4DMLA

3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
241
Chain Sequence
LPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMAEKLLEVIPLGRYGEAAEVAGVVRFLAADPAAAYITGQVINIDGGLVMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
publication title 3-oxoacyl-[acyl-carrier-protein] reductase from Synechococcus elongatus PCC 7942
rcsb
source organism Synechococcus elongatus
molecule tags Oxidoreductase
total genus 89
structure length 241
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dmlA00
1YS4A 3JQBA 1IB6A 3M6IA 1KEPA 4O63O 3IS3A 2G76A 1PZFA 3W8FA 1C1DA 3VDRA 4GX0A 3UGKA 2EEZA 1J6UA 4UEOA 5F21A 3G79A 3K8ZA 2D5AA 3G0OA 4IQ8A 4RVDA 3INTA 1DB3A 2NVUB 4Q3DA 3V2HA 4XB1A 5IAAA 4DVJA 4HXYA 1QLHA 4II2A 2P9GA 3ZNQA 3OA2A 4J4BA 4XJSA 1XU7A 1GQQA 4E6PA 1QXSA 5IDQA 3AUSA 2O7QA 5ITWA 2BFOA 4CMIB 2H1SA 1RM5A 1YH3A 4WCDA 4ZQEA 1TT5A 1X15A 3U9LA 1XQ6A 1YBVA 2NWQA 1QP8A 1HRDA 2PV7A 3AOEA 4NBRA 1SEPA 3I23A 1GYPA 3JQ8B 2VZ9A 4EITA 1VRWA 1BXGA 3ULKA 4O6VA 3R3SA 2IE0A 1LSSA 4AFNA 2YQ4A 4PG8A 2OHXA 1C3VA 3O8QB 3QHAA 3I1JA 5KJFA 1YB5A 4E21A 2WWRA 3E9QA 1X7GA 4BB6A 2VYNA 1E1LA 1PL7A 1GYQA 4XB2A 4FC6A 3RFVA 5KJEA 5B4VA 1NP3A 5C37A 1EE9A 2D0IA 3IIEA 5HS4A 1FK8A 4CLRB 4FFLA 3ETGA 3G17A 4CMHA 3ZU2A 3F5SA 4HWKA 3DZJA 2QIOA 1E7WA 2GN8A 4LRTB 2CD9A 3RKUA 1VL8A 1YDEA 2VNSA 4RPHA 1ZXLA 3HHPA 3DFZA 1Q7GA 3VH3A 3VZPA 4EUEA 1IUKA 1LDNA 2QX7A 2V6FA 4FBGA 1NXQA 2AQIA 8ADHA 3NTOA 2HK8A 5G4LA 3BMCA 4AJKA 3ZV5A 4CR8A 3AU9A 1GAEO 4WLNA 4AVYA 3PIDA 1KS9A 3LF2A 3PGXA 3TZ6A 4WK6A 5K6AC 3A4VA 3WX0A 3H3FA 2Y1FA 3MJTA 2JCYA 5EERA 3UCEA 3BYZA 5A4DA 4RVSA 1PL8A 1ISJA 2DKNA 2TMDA 4IDDA 1OZAA 3PK0A 3RC2A 4CPDA 3H2ZA 4CUZA 4O0LA 2NADA 3PJDA 2HRBA 4QSMA 4R1SA 2IDZA 3KSDO 4JX8A 5KNLA 4LSMA 1LSUA 4NBVA 4JBGA 4Z6KA 4I8XA 4IM7A 3GK3A 3GGPA 5JC8A 5EESA 2AEJA 4IUYA 4OOEA 5ITVA 1JLLA 4TWRA 4YJGA 2PR2A 1C0KA 4WJZA 3RBZA 4J7UA 4TRRA 1DLIA 4BO1A 1BVUA 2IRWA 3K73O 3VZQA 3DZBA 1RJWA 5FWNA 1T4DA 2IXAA 5JBIA 3HDYA 4UEJA 4XRRA 4PGFA 1ADFA 1MUUA 3VZRA 3A14A 4O59O 4MKXA 1PS0A 4YBZA 5TJ9A 2X9GA 2VWHA 2J5KA 4UULA 5IDWA 1NVTA 2ZIZA 5G4KA 3IC5A 4CLXA 1XLTA 2GZ1A 1YWGO 3VH4A 2OMEA 4G5HA 4RF2A 1E5LA 1EVIA 2PFGA 4R5MA 1U7HA 3GUCA 3W4KA 2ZJ1A 2GPTA 4J1TA 4HP8A 1CERA 3AY7A 1BWSA 3OJFA 1I8TA 1ZJZA 2VUUA 1Z73A 3IMFA 2O50A 2HDHA 2I99A 4KZPA 4BO2A 4E5KA 2EG9A 3LYLA 2OL4A 3DEYX 3D1LA 1VI2A 2XXBA 1HDOA 4FSHA 3BMOA 3WWYA 4TRNA 5A1TA 4E12A 5ENVA 4BKOA 1HDZA 1VJ0A 3DL2A 1NFQA 3ADPA 3GLQA 3RQSA 1V0JA 2GLXA 2CFCA 2J3IA 2PKQP 4IINA 3ZZNA 1Z45A 1KEWA 1Y6JA 2Q1WA 3Q1LA 3C7DB 3A9WA 1OFGA 3SC4A 4BGUA 5T67A 4E2ZA 3CKYA 3KB6A 5TQVA 2GD1O 1UUFA 3R1IA 4DQUA 1W73A 3LQFA 2YYYA 4BKRA 2NUAA 4ND1A 4YRDA 3GDFA 2QRJA 1HETA 4W99A 3X2EA 1H0KA 2X5KO 3ZDFA 4A0SA 2E4AA 4DL9A 4CV2A 4OIMA 1LC0A 3LZ6A 4NJMB 2FR0A 4WOKA 3AOGA 3AUUA 2GN4A 2P4QA 4MVJH 4PG4A 3DMTA 4J9VA 1NQAO 5F5NA 3NJ4A 1H9BA 2X0IA 3A1NA 3I9LA 2YQ5A 1YGYA 3RASA 3ZWPA 4XGIA 1B8UA 1V3UA 2B5WA 4JJFA 5H83A 4HKTA 1I32A 4FC7A 4XWYA 1V3TA 3S55A 4H16A 3S8MA 4UVEA 3MEQA 5DZSA 4FD3A 2AMFA 1R6DA 4N7RA 3CUKA 5AXAA 4NDNE 4CQMB 4R1TA 2G17A 4YWJA 1GQ2A 1HEUA 2DPGA 4XQEA 5IXSA 5EJ2A 5KJ1A 3WB9A 3HADA 3ZU5A 4DQVA 4PVDA 3F1KA 1EZ4A 1AXGA 3WGOA 2OGUA 1DC6A 4RVUA 4YCAA 4L73A 2JD2A 5DBFA 3TN7A 2ZQZA 1RKXA 3B20A 4XA8A 1ZJYA 5JCXA 1L1FA 2NSDA 2O3JA 2VOJA 3ZW9A 1YBAA 2PH5A 4WLEA 1HYHA 3QP9A 3BMQB 3ICCA 2F00A 4PG7A 4CM6A 5JAMA 1UP7A 2DFDA 4W82A 4B7XA 5DT9A 1PWXA 2NVUA 4E2XA 3GRPA 1G1AA 1H6AA 2GN9A 1D4FA 1BHSA 1EVYA 4TQGA 3HJAA 3ST7A 1VM6A 3GVHA 3BHIA 4CMIA 3VH1A 4BNZA 3H2SA 4RF3A 4MOWA 3GNQA 2X5JO 3KLMX 4ND5A 3PRJA 4O1MA 1HE4A 1NR1A 5JLAA 3H4VA 3ZU3A 2C5AA 2B69A 3JQ8A 2BF7A 1PQPA 1BRMA 4OQZA 3IJRA 4IQ0A 4NH4A 3RJ5A 