4DMFA

Crystal structure of the cftr inhibitory factor cif with the h177a mutation
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
293
structure length
293
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWAFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibiting an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa Protects CFTR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Putative hydrolase
total genus 111
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dmfA01
2OGZA 3I6YA 1FFEA 3WMRA 5JAOA 4W9RA 2VAXA 3KOOA 2YXPX 4DYHA 1WPRA 4K5QA 1EH5A 4HZGA 1QONA 2QVBA 3O9MA 5C8ZA 4OB7A 5JATA 2QZPA 2WHRA 5AH0A 2BUAA 5AM2A 2PL5A 1W76A 2WTMA 1O6FA 1XQXA 1G5FA 3FLEA 4AO6A 3K2IA 5I8PA 5ALMA 4XWGA 4G8BA 3GBSA 2XUAA 1TAHA 3AFIA 4MEAA 2BKLA 2OGTA 3I6ZA 4KE8A 4E46A 4P9NA 4DTCA 3WK6A 5CXUA 3D3NA 4GLBA 2QXUA 4HVTA 1N1MA 4MYDA 1C7JA 1H2YA 2OLEA 3OG9A 2QUBA 2CMFA 4B7ZA 2OAEA 4ARBA 1ODSA 5AKHA 5T4BA 1ORVA 3ZV7A 3BDIA 4ZV7A 1CUHA 4PSUA 5ALEA 5IKXA 2QUAA 4I4CA 4DM7A 2HU5A 1VJ5A 4U2CA 1S8OA 2C5GA 3ED1A 3AUKA 3QBJA 3VVMA 5DJ5A 1MU0A 1B41A 1W52X 3C6YA 2VT6A 5CT6A 5AI0A 2WQZA 1E3QA 2G5TA 3A2LA 1LPBB 2Y2UA 4H7EA 1XFDA 3RLIA 1BN6A 1QIEA 5JZ9A 4ITVA 4RPCA 4BAZA 4DNFA 4AO8A 3IUQA 5EGNA 2XUDA 1EB8A 3A2NA 1ZI8A 4Z49A 3R3XA 2ZSHA 2RHTA 3DOHA 1CUEA 1XQVA 1PV1A 1TIBA 2JGLA 3O4HA 2C0QA 2BCEA 4IH4A 3C6ZA 1UK8A 1BS9A 3N0TA 1CQZA 4UHBA 2HRQA 5LZ5A 4EY7A 5D7BA 2O7VA 4D9JA 3MGAA 2GBCA 3L1HA 3O4GA 4INZA 2H7YA 1AKNA 3L1JA 4H0CA 5AK3A 5ALFA 2ZJ6A 3YASA 1ACJA 2PU7A 3GZJA 1E8MA 3G0CA 4IQ4A 1QO7A 4DSAA 1G42A 2FX5A 3R3UA 4BAUA 4X90A 4B0OA 4QEKA 3K6KA 1BU8A 5T4HA 3E0XA 1GKLA 2PSFA 2ACKA 1MX1A 4XX1A 4UBMA 3B5EA 5KREA 4BZWA 3C45A 3H2GA 3NWOA 1DWPA 3ESCA 3CXUA 5HQ3A 5ALXA 4U2DA 2HA0A 3ILSA 4X6YA 4UHHA 3CN7A 5DNVA 1UZAA 2VATA 1W75A 4O08A 1R9NA 1XRNA 3HRHA 4LXHA 3W06A 1CUWA 5ALDA 2YYSA 2EEPA 3WZMA 3FSGA 5SYNA 1QIFA 4QWWA 4BP9A 3FCYA 3FVRA 5EIEA 2AXEA 3H0CA 3B3QA 2QRUA 2PUHA 3WZLA 4FBMA 3CN9A 4GHWA 3R40A 3A70A 1R1DA 3VISA 1Q0RA 4UUQA 1THTA 3EF3A 1LGYA 2Z5GA 1XZBA 3TGLA 1XLWA 4UBOA 3RKSA 3UUEA 4AZ3A 1CR6A 1P0IA 4FNMA 2W6CX 4UBLA 3PFCA 1JU4A 2XMQA 3GUUA 2WHPA 2XLBA 4HXEB 2P8SA 3DD5A 4HAIA 2XI4A 3IURA 4L72A 3AINA 1DWQA 1SFRA 2HM7A 3HI4A 4FHZA 4KACA 2XUJA 2HA3A 1XRMA 1YS2X 4JEIA 2G63A 5AP9A 5ALZA 3F8SA 5K5EA 1XZGA 2AJDA 1VOTA 1MAAA 3QPAA 1ZD5A 4OU5A 5C7YA 3W9BA 5C81A 1SOMA 1VZ3A 4AQDA 2XQKA 3EIOA 2QJRA 4KRXA 2VEOA 3O9VA 1R88A 2WTNA 5ALKA 3FBWA 1X2BA 3WK9A 3I1IA 5AI9A 1UT6A 2GBGA 4AXBA 2WIJA 3V1NA 4BB0A 2AJ8A 1DTEA 2WU3A 4X97A 1L7QA 1FSSA 1QIHA 5AKJA 3STWA 3VJMA 4X6UA 4UHDA 5KWJA 1AX9A 3BE8A 4LHEA 4JYMA 2JEZA 1TK3A 2QXTA 3ZWQA 4Y2YA 1DWOA 1MX9A 2XB6A 3R41A 2CUTA 2XT0A 4RE5A 2UZ0A 3DJYA 2XQIA 1YA8A 4CG3A 4FNGA 1TCAA 1ZI6A 1K5PA 5CT5A 2WUFA 5D6OA 1TKRA 4GDMA 1EX9A 4YASA 3KSRA 2CB9A 3ANSA 3FSGD 1CUAA 5EHQA 4KAFA 2XMDA 1W6RA 2VQ6A 4IH1A 2VJCA 5DTIA 3LS2A 5AM5A 3ZLVA 2XMBA 5E4TA 2PKYX 4GXNA 5AI5A 2B61A 3ANTA 3E4DA 2B4KA 4BBZA 3FOBA 5DTJA 4NS4A 3H1AA 1QFMA 1QIIA 5AK5A 3M3DA 5HF9A 5LIPA 1ORWA 4BVJA 4W63A 1AC5A 3FYUB 2AJBA 3BF7A 2G4LA 1XZIA 1XZMA 3JW8A 5ALTA 3WYNA 3BJMA 7YASA 1H23A 1TRHA 1LPNA 3BIXA 3R3VA 1T2NA 3WA7A 3HZOA 4V2IA 1FFCA 4Q1VA 2WUGA 1XZDA 3H2KA 3WJ1A 4UFNA 1CUXA 2RONA 4LXGA 2K2QB 4CIAA 5K3CA 1RP1A 5K3DA 4BVKA 2XUGA 3AIOA 4A16A 4DMHA 2Q0XA 1CUJA 5C8XA 5AM3A 3STVA 4Y2TA 4GI1A 4CI9A 1QE3A 3M82A 4J0IA 2HFKA 4H7HA 4TVKA 1F0PA 2X5XA 1LZLA 4OU4A 2YASA 1F6WA 1N5MA 2OXEA 5A7FA 1XRLA 2JF0A 1QTRA 3WL7A 4J03A 5BV7A 3R3WA 1IUOA 4GWLA 4G9GA 4BP8A 4B0PA 2ECFA 3G02A 5DYWA 4J0GA 4BRZA 2WFLA 2BGRA 4Y2RA 5KBYA 4MXDA 1GZ7A 4B85A 2VJAA 4OPMA 3H2JA 1JI3A 2PSDA 3AZOA 1L7AA 4H7IA 2D5LA 4CFSA 3OM8A 3OC0A 1ETHA 1CRLA 4MJ3A 2XMSA 1LLFA 1FFBA 2WJ4A 4XVCA 4QLAA 2JGIA 3VKFA 2J3DA 3HXKA 3G0GA 4HS9A 1CQWA 1N8SA 5JALA 3BJRA 4EY6A 5CT8A 4DMKA 1ZJ5A 1XQWA 2J4CA 5BOVA 4ZGBA 4QDZA 1SCKA 1QZ3A 3JYHA 3FNBA 3WWOA 4TGLA 2Z3WA 4OUKX 2HA5A 1AZWA 3M83A 2XDWA 1KU6A 1QIKA 1WHSA 2FJ0A 2Y6UA 3QZUA 5JD5A 3EBLA 3H17A 1YSCA 2WFZA 1AURA 2HL6A 4BZZA 5D3ZA 1CEXA 2ZYHA 4C4XA 2QJWA 4J3JA 1EDDA 1YS1X 3IBTA 4H18A 4H7KA 3STUA 4BATA 2I3ZA 3N2ZB 3D2BA 4BTLA 3HJUA 1USWA 5LKAA 1WM1A 3EQ7A 1EDEA 1J06A 4UBKA 2ZYRA 4KRYA 3MVEA 3W9UA 2PPLA 4KJXA 1CFJA 2IITA 3DYVA 1P0MA 4EY4A 1H2XA 1CUIA 4LKOA 3DYIA 3R3ZA 3T4UA 3WIBA 3MUNA 5FKJA 1J2EA 1MAHA 2OQIA 1THGA 3U1TA 1E66A 1T4MA 2Y6VA 4QZVA 3OPMA 3O4IA 2GYWA 2XQFA 4BE4A 5EHZA 3HEAA 4G8CA 4UFPA 1XKLA 2HFJA 1CUCA 2RIPA 2LIPA 2XUFA 4X95A 4YK7A 4FLMA 4B9AA 1CUVA 1XZEA 2GZSA 1BCRA 4ETWA 5HKAA 5AKKA 2JIDA 1QLWA 4DGQA 5IVDA 2AJCA 4X92A 6YASA 2HU8A 4KE6A 1WOMA 3PI6A 5AOCA 4B6GA 5LZ9A 3ZLTA 1XZJA 4K6KA 4K6HA 1NX9A 1U4NA 3AIMA 4EBBA 1QGED 1TCBA 4W1SA 5C8VA 1CUZA 3UMJA 2HRRA 4MEBA 3QH4A 3PF8A 2XUIA 3PFBA 2HADA 1F0NA 3LP5A 4Y2XA 1UXOA 4CG2A 3WQHA 2XMGA 3F97A 4HTAA 4G5XA 4ZRDA 4AB1A 5HCUA 4KAAA 1FFDA 1KEZA 5DWDA 3WWCA 1QTIA 4M0FA 3CCBA 5FV4A 3D59A 2JEYA 1NU8A 5AI6A 3RK4A 3G9UA 3QITA 1F8UA 5FOQA 4GW3A 3STTA 2HDWA 1UK9A 3F96A 1AUOA 1BE0A 5KWIA 2O2HA 1IZ8A 1R4ZA 5JIBA 5IVHA 2WU4A 2BFNA 1HKHA 