2BA 1IWPB 4P4NA 3QVTA 3IBSA 4NK5A 1Q20A 3GARA 3ZJYA 4HXYA 3A4LA 1QKKA 5KTNA 3C5WP 2WHYA 5F1KA 5I9MA 1B1CA 1UBMS 4NULA 2Y0EA 2R6AA 4IQ8A 3ZCRA 1UF9A 2FW7A 4OI2A 5E2AA 4BNXA 2R5FA 2ZS7A 4J29A 3FWNA 3O7MA 1JEYA 1EBFA 1QX3A 4HDNA 1BS9A 5F2OA 3IPLA 3NRJA 4JUBA 3EW9A 1LPBB 3O38A 5JSZA 4B73A 1QRRA 5DM4A 3FZYA 2CFSA 4PBSA 5AKYA 3W6PA 2RJNA 3JYHA 5KPDA 1QOPB 4DIEA 2Q7DA 3AIIA 2FAXA 4TQGA 3L01A 3V4VB 4MMZB 5BXYA 4G5SA 4IHJB 4RS4A 1MOQA 3U3JA 3AVQA 4YJGB 4DPLA 5EP1A 1HL3A 1JUDA 2CY0A 2WDZA 4B6SA 5EMMA 2KLHA 4B75A 3KOXA 2FPXA 3B89A 3RKUA 4JL5A 3L8HA 2WPDD 3L0DA 3NT4A 5DNVA 4ZJPA 4PNEA 4A6PA 1F6DA 3LRPA 1JLKA 3ZNQA 1T2NA 4O02B 4DKJA 2WM9B 1W7AA 1FJHA 2DUWA 2KM1A 4HGOA 1JAZA 4NE2A 1L5ZA 1Z7GA 1HDYA 2WFAA 3GBVA 5J1TB 3DNMA 4JCCA 3RD5A 2OCKA 2PBZA 2ORYA 5E7IA 5B4TA 1VL0A 2AMYA 3GJ8A 4OGLA 3SFVA 1DUSA 4CEIB 3D5TA 2P5SA 5DIZA 1WO8A 3AONB 4YCMA 2JD0A 3AXSA 4U2CA 5HWSA 3B3GA 4RD2A 5HZKA 4IHJA 5I51A 1Z35A 2MYTA 4I1IA 4C76A 4YJGA 2QEQA 2B92A 1UQTA 3DE3X 1M66A 1I24A 4GM1A 3NXKA 4S35A 3I6QA 3M5CA 4L15A 2FCRA 3OOWA 5GM1A 3C5EA 2B5WA 4OMUA 2NYUA 1L7NA 3W5HA 4MQ5A 1LBIA 4Z1OA 4DCCA 5IT0A 4BVBA 3X1ZA 2ZRCA 1PDVA 2WUFA 1W1IA 4B8YA 4L74A 4R40A 2BFEB 2GK7A 1D1PA 1YK0A 4H0CA 3I3OA 2CZGA 1UPBA 4EJ2A 4JEHA 2QPOA 1JQKA 2GAAA 3LI2A 3GX1A 4B3BA 3D8BA 1CKEA 1X8KA 1GUDA 1Z5NA 3SFTA 4EABA 4F8YA 4J0CA 3GAZA 1UXGA 3QV2A 1ZWKA 1KK0A 2A33A 2Q0SA 4RWZA 3QVUA 1T6XA 4FEEA 4B6FA 2GT1A 2H4WA 1MT0A 2HREA 3HUFA 4KE9A 4CDGA 4LTDA 1XAGA 3FMVA 1WXWA 5JHGB 2DH6A 3D8UA 3M1AA 2PO7A 3MIZA 4PC2A 1E62A 3A28A 4XFDA 4YJ3B 1PSZA 2JH3A 3HVHA 4ZCPA 3RDPA 2NMVA 4E15A 2QX7A 3ZDXB 3E7DA 1XMOB 3RIMA 4NJEB 2B5OA 