1MFPA 3JD0A 4CMGA 2FR1A 1XEAA 3L4BC 3A28A 1NR7A 3HN7A 3AI3A 3OEWA 1WWKA 5EQFA 2BLLA 1VC2A 2BGMA 4RCVA 2PH3A 5IZ4A 2BI8A 2NM0A 4LVUA 3U3XA 1GPDG 1RM3A 3WS7A 1F0YA 3RCBA 5AYVA 2O4CA 2BD0A 1M6HA 3WYBA 4XKJA 2CMDA 4CLRA 4GKBA 4RF5A 5FEUA 1ZK4A 1VL6A 5I9LA 4B79A 2Y1CA 4RV9A 3UKOA 2BMAA 4A10A 3AM5A 5THKA 1WXDA 4KUGA 1FDTA 3E9MA 4IGFA 3JYPA 3VPSA 4A5OA 3QY9A 1PGNA 2DQ4A 4NNJA 5IN5A 5COAA 4Z0PA 5EIOA 1EE2A 4MIOA 3QIVA 5CPFA 4QEDA 3PZBA 4WNIA 3LT4A 3OJEA 4OQYA 4PG6A 4Z3DA 1ENYA 9LDTA 1HKUA 2YDXA 1LTHR 5JO9A 1ISGA 2G0TA 5CDTA 3P7MA 4AL4A 4YRAA 2ZTMA 4QECA 4MIYA 3ZU4A 5ER9A 1PL6A 4E5PA 5HM8A 4BHTA 2OBYA 1FMCA 2RHRA 2V6MA 1X7HA 2EERA 3SJUA 1U3UA 3ZWAA 1MG5A 3FPLA 4MKZA 3PZRA 2O7SA 5DBGA 4ALJA 5EINA 2JFHA 1KETA 4IZHA 1UZLA 3CMMA 5DP2A 3JQFA 3N74A 2VTDA 4I5GA 1I2BA 2OZPA 4MP8A 5DP1A 2NLOA 3PQDA 4BNMA 1TI7A 4J9UE 4R41A 4YJDA 2ZYGA 4AJLA 2VHWA 3ICPA 2TMGA 2Z95A 1NVGA 3PQEA 4BS9A 1NAHA 2NVWA 3WGIA 4OL9A 5C7IO 1PZGA 3N7UA 1DO8A 4UUOA 1U7TA 4W9NA 3OH8A 3L07A 4OHUA 1NQ5A 1DRWA 4PG5A 3IJPA 4PZCA 5FI5A 4MVJG 4AICA 1DC5A 3S2IA 3ANMA 5GZ3A 2Y99A 3OICA 1J0XO 4FFMA 4U8GA 4OJNA 1TT7A 3HNPA 2AE1A 5JO0A 4FB5A 4RL6A 5L9AA 4CUKA 1VE9A 4Q3BA 2FPGA 3PHHA 3HZZA 2AG8A 4E0BA 5ES3A 4J1QA 4WECA 2CDBA 2RCYA 2Q4BA 3GA0A 1KVRA 2IZ1A 1M2WA 3QA9A 1NASA 2HMSA 3BAZA 4IDCA 5A3JA 5MDHA 1LDYA 2J5QA 1GADO 1O5IA 3ETEA 4FW8A 1VSVA 3GMSA 3MWEB 1ADGA 3OFSA 1WP4A 1ULSA 2C7VA 1QYWA 4WCFB 4BIIA 3F46A 2Y1EA 2C20A 5B4TA 2Q50A 2YFHA 4RDIA 3JQAB 2EHDA 2Q3EA 2IEDA 4XR9A 1PEDA 2R00A 1KERA 1YJQA 2J3KA 3PFWO 1V35A 3GZ4A 1EQ2A 5F5LA 5FYDA 2YDYA 1VJ1A 4DRYA 1I5RA 2O3SA 4GWGA 3AWDA 1J4AA 3D4NA 3DHNA 5C7OO 1NPYA 3WNQA 4QT0A 4E2WA 3IKTA 1BDBA 3JQCA 5EL0A 4NJOA 3ROMA 1KIFA 5T8KA 4UVGA 3CINA 1C0IA 1LX6A 4UVIA 4EGFA 2BELA 2GR9A 3WBBA 4D0SA 1DIGA 2A9FA 4N18A 3JQEA 3IP1A 2WD8A 4IS3A 3GNSA 3TOZA 2Q2QA 1TEHA 4NJMA 2YHIB 4HBGA 4OYRA 1PGPA 4BO6A 4QX6A 4BL5A 4ALMA 4RF4A 1SCUA 5CPBA 2I3GA 1ZXBA 3PTZA 1N8KA 4W7IA 4TVBA 3QVWA 1H6CA 4M54A 3GHYA 1ZFNA 1P1FA 5K0ZA 2DUWA 1HLPA 1GU7A 3NUGA 3VKUA 1JKJA 4IDFA 4FFRA 1DAPA 1UH5A 1X13A 3DONA 4FCCA 4DREA 1SNYA 1F12A 3DC2A 2X9NA 4N5MA 3WYCA 5BT9A 4OKIA 4DPMA 4XYLA 1DXYA 3RU9A 2WYUA 3PXXA 1XKQA 2XF8A 4AG3A 4CQMA 4I5DA 4NK4A 1ZKMA 1H6BA 2DBVO 3LF1A 4NU6A 1PJ4A 4TRMA 4DLLA 1ADCA 4HX5A 2I9PA 3T7EA 3OETA 4AJ2A 3RJ9A 4I9HA 1T2CA 3PHGA 1QMGA 1E3SA 4PLCA 3S2GA 3K6JA 2OOSA 2VUTA 5IZCC 2EKLA 4KQWA 4F45A 1H93A 1NTOA 1D7OA 4NFSA 2FPIA 1SAYA 3QE3A 1DSSG 1E7QA 3MZ0A 4WLUA 5KOIA 2XPCA 1D3AA 2O3TA 3NTRA 4PLWA 3IAHA 5DOZA 5ICMA 3B1JA 3TZQA 3V2GA 2EJVA 3K9QO 4CLOB 1JW9B 1OI7A 3HE3A 3RC1A 1LEHA 4E13A 4LVCA 1Y81A 2NVBA 4RZIA 4OSPA 1PJ2A 1DPGA 1WDLA 3TL3A 2IZZA 3S2EA 1YXMA 1DIHA 2D59A 1K3TA 3HG7A 4BMVA 2WJPA 5KVCA 1TB4A 3UXYA 4B3IA 3K2BA 5IN4A 3INGA 3R6DA 4DXHA 4FGSA 2JD0A 1LLQA 2VWQA 2DAPA 2E48A 4R9SA 4Y6RA 1DIRA 3GAFA 4CV1A 3E5MA 3VOSA 1PZHA 1ZNQO 2Z5LA 4NBWA 4MDHA 4E5NA 3DDNA 3QV1A 5TNXA 4FDAA 3JQ7B 1U1IA 3SVTA 2DBQA 3WMXA 3V1TC 2E82A 2FR8A 3UFXA 3DZHA 4Q3AA 2B83A 2X0RA 4PZEA 1V8BA 4CM9A 3C1TA 1UAGA 5JC1A 3D4OA 3PYLA 4Y98A 3DMYA 3WGZA 5G0TA 4XRGA 3K31A 1OC4A 3VTFA 4J4TA 4CM4B 5TGDA 3KYBA 2OUIA 2QRKA 4BNVA 1RPNA 3O38A 2C5EA 4GLLA 1H2HA 1U2DA 2CDCA 1GZ4A 2J5RA 5JYEA 2CF5A 2RBEA 1T2DA 3OQ1A 4CQMD 2HCTA 3ZNNA 4WPGA 3M1AA 4CR7A 5JNLA 2BGLA 4IJWA 4K9DA 4M87A 4ZD6A 3G1UA 3WOHA 3JQ6A 4HY3A 1Z74A 3OHSX 4XYEA 5IJZA 1FJHA 4CV0A 4L76A 4B8WA 5LDHA 4YR9A 1ENOA 3ZHZA 5KKAA 1E3WB 1Y5RA 3UAGA 2GASA 3AW9A 1MFZA 5KVQA 1ZBQA 1R12A 3EAGA 1DRUA 3MJVA 1HF3A 3LSYA 3HN2A 3WXBA 2DT5A 2DPHA 3JTMA 4LSWA 1HE5A 1UXJA 1ZMTA 1Y1PA 4NHEA 4AJIA 3ZCXA 4CM1A 4M8SA 4YACA 4DLAA 4HFNA 2H9IA 3O4RA 5BNIA 3WFJA 4AJPA 5L4NA 1A7KA 2OP0A 4E33A 5CEJA 2AEMA 1NQOA 