1O6GA 2Z3ZA 3ESDA 3IUNA 5AKYA 4IHAA 1IUNA 2ES4A 3D5EA 5CH5A 1Q84A 1IUPA 4H35A 5HF6A 3IUMA 5JZSA 1EA5A 3C70A 2R11A 2BUCA 1BROA 2VA9A 1BN7A 3ICWA 4J0HA 2I03A 2ACEA 2DQYA 1W4LA 4JYPA 3DKKA 4ARAA 3BDVA 3WL6A 1R3DA 2OCGA 2X8BA 4UBIA 2QR5A 5JANA 4MYSA 1YAJA 4DSZA 1TCCA 1K6EA 5FLKA 1XZCA 5YASA 4G4GA 1QFSA 4DNQA 4OCZA 4QA9A 3S2ZA 3G0DA 1P0QA 1YB7A 4G9EA 4RE6A 5JZBA 1U8EA 2VTVA 4EY5A 3QM1A 5AK6A 2QM0A 5ISMA 3AILA 5LKRA 4IH9A 2GZRA 5LZ2A 2J3QA 5JADA 4AO7A 3F9CA 3VDXA 3RARA 5A2GA 1XROA 4AMYA 3BF8A 2VSQA 3C5VA 3H19A 5K3FB 4L0CA 1CUGA 3I2GA 1Y7HA 5LZ8A 1U2EA 5ALOA 3QYJA 4B82A 1CUSA 4M0MA 5AKGA 5IH7A 4H77A 1AGYA 5ALQA 4C4ZA 1MO2A 2WLSA 3I2JA 5ESRA 2GYUA 3I2HA 3WA6A 3V1MA 3C87A 4DMFA 2DCMA 1LPAB 2V97A 5EFZA 3BL8A 3PUIA 1YASA 4L9AA 3DLTA 2OCLA 4WY5A 4DIUA 4U2FA 1UWCA 4Y9SA 4MWSA 2BGNA 1EK2A 1IZ7A 4BDTA 4FLEA 4F21A 2WG0A 5E2IA 2QKYA 1RWQA 4E15A 5AKEA 4W1RA 4N8EA 4OSEA 4J0CA 4KEAA 4MWTA 3NGMA 1OCEA 5I9IA 3UUFA 1ZD2P 3WK7A 3DCNA 4A5SA 4Y2SA 4CCWA 3HACA 4X6XA 3FAKA 4B81A 1A8SA 4RGYA 2XUQA 4EZIA 3S8YA 2WSLA 3FYTA 3DKRA 5D3KA 3E3AA 1YB6A 4JUIA 1YR2A 2WHQA 4KE7A 2CZQA 2PU5A 3WKCA 1MNAA 5LP1A 1XLVA 2ZJFA 2QTBA 1MTZA 2GBFA 1XZKA 5HZGA 2HA2A 1BCSA 2O2GA 2V98A 3D0KA 3AZPA 5ALNA 2VJBA 5A62A 3WIOA 1LZKA 2XLCA 2I78A 4KYVA 3K9BA 4Q82A 5IVKA 2DHCA 2ZYIA 3FVTA 1LPPA 1K4YA 4UHCA 1LNSA 1PJAA 4DNPA 4DLNA 2XMRA 4C6HA 3FLBA 3M81A 3SC2A 3IULA 2CJPA 3H2IA 2G5PA 4BYMA 1H2WA 5AOBA 1P0PA 1TQHA 2QOEA 3WKAA 4UHFA 3O4JA 2ZSIA 1UK6A 1DINA 5I7UA 5T4FA 1U65A 5AKIA 1UKCA 2DSNA 1VE6A 3WYDA 2RGUA 4CIBA 5FRDA 4C4YA 1YAHA 5ALUA 3G9XA 2ZYSA 3I2KA 4BE9A 5DLPA 4X7BA 3WI7A 3DOIA 1HDEA 2D0DA 4Q05A 4GEGA 1CUDA 5CT4A 5AKZA 1YCDA 5EIHA 4KR0A 3C6BA 1XZFA 5AI8A 5F4ZA 4C01A 4W1PA 1KU0A 2VJDA 1K63A 1IVYA 1X2EA 2PVSA 3GFFA 4KAJA 1GQSA 5JASA 4WDQA 3AIKA 3I28A 4AZ0A 2VAVA 1A8QA 1WB6A 1AMNA 5SYMA 2QT9A 1FJ2A 4B9EA 3I2FA 3WKDA 2CBGA 1EDBA 2BAGA 5HF8A 3PF9A 4FLFA 2VT7A 1SCQA 3V9AA 4N5HX 1ISPA 1X70A 1XRPA 4WDRA 2JGMA 2WUEA 1CUBA 3ZI7A 2QMQA 1DQZA 4ZWNA 4PV7A 1H22A 2CEKA 4ZXFA 3GELA 4EY8A 1JFRA 3WK4A 3DS8A 1D07A 3LIIA 1PFQA 4BC0A 3I1YA 3FWHA 4BCDA 4IO0A 2C58A 3KWJA 5LYYA 1VE7A 1YA4A 4HXGA 4Q34A 3QVMA 1LPSA 1EI9A 1JJFA 2HU7A 3BXPA 3H1BA 4NZZA 5CURA 5LZ7A 5ALYA 2JGJA 3WKEA 5AKLA 4QDOA 1GGVA 2H9YA 1E8DA 1VXRA 4E11A 2R8BA 2OPHA 3QMVA 5AICA 5AI4A 4FBLA 1EVQA 4XIIA 2ZJ7A 4Y2VA 4E14A 1EB9A 3DL4A 3NUZA 4U2BA 4WFJA 3W04A 5T4EA 3WWPA 1GPNA 3F98A 3ZLUA 5CT9A 2HA7A 2H7CA 1XZLA 2OCIA 3WWEA 3H18A 2DQZA 1GPKA 4P92A 4P93A 3WL8A 1B6GA 1HQDA 1W1IA 5BWCA 5ALVA 4DMCA 2DHDA 3OTQA 2NW6A 2PBLA 3TJMA 3HC7A 3IDAA 4X00A 3RM3A 5CTAA 4C89A 4LYDA 3OOSA 3PDCA 4X94A 1GKKA 4U2EA 5K3FA 1DT5A 2FUKA 4QLOA 3D7RA 1WPXA 1RYYA 2XUPA 2Z8XA 4MQLA 2PM8A 1MPXA 4RNCA 3CCCA 2EDCA 1VA5A 4QNNA 5FPQA 3G0BA 5AO9A 4BDSA 4GECA 4NVRA 5CH8A 5AOAA 4H7DA 3IVMA 1CUUA 3WWDA 4FFVA 4C87A 4FFWA 5EHXA 5JAUA 1CIJA 5A7HA 2PSJA 2WILA 4G1FA 4N8DA 5ALLA 1IMJA 3PICA 1HL7A 1OXMA 4PW0A 3R3YA 1DX6A 4U2GA 4B80A 1ZOIA 4UFOA 3W2TA 3C43A 1DU4A 3AJAA 5H3HA 4Q3KA 1J07A 4C88A 5JD4A 5JAHA 3HYSA 2PX6A 3EQ9A 1WHTA 1GXSA 1Q83A 4YPVA 3L1IA 2DFPA 4OYYA 5K3EA 1CUFA 4ROTA 4WFIA 4AN0A 2WJ6A 5AM0A 1VLQA 2XQJA 1DQYA 1BEZA 5E4JA 1QIDA 3F67A 5AHXA 2WFMA 3PUHA 4UBNA 3T52A 2WG1A 3IB3A 4GBGA 1LBSA 3DQZA 2JGEA 1XRQA 4F0JA 2IIVA 2EDAA 4HRXA 1LBTA 4ZREA 4QE3A 1L7RA 4UHEA 4N5IX 1I6WA 4BRSA 4Y2PA 4Y2QA 3SK0A 4AX4A 4BCCA 2BJHA 4JNCA 3PE6A 2OQVA 4S0XA 2JBWA 3V1LA 3WLAA 4PF1A 2DHEA 5A71A 2V96A 5LZ4A 2WJ3A 2Z8ZA 4OB8A 4X85A 1MT3A 3WK5A 4KE9A 1QOZA 4BAGA 4X91A 1ZGCA 2XUOA 5K3AA 1E89A 3R0VA 2XUHA 4WY8A 2WHPB 1WB4A 5HFNA 3KDAA 2H1IA 4G8DA 4PO3X 1XLUA 5ALHA 1WCYA 4UPDA 1A88A 2QS9A 4BTVA 3TEJA 1QIMA 1EK1A 1ZIXA 1UOQA 3AZQA 3FLAA 2WKWA 4LIPD 3HSSA 2PSHA 3C8HA 4EA6A 4QWMA 3STXA 1LPMA 1QJ4A 2VF2A 4J0DA 5EIAA 5HF5A 1LPOA 1K8QA 4WFKA 4BCBA 1EHYA 1UK7A 3ICVA 3FYUC 3D2AA 1ODTC 3OURA 2ROQA 5ALWA 2B20A 1UOPA 1JKMA 2Y2VA 1GQRA 1BEEA 1A7UA 1EINA 1M33A 2WUDA 4TPKA 5IVIA 4EHBA 1JMYA 2JGFA 2E3JA 5ALRA 2H7XA 4Y2UA 4PNZA 3G8YA 4J7AA 4FOLA 3QPDA 3C8DA 1XRRA 5AKXA 3STYA 5HQ3B 1JJBA 4XJVA 2RHWA 1CPYA 1H2ZA 4QDTA 3VVLA 4AMZA 2OGSA 4M0EA 3QPCA 2BUBA 4FWBA 4I19A 5DNWA 4FTWA 2I3DA 4DNOA 5A7GA 2RAUA 4B84A 1Q0ZA 1G4HA 2C4HA 5AM1A 3WKBA 2PSEA 2C0PA 1Y7IA 1XKTA 5ALJA 4G4JA 2ONCA 2WIDA 2HHAA 3MUOA 2B9VA 2GBIA 1HBJA 3KWFA 1ACLA 4EUSA 1QIJA 2WM2A 1ZIYA 1GPLA 3ESBA 1JJIA 5CH3A 3IA2A 4L3WA 4QDUA 5HFAA 5FUMA 4X3CA 2XE4A 2XUKA 3C5WP 4F60A 3X3HA 3SX4A 1HLGA 2ZVDA 3QMWA 1UOOA 3KXPA 4OD0A 1JT2A 5HK9A 1XZHA 3BIWA 2J4FA 3G7NA 1A8UA 1VXOA 5HKBA 5JARA 5JAPA 3IIIA 1NU6A 3WL5A 3H2HA 3LIPA 4WCVA 4X71A 1G66A 3JWEA 4W1QA 4NMWA 4BC1A 3I2IA 2XMCA 3LCRA 1MNQA 2C5FA 5DYTA 4X93A 5AJHA 1Z68A 3DDUA 3D4LA 4OB6A 4YX9A 4ZV9A 5JYCA 5J3JA 2WFLB 1EVEA 4Y2JA 4N8SA 1N5RA 1MN6A 5AK4A 5BWBA 3O95A 2CKMA 4AN1A 2DR0A 4FKBA 1DX4A 3G0IA 2WIKA 2IX9A 1VZ2A 3D2CA 3ZPXA 2GYVA 2XMZA 2RI6A 2FJPA 1QO9A 3TRDA 2HA4A 5JD6A 5AIAA 5CRIA 5CBKA 2OCKA 3IUJA 3VJLA 5ALPA 5E4YA 4K2AA 1QIGA 2C7BA 1XZAA 3HLKA 1VA4A 1ODCA 4HXFB 3GROA 3C6XA 2YH2A 3V48A 5CW2A 2HA6A 4I3FA 3O0DA 4UBJA 3DL7A 