1JDVA 3D3NA 4HWPA 3O92A 3BXGA 4UASA 1S7GA 2PTGA 2BFEA 1KF0A 3V8MA 2E4YA 2ZAMA 4DIOA 3LKVA 3T1NA 5F23A 2C4NA 1QP4A 1E1NA 4QUJA 4QTXA 2FNAA 4BLTA 4JP1A 1E3LA 1Z73A 1AV7A 1DMRA 2B4QA 4HQLA 4EHJA 3M70A 4G97A 1DRUA 1E61A 1BMTA 1J23A 1FU7A 1II9A 1P0FA 1V8PA 1YIDA 1Z82A 4RA9B 3VPBA 1K27A 2JKYA 4WBSA 4IGFA 2JRLA 2O6LA 2FK8A 1SCUB 1AUVA 3H2BA 4MWBA 2AX4A 1Q50A 3E82A 5GADl 1NM5A 2WUEA 1J8DA 3H16A 4TL9A 3HRKA 4YJ3A 3IVRA 2W6OA 4AG3A 1VYHA 1UBJS 4EGJA 3ICCA 4L9WA 4NJEA 2IIPA 2JNWA 4R2IA 3ODPA 3ED1A 2QUKA 1XDBA 2XQGA 2BFWA 2X8AA 2V7PA 3VDMA 2HRCA 3UWDA 2IBTA 2F8TA 3FWPA 1XJCA 4IXWA 1TJ3A 3RS8A 2HWWA 4UDYX 2FSPA 421PA 4ZO9A 2NUPB 4RA9A 5CH8A 4E5PA 3VJKA 1USUA 3NM6B 4JVMA 2DKFA 2OV4A 1W5FA 1NXXA 2JB9A 2ECKA 5HBRA 1X9IA 1SCUA 3GD7A 4KNWA 4INPA 4PPYA 2HQRA 4LDNA 1PQWA 2XRYA 5DGIA 2IIBA 2PUFA 3RROA 2ERCA 2O4CA 3SC4A 3TVYA 1EGAA 4ZO6A 1V8FA 5CNKA 2E5FA 4M0DA 4AP6A 3A6KA 5CD1A 1ZQ9A 2HHAA 4R8SA 1GGKA 1PFKA 4CT0A 2G06A 4OVKA 4UUPA 3JQ7B 5ALDA 1RRGA 3H1PA 4IJVA 5EIBC 1HDIA 3OLVA 3BRSA 5IEJA 3L4SO 2XD4A 3JZDA 4KQXA 4NPAA 2HB6A 3U49A 2J07A 2NUPA 2XWPA 1UC8A 3AY6A 4MEAA 2AW3A 3C5HA 3K4QA 1XMPA 3ZCSA 2RGRA 3OOYA 1XXHB 4MRNA 4OHMA 4ZVSA 4ARVA 4EBFA 1H2WA 5DWDA 1U7HA 5LIRA 3SQNA 5K0BA 3OEHD 2CXQA 1IVSA 1JI0A 2XVMA 5FJJA 1DU4A 4BBZA 3M5WA 2AQ8A 2IV3A 4KE6A 3M6MD 3ROGA 4CPDA 3V8RA 4OX9Y 1H42A 4MJ3A 5C5DA 3G6WA 2XUHA 4TZ0A 1PNVA 3A8TA 3FSGA 3W5JA 1TTPB 3M3DA 3A2MA 3EAQA 4MV6A 3NAZA 2C83A 4L16A 3NXSA 1ONBA 1J5PA 3IOBA 5DGXA 5AVJA 4DMUB 4WLOA 1P45A 5CDFE 1G16A 1OMOA 2ZIGA 4OLJA 1Y8RB 2EWMA 3H5LA 3JQ7A 4TYMA 3IDSA 3PKJA 1JV2B 1MHPA 1P31A 4NJOA 4JELA 4UDXX 1JQBA 2EKBA 3FCAA 2W0SA 