4RQUA 2X0JA 4HNHA 1B14A 1VJTA 1XYGA 1UXIA 4YT2A 1DHTA 4URFA 3GFGA 4CQLA 2X9VA 3F3SA 1UXKA 2OP1A 1LQTA 4TMFA 3RBVA 4I1IA 4RVFA 3B6ZA 3ZH2A 1NBOA 3A06A 1X1EA 1WDMA 1QKIA 1M67A 2C59A 2EW2A 1I3LA 4MVJP 2VT2A 1Y8QB 3KV3O 3SLKA 4BVAA 2GERA 4DIBA 3SJ7A 3KM0A 2BKAA 2X86A 1GY8A 1SZJG 4C7JA 4WEQA 4NPCA 1O9BA 4L75A 2PZLA 4U0JA 3FF4A 1SC6A 3ROQA 4TKMA 4F3YA 3DAGA 1J49A 4D46A 4Q9NA 3H9JA 3QW2A 4OO3A 1PR3A 4MVJD 1DJNA 4GI2A 3C3XA 5CDYA 1IE3A 4XDZA 4PN3A 1PSDA 1Q0QA 1KVSA 1AE1A 2RH4A 3C85A 1F17A 3PLRA 2PGJA 1PJCA 2VT3A 3FBGA 1JDJA 2NU9A 3C1OA 3GRKA 4E5MA 4GMGA 4WCFA 1DFGA 3GPDG 2G1UA 5K6AA 2WTBA 1C0PA 2QQ5A 1AUPA 1H94A 1NFRA 1GR0A 4MP6A 4JBHA 3JQAA 3TZHA 4R16A 1ZK3A 3ABIA 4NZ9A 3E8XA 3C1AA 3INRA 3TWOA 2O48X 4IIVA 1MB4A 3JYOA 2X4GA 3AK4A 3OQBA 1M76A 3KXDA 3FNHA 4Y6PA 3O03A 2LDBA 3RKRA 1UZMA 5T64A 4EJMA 1I3NA 3H9EO 4OXKA 8LDHA 3JYQA 1Z7BA 1EBFA 3HDHA 1WW8A 4PLZA 1BGVA 3WR5A 1C1XB 4A2CA 4WLVA 3ZHYA 3FSRA 5DCYA 5L7YA 2D5CA 1R15A 4M1QA 2AQHA 2CY0A 2EV9A 3K5PA 1B3RA 1P3DA 1E7YA 1PJ3A 5EN4A 5TS3A 2ZKLA 4G81A 3E48A 2BH9A 4YQZA 2P5UA 2X22A 4BKQA 5KIAA 1T1RA 3OP4A 4P4LA 3L0DA 3TPCA 5ER6A 1YDWA 4R9RA 4U5QA 3AFNA 1IHYA 2YHIA 5HTOA 3W6UA 3MWDB 3P2OA 5BSGA 2R2GA 2I3AA 1H5QA 4BQRA 2J3JA 1GV1A 4CLEA 3GT0A 1ZEJA 3VPGA 4GH5A 1WLYA 2RH8A 3GGGA 4E2YA 3ASVA 4CMCA 1M6WA 2F1KA 2NQ8A 3ZNOA 2VRBA 4D3SA 3SBOA 4PLPA 1EEHA 3I4CA 4OOFA 2I66A 3RC7A 3O9ZA 3LT0A 5G0VA 4H15A 4I5EA 1QLJA 4D79A 1W6UA 3MOGA 4BMSA 3BMNB 4XD2A 1PGOA 3FHLA 4UVHA 2OO5A 1VPDA 3DZKA 1WNTA 4R3NA 2FP4A 3UUWA 4ZN6A 4E3ZA 1Y9EA 2ET6A 4LMPA 3OM9A 2VYND 3ADOA 1GZ3A 3NT4A 4XJTA 3ZWMA 2HUNA 2YHUA 3H6KA 1ARZA 5U1PA 4XYBA 2GSDA 4DGSA 3GZNA 3N58A 3TQHA 2WD7B 2JJYA 3MJSA 3OBBA 3VZSA 4CODB 3NKLA 1NX6A 1LLDA 4Q3EA 3DTYA 4BNTA 1U3WA 2RIRA 1X7DA 2Y0DA 2ZB8A 2ZJ0A 4QUKA 2HMUA 5A9TA 3WSWA 1B8VA 1ONOA 1GFSA 4HNGA 4M89A 5ILOA 4YA6A 3OF2A 4XQ9A 3SC6A 3WJAA 4CLOA 2IEBA 3D0OA 4NFHA 3STHA 1K0UA 1YE3A 1FDWA 1ISIA 1YO6A 3DHYA 9LDBA 4BO7A 1P1HA 1ZK2A 4ZGWA 2XOXA 3DXFA 4GKVA 3WSVA 3TJRA 5EMHA 5BSFA 1SB8A 1T2EA 4PLVA 3DQPA 4R69A 3NJ8A 4ZRNA 4I9NA 3AI1A 4RJTA 3KETA 3PI7A 3ZV3A 1Q0HA 4QFDA 5LC1A 1MC4A 2JL1A 1Z75A 3QWFA 2DTXA 3WDSA 1VKOA 4GVLA 3HFGA 3NDJA 4RVHA 3QSGA 1E7MA 5CP8A 3WLFA 2I67A 3PEFA 1EDOA 4BNJA 4LGVA 3JQ7A 2Y05A 4CM8B 1B26A 1NWHA 3GDGA 4Z9XA 1I30A 1Q2XA 3GN2A 4B7CA 1ZCJA 3RD5A 4IMPA 1HYEA 2WE7A 2VN8A 3LC1O 4OMUA 3PGJA 4PRLA 1JN0A 3H7AA 4CM4A 3DBVO 4YTEA 3GEMA 4LMRA 5ADHA 1UJMA 3CMCO 3JCZA 3MJCA 4RZHA 4YAEA 4Z9YA 4P8RA 2VQ3A 1XU9A 2Y1GA 1ONPA 2C54A 3GEDA 3L4SO 4L4XA 1HWYA 4OSOA 5AVOA 4DYVA 3KEQA 1A71A 4D42A 4OH1A 3LC2O 5LDGA 2DFVA 5JMWA 1R0LA 2IYPA 4E4YA 1GCOA 4EW6A 4BO9A 5GZ1A 1X0VA 3RUDA 2CSUA 1OC2A 1AHHA 4OKNA 3E1KA 2YV1A 2WSBA 1PR9A 1T1SA 4TVOA 1E3WA 1EK6A 1PIWA 2Q1TA 4WOJA 1P0CA 3PHLA 2Q45A 3ROKA 3D3WB 1G0NA 1K6XA 3NDIA 5A9RA 5A5FA 1LBEA 1F8GA 3CTMA 1LSJA 1A5ZA 1LQUA 4TROA 4OXYA 3DB2A 1BW9A 5F3RA 2Z1NA 3L6EA 1Y8RB 1SOVA 2QYTA 4PVCA 5FI3A 3I52A 4IJUA 3H9UA 3EMKA 3PLNA 1BTOA 1V9LA 5B37A 2A92A 2EKQA 4BO8A 3CZMA 2AW5A 3HUDA 1AHIA 3LLVA 3FPCA 2B4QA 4IDGA 3RUEA 3RI3A 3DOOA 3ANNA 4PLTA 5DCUA 3L4BA 4CMBA 1KC3A 3FN4A 4IXTA 3BHMA 1ML3A 2FOIA 3EZLA 1T24A 2ZYAA 1E0DA 2CNBA 3CEAA 2VNAA 1Y8QA 1DJQA 1PQWA 4RPGA 4QXMA 3DTTA 2VZ0A 3OSUA 5BNFA 4KOAA 4YAGA 5C5IA 1M66A 5TIIA 3VAZA 4GMFA 1SEVA 1H2BA 3TRIA 5B4UA 5DDIP 2EIHA 1XG5A 2NU7A 2B5VA 3JQ9C 3QWAA 3WTCA 1I24A 1MXHA 4U7WA 3Q11A 3AY3A 2EGGA 5F1OA 2ZTLA 3MOIA 1UDBA 4Y8VA 1PU2A 3FI9A 3C7CB 4FS3A 4XX0A 2DTDA 2YW9A 4B4VA 4FIZA 3QWHA 1F8FA 3SLGA 2FRDA 2P91A 1ZK1A 3F5QA 1IL0A 2GN6A 3M2TA 4Z3KA 3JSAA 5A03A 2ZK7A 2GZ3A 5H82A 4OAQA 2Q2VA 3X2FA 1BVRA 2I65A 1QYCA 4DLBA 1AN9A 2GGSA 2GNAA 2GUGA 3EUWA 4BV8A 2EF1A 2C29D 1NHWA 