4JH0A 3V1KA 2W22A 5DYYA 2WIGA 5CMLA 4LYEA 1J1IA 1HPLA 4J0JA 4QDXA 1CLEA 3VJKA 2PUJA 3NOXA 3WK8A 5AM4A 2ORYA 5ALGA 1CUYA 4Q3OA 4FDMA 4H7FA 3B12A 4EB0A 2XQGA 1ZICA 2AJLI 4G4IA 4H7JA 1JMKC 1C7IA 4ZI5A 3G9TA 1CV2A 1JU3A 4FMPA 4A23A 1SC9A 2Y1KA 3KD2A 4PSDA 4Y7DA 3Q8WA 2HIHA 5LLSA 3DEAA 4PQEA 3QMMA 1ZGBA 3P2MA 5AIBA 3DNMA 4P08A 1XQYA 3E1GA 2O7RA 1VKHA 3VXKA 2OAGA 4OYLA 3GA7A 4PSCA 3FCXA 5FPPA 1ZI9A 3A6ZA 4K6GA 1WB5A 4LXIA 3G9ZA 1GT6A 3A2MA 1CVLA 5CXXA 1OILA 1E5TA 1UFOA 3ESAA 4MQMA 4WJLA 3EQ8A 5FXMA 1ZD4A 4BVLA 5K3BA 4F5ZA 5FDFA 5ALIA 1SCIA 3FYUA 2OG1A 5HK8A 5EHNA 1MJ5A 1DT3A 5EI5A 3I6MA 4J0KA 3WJ2A 1R50A 4CCYB 3LLCA 1UKBA 1BRTA 1C4XA 3SWWA 3HABA 1Y37A 2O2IA 5A6VA 3Q0TA 1ZJ4A 1UKAA 1AQLA 4CG1A 4Q3LA 2JGKA 4CCYA 1R9MA 3W05A 3U0VA 1MX5A 5FP0A 3H04A 3BWXA 2X76A 5ALSA 1E8NA 4B83A 5DNUA 2V9ZA 4HRYA 2WIFA 1ZD3A 1FFAA 1EXWA 2WG2A
chains in the Genus database with same CATH superfamily
1TOAA 3GWGA 2QD4A 1T9AA 2BM9A 4INOA 5EESA 3WDLA 1C3VA 1GQFA 3RFXA 2QYTA 3T1YB 4CLDA 5K0BA 4C7KA 4QC2A 2FQWA 5JEDA 1L8OA 1OFUA 2VDPB 3DDWA 4PHHA 5JS8A 4A15A 2YXPX 3JWHA 3ICEA 4DYHA 1EH5A 1KYVA 4Q4HB 2C42A 5K0LA 4HZGA 5TXGA 1SCUB 4JP1A 1YBHA 4IUCS 2HCRA 3B82A 4FMDB 1W30A 4QTZA 2Q3DA 3NJ4A 4G24A 1SHJA 3VHQA 5IDWA 1D04A 2BZ1A 4BMZA 1T6NA 4I99A 5TJHA 1QG0A 4CKBB 3T7IA 4BMVA 2DLCX 1LSUA 1RPTA 2O0MA 3EVAA 3K1JA 4Q24A 4KR9A 5AM2A 2WF7A 4NYMR 3RU9A 3QXCA 4XYEA 5LBIA 1UR5A 1AK2A 4OJKA 4XW2A 2Y0CA 3S4YA 2QTTA 5KO2A 5A4AA 1ZD8A 4F3KA 2PQMA 3VYSB 4B46A 3U60B 2O8CA 3VR5A 5I8PA 1G6KA 1UZLA 2VP9A 5IH3A 4A8JC 4BWGA 3DLBA 4AROA 3FHTA 5DK4A 4ER7A 3GBSA 4Z0NA 1N2EA 2GT1A 4KC0A 3UKOA 1S02A 2PHZA 1TAHA 5EJ2A 1FDWA 1W36D 1FIUA 1Q3HA 4D9BA 4MGHA 3S1LA 4Y6GB 3EWNA 5H70A 4LXYA 2H52A 1UXKA 2CJWB 2IUYA 1DBWA 4OV6B 3RIGA 5HPYB 1OGIA 3AERA 3FUXA 4JQSA 4E46A 1QP4A 3QVSA 5THKA 1KF0A 1CK4A 1PL7A 4HEA1 2MYPA 2CXHA 3FZNA 3T5TA 1G21E 1GKYA 1LDEA 2WUWE 2QK4A 1R2QA 2EGGA 4ZN6A 4ZA2A 1Z39A 3HR7A 1CIVA 1IBSA 3GIWA 4L27A 2ECQA 1U1IA 1PK8A 4BQFA 5BMOA 3PVZA 1X7ZB 3IE2A 3OG9A 2QUBA 3TNDA 3GMDA 4FE3A 2OFWA 3VYWA 2ZDHA 5AHOA 4QKQA 1U5BA 4PICA 1D2EA 2G36A 3CX8A 4JY7A 3FH0A 5AKHA 5KC8A 1H0KA 2ZYGA 2PAAA 3NTUA 3N58A 5DWQA 3UG6A 3ZV7A 1RADA 1ZEMA 4N0DA 4WCFB 1CUHA 5FOWA 1LC0A 2UZ1B 3HY4A 2WIAA 3QLUA 4NFLA 3MM4A 4UOQA 5CB6A 4MVJG 4CIDA 4I4CA 3TQCA 1IEQA 5GIPE 3HYLA 5G41A 1H2RS 3FSJX 1DX9A 1J8VA 1JXAA 1WRBA 2RGGA 5AJZA 1EXVA 3B7GA 3KYIB 3ZN2A 2VP5A 5EE3A 2GASA 1O96B 2XGJA 5JU6A 1A8PA 4DCUA 1JVSA 4TM7A 1VJ5A 3IEUA 3O84A 5CX4A 3U4HA 1K2WA 1XCOA 2VHWA 1GR0A 3F47A 1KMHB 3TR0A 2GSDA 4UU7A 4TSFA 2C5GA 3ED1A 1D1TA 1KAOA 1FVXA 2QAJA 2PZEA 3E9DA 2DF8A 4DT1B 5IWAB 4L95C 5KSPA 4DJFC 1GL9B 3GHHA 3AFNA 5EJAA 1M2OA 4B8ZA 2VK2A 4HYQA 1TDJA 2QU8A 2VN8A 4CQMA 4C3VA 1GTSA 4B3TB 2RAPA 1E4OA 1Y9DA 4F5WA 2WQZA 4DCJA 4L76A 2G5TA 1ND5A 1MFPA 2QLFA 3IEKA 3V33A 5HJ2A 3A2LA 3QHAA 4K9QA 3FFWA 3CT6A 3HCBA 1XFDA 1DFIA 3RLIA 3Q6MA 1QIEA 4RPCA 4L02A 2B99A 2SCUA 3E7XA 2A1UB 4BAZA 4WXYB 4CL0A 3ZDEA 1XWIA 1JJAA 4BGDA 1EB8A 3A2NA 4YMIA 4M4SA 1UM9A 3CW2A 1FNDA 3ZWPA 2DMRA 4I7EA 1AK9A 4BBPA 10MHA 4NARA 3H2SA 4W5TA 2VNIA 4EDFA 1FVOA 1SUCA 4YMSA 3GLIB 3R3XA 4GGOA 1S3SA 2MHCA 2ZSHA 4JLUA 2RHTA 5IBRA 2XCQA 1VGQA 1CUEA 2FQ1A 3DOHA 1G7RA 3I92A 4YH1A 1PV1A 4V0LA 3RANA 3JU3A 1FP7A 4BQQA 4XGQA 2CEAA 3BE5A 3O4HA 2MINB 2I76A 3C48A 4I1UA 3IIMA 1Z73A 4RL6A 4FFSA 3W6NA 2P9GA 7ADHA 3TOCA 2WTUA 3M49A 3N0TA 5TEVA 1TQ4A 2C5HA 4PG7A 4M9ZA 3SHWA 2NVUA 2O20A 4J76A 2G5GX 3GJSA 5TLSA 4OAQA 5F3DA 1EM8A 2B5VA 4OL0A 1JGTA 1CP3A 1U8XX 1X7ZA 2GBCA 5KDLA 4R1UA 1WULS 1R0ZA 2WYWA 1JPNA 2I9PA 2YFHA 4R8MA 1J09A 1IEVA 4LBYA 3E0QA 3UK6A 4MWBA 4WHMA 3L1JA 3MTDA 4FGSA 4RYDA 2EZUA 3RSSA 4QICA 1NQUA 3KV3O 1FTQA 1PYOA 1TM3E 5C53B 3QFTA 2VCHA 4KTVE 4LJ6A 1QYWA 1S7CA 4G0NA 2FZVA 1U8ZA 2PU7A 2FW8A 3QIAA 4QHSA 3FDIA 4IQ4A 1WVMA 5LA6A 4JAVC 4J94A 2CZCA 4MV7A 1IOVA 4ER3A 4U6SA 5DHQA 1DTWA 3AUYA 3O90A 3V7NA 3ETJA 4JT9A 4AP9A 4N49A 1TC2A 2YZNA 2ZGVA 4NJMB 3HM2A 4B0OA 4BVFA 4EKYA 5LOVB 1POWA 4LY9A 4FONA 4QG3A 1EXMA 2PZMA 3QUSA 1USGA 4E09A 1WEKA 2X4IA 1GJRA 4QSMA 1NYRA 2ACKA 3HU2A 1VJ1A 3A8TA 3DOCA 3QKUA 4JUBA 5KWSA 1KAGA 2A9QA 2QTVB 4HDNA 1GTL1 3DWGA 2HSWA 4J6EA 3FVWA 1RXVA 2EV9A 4DGSA 1N8KA 3P19A 3ODPA 2YY7A 3SJ7A 4XARA 1DEXA 1THMA 2CKDA 3H2GA 4FXOA 5CNJA 5J63A 4LNAA 3ESCA 5HQ3A 2HT1A 1SXHA 2CWWA 1VGVA 1HNXB 3T1OA 3DVQX 4P38A 4BY9E 1ISRA 1MLDA 4BZPA 3ILSA 5EE0A 4NYJQ 1Z7EA 3EC7A 3UWMA 4EJFA 4K6FA 4X6YA 1IY1A 5E9AA 4ZPJA 1JHRA 4Q21A 1OV6A 2QLTA 4H15A 5AXDA 1OAKA 2ZROA 3HFSA 1DTSA 4DV0B 3DLPX 5EQTA 3QVVA 3EFOA 2VATA 3EAQA 5JDCC 1TIKA 3EYWA 2J6IA 3NJRA 4CG0A 3WNDA 2WKPA 1R9NA 3HRHA 1UMBA 1INLA 3C3KA 3W06A 1Y4DE 3GJTA 3CJTA 5ALDA 1G16A 3AF0A 2F90A 3QKWA 4A5OA 3SYLA 3SLRA 3K0SA 1BA2A 1M54A 3GNSA 2YYSA 4TS4A 3C3XA 4BIIA 4RTQA 1ZD9A 3FSGA 2OZEA 1T1EA 3CZ9A 2R8XA 3GFQA 1SB9A 4DDTA 3IOEA 3KT3A 2P0EA 2QW1A 4KMOA 5F64A 2ZBDA 3CUEF 1IBMB 2JI7A 5IK2D 4MGYR 3VGPA 1PYDA 3HUFA 2FAXA 1XXHE 4L5BA 3DONA 4FBMA 5JRZA 3SM9A 3KEOA 3CN9A 5EIWA 2LTAA 1EFKA 1HFWA 1R5NA 1R8JA 2JJ2D 3MINA 1ONPA 4MJLA 4GHWA 3FPHA 2WSBA 