4GYJA 1Z5UA 2WVAA 4ALLA 1SUEA 3F7TA 2MR5A 3R5FA 1XXHA 2OECA 3W1WA 5ITSA 1JBQA 4NU0A 2GPNA 1DC3A 2RHMA 3M81A 1EJ2A 1K6XA 1J56A 4GI7A 4GG1A 4H7PA 4V03A 4X7BA 3TQOA 1HZZA 2ZT6A 3LVRE 1N2XA 1DUIA 2C4TA 1QVWA 3CVOA 1PFUA 3L7OA 2ZYVX 1UMDB 2QZPA 1PT5A 1XMXA 3UH1A 3V32A 4CLDA 3FZQA 4EKGA 4UOEA 5FWNA 2DEUA 1K6JA 4NBTA 3AVPA 1A4RA 4HRXA 5JSQA 4Y6PA 4II2A 4B47A 4OSPA 1ZLXA 1L4EA 1QNLA 4DJFC 4EKEA 1IK6A 2OFOA 3AUSA 7MDHA 2PEYA 4Q9AA 1E98A 2D0PB 2ZAIA 3FJ1A 4N9QA 2PU5A 1Y8RA 4X8LA 1O1YA 2GVDC 3E9YA 5AHKA 4JC0A 2ODAA 4ALNA 4G24A 4AN4A 3HU3A 4IFBA 3QX3A 4KXMA 3TR0A 5K4HA 3ZKWB 3HP7A 3ONFA 3VC7A 1YHZA 2FMUA 4QBFA 1JXOA 3IQDB 4IDHA 3T9FA 4HMOA 1ZOLA 2DBQA 4PHCA 2CUNA 3PPIA 3I2KA 3LCUA 4L5AA 4WHMA 5F3RA 5JD5A 3DCYA 4GZ5A 4BGEA 3KB8A 1UMDA 3AUXA 1YQTA 2B35A 4G1MB 4LRQA 5ELLA 3KSAC 2M6RA 1DPGA 4NAVA 4BLQA 4P82A 1WNFA 2XTZA 3NNDA 4AECA 2ZUBA 1R0SA 1XZMA 3R9KA 3JXEA 1WZUA 2Q4DA 3FR8A 4YIKA 1MVNA 1GVHA 3V8VA 5IC4A 4NOMA 3ULKA 3ROEA 3DA8A 1KZ4A 3AUFA 5EOVA 5IM5A 3O1IC 4RESA 4JQSA 1N0HA 3GJQA 1X7ZB 5EIAA 4NOLA 3ZKWA 4EDFA 5TLSA 5G0UA 3LX5A 4QYWA 5I9LA 3FSGD 1G6HA 4YHHB 3AESB 3JVVA 1U8EA 3O8DA 1CRWG 2IYQA 2QRNA 3E05A 2ILTA 1T9CA 2E55A 3LT1A 3TR6A 5KKCA 4JS0A 3DDHA 2JD2A 3CN7A 4GDFA 1XQ9A 2OBYA 3EGDB 3G0OA 1N5IA 1I6MA 2GEFA 3DWGA 4WOKA 1GKKA 3C85A 3CF4A 5C81A 4I46A 3TIGA 3WGUA 4EOGA 1ZD2P 4JJ8A 3CV3A 3IC5A 5FX2A 2AMFA 3FUCA 3K1TA 2IIVA 4RZHA 2VG8A 3PR2B 3BS4A 1ENYA 2WHQA 2WTXA 2QROA 3NASA 3ELYA 4LTMA 5FR2A 3ZLVA 1XRLA 4BPRA 5IX8A 3Q7IA 1F8GA 1XCLA 3W06A 1JAYA 1L5QA 1P8JA 1X7ZA 4DOMA 4GWLA 2QJFA 3IO3A 3M5DA 3OU6A 3TEMA 2QRHA 4AKIA 3AESA 3AUTA 4EHFA 2RGNC 2DQKA 3RTDA 5A7GA