1R4NA 4LCEA 3CPSA 2J6IA 4JP2A 3EGOA 5TX7A 5JPIA 4RLHA 1YL5A 4BNLA 2JD1A 3GOHA 3L9WA 4KWIA 2DUUA 3UCFA 1KEUA 1ZMOA 3OEYA 3PDUA 1C1XA 2WYWA 4M55A 1BMDA 3V2UA 4K6CA 2ZB7A 3ZWOA 5L53A 1N1GA 4MIEA 3IP3A 3FWNA 2GO1A 4YEDA 4AJJA 4E30A 1X0XA 2C82A 5JDIC 4XIJA 4WNCA 2P9CA 3GY0A 3I4FA 1DOHA 4IDEA 2C0CA 4G2NA 3W4IA 1GTMA 1IPEA 1F14A 1QV7A 4MVJE 4JK3A 5G0UA 2EGHA 3BHJA 1SPXA 3FR8A 3UICA 2ZCVA 3JYNA 1FF9A 3KYDA 1NYTA 2D3TA 4CUJA 4DC0A 4BB5A 1Q0LA 4A03A 2B36A 4EI2A 4D43A 4GX5A 3WGYA 1LRKA 1RYDA 1FDSA 1U28A 3ONEA 4QO8A 4ZQHA 1DEHA 3UOGA 5DCWA 2PNFA 1JWAB 1TVEA 2AQKA 2V6GA 3DOJA 4I08A 5F1KA 5A3VA 3VKVA 4CQLB 2HQ1A 3WQSB 3HB4X 4H3VA 1P77A 4F6LA 4TRJA 4DA9A 4YRBA 1KEVA 4XYGA 2I5PO 2Y0CA 3BMNA 3KOUA 3ASUA 2B0JA 2FN7A 2PKRA 4GQAA 4LK3A 3EC7A 4JCOA 2VHYA 3U4DA 2HAEA 4IXWA 1H9AA 1HDXA 3MJEA 2ILTA 3HSKA 2Z1MA 3VHRA 1NNUA 1Y9AA 2FWMX 3MTGA 1BXKA 3JQGB 3OJ0A 3H9GA 1SB9A 2BFAA 2WD7A 4R5HA 4S3MA 5KCZA 5DN9A 3G49A 1PS9A 1ZIDA 3B1FA 4HFRA 4OM8A 3DBHB 2W90A 2NNLD 4XGNA 1U5CA 5TC4A 3F1LA 3GC6A 3KSUA 3ZWXA 4DYDA 3CIFA 5JCJA 1PJQA 1QG6A 2C7GA 3BXXA 5MGBA 4DIOA 3MCVA 5CG1A 2AG5A 3ROPA 4L8VA 2O3RA 4J16A 2CDAA 1LJ8A 1GDHA 1V6AA 5KJCA 1Y5MA 1PGJA 3I6IA 4P4GA 1FDUA 1DIBA 3F47A 3D5QA 3IDSA 3ZV4A 1TXGA 4A27A 1LSOA 2I76A 1EUDA 5A06A 1QR6A 3OJOA 4J4HA 2A35A 1WAMA 3MTJA 1MX3A 2GYYA 1NVMB 4XZ3A 5GMOA 3OIGA 1F06A 2R6JA 3ZNPA 4IQGA 1DLJA 4P38A 1UDAA 1ID1A 5HBRA 3LC7O 3EYWA 1A7AA 4W9NC 2QW8A 4PRKA 4MPDA 3RC9A 4CM8A 4PLYA 1WMAA 4MO2A 1N7GA 1K89A 3DO5A 4ALNA 3GVPA 3K92A 1WZIA 1K5HA 3JYLA 3TL2A 3EVNA 4CJXA 2EJWA 4PCVA 5L3ZA 1EVJA 4PLFA 3B70A 1I3KA 3Q6IA 4CMEC 1T2FA 2D8AA 2H5LA 3PFFA 1J5PA 3ZWWA 4AJEA 4TZKA 4FPXA 1G6KA 1A9YA 3PHIA 4Q39A 2AHRA 3E9NA 4BNNA 2YJZA 1N7HA 1EFLA 3VPXA 3FNEA 2HSDA 1DHRA 4IMRA 4XQGA 1GUYA 5JY6A 2QHXA 3IUSA 3KEOA 3Q9UA 4Y9DA 5IZCA 4A7PA 2VHVA 2X6TA 2B35A 2AE2A 4D3FA 2IZ0A 3ZWYA 1ZH8A 2O2SA 4KQXA 1GD1O 4JNKA 2UUPA 1OMOA 4BO4A 3CH6A 4DWVA 4ND3A 2E6UX 3F6YA 3D3WA 3GGOA 3HB5X 4FQ8A 3H5RA 1D8AA 2NTNA 4KWHA 2ZTUA 1CETA 4ALKA 2HJRA 4DPKA 2VYVA 3WGGA 5T57A 5A04A 5CEEA 3HDQA 4L4SA 4QQRA 1LNQA 1Y8RA 3GZNB 4YAIA 2EW8A 2PD4A 3PWSA 5IFLA 1QRRA 3ONDA 3EHEA 3H9QA 3PP8A 3CE6A 3ONFA 2VUSA 3UW3A 3SX2A 1QYDA 1U8XX 4J1NA 4FN4A 4I9UA 2OFPA 1ZW1A 2BGKA 4QTZA 1SOWA 6ADHA 5KWEA 1WPQA 4ONEA 1N2SA 6LDHA 4FJ0A 2O4UX 4D7AA 2BHLA 4HADA 1KYQA 5L40A 1HTBA 1PJBA 1RM4A 2O3UA 1YKFA 4KUEA 3IUPA 1P1KA 3WQRA 4IJKA 3DBRA 1HE2A 1P44A 1LDMA 4K1LA 4YQYA 2HMVA 5TF4A 3ZI0A 3RU7A 3FNGA 3FCOA 3H5NA 2B4TO 3D64A 4N54A 2GZ2A 1B8PA 1ISHA 4YAJA 1YB4A 3JD4A 3G3EA 3TOXA 1JKFA 2X7HA 4BO5A 1R4MA 4XEHA 4MP3A 1EVZA 4BMNA 4W6ZA 4JJGA 1E6EA 1LU9A 1P45A 4AJNA 5JAIA 4L4RA 1Z7EA 2PZJA 1MLDA 4LRSB 3G1TA 2C2YA 3D5TA 1IZ9A 3WGQA 4DPLA 3T7CA 1R0SA 1O0SA 2X0NA 4L74A 5AXBA 4D41A 2EKPA 3F4BA 1GUZA 2ZYDA 3VH2A 4L9RA 3QVTA 4XCVA 2EXXA 4DMMA 4Y67A 2P9EA 3L6DA 1WDKA 4JIGA 4RPKA 5I8WA 4FOSA 2H63A 1SO8A 4II3A 2I6TA 1QYVA 4FR5A 3W6ZA 2ZTVA 3GFBA 4X54A 5JDCC 2DVMA 4J2HA 3IOYA 3IQDB 3DZIA 3TZKA 4CLHA 1Q7BA 3D3EA 2FSVA 1UR5A 3GVIA 5CDSA 4BKUA 1T2AA 3Q2KA 5A5EA 2POQX 3KYCA 4WE3A 4N5LA 4J6FA 5JMPA 3WGTA 1LA2A 1YQXA 2Q46A 1GQYA 1YL6A 2W2LA 4N5NA 3AY6A 4BO3A 3RROA 3HWRA 1LLCA 3VPHA 1KOLA 3BIOA 1RM0A 2XXJA 4A73A 5L4SA 4KDFA 1QSGA 4BNKA 3KRTA 4HUJA 3AUTA 4GLOA 1ADBA 3NGXA 1UXGA 1QV6A 3E18A 3DAPA 1BW9B 3I9NA 1N1EA 2IXBA 3I9KA 5ILGA 1C0LA 3I3OA 2GF2A 3V1UA 4J91A 4BV9A 3Q9NA 1VKNA 4BNHA 3GEGA 1PJTA 1D1SA 3LT2A 1B15A 5KJ6A 3U4CA 4XGKA 4BNIA 4BQPA 1KVUA 4B4UA 1JAYA 1HDRA 3LK7A 2DBRA 3NV9A 2JCVA 4R51A 4CM7A 2W4QA 2Y93A 4MVJI 3L9XA 4WLFA 4GX1A 4BOYA 2FSSA 3K2EA 2PY6A 4FGWA 2W2KB 1I10A 1ZUD1 1BDMA 4NK5A 2YV2A 4IDAA 3QVSA 1GZ6A 4CM9D 2Y68A 3JQGA 1MXFA 3H8VA 1U5AA 1B0AA 5GY7A 