2C2ZA 4FYHA 3F7OA 1SCDA 3P2KA 3G9QA 5AVYA 1JSLA 3IL2A 3FWPA 1BWQA 5JPDA 4DRZA 2CLDX 2Z5LA 3CX3A 4UUQA 5DYGA 3I9JA 5H16A 1THTA 2ZIEA 3VISA 1C7FA 1Q0LA 3EF3A 4NU8X 1XLTC 1U0BB 2G9ZA 3DLAA 3M5PA 3N5CA 4IF4A 3WYGA 4F93B 5I8WA 3UUEA 2P5SA 3OHMA 3QWHA 3H1TA 3ZV5A 5D3MB 3WGNA 4Q7QA 2CCKA 2BLNA 4HZUB 1DXOA 3GLQA 3NDPA 4P81A 2XDAA 2W6CX 1GUYA 3FTNA 1Y6RA 3PFCA 4FIZA 2WU1A 4S05A 1TT5A 1RRMA 2P1RA 3O3OB 4GPIB 3UY4A 4E07A 1LQUA 2XMQA 1L7DA 4RDCA 2X2PA 1OZAA 3DC2A 1DHRA 3O5AA 5BSFA 4HH3C 1WG8A 1NMSA 2WABA 3A4MA 3PENA 2P5TB 3HI4A 1M1UA 1VBFA 2ZIGA 2K2WA 1Y7TA 5IJ0B 1KKLA 1S3IA 1H6DA 1GY8A 4JC4A 1FFWA 3N7TA 1CDDA 3A27A 4IXWA 2GVNA 4YGXB 1FZQA 4KACA 2HSZA 3P2YA 4RA6B 4AF7A 4DABA 3J7TA 1KJYA 1RLIA 1U5AA 2O7NA 5EA2A 4ZV4A 1XMPA 3LWNA 5ECGC 1FJHA 5AP9A 3ZIAA 5B7QA 3BS4A 4R2KA 4ZMSA 3F8SA 4O02B 1ZK1A 2C4VA 3NNDA 4JHXA 3JATB 3N8IA 1VOTA 4YCJA 3AHJA 2FZEA 4B74A 3IPLA 3TLAA 5C46F 2ZXUA 1ZD5A 2QPLA 4OL9A 2YVUA 4YUWA 3EXAA 4CDGA 3W77A 5HZHA 3EXIA 3VR6A 4Z2AA 4AQDA 4B31A 2AOUB 2XQKA 3ZCQA 1E0SA 1DJMA 1QYXA 5DULA 3VPGA 3NO4A 1ZK0A 4QUGA 1N5LA 1BEUB 3EOBI 2IY7A 3BZWA 4MAMA 3W5UA 3NVMB 3ZJ4A 2YXBA 1D4OA 4UTZA 4I55F 2F3TA 4NAHA 2ZJBA 4U7WA 1A3CA 5FOSA 3S44A 2ZDQA 1F5SA 3ASVA 3LL4A 4GR9A 4W8OA 4C0KA 4RJTA 1D2HA 1UM8A 5HVNA 2I6QA 2WTNA 3FBWA 5ALKA 5G4KB 3URMA 3I1IA 1ZUD1 3VSEA 1PS0A 1YDEA 1F1JA 2XT9A 2QSJA 5FHRA 1TXGA 1Y4AE 3NP7A 2P79A 3SZOA 2R97A 4NU0A 3FF1A 2AJ8A 2JIMA 2G17A 2WU3A 1OJ7A 4FFOA 5LJLA 5TGTA 2QV0A 1FDOA 3FMGA 5DGIA 4ESVA 5EL0A 3L7JA 3ISVA 1P81A 2IYPA 4ZCPA 3QBTA 3BULA 4MR8A 4C0XA 1E3JA 2BFDA 4IM7A 1K27A 1NX6A 2W71A 2ZRMA 4F3RA 1EE1A 1JZTA 4PQYA 2GWHA 1UDWA 5KWJA 2MSCB 1B8UA 3AHIA 5H83A 4I55A 4RACA 1W9HA 4LHEA 4XSVA 521PA 1QYVA 2UXCB 1KVQA 3DVRX 3F74A 9ATCA 1J1ZA 4OHFA 1FA9A 2BMWA 3LO5A 2QXTA 1JYFA 1EPUA 3MTBA 3QELB 4IKPA 1GCGA 2YJ6A 4TWZA 4HPXB 4KWHA 3OOWA 4MUXA 4D0NA 3TCKA 3KS9A 2ORVA 3V7WA 5F52A 1A2OA 3FNRA 1ECFA 2IA5A 1G63A 2CHVA 3L1KA 3JASA 4U7TB 4R71A 3F73A 4KFCA 4KMMA 4RE5A 1FQKA 1CKEA 1HT2E 1Y1KE 2R8EA 2P5YA 4FOPA 2QQ5A 3ZE2B 4D8XA 1B76A 3ZQ6A 2R1UA 1FP2A 3V8VA 2KMLA 2IEGA 4FNGA 3W34A 1HQKA 3HGMA 4FB5A 1ZI6A 5JEEA 1S8AA 3C7KA 2C9OA 5K6RA 2ADOA 2DCUA 3JQ7A 4ZVNA 1SUWA 1J8MF 5B4UA 1UJCA 1U0LA 3RRYA 1KMIY 2CXQA 4GMDA 1EX9A 4A6PA 3AOEC 2H2GA 2NAPA 4RF2A 2W4IA 4LVOA 3UB2A 3ROQA 3KSRA 4U4AA 4LJ4A 2ZRKA 3E81A 1I4WA 5EJIA 3FSGD 3BREA 3C3YA 1FJGB 5DSTA 1C1XA 1V45E 3N28A 4FCCA 5JS7A 1PJ8A 2VT3A 4GL4A 3E3LA 3FE2A 4AUMA 3QJ5A 3K1ZA 1O0BA 3D8UA 4EVRA 1RRGA 2X1HA 4QQFA 4Q9NA 3QFHA 5IT5A 2AYXA 3QFCA 2VJCA 4DR5B 1YRLA 2AOTB 1P5JA 5DTIA 4N48A 4IBOA 2DP4E 3NHJA 2CL7X 3OEWA 4IMPA 3TQSA 4EW1A 3A6GA 3RFTA 1GU0A 4H0FA 2GEFA 2GEVA 1KY4A 2GPYA 2XF8A 3INRA 4XD7A 5BORA 2QZ4A 5LQKA 5AI5A 2WTXA 4HWSA 4JCOA 3I2YX 5G0WA 2BN4A 1EUCA 3ANTA 2OECA 2I8LA 2WKSA 5I9MA 3RVMA 4EVIA 4F46A 4AAYA 4ZHQF 4R40A 2R4UA 1ZAYA 3OPNA 3H4TA 3TIFA 3GLGA 1QF9A 4BBZA 1EFPB 1AKRA 5T57A 1T0HB 1P6QA 1QFMA 4LJ5A 1I0ZA 3AEKA 4MGEA 5BYJA 4BLQA 3P2IA 4ARCA 1QIIA 1WU7A 4ZZ1A 2VHXA 4CKEA 5JMOA 1W85B 3PSAA 4ZAVA 3L8YA 1YXMA 5HF9A 3ESZA 1L4BA 3BHMA 2JIQA 3S5UA 2EYQA 2DJ5A 1ILEA 1PLLA 1SUFA 3ZHYA 5I8ZA 5C0OE 1WP9A 5J1SB 1TGVA 3G2OA 1C3EA 2DPHA 2ZRPA 1SUAA 2QRJA 4OHXA 1RXIA 3A4YA 2GB4A 5ALTA 1EBFA 4KQKA 4U00A 4AWBA 1RACA 1H23A 3H84A 4JB8A 1M5RA 4B2LA 1RYNA 1ZM7A 3R3VA 4D4GA 3LCJA 3ME5A 4E5UA 1ZH8A 2X8AA 4O8CA 3SYRA 3F8WA 1FFCA 2JLAA 4PLFA 4FMCF 3RJMA 3QU2A 4B47A 2WUGA 3UG7A 4BKUA 1QU3A 3ZXUB 5HUHA 2FMUA 2IU0A 2Z57A 3VPBA 1Z5VA 5JJKA 2J5XA 4GOKA 2Y0BA 4HX5A 1SXJC 2VSFA 5DVZA 4GMKA 2I55A 3OZRA 3JZMA 5D7NA 1DJQA 3CTPA 5A5DA 4HAWA 2FSUA 4JEMA 4ZYYA 1OFIA 3ZDRA 4CIAA 3HBNA 1KSGA 3WQQA 1Z7BA 2M9MA 3TMKA 2XBLA 2XA1A 3ROMA 4MPDA 2QQGA 2QPAA 4WZAE 3RVRA 4A16A 2BR3A 5BN5A 3I5YA 3K72B 4XB2A 3ZWBA 1V6AA 2FX3A 5KJCA 8OHMA 2P3QA 5CFLA 4HLDA 4I9NA 3ROFA 1G0OA 4TT8A 1RP7A 4MR9B 4UEKA 3QEOA 4IICA 4D56A 4CI9A 2GMWA 4IIJF 1GM5A 2WLTA 3JV7A 4UM9B 4MV5A 2M98A 4MS3B 2A1TS 2A3RA 3N0VA 4H7HA 1Z18A 1DOAA 4K9PA 1GGNA 4OU4A 1F6WA 1C7RA 5E38A 2Q4TA 2ZBGA 1L7XA 3FJ1A 4FHFA 4XAQA 2WMDA 5T3UA 4RM2A 2RI0A 3ESYA 2W43A 4NCHA 1XRLA 2R7MA 4NRDA 1TF5A 1KTIA 4JITA 2YYZA 2NTNA 4U7FA 3E23A 2Y0DA 3WLRA 4R2MA 3RHTA 5HJ7A 1F2VA 1Z2EA 2PWAA 1D4FA 1ZR2A 4Q4CA 4MCHA 3R3WA 1TVKA 3PGKA 5CCXA 3BMNA 5EAIA 4J3NA 4BP8A 2Y1WA 1EJBA 4B0PA 2GXAA 4PG5A 3AUFA 2HRZA 2AFRA 3WDMA 2ECFA 4CQMD 3QVTA 4FZ5A 4J0GA 4JB3A 4LCEA 3OKAA 4EGFA 4F96A 2BGRA 5BVHB 3CUKA 1B4DA 1YK0A 3QX8A 4BKOA 4YJ2F 3QQ5A 1WMEA 2AMJA 3R0IA 1RJGA 4E2YA 2PUEA 2WK1A 3UTDA 5JCJD 1U3TA 2PFSA 4KUGA 1R00A 3TLJA 1GZ7A 5LD2B 1JDTA 1RQGA 3PQ3A 3GLIE 5E6UA 4P4SA 1VMKA 4RANA 3A36A 1M2FA 4BX0A 3DL0A 2CVZA 2VZ0A 1XJ5A 3BCRA 2PMDA 3RRXA 1JI3A 1Y1QA 4RETA 4D3DA 1L7AA 3A04A 3EDCA 1PD0A 2PJRA 3FNHA 5LNK6 4EFLA 5LD2C 3VPDA 2X1LA 3ZWMA 4Z3DA 2D5LA 4OXKA 4Q9HA 1VL0A 1F3OA 2JJ2A 3OM8A 3TCNA 1PTJA 5C35A 1RE0A 4IR7A 4MLCA 4UDXX 2JRLA 4EUNA 3RASA 2D59A 4LZPA 4BNMA 5J47A 1CRLA 4L9RA 2NYRA 3TB6A 3MB8A 1EESA 3H1FA 2XMSA 4O3FA 1LLFA 1HO3A 1VMEA 2ZE7A 3BFXA 8MHTA 3U9LA 1UBSB 2FRDA 3DPSA 3GGDA 3IT1A 2QEQA 4N3CA 2WDPA 4WLUA 3VKFA 3HBMA 4U7HA 3SSOA 2FPLA 3HXKA 1H2AS 3S2FA 3ZWWA 1BS2A 2GD1O 4CCSA 4QGSA 3W5AA 4ZPXA 3BFJA 1WMSA 1H1TA 1OZHA 1N8SA 1K7CA 3PQ7A 5LVAA 1M6EX 3RR2A 3MAAC 4E08A 5D1HA 3UTCA 1FMLA 3HUDA 3QVLA 4EY6A 3L84A 2C20A 1Q7GA 5EHGA 2O1EA 5LNK1 4RY8A 4G07A 1G2OA 4C3UA 2CY0A 3AQ4A 5HFJA 1TZJA 3G5MA 3HDQA 4LSZA 4DT1A 2O8BB 4NFYA 3ZLBA 3Q9LA 5E7QA 1YR3A 4QO7A 2ICAA 2M1ZA 2V8OA 4UCXA 1NUUA 3IP7A 4WV3A 4OUKX 4HD8A 2NYUA 3MRXA 1PO7A 4RHXA 1GRRA 3G17A 2BEVA 4ZU1X 5FBRB 1B0ZA 3EQZA 2Q8NA 4JASB 2R1VB 4JVLA 2XPCA 1OAOA 4QYXA 2W93A 5ARDA 1JHOA 2FJ0A 2FSFA 2JLRA 3ND5A 2VJMA 4DIBA 4WXRA 3EBLA 3QEMB 2ZUVA 2WF9A 1AURA 4OMDA 3FNQA 2A14A 2C2YA 1SG9A 3SF8A 1JG6A 5D3ZA 3NIGB 2EZTA 3LPMA 4H16A 5H0IA 3U81A 4BQNA 4C4RA 4NPHA 1CEXA 3RJ9A 3B51X 4LJRA 4YDSA 4IOKA 2WJWA 1RCUA 1S4MA 3V4ZA 3LJKA 4UMFA 3RQSA 1VPVA 4Y0NA 2FPPA 4H18A 1SIUA 2MT9A 4HAVA 2DUNA 4IGFA 3ZV3A 4JVSB 3VPHA 3QLVC 3KO8A 3PUKA 4BATA 1GL7A 4GPZA 3JCZA 2P9JA 1W5TA 2OHVA 3KEFA 1XDGA 2H1RA 1JIIA 2DHQA 4PRKA 5CJJA 5G0TA 1CBUA 5LKAA 2ON6A 3TZBA 2ZOSA 3VHXB 1WM1A 2Q6LA 3EQ7A 3FHOA 3ORYA 4HJXA 1EDEA 1UP4A 2XJ4A 4FYKA 4UBKA 1F2DA 5GOZA 1D03A 2YOFA 2ZYRA 3MVEA 1PK7A 5KS2A 1H3EA 4RBNA 1EJ0A 3RGWS 3VR3A 2BEUA 1V39A 2XHZA 4KJXA 5EXSA 3RS4A 1M0TA 3DYVA 4EY4A 3D8BA 2WSSA 1J8FA 3P5BA 4TV9B 4X8OA 3R3ZA 1Y7LA 3CRQA 4KODA 1GNPA 3IBGA 1H66A 2B35A 2DHRA 4D2IA 2ISSD 3LDAA 1VRVA 1WMAA 2E5FA 2Q1YA 3KE8A 4L08A 4OIFA 2UZ4A 4GLFA 5DHTA 5EPOA 4FPXA 4Y1FA 3SFVA 1KP2A 3JYPA 4C6TA 4N82A 4RD0A 2Y6VA 4RS4A 1X7GA 4Q3DA 4YUXA 5H68A 2IY9A 4RSMA 1RM0A 4QZVA 4MYHA 5JSZB 4D3YA 3A9VA 1P0CA 4Y9TA 3EPKA 5KEIA 5CNMA 1NFFA 2HYIC 4DYDA 3DD1A 4A4DA 3FDZB 3A0RB 3V2UA 3O4IA 4ZKEA 2XQFA 1T2AA 2AG0A 4PC2A 1GRNA 3SJBA 1SCBA 3AGQA 1NAIA 4Q1BA 1XKLA 2QZZA 5LM3A 2QVCA 2PA3A 4F6CA 1K3FA 1UDCA 1X7WB 3DFMA 2XUFA 3MTJA 2EW1A 4X95A 4YK7A 1EVLA 1YR9A 1RTTA 5M2QA 4FLMA 3GWZA 3NFYA 3PEWA 2VLBA 1XJCA 3HCNA 1BW9B 1N3IA 1LRJA 1MAUA 3ANNA 3DVAB 4IMIB 4OH1A 5F5LA 3UWKA 1C0PA 2P27A 1VB3A 3QSGA 3QYAA 5EFOA 5FBHA 1RNLA 1UC4B 5BP7A 3ZZ0A 3BMNB 1T8PA 5AKKA 3FDFA 4YMVA 3IALA 2I4OA 1ZA1A 4JXKA 5GJVC 3CVWA 3QJYA 3LHDA 2NUBA 5JLJA 5KAPA 5CX1A 2QIOA 1U5BB 4OKIA 3U31A 4D9HA 3QA9A 2D8MA 1ZC4A 1ZWKA 5H3LA 4QTTB 3RVJA 5CGZA 3T5GA 1T4DA 1N0HA 4O2BB 4Q9IA 3RJZA 3QHPA 1E7MA 4Y8VA 4NPCA 1U1CA 1IPHA 2BMAA 3I9V6 5L3RA 1G3IA 1FW6A 2P40A 3ZLTA 1XZJA 4KFSA 5E0KB 2P9CA 2QTRA 5CK5A 4QTYA 2BGUA 4C1NA 1NX9A 1T5SA 3OZWA 621PA 2PGIA 1NGSA 2FFRA 3RD5A 1CU1A 1X94A 4M1KA 1A5ZA 3AIMA 2OM2A 2OPBA 4CFZA 1Y3DE 3O8LA 3T3IA 4W1SA 4RDXA 5KNCD 1RMYA 3DLCA 1ZD1A 2NSYA 3CKMA 3HPQA 4HDSB 3RRJA 4BBAA 1OFGA 3W4IA 3Q8KA 4UE6A 4BNDA 1YV9A 3EA5A 4OHWA 2HK8A 2R6DA 4CM8B 5J2TB 1L7VC 2GN6A 3G13A 2GCEA 4WN9B 3EEQA 4Q0MA 3UXHA 2Y9MB 2Q5FA 1FW8A 1HEYA 1XTKA 1EYZA 2X8LA 3KT6A 1NIPA 3KOYA 3VR1A 3QY9A 5FR2A 3PF8A 2P35A 3DHEA 3U26A 3VR6H 2XUIA 4IIYA 4DJJA 4Z4FA 3OO0A 4G84A 4DBVO 4P82A 1VCOA 2D2VA 5EYPB 3IKTA 1YTUA 3M70A 4TVBA 1O8CA 2O2YA 3SC6A 2HADA 2II6A 4F4UA 1R8YA 1ZK3A 3BXZA 4BV9A 1N1EA 1US8B 1YI1A 4MR9A 1ISGA 2ZRLA 3PX3A 5AVZA 1RBQA 2XYHA 1XR3A 2B78A 4FBGA 1QVWA 3UKDA 1OTHA 4MKFA 4HTAA 4G5XA 4ZRDA 4AB1A 3N07A 1UMDB 3A6PC 4JIGA 4OMUA 3URKA 4CMEA 1KO1A 1TEXA 2EX1A 1PBNA 2O3JA 3DV9A 2WQ6A 3CCBA 3JAKB 3ABOB 3MMPA 4HC4A 3I01A 4NFHA 2CXUA 1REQA 5K0JA 2XVMA 2BEJA 2W5UA 3D1LA 1ZUNB 2CW5A 2CL6X 2QE7A 1NU8A 3DVLA 4ZOCA 4B32A 1PZGA 3WVNA 2F3QA 1GG8A 3ZIAD 2VPWA 2C2XA 3L18A 1OXVA 4B09A 4ND8B 5FOQA 1GT91 1CEEA 3H7AA 2DQ4A 3IQHX 2V3CC 2IXFA 3HRIA 1YIOA 2FN3A 4CKEB 2GF9A 1K1EA 2OORA 3DBLB 3LOPA 3EGWA 4DV2B 1TC1A 3PX2A 4L4ZA 1QV9A 2OO3A 3KZKA 1BE0A 5DCUA 2EF0A 2CSXA 1CZRA 3M6FA 5JNUA 2O2HA 1QH0A 1YULA 1UCFA 1R4ZA 4BFCA 5JIBA 1XEXA 4OFZA 2VXYA 4YLEA 5FUBA 1CY2A 4TWJA 1I5RA 5HIKA 4JBNA 2A88A 3SFTA 4XVQA 1L8LA 2FG6C 4ZT2A 2GR9A 1E1CB 2EJBA 2PYIA 2WU0A 3KTAB 4FE7A 3SZUA 3T0GA 4Q48A 4HTFB 3RYCA 4PHFA 1TM2A 1DZIA 1RPJA 3Q7IA 4LV8B 3W7AA 4EJSB 3IUNA 3WNBA 1IUNA 1AUXA 1GPH1 2H0QA 1L4KA 1YQWA 3T1QA 3I34X 4R0MA 3B9QA 2HQRA 1Q84A 2JFOA 4EJ6A 2ZUWA 2Y99A 4H35A 4MW0A 4Q4AB 4QU0A 4LZWA 3NHFA 5HF6A 3HFJA 4YMGA 2RGYA 2I0FA 1UWVA 2R11A 2VOJA 1P31A 2HR1A 1I3LA 3IQXA 1MDBA 4DY4A 5LN1A 4MK4A 1BN7A 2HIMA 3M9LA 4LZJA 5C52B 1QH9A 4IQ0A 4EG5A 5GZ1A 1LBHA 3KELA 3GBPA 4NLLA 3PC6A 4PZCA 2AOTA 2FFAA 5E9JA 5HE8A 2PFKA 4G0QA 1IN7A 2JS7A 3JVVA 3BDVA 4OP3A 3GDOA 4LPKA 1P1CA 3SP1A 1NZJA 1R3DA 1TPZA 2OCGA 2X8BA 4ETNA 5F1PA 4A8JA 1K3UB 1EDOA 1V3TA 1C1XB 3C0KA 4ZZ0A 1T91A 1E2DA 2P2DA 3GJ0A 5JANA 1FS6A 1PJSA 4LJSA 2AFIA 2B6HA 2BV3A 2J7PA 2WWHA 1TCCA 1NNLA 2FP3A 1K6EA 4JLOA 2DSTA 2CDCA 3KHTA 5BOSA 5IZCA 3WE7A 4C5BA 1IZ9A 3K9QO 4IQ8A 4GQAA 5YASA 4DNQA 2C1XA 3R3SA 1I13A 1XTBA 3S2ZA 4AYWA 4KXXA 4LRQA 1KS9A 2C3YA 3NHRA 4YPFA 1YB7A 2G1AA 4CTKA 3K1TA 1J9ZA 3JVUA 4QELA 1UMDA 5FI3A 2DECA 2JD1A 4EY5A 5HX7A 2J3KA 4MROA 3S1AA 1Z9BA 3MWJA 2W0MA 2QM0A 4C06A 3INTA 2UZAA 4QPZA 1URPA 2WVHA 3EXEB 3ET5A 2QY6A 3M1YA 4HUJA 4IH9A 4UDYX 3WLSA 1ZL2A 3DFIA 4WLEA 3UQZA 5LZ2A 1YUNA 1N1GA 1N4AA 5ICCA 1AXRA 1OQAA 4I1PA 3LFTA 3M5CA 3T9CA 5HM6A 1P9NA 2IPNA 4AO7A 2ZI5A 3ZE1B 5JG7A 2PQ2A 