3AFMA 1PQUA 2DTEA 3LLSA 3NRCA 4PLHA 4R4JA 4PZDA 5HA5A 5FF9A 4CMKA 3BZUA 1IY8A 1HZZA 3DBHA 4G65A 4J7CA 2UVDA 4RQTA 3RFTA 4BGIA 1YOVB 4FJ1A 2V6BA 3PPIA 5B12A 2P4HX 3GHHA 4Z0TA 1I2CA 1WVGA 3Q0EA 4GGPA 5KTKA 1E7RA 5L45A 1U3VA 2CZCA 3WIEA 1NM5A 1JQBA 2PZKA 3JQBC 4IDBA 2EWMA 2HMWA 1ENZA 1E92A 3OIFA 4LCJA 3W8EA 1I01A 4CMAA 1YL7A 1TA4A 4WKGA 3VVCA 1AGNA 1PX0A 4XQCA 3S1LA 1E3IA 3TSCA 2W2LD 4JJIA 3GH3A 1TLTA 3NDRA 1HSOA 4C7KA 5HRUA 2DM6A 1Q1NA 1R4NB 2VCYA 2ZQYA 3WLEA 1I0ZA 1EFKA 3NYWA 2NV6A 4Q3CA 2W98A 3OQ6A 1DRVA 4LISA 5DF1A 2NQTA 3WIDA 1CQJA 2AA3A 1KBZA 3I83A 5IXYA 4FFNA 3AOEC 4P4NA 1B7GO 4P22A 2DU8A 4RVGA 4HFMA 2JKVA 1IOLA 3I9MA 4U0KA 1QYXA 4CR6A 4RPJA 5AXCA 3AI2A 3FWZA 4RPLA 5TSDA 4B8ZA 4UVDA 4GBJA 1QORA 3GQVA 4HV4A 3RFXA 1A4UA 4J3FA 3GUYA 3HFSA 4ALLA 1ZK0A 3DFUA 3E03A 4YT4A 4YJHB 4ZQGA 3P2YA 3JD2A 3KYDB 3E6AA 2PKQO 4GWKA 4WCFC 5JFOA 1HDYA 4F6CA 1GL3A 4TZTA 4R3WA 5KKCA 4IS2A 3GVXA 2PK3A 2JCXA 5I9NA 3KUXA 5JSFA 2RAFA 3D4PA 3WQQA 4E32A 3OA0A 3F4LA 3QRWA 3C8MA 3GMDA 4ID9A 1EK5A 1E77A 1KY5A 1U4OA 1U9JA 1XGKA 4BO0A 3L6OO 3EVTA 1ISMA 5DBIA 5HS6A 3PYXA 1R16A 2A94A 4NIMA 5DNAA 3M2PA 4BNUA 4ZICA 2PTGA 1K6IA 4NMHA 1P0FA 3JQDA 1ZEMA 3GNTA 1X1TA 4GSKA 1A27A 1ORRA 3BTUA 4W7HA 3U09A 3SEFA 1EMDA 3JQAD 1PS8A 4ZQBA 3QWBA 2BFMA 3UN1A 4CMJA 1EUCA 3HQ4O 4B4OA 3E5RA 4KUHA 1HLDA 2WE8A 5BQFA 1YRLA 4Q3NA 1GPJA 1I33A 2P68A 4YPOA 4CM5A 1LC3A 4EUFA 4OXNA 1FDVA 1KY4A 3AM4A 4EEZA 1JA9A 3BTSA 4NR0A 3RUCA 3WYEA 5U4QA 4WUVA 5CEFA 5A9SA 2IODA 2B4RO 3ORFA 1XSEA 4IJVA 2AQ8A 1RWBA 2NTVA 4PLGA 4ILKA 1X14A 1LDEA 3WBFA 5BSEA 5L7WA 2BRUA 1DAOA 1ZVMA 3BTVA 4K28A 4DIFA 3F9IA 5G0WA 1ZZEA 4J90A 1OBFO 4C4OA 1Q7CA 2FY8A 3NTQA 1B2LA 4OGWA 2Q4EA 3WGHA 3WFIA 5ICSA 2Q1SA 5K9ZA 3DOCA 2FZEA 4KTTE 5AQ1A 1W8DA 1DC4A 2YUTA 1SMKA 1MP0A 3NEPX 3D7LA 1LXCA 1E6WA 3JD1A 4YJFB 3ZWCA 2VWGA 1HE3A 3O26A 4FOOA 1CRWG 1A9ZA 1NAIA 1A72A 3KBOA 3FNFA 3RBXA 4ROSA 2WM3A 1LDBA 4JROA 3PJGA 4RORA 1CYDA 4ZA2A 3R3JA 4RO0A 1U2GA 3LVFO 5BNTA 4AJHA 3RWBA 1UP6A 4YYZA 4WASA 1O6ZA 4BUCA 1CJCA 1MA0A 5THQA 2UUOA 3C24A 3GN1A 3H3JA 2Y0EA 3AU8A 3RIHA 2O23A 1PJSA 1KVTA 2PD6A 3I5MA 4DC1A 2PZMA 2CVZA 2Q2WA 3U49A 1E6UA 3VC7A 1R37A 4A26A 2CVOA 3CZRA 4KMSA 1YQDA 4NBUA 4NU5A 3I9JA 1K2WA 4ND2A 1E1NA 1XA0A 5TT0A 3UH1A 3RAJA 5J23A 4YDRA 1YBMA 4I5FA 1G0OA 3AJRA 2X58A 1OOEA 3V5NA 2QZZA 3I9OA 1E3JA 1ZSNA 4J2OA 2C2XA 2DC1A 5IG2A 1GYRA 1NHGA 3HDJA 3BA1A 4M49A 4UUPA 5CFZA 5KVVA 3WG9A 4IBOA 3JQ9A 3IKVA 1WMBA 3OMLA 4GX2A 3K30A 3DMTC 4KTVE 4CM3A 3KLPX 4JLWA 1IPFA 1UP4A 5BR7A 2NACA 2W8ZA 3TFQA 1IZ0A 2ZB4A 3U4HA 2W2KA 1T25A 1O95A 2PGDA 4D3DA 4ESOA 3DBRB 4NG5A 2GCGA 4ZVVA 2Y66A 2G82A 2ZCUA 1I2ZA 3COSA 1IHXA 3MJ4A 2DLDA 2O2YA 1DBVO 4MVJM 1V3VA 3LT1A 4J49A 3ZWBA 1R4MB 2D2IA 4K6FA 4WEOA 1XQ1A 5A02A 3ZWNA 4EBFA 1H6DA 1YOVA 3Q2IA 3QWIA 2NU6A 2QRLA 3RUFA 1Z6ZA 1XCBA 4UEKA 4B7UA 3V8BA 1O8CA 4XYMA 4ZU3A 4DBZA 3Q3CA 5I9MA 3IL2A 2X23A 3ZW8A 1E5QA 3S2FA 2V65A 2ZATA 4ND4A 4PIVA 7ADHA 2J3HA 1S7CA 3AM3A 4NI5A 4MINA 5JDIA 1W0CA 3PDJA 4ZQFA 5AOVA 3VPFA 2JFFA 2WMDA 5DOVA 4R01A 4DUPA 1E1MA 3KTDA 3K96A 3PWZA 3O8QA 3R0IA 3DBLB 1LRLA 1KVQA 5I7SA 3DZFA 4MVJF 4JBIA 1HT0A 1U8FO 3H5AA 2RHCA 1B3BA 1N9GB 4JXKA 4R1NA 5FFFA 4R54A 2H6EA 1KC1A 2FHSA 1ZO8A 1HSZA 1DC3A 3KYCB 4Z9FA 4GAEA 4W4TA 1ZSVA 3I6QA 1DFIA 4GSLA 5I7FA 2JHGA 1EQUA 3ZN2A 2V7PA 3DHEA 3WTBA 3VVBA 5C3MA 1HL3A 2UYYA 3H65A 3QJ5A 2X1HA 2C07A 3NX4A 3U5TA 4Y6SA 1CWUA 3PJEA 1R0KA 1Y7TA 1P31A 3ITKA 3L77A 4JN6B 4YJHA 4ZRMA 3TDKA 4NQZA 1YONA 4B4WA 3W8DA 3T4EA 1MV8A 2JAPA 4O5OA 4KP7A 1JTVA 1N92A 4J43A 5L95A 3QVXA 4DTIA 1W4ZA 3GF4A 4GVXA 1B16A 1P74A 4EDFA 1LRJA 4R1UA 1L7EA 1LI4A 2OORA 2Y67A 4UUMA 1YB1A 3PJFA 3FTPA 5BSHA 2HMTA 2HKIA 5CG2A 2UDPA 4YVFA 