3K16A 1PVOA 3GRYA 5AW9A 5EZ5A 3VDXA 4V03A 4Z7JA 3OMXA 5A2GA 1ESNA 2B94A 3V4VB 4KQ2A 4AMYA 2P75A 4FFPA 1P6XA 4TRJA 2W48A 3BF8A 5JVDF 2E82A 1ZBDA 1L3IA 4YV1A 3I62A 3V2GA 2QYSA 1N32B 4MV4A 1E1LA 4KQ9A 3G5UA 5DWVA 1C3LA 3UGQA 4LY3A 5LZ8A 1U2EA 1XZQA 3O6VA 2NZUG 3KQQA 2REXB 3KTAA 3TZEA 4TL9A 2V1UA 5EEHA 5IH7A 5EJ5A 3TLEA 4XUEA 1GIAA 4RVHA 3IA7A 1KDOA 1T36A 1Q95A 5E6SB 4O2BA 1XVUA 4F1KA 4RFVA 3M6WA 1ZUIA 4WASA 5FPHA 1JHAA 1W581 3H5VA 4PGHA 1PYGA 4QYIB 5DBHX 4GX2A 2DPYA 3HBFA 5JS1A 3FKJA 3HKCA 3DAGA 1W36C 5DTEA 3PSHA 4G5OA 5A3RA 3C3JA 4QYSA 3I2HA 3Q10A 3WA6A 4LJ8A 3ZD9A 1SU6A 3UFBA 4C21A 3UMVA 3C87A 3D31A 3EOAI 3HCPA 4LX8A 2ZAYA 4KOEC 4ZGWA 1LPAB 3BZBA 3ZBQA 2RHCA 4TQAA 2FSGA 2G67A 4OQDA 4B45A 3VNSA 2A0UA 3F6EX 4N3BA 4L9AA 3TW8B 1I7QB 1AV7A 3DLTA 1RZVA 2OCLA 4BFLA 4K86A 3B38A 1FSGA 1JLSA 4IJKA 3V1TC 4KR7A 1I4EB 3WIVA 4Q3AA 2QLJA 3VC2A 3NHSA 5A6SA 3WLJA 5M7EA 3FMFA 4E4YA 3U39A 3EVFA 1EK2A 2XE7A 2ZWAA 4KDRA 1IZ7A 2QMEA 821PA 4L51A 1CS0A 2N75A 3U4GA 2JCBA 1LSJA 4EWLA 2JANA 4E6PA 1WV1A 2V59A 4J2OA 3BMOB 4GYWA 1P9LA 5E2IA 2QKYA 3ER8A 3A6JA 4QDJA 3CVXA 1P3Y1 2JB9A 1IXYA 2BEKA 2I1QA 3D0RA 4RM3A 3EUFA 3DTYA 1RFGE 2ZSUA 3L3BA 2Q5IA 4HEA6 4MV8A 3VR5D 4W1RA 1J5PA 1WE2A 5B58C 1BFUA 1CQIB 4LCJA 4Q18A 3DBRA 4CF6A 4HF7A 3WHPA 2UXBB 3CEAA 4FZ3A 1ZQ9A 2GPJA 3NGMA 4MWTA 4D5EA 2FDCA 2UU9B 3HCWA 2WMYA 3LA6A 1FNSA 4N39A 4IJVA 1L8QA 2MU1A 2ZUBA 4AZ3B 1ZD2P 4JP5A 2HQSA 4MQUA 2VAPA 1OXKB 3ADCA 4ND1A 4Y2SA 1Y4UA 4X6XA 4FGZA 4YDHB 1BVHA 2FU5C 2ODWA 2GVDC 5D6NA 3FWKA 3RU7A 1EGQA 2XUQA 4OO3A 2PUCA 2WSLA 3HN2A 2EKQA 3QEAZ 3N0WA 2H29A 2ISCA 4HNRA 3L4BC 3N87A 3D43A 3FYTA 3ZDBA 3LG2A 5D3KA 3E3AA 2VDNB 3D6MA 3LT1A 2ZE8A 3VYRB 2C7OA 3I0NA 3Q12A 4O0MA 4QPDA 4LZAA 3RBXA 2X2EA 3LWBA 1YR2A 3CUWA 1OA1A 3RHZA 3WQSB 2QN3A 1RI4A 2HLDD 3L1VA 4YJHB 2PU5A 3I9LA 6REQB 1W94A 3I8OA 4MRNA 2A3NA 5CK4A 3K70B 3UHOA 3UB3A 1GZ5A 2VTDA 3BTSA 4EW6A 5L51A 3EBOA 1UOEA 4F4DA 1QH8B 4URXR 3T5MA 3M9XA 3ZWKA 3ROGA 3A7EA 3PDWA 2GBFA 3IR7A 4NJOA 3VHLB 1B6RA 5KCZA 3N0RA 3WXMA 1VSVA 2C0CA 1NYTA 3F0TA 5HQTA 2HA2A 1FP1D 3ONFA 1WUKS 3R3JA 3MCUA 3U62A 4PEVA 1RWOA 3P71T 4L57A 2KYRA 4HWOA 4JJ4A 1CZNA 3GCXA 3ZU6A 1GYQA 3AZPA 5J4VA 5ALNA 4MW6A 1PW5A 1Z6AA 3GZNA 4WVFA 1LZKA 4QUBA 1RKUA 2I78A 3L1UA 3WMFA 3ENWA 4QQ8A 5JHGB 1I3MA 4Q82A 5DASA 3SXUB 2NQ2C 5JBIA 2YJNA 3DMNA 2WPDD 1ADCA 2IE8A 3KJHA 3ELBA 3NT2A 4QYWA 4DLNA 2G9NA 3V42A 3KVVA 3TSYA 3L8HA 4C6HA 2C4KA 2H06A 4WN3A 3CW9A 1NULA 2DE0X 5IJ9B 4V0QA 1WDMA 2CDAA 2QE6A 4YQEA 3MB5A 3LH5A 3G2IA 4YA6A 2XDYA 1MC4A 2AF4C 2OZVA 5H82A 2XH8A 1ZH0A 3GHYA 2G5PA 4O4LF 1EQ2A 1P0PA 5DP2A 3EQ6A 4X7PA 1V43A 2NSJA 3O4JA 2CLKB 7GPBA 3VHRA 2Z9DA 1Q6ZA 2AA3A 1NXPA 1R64A 4O8ZA 1Y8QB 2A67A 4CMGA 4LQDA 2H17A 1X1TA 3HKDA 4C05A 3ZX4A 2DBZA 3C85A 4B87A 4TXMA 1M2GA 3EAFA 4LC9A 4ED9A 5I7UA 2XYGA 3CZ5A 3F5DA 3RRBA 4KQ6A 3DBVO 2R84A 5FR1A 1UBLS 4IIXA 4EYGA 2DSNA 3HHPA 4WY2A 1XCJA 2RGUA 2J6BA 4WL0A 1H69A 2B4TO 4C4YA 3EVDA 4CIBA 1YAHA 2WF6A 2O54A 2H5EA 3K15A 3FDXA 3UAGA 3WJAA 4D9IA 4HK4A 4ZMRA 2UYYA 5IX8A 4G0VA 3AR5A 4UHKA 3V55A 3CRVA 3V8QA 4M9UA 1XD2B 5GY7A 4ESOA 4JELA 1Q0QA 2BTOA 4IP0A 3MS2A 3RJTA 4D9NA 3A6EA 5A5FA 4B4UA 2TS1A 3GRFA 4O2LA 4Y1GA 3T99A 2QL7A 1BMDA 4O4LA 3IVGA 3S2UA 1VYVA 1T5TA 1KFCB 4H6WA 5EP4A 3SOPA 3WI7A 2HBZA 1HDEA 3IVCA 4Q05A 3RG8A 1I9CA 4RXTA 2R66A 3OQPA 2ZYAA 3HM9A 1Q20A 1CR4A 3IHKA 5EIHA 4BMXA 3KVNA 1H1DA 3ZHRA 1IWOA 1DO8A 4RTKA 3DBIA 4D9FA 4UKDA 4ZVUA 5ARCA 1EP1B 3NJ8A 4H60A 4C01A 5CAEA 1PX0A 1Z06A 1G20B 1KU0A 2HJHA 3IUBA 4YECA 3UO8B 4TLEA 5DI9A 1U6IA 3U6KA 2A92A 1LUAA 3CPEA 2R1VA 4BLVA 5KJ6A 4TLDA 2PVSA 1IZ0A 1O94D 3B1JA 1KZ7B 3K0FA 1H94A 3QUQA 4MITA 3OJWA 5HOQA 3NEAA 2Y05A 3GFFA 1R4NA 3BJIC 4QPCA 3SHOA 1RQ7A 2R6FA 2WJZB 3I28A 3BXGA 4X24A 4YGYA 1EA7A 4B3XA 5F1OA 1TPYA 1KRHA 1XZPA 1WZIA 1SELA 1WB6A 2X4GA 2Y92A 3AB3A 3DNPA 2ZQ5A 3JQAD 3K5PA 5SYMA 3PWSA 1FJ2A 3NV9A 3WLTA 4XUGB 5B3JC 1IVSA 2VQ3A 5IUNC 1NUHA 4TMZA 2VBGA 4LPSA 4IAOA 1DEOA 5BQPA 2RB5A 3U7GA 2CBGA 2QDKA 2H4YA 1ID1A 3U0BA 2RKWA 4PZEA 4XPZA 1W6UA 2OK8A 4GPAA 2VT7A 2FTKE 3KWMA 5IJ9A 3IV9A 3V4RA 2J3MA 1ISPA 1MXHA 3PDIB 4JVOA 4AI6A 1UBUS 4WDRA 1E3WB 3C4VA 5B37A 5HIAA 1GPUA 1VM6A 1UXHA 1Y34E 2PRSA 3L7NA 3MCZA 2QUJA 1EFHA 3EEBA 3KD3A 2D6FA 4V3CA 3PHGA 5K8UA 3ZI7A 1FDVA 2BFEA 2QMQA 3QOFA 1O03A 1A9SA 3QLTA 2YXNA 3GR6A 3DKIA 3FTPA 3HB5X 5JNVA 4YY3B 3G2NA 1C0LA 3P8ZA 4DILA 2CEKA 5GONF 3NIBA 1C8KA 4WOKA 5SZJA 4UQLA 3ZW8A 1WS6A 1BDMA 5FTJA 5BR4A 3SS9X 3WK4A 1DAPA 3R74A 3DS8A 1D07A 1L4MA 3O7MA 3H0KA 4E51A 2WMNB 3WGQA 4L5JA 5COBA 2AI2A 2DLDA 4Z4HA 1E1NA 1N7GA 1ZP6A 2EW8A 3LKDA 1L5GB 4BC0A 2HMTA 1JZSA 3I1YA 1X6VA 4UCWA 3DF7A 1PR9A 3CIFA 3M4JA 3WNZA 4AKSA 3E9MA 5FFNA 4OUDA 2GUGA 5LYYA 3OU7A 3PHJA 4NZNA 5KI6A 3VZSA 3SEQA 5INTA 4HXGA 4KGXA 1YZQA 1IYZA 2HF9A 2JGAA 2XOKD 3QKRB 4NBUA 5ES3A 1T6ZA 3AB7A 1E3EA 1LPSA 2H5LA 4BVEA 1P1HA 1N6NA 4MP8A 4IS2A 1XNRB 3UUWA 3FOAA 5AJVB 3I01M 3N8NA 4QDOA 2VAMA 2JAHA 4K9DA 3UJDA 4JA0A 2AEEA 5E1BA 5JWHA 3UK2A 4F8JA 3ELYA 1HT3A 4GVLA 4NEHB 3OI7A 1BD4A 4CL8A 2V45A 4F5DA 1JAHA 4OH7A 1LK5A 2OBMA 3DZKA 1Y7PA 3DULA 2R8RA 5AVWA 1WO8A 5LOVF 1YGYA 3SVLA 3OICA 4IINA 3HEMA 4FBLA 3HVHA 5KQMA 4Y2VA 1UFQA 2CV2A 4E14A 1VI5A 1OWLA 1W2GA 1ZMXA 4C07A 2EFEB 4IILA 1Q5PA 1FDRA 4PLVA 3LKVA 1YQDA 2GZ1A 4MKHA 5GONB 1G38A 3RUIA 1GVNB 3TVDA 5KNDA 1ZQ1A 4PZLA 4ZJPA 1JHZA 2I2CA 3WWPA 2OUKA 3SBDA 5JTUA 1XCGB 2Y1CA 4HLUC 1ZH6A 2GETA 3F98A 3QXHA 1V1RB 3ZLUA 3K9GA 5CT9A 4BX9A 1UKEA 1W96A 1NDUA 1XZLA 4U8HA 1B14A 3H18A 1GHTA 4YACA 5LWQA 3TG2A 1L2TA 2DQZA 2F1KA 3KQPA 1UANA 1W4CA 2ZTVA 4ZYTA 2VJOA 2WWRA 3L7BA 2ORWA 5IMBA 1U2QA 4EGCB 1T2CA 2IEAA 4DEXA 3H8SA 1U7ZA 2EFCB 2Q4OA 4J2TA 4B6PA 2OAQ1 3EXFB 4QPNA 5LLTA 3KSMA 1E1QA 4XX0B 1L4YA 1ZW1A 2RH8A 1E98A 2R48A 5FUXA 1J2JA 1WCIA 2DHDA 3OTQA 4DMCA 1SZDA 1SOWA 4ZYLA 3X2EA 4OFBA 4LS3A 2NW6A 3EARA 2PBLA 2GAFA 4IIBA 3TJMA 3PS9A 4BNWA 3FX2A 5CDYA 3EWAA 4DLKA 3A05A 2KWIA 4UCQA 4IDNA 4DDUA 4MW9A 2WZQA 3DXXA 4E3ZA 1GZSA 2I67A 2VYVD 3OOSA 3GLTA 1U4SA 3CY6A 3PDCA 2W8BB 2XWSA 1UBJS 4W82A 4XA8A 3THXA 3PXEA 4OQYA 2NNWB 2QVGA 3DP9A 3NKLA 4JJKA 2IHKA 4FCTA 4PFKA 3IP8A 1SBYA 3MCVA 1FUUA 3MWFA 5FBLB 1LLCA 2YWEA 3QKSA 5L95A 5EXTA 3SDZA 4QECA 4UATA 4DDKA 3ORRA 2PM8A 4MW1A 4MUNA 4DJDC 2IXAA 5HS4A 1LFAA 4A3SA 2WZCA 1MPXA 2NWQA 4RNCA 3RYFB 5LQJA 2O6LA 4N7BA 2ATXA 4CKWA 5IXJA 3KCQA 4WADA 3AI7A 3GOHA 3UZUA 5JRDS 1ISSA 2EVWX 3ZDZB 1W73A 1H2EA 4GECA 2P5UA 4NVRA 4WGGA 4P31A 1KYZA 1EWKA 3DBHA 3ENZA 1CJVC 3F8TA 4UVHA 1MW9X 5AOAA 3ZIDA 3IVMA 5I7VA 1KI1A 4FFWA 2IZ6A 2ZANA 4BMOB 1KWGA 5KJ1A 5DO9A 2QRNA 2OA0A 2QLMA 3UT5B 1WIWA 1KYQA 1A5AB 1CIJA 3TO5A 1W36B 4YT5A 3PDJA 1JG4A 4PYJA 1G7CA 4HR7A 2ZYWX 4ND8A 5GJCA 3AONB 2G0TA 3QVWA 4MDHA 5EJ6A 3NC1C 3SIWA 2AIRA 3K6RA 1XEWX 1PFWA 1YE5A 4R8VA 4BJHB 2X5JO 1RRKA 1NL3A 4P36A 4JP8A 3AVQA 3PNKA 1QCCA 3BGWA 4WW0A 4YYEA 2JLYA 1PUXA 3VMMA 2E5WA 3H7IA 2X0JA 3RYHA 1A9OA 2VBCA 2QLNA 3PB3A 3V7UA 5HGXA 3FYDA 2HTFA 4B80A 1GTZA 5KYKA 4DLPA 5L3SB 4ALKA 3RKUA 2NO5A 1FMCA 4S24A 3AUXA 4FYIA 3C43A 4XWKA 1G8AA 1J49A 1N6KA 4O2AB 4ZTZB 2Z6QA 1XO1A 3EHEA 4F3TA 2XXAB 2AEMA 1XPRA 1KQPA 1H3FA 4DG8A 1XAHA 1NLZA 4L6IA 4DIKA 4N9QA 5C1IA 2YHIA 2BY4A 5FL7A 4EHHA 3ETNA 1J07A 3FJYA 4Z53A 2ZR7A 5IZ4A 5JD4A 4MR8B 1BAPA 1VCIA 2ZRHA 5JAHA 3HYSA 2V4ZA 5LBTA 2JZOA 3GA0A 1UAGA 3RU3A 1L4LA 3WLLA 3IHWA 4NY1A 3K0AA 1FRFS 3KUKA 1Q2XA 4EEXA 1C8BA 2F1HA 2QRKA 4JC8A 4YAEA 5L3VA 1CHDA 1XA4A 2JI9A 4LGMA 3TGPA 2UYHA 4OK6A 3L7LA 2O0HA 2BR5A 4WKNA 2CFTA 3WRVA 3S2GA 1UKZA 2LDBA 2O1XA 3PIRA 4OM7A 1T0UA 3P9YA 3DPIA 1KETA 5BT9A 4URFA 3UNXA 4XDYA 1W1WA 3BHJA 2QG6A 1UJBA 4N6OA 4MA4A 2RGAA 3I23A 2EOAA 5EXXA 3UJNA 4YXFA 1AGNA 4RORA 3HNPA 1Z0FA 3BDAA 3TLZA 2WJ6A 2LPMA 1HNWB 1ISHA 2HQOA 2IW3A 4OGFA 5AM0A 5JZOA 5G4KA 2HXYA 2XQJA 1NVAA 2IKQA 1FU7A 1AKMA 4UTVA 5AHXA 5AW7A 4HFRA 2PH7A 5BMVB 4BMYA 1IN6A 3KSZO 4JI3B 2IPOA 2FWMX 1O3YA 1M74A 1JN0A 3DQZA 2WUVA 1R9JA 2JGEA 1XRQA 2ZRGA 3L4EA 2LXNA 3LW8A 4ITUA 4P35A 3KQSA 5KHLB 4A6DA 1KOLA 1LBTA 1LDGA 2I1LA 3IPYA 3AXTA 4RENA 3T38A 3ASYA 3ETDA 2NZYA 1L7RA 1BA3A 4XUCA 4Z4QA 1JSRA 3AVPA 4MVWA 4N5IX 2HDNB 4MUEA 4TLAA 4TV8F 3RCBA 3OTIA 3U4DA 2ZTLA 3EGEA 2PX0A 4C5CA 4Y2QA 3ZGYA 1LBIA 5BRAA 3LNTA 4AX4A 5ERGB 1G19A 3CMMA 3PE6A 1ZW6A 1RHUA 1UZUA 1X8LA 2OQVA 3CS3A 2GXUA 3ZOZA 2W6PA 4OKSA 3L8DA 4CI0B 5I7FA 3QU4A 3FBGA 3RPEA 3UMGA 1KI6B 3LT2A 4ZT6A 2BDUA 2DHEA 1PG5A 3IUPA 1WD5A 1U3GA 3OSZA 4AULA 1PFUA 1ZIDA 2ZJ5A 3QW4B 5DT2A 2ZAMA 2VHCA 1BS1A 1MA3A 1HSZA 3KJXA 3PFNA 4FUQA 5BXQC 5IHPA 4KIWA 2ZIWB 5CLGA 2I2AA 5J5CA 4B4DA 2R7LA 1E96A 4O4IF 4ZALA 5GONA 1SUIA 5TQJA 3OT1B 2E4ZA 1I2AA 1KJNA 1DAEA 4X91A 1OV4A 5IAKA 4CGZA 3ZBUA 3FG9A 1DG1G 2XUOA 5T8KA 4YRIA 1GNQA 1QH1B 1TO1E 6LDHA 5HTOA 2GM9A 1W88A 3O74A 4KIGA 4KNVA 4NQRA 2IS2A 1SQFA 3T4PA 4YRBA 4KYUA 5KYGA 2XR1A 1M8GA 1PSDA 1UC5B 2G9QA 2XUHA 4KLCA 1ISJA 3D4IA 1MZPA 3W8RA 4F7WA 3KHUA 3KQUA 4W99A 1BWPA 3LTEA 1QVAA 1K2VN 4I14A 2ZBRA 3DTVA 4DC1A 5AW8A 4R2WA 1SM4A 4PO3X 3WYFA 3UHFA 2YHSA 3E3NA 4FI3F 3WR5A 2J31A 4C29A 1JH9A 4TTQA 1NLYA 1T6YA 3I5MA 1VMDA 3TEJA 2YTZA 3NH9A 5LJIA 1EK6A 2B2XA 2NO7A 1TK2A 2X0NA 5HA5A 4ZU3A 5LCXA 3RHSA 2IQIA 1T24A 2AZMA 4BNDB 3JZDA 1Z3IX 1MGOA 1V95A 4OY3A 2GFIA 5HYVA 5IPFA 1BH2A 4PY2A 2JATA 3C8HA 2XY4A 1YB1A 2PLAA 1LPMA 2PX4A 2JJQA 5G02A 1P2TA 5T6MA 5CBPA 2VF2A 5C1BA 4OFXA 1XQ6A 4FQ7A 3UEOA 1G2QA 5DHSA 4YJ3F 1XX6A 2RHLA 5FADA 4MIOA 2RGWA 1LPOA 3OY7A 2WWFA 2VP6A 3P9PA 4MV0A 3ZBTA 1FYEA 3TLBA 1ZVMA 1BIFA 4TRMA 5E7MA 1YA6A 1JG3A 5CG2A 4TRRA 4PO9A 3U37A 4OP2A 2DH5A 3PJRA 1WUYA 4IGEA 5ERYA 2WP0A 3FKSA 3I5AA 3O3MB 3SXJA 5FBVB 4F9EA 1OHHD 4TN5A 1TKAA 1TJPB 2GEDA 3OWHA 4JNKA 2FMKA 4L8YA 3RS9A 4C0JA 4E5PA 3IJPA 1T5BA 4AJ1A 3VU9B 1XTTA 1BEEA 4R9UC 2WKQA 4LFCB 5IVIA 1M33A 3ITEA 4EHBA 4TMTA 4YFYA 3PT9A 3DE0X 2BTQA 4TLBA 5I9TA 5M5BA 3WRWA 2B9EA 1W4RA 3VTKA 1STOA 1E1MA 1OWOA 2FW0A 1SULA 4U0JA 1POXA 2BGMA 1RR6A 4ZQIA 4NBSA 3T0FA 4IJUA 3G8YA 2B25A 3SSNA 2P6NA 5FAXA 3QPDA 1OPXA 2UUBB 5DN9A 2ESRA 1XRRA 1ZSVA 1KVTA 2XZDA 1HE3A 1GL6A 5PGMA 2FYTA 3VSDA 4CGYA 1FFXA 1W5SA 4REQB 5ICFA 1FRVA 1GRCA 3F7NA 3TI7A 3JYLA 4QDTA 3WHIA 4DG9A 4AMZA 4YAGA 4O4JB 2VHQA 2HT6A 1P17A 3BMXA 1KZHA 4KX3A 