1NQTA 1C14A 1I3MA 5JAQA 2UAGA 4CL8A 1MC5A 1HZJA 4FFOA 4EYEA 4J0EA 1JKIA 3TNLA 3P5SA 1IULA 1IYZA 2PGLA 4MKRA 5TT1A 2XAAA 2O3QA 5EPOA 4R68A 1C1DB 4UREA 1I36A 2EP7A 3WICA 2JAHA 2LDXA 2GRAA 5T6BA 2VZ8A 3U0BA 1PJLA 3ZGYA 1XWFA 2HK9A 2YY7A 2Y1OA 5G0SA 2HK7A 4CV3A 4F46A 5L4LA 1GCUA 1UDCA 4BGEA 3W1VA 1BXZA 1P33A 2QYSA 1ONNA 4LN1A 2G5CA 4S1VA 5JY1A 1LDGA 1HDCA 1O89A 1TT5B 3PYMA 1YVEI 3FRJA 1U4SA 3EW7A 3JQFC 1DDOA 5F1PA 5TRTA 3WWZA 2YFQA 4H7PA 1BXGB 1NPDA 3WJ7A 3ENNA 5I7EA 4TKLA 3UF0A 1HDGO 4CMEA 4WLOA 1RYEA 2ZB3A 1CF2O 3KVOA 3GVCA 3AUAA 1HXHA 4D44A 5IDYA 3ZHBA 5COBA 4IPTA 2VRCA 2PA3A 4J7XA 4J1SA 2Q99A 5A05A 1T26A 3DWFA 4QFCA 3EY4A 3C7AA 1N5DA 3WMWA 5TLSA 2HU2A 3JV7A 3W4JA 1YJ8A 3JD3A 4YXFA 3DR3A 4LW8A 3V1YA 2HJSA 3VTZA 4YT8A 3GAZA 3LDHA 4IZIA 3UHAA 4EJ6A 4DBVO 3ETDA 3BMCB 3EDMA 5IDXA 4YJFA 4KDEA 5CAEA 3UCXA 4UUNA 1JWBB 1P1JA 1GEGA 4J0FA 5LCXA 4BNFA 1E3LA 4ALIA 4AJ1A 3NAQA 3UVEA 5C7LO 1ISFA 5HWSA 5L7TA 3KHUA 1VSUA 3FR7A 2WYVA 4GPD1 5JXWA 2YV3A 3KSZO 4K26A 2A4KA 1XR3A 2GDZA 5CDUA 2QZ9A 1PTJA 2WEKA 2HO5A 3B1KA 3FBTA 4PFJA 4GL4A 4D0RA 1PWZA 5CDGA 2R00C 5L51A 3DAFA 1EBUA 1UXHA 3GPIA 3PHJA 1OAAA 4BNYA 3ITDA 2UV8A 3RUHA 1VL0A 3PWKA 5H81A 5JCJD 1P9LA 2D1YA 1GUFA 2OBNA 5GZ6A 1GEEA 1DFHA 2VHZA 2P5YA 1SBYA 4YJGB 4EUHA 1E7SA 2VOEA 5COQA 2PWZA 3ZWVA 1NWCA 4NBTA 4QO7A 4CL3A 5T8KC 3ANLA 3TF5A 3CXRA 3FD8A 1FXSA 5EQDA 1XIVA 4BNWA 5ENDA 1PGQA 2NTJA 4BGVA 3EK2A 2BI7A 4IY1A 3EZYA 4TSKA 1NFFA 2P2SA 2VTEA 3GDOA 2NU8A 1XELA 4E31A 1P1IA 5IF3A 1E3EA 4L0QA 4MJLA 1R66A 1CQIA 3U62A 3NT5A 5G4KB 1D1TA 2OXIA 2SCUA 2DBZA 2B37A 2VRCD 1LUAA 2VHXA 2J8ZA 2JHFA 4IGEA 3VDQA 2EP5A 2CUKA 4D45A 4B3JA 4RGBA 7MDHA 3PQFA 3BTOA 1UZNA 1LLUA 2FPPA 4FFPA 4IIUA 5A9SB 1CEQA 1K6JA 3BMQA 4YAKA 1EUZA 1AXEA 1PZEA 1MGOA 5B1YA 4GGOA 4U6SA 4BNXA 3RUAA 4FJ2A 1ENPA 5JE8A 1ZSYA 3CSDA 4WGGA 4CLDA 2FMUA 3NT2A 3LU1A 4XIYA 1A4IA 2E37A 5JDCA 1Z82A 2X8LA 4B3HA 3DZGA 3BMOB 4RDHA 4EZBA 3ZV6A 4DQXA 1CDOA 4YB8A 3NGLA 4UAGA 2FZWA 2Y1DA 4EJ0A 3RUIA 3QVOA 5I7VA 1WZEA 3PIIA 5I8ZA 4JQCA 5G2OA 3OIDA 4BNGA 1L7DA 4EEXA 3KZVA 4AJ4A 1JU9A 3DBLA 5DULA 3QLJA 3RVDA 3ENKA 5TJHA 2HRZA 3FTNA 4U6QA 2Q1UA 1ULUA 5CHEA 4ZHSA 1VLLA 2PLAA 5AXDA 1N9GA 4RLSA 2VYVD 5JAZA 1UAYA 1DIAA 2JFGA 4XDYA 1XDWA 2E49A 5JS6A 1XHLA 2D4AA 4MVJA 2AEFA 4E5YA 1S6YA 1CIVA 1GV0A 3GG2A 5U9CA 1NPTO 3GG9A 4DMLA 3SXPA 3U4IA 2AXQA 2QG4A 3KO8A 1JAXA 2Q49A 3T4XA 5JW6A 4Z0HO 2BFPA 3OECA 4XR4A 4ITUA 2YZ7A 2PD3A 3GR6A 1U3TA 4YT5A 3E82A 1MG0A 1P1RA 1JVSA 1M75A 5KVSA 4JP3A 1YQGA 3TFOA 2WDZA 3P19A 1JVBA 1O94A 4JGBA 1BG6A 3WNVA 2CVQA 4INAA 4BKPA 5JYDA 1T4BA 2CF6A 2X5OA 5T5QA 4M86A 3PVZA 3TZCA 3ZHXA 4ZJUA 2VWPA 3M1LA 1HYGA 4HFJA 2IYOA 3OJLA 4AJOA 1E1KA 1EDZA 3ON5A 1BSVA 3RSHA 3QQPA 4NFYA 2HLPA
chains in the Genus database with same CATH superfamily
3DM5A 2ZOSA 1CCWA 1R50A 1YA6A 4UHEA 4O63O 3W8FA 2ZSBA 4R2MA 4BVHA 4UPEA 3P0FA 1MHTA 1XHFA 1SR8A 1J8MF 3NEAA 3QLTA 4L27A 3G79A 3KJXA 4RVDA 1FTGA 3NUZA 1DB3A 1YI0A 5CFRA 4FINA 3WK9A 4HXYA 1QLHA 5TMEA 2ZSJA 1AKEA 2G6BA 2HCRA 4GNKA 5E9JA 2OOKA 5MHTA 1TC2A 2CBGA 2J59A 4E6PA 3PLAE 2ZRHA 3AUSA 3KVVA 1H4TA 2A88A 4IVQA 4FB4A 2W2XA 5ITWA 4OX9B 3LDGA 5J4YA 3FNIA 2JLVA 1W4RA 2XYPA 3PDIA 1TYEB 3GLKA 1KEKA 2OCYC 1XL1A 1QP8A 2PV7A 3N76A 4JLAA 2IOQA 2PUJA 1XAIA 1RI4A 1VMEA 2RGXA 3BE5A 2ONYA 3CZAA 3QV2A 4P7KA 3CEHA 3N28A 4TM7A 1FP7A 4LOJA 1ABEA 5LU9A 4CEJA 3BG5A 4EITA 3GFOA 4H27A 1VRWA 3EIQA 3O84A 1UWKA 3GX1A 3L7DA 4BCBA 3HBAA 4C3ZA 4O6VA 4GLJA 5JCPA 2X8JB 2NGRA 2YJGA 3NVAA 2GWHA 2WILA 3R3SA 4IO0A 1C30A 3VNQA 1I1HA 4KQIA 5TARA 4FEYA 3SQMA 1J5EB 2IEZA 3B6MA 3DH0A 3NKVA 2IXGA 4ARZA 4P53A 1YB5A 3ND6A 3ORHA 4HAZA 1X7GA 2VPPA 1SHJA 1PL7A 1YR3A 2XVXA 1J2TA 4YAUA 5LNK1 