1YS7A 4M0EA 1YIAA 2MMCA 3QPCA 4MPJA 1ZJ6A 4FWBA 1F51E 4I19A 1HE5A 2GNOA 2KE5A 2ZBEA 5FT9A 1RPAA 3EVTA 4OAPA 2JD2A 4YXWD 2BI7A 5GAJA 4MW7A 3RSLA 5KJFA 2NU9A 1NOJA 3R0ZA 3FD8A 1VKOA 5FIUA 3VZCA 2C4HA 4L28A 3ZX5A 1DTWB 3WKBA 2XTMA 1FB5A 4NULA 3TW4A 3GK3A 4M8SA 3U40A 3L2OB 3QKRA 4G4JA 3TMAA 1NUAA 3WYCA 1GYRA 3GN2A 4CTOA 4L0QA 1QHHA 5CFQA 1PL0A 3KKEA 5FD8A 2E4UA 4E3WA 4MKXA 3TS1A 3WMGA 2ZETA 1HMPA 1QGUB 3FYSA 2O8DA 1QQBA 1BCSB 4NE9A 3MILA 1ENPA 4EUSA 4KVFA 3DOUA 3GGJA 4FYJA 4G65A 1FLDA 1QIJA 3D1VA 1ZIYA 1IC6A 2ZSKA 5GTDA 1KJWA 2W37A 2CJXA 1NF8A 1GPLA 3EFBA 1CRQA 1E5DA 3EZLA 4CEHB 3ESBA 4LOAA 2LVBA 2VJMB 2BSQA 3AQIA 4XOUA 1N7JA 4JV5B 4UULA 1UDBA 5CHEA 2CJFA 1Y82A 4QDUA 4V3BA 4EMUA 1M6WA 1U7PA 4E6EA 5CYFA 5FUMA 1U80A 1VG1A 3GUVA 1YBFA 5CBPB 3RQIA 2R6AA 3ZQKA 2O8DB 2X6RA 1E7SA 3C5WP 4R41A 4TMWA 4CMEC 3K4PA 2JLUA 4LVUA 4IIVA 3I45A 1PUIA 1KY2A 2JFXA 3A6KA 4H3SA 1IQRA 1Z6PA 4LDAA 1E3WA 4P7GA 4F38A 1NFQA 1XXHB 1NW5A 2F43A 2GHTA 4MS1A 3RYIA 3X3HA 3SX4A 1HLGA 1MIOA 1MVLA 5CA0B 1M2WA 4R69A 5HK9A 1JT2A 5JCPA 2H4WA 4XM0A 3RVQA 2EIHA 2VL7A 4H1TA 3D4PA 1EWRA 1GNLA 3ZTWA 4AZTA 5K0EA 1U94A 1SU4A 1X1SA 3ND6A 2J4FA 3BKXA 2QNIA 3ACCA 1EX7A 5HKBA 3D3EA 1NJFA 2EZ9A 1V1MA 1B8PA 2BFBB 5THQA 1L5RA 2D1FA 3P0FA 3ABZA 5JAPA 4FSHA 1YO6A 3CLKA 4RC9A 4UAGA 1PCXA 1FBNA 1NJ8A 1WXDA 3FMPB 2F17A 3LIPA 4RCVA 4WCVA 3SI7A 3T34A 2EHJA 3E03A 2F43B 4FQ8A 3VZQA 4YYZA 1NP3A 3FRIA 4KPUB 2R5WA 3ROZA 1G66A 3OLQA 4W1QA 4NMWA 2UVQA 4N6GA 3DMFA 3I2IA 4M8IA 1O1YA 2XMCA 3GXBA 3LCRA 1ECCA 2J9ZB 3LY5A 1QE5A 1N6RA 1QANA 2BHRA 2LKCA 2IHUA 4X93A 5AJHA 2R86A 3B2EA 3Q8XB 3CMCO 1W0JA 4YMLA 3DDUA 5MGNA 3MWEB 3OT4A 2WPNA 4JEUA 1VDZA 3P9QA 2KBEA 4D96A 4UEJA 2FG5A 2RHJA 5I47A 5HSGA 3W2GA 1Z74A 1KO5A 1XNHA 4PE5B 3SX2A 2JH8A 2Q3FA 2Q0HA 4Y2JA 4N8SA 4FGJA 3N2GA 4DUZB 3ZVKA 1EWVA 3WLKX 3VAYA 3M4YA 4NYIR 5EJFA 1C29B 3O95A 4LXTA 1N2OA 1A9TA 1YWGO 3ZD6A 2H9AA 4K3UA 1PAUA 3MIZA 2DR0A 2WZBA 4M1OA 1ZL0A 4PRLA 1C1DB 2WJPA 1DX4A 3M0EA 5AHKA 2PUVA 3N8DA 4BX2A 1J9EA 3GLIA 4IX9A 5IUKC 3BSFA 3PZRA 3THWA 4FYPA 2GYVA 1JQKA 1VIDA 4D9MA 4OYRA 1JG7A 3TTTA 2OCXA 2VK8A 1QO9A 4LHXA 2HA4A 4H2DA 4KR2A 2AQKA 2EGUA 2BGGA 5JD6A 5AIAA 5IT4A 2GHRA 4Y2HA 1PK9A 2GQ0A 5EZQA 4XWOA 5TIIA 2VXBA 1XOIA 1FOEB 3GLHE 3LDFA 3LCVB 4FMBB 3OJLA 4IEIA 2ZVJA 5E4YA 4HQNA 1JLKA 4P4UA 4W7HA 1QIGA 4WAUA 2DBRA 1N0WA 4G25A 1L5FA 3BGVA 2NP6A 1XTZA 3B9BA 5K8VA 4NMMA 2EC5A 6ABPA 3MPOA 1KY5A 2PZFA 4FYVA 1VA4A 1OXTA 1L1FA 3SF0A 5KNCH 2RH4A 4FSXA 1SXPA 4OQQA 1XL1A 4E4TA 3NUQA 4FR5A 2OZKA 2R47A 2A9OA 4CTMA 1KAMA 3KBBA 4PZUA 3AM4A 5MN4A 3I04A 4HEJA 4OMFG 5AJYA 3T5CA 5CFMA 4I3FA 1FTWA 3QPBA 4A8PA 4AF8A 5E3HA 1O6BA 4Q7KA 4C4TA 2DB3A 3QTTA 3DL7A 3TF5A 5IDYA 4JH0A 3O1JC 3V1KA 1B7GO 1EXNA 3GVXA 4EZEA 2H4JA 4KUHA 3RBAA 3U2QA 1PLJA 1D2NA 1MGPA 2WIGA 3RIHA 2KBFA 3L0CA 5ANRB 3NBUA 4X41A 4A10A 3N9IA 4LOIA 4YAIA 3HUEA 2IRWA 1Q1EA 3AUJB 1COWD 3D2LA 1TEVA 2FMIA 2X41A 3PG5A 1GCOA 1RWXA 1SRRA 3EXHA 1COZA 3H0EA 3KLMX 4H6XA 4LK3A 4R9NA 4KSYA 1XEFA 1QQ7A 3K5WA 2BHSA 4G2TA 4QDXA 5FPSA 3SQLA 3WADA 1WQ4A 1VJDA 3L8CA 4H4CA 3VJKA 4RW0A 2WOJA 3NOXA 4ASUA 3OD5A 4MW5A 5CCBA 3WK8A 4JLWA 4Z9BA 5AM4A 3ADBA 3PFFA 1TEHA 5FI1B 2W6NA 2Y8EA 2XVYA 4NICA 2LRHA 4JFAA 4Q3OA 3RNLA 2ZUFA 3HR8A 1YHNA 2C95A 3EPHA 3B12A 3U13A 4GKBA 1NMQA 1FF9A 4BKRA 4TL6A 1GPBA 4Q00A 2E37A 1M34E 2F9MA 2HOQA 4W5QA 2IOQA 1IY0A 2ZJ3A 1TVKB 5HTKA 5TR9A 3TNJA 1WXEA 4NBKA 4D74A 4V1CB 2RJOA 3C3AA 4EW3A 2XBMA 2ZJ1A 1A1VA 1IXSB 3NONA 1DXQA 3RSHA 3TD2A 5JSQA 1JU3A 2OMKA 4KLZA 1J23A 2OD9A 2Z2XA 3EIHA 4A23A 1ZJYA 2H0RA 1JG2A 3KD2A 3EH1A 1NN1A 3ROXA 5H9WA 4CWAA 3W4JA 2ZAIA 2AW3A 3OA2A 1A7AA 2ZBVA 3KXIA 1M1NA 1TECE 3JTMA 3QMMA 3P2MA 4PQEA 5JSFA 1BJKA 3AETA 4EJ0A 2G40A 1BHO1 2P6UA 4LHVA 1D6NA 4DPMA 4LF7B 3UA4A 2EBUA 4EKEA 1DV1A 2QNBA 4ATNA 4IV8A 1AQUA 1NMEA 3E1GA 4GGPA 3L6BA 2Q3JA 4NP6A 2UYCA 4OSPA 1I1OA 2H2HA 1U7XA 4OP1A 3E7WA 3KZOA 1MB4A 4NI5A 3W5VA 2WYHA 2XXAA 1AKWA 2GRJA 3GA7A 4IVPA 3FCXA 4S1TA 3GRCA 1E2NA 2AVNA 4MQ4A 1OROA 3MYYA 3E7FA 2BFWA 1VG9B 3A6ZA 4UUNA 4DGQA 4HQRA 2CD9A 4ZOLB 5L53A 5E4FA 2JAWA 1VMAA 2XSZA 5C1PA 2FNAA 1OILA 4ISBA 1Z29A 2XKAA 1XTUA 3U4CA 4LG1A 3QSYA 1SR8A 2R6HA 3D0OA 1I6KA 1ZN9A 3UKJA 1TUGA 4RPJA 4ONEA 5EWJA 1QAOA 3N75A 4W9NA 3BA6A 3TRIA 1PZNA 1E5TA 1UFOA 4UD6A 4GI5A 1NQAO 1RWNA 4JI7B 4MUMA 4BVLA 1JFLA 3S40A 3O83A 4LX0A 3FWYA 7MDHA 5K3BA 3CVUA 5G2OA 1HZZA 3WDKA 1WD7A 1YFJA 3K8YA 2YVLA 1MMFB 5KTKA 4PR3A 3UAXA 2DWUA 5ALIA 4ACBA 1YHYA 2NZVG 3FB4A 2BHTA 5JOQA 1LTQA 1GGEA 2OG1A 1C30B 2D0PB 2WJHA 1II9A 5E6SA 1UWKA 1V8OA 4Q3CA 2GCNA 2ID4A 3N7AA 4MUKA 4POOA 2QW8A 2ZJZA 4LW8A 1VIYA 3LLCA 5HHTA 1Z17A 2WA1A 1AZSC 2WOOA 3NM6B 3PJEA 3Q2IA 4NYIQ 4UTNA 1JR3A 3GIDA 2OGWA 4KQJA 4LF4B 4GXRA 4NU6A 3LVBA 4B3RB 4GKKB 2ZB7A 3SWWA 3RTGA 1Q57A 1EHCA 2VCEA 3RRNA 4BYGA 2D7DA 2VDOB 4U7GA 2I3GA 1Y37A 1IAVA 5JMTA 1ZJ4A 1E4EB 1DUSA 2F1OA 4IYJA 3RB8A 1TU0A 1RTKA 1I33A 3C7AA 4NH0A 4ZOQI 4KXNA 1G291 2GEJA 2JA2A 2Y3IA 3FPKA 4II2A 4MI3A 4Q3LA 4DCTA 2J5KA 5LP6B 3QEBZ 3Q3HA 2D0OB 1XTPA 1YTLA 3W05A 3AF5A 4YJDA 2C2GA 1MW8X 4MVJE 2FN7A