3OTGA 2FQ1A 3IDFA 5AK3A 1P0QA 1N25A 4S1NA 5GVSA 3ZU2A 3QOYA 1V5FA 3O4FA 3KQUA 1E7WA 2RE8A 1BDHA 4IEEA 4LRTB 3RKUA 1VL8A 1YDEA 1N5MA 2A57A 1Q7GA 1JDUA 5DHPA 1JR4A 3AFIA 2NXNA 1LDNA 2V6FA 1ZN8A 4M98A 1XD2A 2OAP1 2IU0A 3SK0A 1SD2A 1X6VA 3LLCA 1TEZA 1I80A 4RJIA 3RHZA 3EISA 3TMAA 4AJKA 2VA8A 4URVR 2Q5QA 1NZFA 4I46A 1KS9A 3VR6H 3LF2A 4MPTA 4L50A 3PGXA 2ZIGA 1XVVA 4R1MA 1E2FA 1GDDA 2RK3A 3NH9A 3TZ6A 1FJXA 1QO0A 1JXAA 1T1JA 2QJFA 2HSJA 2R1VB 2JCYA 4M8LA 4UBMA 3STVA 4B87A 1PL8A 2H4JA 3A1VA 1NNSA 2DKNA 2TMDA 2FJUA 3HPQA 4ARBA 1WSAA 2MDTA 4PO1A 5H4GA 3RC2A 3P9RA 1EVQA 4J0CA 3H2ZA 1YAJA 4MCIA 4OHPA 2CCJA 1R10A 1FX0B 2EZ4A 4NX2A 5KC8A 5B53A 1QP4A 2HRBA 4WY2A 2IDZA 4LBVA 2D5BA 3CRMA 2EBWA 4LSMA 2E4WA 1CUXA 4KPYA 1SVSA 3H5IA 4RMGA 1KAHA 1CY4A 3MS2A 2FMHA 3DKKA 4RHYA 4XWKA 5EFZA 3M9XA 3Q3IA 3E4CA 5JC8A 5L3RA 4FFDA 5I7UA 2AEJA 5ITVA 4C05A 5DNYB 4XWGA 1NC1A 2CEAA 4FGKA 4WBNF 3QEBZ 2JGKA 5HJ7A 4RDXA 3UWDA 3N8GA 4GI1A 1FLNA 1V2GA 2ZBFA 2AW3A 2HZ7A 1EWRA 4URZR 4A1OA 3DNFA 3N3BC 5ENZA 3O93A 4XASA 2ZU6A 1P75A 3CF6R 3HDYA 4XRRA 3JWPA 1ADFA 4ZAYA 2JHAA 4H1WA 2DFKB 4WZBB 1BD4A 1LBTA 1ZD8A 2C5FA 4O25A 1XV5A 1SHTX 1KL7A 2ON6A 4BNDA 3FTQA 4YBZA 4WBNB 5TJ9A 5K0BA 3HNOA 2VWHA 4HVLA 3OO1A 1VLJA 4LDPA 5F12A 1CUHA 3M9LA 4Z5XA 4CLXA 1NF9A 2BTOA 2JI9A 4NKRA 3THWA 1YWGO 1A77A 4TTAA 1U1CA 2Z8YA 2B82A 4FYKA 1EVIA 2H8KA 4G5GA 4E2ZA 1ECPA 1KKLA 4I66A 5CUQA 2VSOA 4LTDA 3W4KA 4XD7D 1A9XA 4B5KA 1EPUA 4F92B 4J1TA 1L9XA 1J39A 4JB8A 3N53A 3O0DA 4CF3A 2IH5A 2JS7A 4MHTA 1QNFA 1R0ZA 1ZN7A 3SSMA 4ERNA 5K8VA 1IM5A 3AHDA 2FSIA 5K4GA 3G2MA 5ISMA 4OP3A 2O50A 5HUJA 3FPKA 1YIAA 3MS4A 3GFPA 4BPRA 3RVNA 4QVIA 4K0RA 2I2DA 2IQIA 4BO2A 5JH7A 1G291 4YMSA 4R98A 4HB2A 1Z26A 2A8YA 2ZJ5A 1QO0D 1SXIA 5D5HA 3RHFA 4DZTA 3R0QA 1IN4A 1HDOA 1HGXA 2XKBA 7ABPA 3BMOA 3WWYA 5LD2B 2BUBA 4TRNA 3VTAA 1TCUA 1CS0B 4RMJA 4BKOA 1LW6E 1TYBE 3OHPA 1S9HA 3FPSA 2MSDB 1C9EA 4JUIA 4AWAA 5JALA 1E2BA 1L8XA 1OKKA 1V0JA 4NBSA 5E3IA 2CFCA 1RJ9B 2PKQP 4C7BA 4F93B 2HNKA 1FSGA 1QHYA 1Z45A 5C1PA 1KSFX 1JLRA 2HW8A 1TO6A 3H17A 2GFIA 2KBFA 3VU3A 5AD1A 2QTZA 1TM3E 4F72A 2GF9A 2VDNB 3CKYA 3H6GA 2GD1O 1UUFA 3EPHA 3HZOA 4L9WA 1RQLA 1F6WA 1C29B 2JGEA 3KJEA 4YV0A 2H0RA 2NUAA 4Z9BA 3VNRA 4CWAA 3REQA 4QTYA 4OI0A 4U7GA 5KINB 5J2UA 3AEQA 4MQFB 2A5JA 3W2GA 3GDFA 1LFAA 4W99A 3FSGD 2XVZA 3NTLA 5CIQA 5GINE 1OH5A 3ZDFA 2E4AA 2WFAA 1KFBB 2JFOA 2OCIA 1W4AA 4NJMB 4J0IA 5CCDA 1RZ3A 2FR0A 3AUUA 2ISCA 5JJKA 1EGAA 5E9QA 4EY3A 3DTVB 3PJRA 1VOTA 4PG4A 5KTSA 2R11A 5EMMA 4V1CI 2W8BB 1M0SA 5AKEA 5F5NA 5DEOA 5IM4A 1AQLA 1E2JA 1EWVA 3BB3A 1VFNA 2YQ5A 4MWTA 3AF5A 1VDZA 4NHOA 3IO5A 5EG5A 5CJJA 1PV1A 5CXQA 5I4BA 4JJFA 3LCJA 1JKJB 2NXEA 5GJBA 2PUFA 2XE4A 1I32A 1IBCA 1E3QA 3P71T 5AVUA 1DG1G 4HWRA 4EYKA 4ZIRA 4US2R 1PZXA 1S3SA 1XTPA 1R6DA 2AMFA 1B8OA 3DWEX 2QMEA 4NDNE 5AQEA 3VC1A 2NG1A 2R8BA 1EK0A 2BGRA 3CUYA 3ILSA 3K4PA 3MT9A 3WB9A 3OM0A 4M8IA 1ES9A 1J0DA 1CR0A 4EW1A 2AKYA 3LKVA 3ZU5A 2EIXA 2BFEB 3GJ3A 1EZ4A 4EX7A 4V3CA 1G7RA 5HFAA 2OGUA 2R47A 2HREA 2NO5A 4D0LB 4ZHQA 3TN7A 3D0RA 1ZJYA 2XGOA 4NARA 5JCXA 1L1FA 3JZIA 4PXYA 2OR3A 2PIDA 2YMLA 5AVQA 3KWLA 4DM7A 1NY5A 1PDOA 2PH5A 9ATCA 3QP9A 3OURA 3DE5X 3L8GA 1ZW6A 3ICCA 1WTAA 4CM6A 4CYMA 2WD9A 2ZJZA 2G4CA 2DFDA 4F2DA 1C50A 1PWXA 2NVUA 4B2YA 3JVIA 1OF1A 3GRPA 3TYXA 1OBOA 4KVAA 4KRYA 3U7HB 1MC1A 1MGPA 3HJAA 3GRUA 4MMXB 2P6MA 4G41A 4YMHA 2YWGA 1YS6A 4C7MA 4YCCA 2WINI 2QT0A 4JITA 5ALGA 3DDUA 1V41E 4Y2HA 2FPXA 2NVOA 3VH1A 2QLMA 3H2SA 4JJKA 3VO1A 4BNZA 4UTZA 1P2GA 3QYAA 2XCQA 3AH8A 4ND5A 1I3OA 3ELYA 2GDJA 3CKLA 1ZOOA 3RWMB 2BF7A 4EELA 1ZD2P 5K6RA 1JSXA 4OQZA 4KE6A 3W6PA 4JR2A 5ALFA 1LVGA 2XZLA 4NH4A 1CUSA 1BX1A 1MFPA 4OQEA 2G1AA 1KI6A 2FR1A 4IAOA 3RJ5A 2VBCA 3HN7A 5B1IA 1HT3A 1WWKA 5B55A 4F0JA 1ABFA 6YASA 4RCVA 5FWDA 4EJSC 2B4KA 5IKOA 3DMNA 1ORDA 2NM0A 1FS5A 4LVUA 1GPDG 4BBPA 1RM3A 3WS7A 3DQQA 5AYVA 2ZBRA 5BSRA 3RODA 3UAYA 3ZHOA 2CWWA 2GEBA 3H2HA 4G0XA 1TO1E 3MC1A 1WETA 2DFNA 1QHHA 3I6BA 5FEUA 5TMBA 4AUEA 1VL6A 1CB0A 3H2BA 4I4IA 4FW9A 3T5DA 1H3EA 4RV9A 4HZIA 2BEWA 2I4MA 3UKOA 3P0JA 4LJRA 2FCAA 3AM5A 4JVOA 1WUHS 1WXDA 2WFLA 3MFQA 5THKA 3RIMA 1RLUA 1J7KA 3M6UA 3R0XA 3E9MA 2W7TA 3JYPA 4KBFA 3KKKA 5K09A 1N34B 2VJYA 3C6XA 4IV5A 3D02A 1VDMA 3HCFA 2CJWA 4DA4A 1LD3A 2QYHA 1VFPA 2WWHA 5COAA 4Z0PA 1CEEA 5EIOA 1EE2A 1GGMA 4MIOA 5FPKA 1ORVA 1ZUNB 1GT91 2FRDC 2P1DA 1JHPA 5CPFA 4DJ5X 4QEDA 5SY4A 3QBVA 1XWIA 3TXYA 4LOIA 1ZJ5A 4Z3DA 3TIGA 4RD1A 4XOUA 1USKA 4HJXA 2WZBA 3S8EA 4Y7CA 4YCDA 1QE3A 5JO9A 4PX3A 2G0TA 1TJ5A 4LHZA 1AKRA 4ZCRA 3UGJA 4HQLA 3GJSA 1NLUA 2VPXA 3C3CA 3PD0A 3ROTA 2ID7A 4BX0A 1T4MA 4EGCB 3ADDA 3LVBA 2OBYA 3QUSA 4JXZA 3KKQA 4D99A 4KWTA 3A1TA 1JFRA 1X7HA 3GRYA 5FBHA 1BX0A 5H1YA 1U3UA 4HQKA 4LYDA 4REMA 2XTZA 4HRXA 4EPWA 3T52A 2O7VA 1N5JA 1DAGA 3G2NA 4L0CA 2JFHA 1EVEA 3I2IA 2HT1A 2VDWB 3RRJA 3KJFA 5F7XA 4OXIA 3A0RB 3JQFA 4A6XA 4B2PA 3GP5A 1PR0A 1GNPA 4MP8A 4LJ7A 3NRJA 4WFJA 4BNMA 2G83A 1WXGA 4J9UE 5A3QA 2ZYGA 4EA9A 3EF0A 1CR1A 4JOQA 1GJRA 2NZJA 3H0CA 3GZTB 2Z95A 2VPQA 3DE1X 5CBPA 1M5RA 4NE9A 3REOA 3O4JA 4MAAA 3WYEA 1U7TA 1X86B 2LIPA 1SUSA 1CUGA 1W9HA 2J9YB 2O1WA 3HWX1 4R0NA 1DQRA 1S2LA 3UXMA 2FN3A 4OHUA 4WESA 4JOBA 2XDYA 1KO4A 2Q2OA 1QGED 4HGNA 2Q4TA 4MVJG 1DC5A 5D8DA 4WOBA 3DMFA 3ZGOA 3ANMA 1J0XO 3EOAI 3ESYA 1MW9X 4WKOA 3K0EA 2BHNA 4OYHA 4IXNA 4UOEA 4RJKA 2H1CA 4CUKA 2JPDA 4FYPA 4G8BA 3OIYA 3LKBA 3MD9A 3TVYA 4HGOA 3T9AA 1XNHA 3QLUA 5ES3A 3WI7A 2BUAA 4N6NA 2ZSAA 2PRSA 4M1ZA 4JJAA 1N57A 2VDKB 1E96A 3ZD6A 1G8GA 4MLPA 4DNOA 2H0AA 1UL1X 4DRZA 4LC0A 3TE6A 2IZ1A 1M2WA 1Z6QA 2R6HA 2UVQA 3PXEA 3FMPB 3TRDA 3NIBA 2IVZA 2AUMA 1WP4A 2VATA 1KRHA 2QROA 2VF7A 4GXRA 4OEHA 4XARA 3RIYA 3C1UA 2WAXA 1DEXA 2B20A 2JIOA 2Q50A 3BH6A 1E8DA 3EDYA 4FMBB 2CFRA 3HRKA 4RDIA 4RTQA 2EHDA 4LK2A 2Q3EA 3H1EA 4LX0A 4L5BA 2R00A 1PTKA 1TMYA 3HYSA 1PSWA 1CY0A 1CV2A 3QTLA 4JB3A 1XTZA 2B21A 3L7YA 4QDTA 2PGAA 1IXRC 1QIHA 3M0EA 1DQZA 5I01A 5F5LA 2F3RA 3ZS9A 4PBRA 3JPWA 3G2KA 4D3ZA 4FIDA 2AFHA 4L08A 1LS1A 2HA3A 5AM1A 4DSTA 4ED9A 4JELA 1R5OA 2AFIE 1J09A 4QXPA 1R0XA 4XWWA 1YU9A 4OGGA 4X20B 2EJBA 2DX7A 2FXIA 3HCRA 4E22A 4RCYA 3GJYA 3T3NA 3IVXA 1PFGA 1P29A 3KYJB 4QT0A 3IKTA 1BDBA 3B5IA 1MB2A 4PQYA 2Y9PB 1BA3A 3TQCA 5BN1A 1JB1A 1UOEA 1IJFA 3TLEA 2GR9A 4GQIA 3CB4A 1W52X 1QB7A 3WBBA 1DIGA 1JMVA 2A9FA 3JQEA 5F9MA 3IP1A 2B34A 4IS3A 2LKDA 3EF1A 4MA0A 2GHQA 4IXMA 3OZFA 4QODA 1PGPA 4RA9A 4QX6A 2WBLC 4LA4A 1IONA 3FPBA 1U5BB 2A67A 2VP5A 2WVHA 1M2EA 1SCUA 3AESA 2H0QA 3LDFA 4TZ6A 5CGQB 3JY6A 3PGMA 5DXFA 5IKPA 2FN8A 5H02A 1UADA 2CZGA 1G3RA 4PQFA 1FFYA 4W7IA 1KE2A 8ATCA 2P2ZA 2FFAA 1P1FA 1IOVA 2W58A 2V5VA 4EHAA 3JSXA 4HWSA 3RFFA 3VKUA 4IDFA 1UH5A 4PXSA 3WWOA 3ZHSA 5KWVA 4FCCA 4DREA 2QVYX 3EDRA 3DOHA 1XXHA 1F12A 4UE6A 4M2LA 4GPZA 5BT9A 4W1RA 4ZVTA 2HA0A 3B13B 4AB1A 1Y9JA 1XJ0A 1XKQA 5DJ5A 3UYLA 1W5TA 3BSYA 1L7VC 1CPYA 3MK31 4NU6A 1PJ4A 3B8HA 3ZVRA 5I5EA 2I9PA 5B3JA 3RSCA 3RJ9A 5LP6A 3PUKA 3QGMA 1T2CA 4I9HA 1Y5NA 4NOJA 5G53C 2XJ4A 3ZDZB 1AH2A 1QX4A 3S2GA 2JI4A 3K6JA 4MEBA 4QBTA 2VUTA 4EMTA 5IZCC 4PGGA 2OFOA 4X92A 1JDZA 4NPHA 3TGWA 4NFSA 1ZYUA 2FPIA 1V1MA 1SAYA 3EEFA 3QE3A 1MIHA 1O6BA 1ZIXA 5HTKA 5HHTA 2NN3C 3BQMB 3K8OE 4WLUA 5KOIA 2Y6VA 1D3AA 4ZPXA 5BR1A 5K0FA 3IAHA 1FU4A 4GMHA 3ZE7A 3B1JA 4CLOB 1QVVA 3HE3A 1OI7A 3RC1A 4JVSB 4E13A 2BE7A 3DHVA 4CTJA 1Z8DA 1Z2OX 4MRPA 4WW0A 4CT5A 1N3BA 3CZ5A 3E9EA 4RZIA 4JJEA 5CNIA 3TL3A 3S2EA 1DIHA 3OPNA 4MRNA 3HG7A 4ECAA 2TMKA 1G3IA 3IEPA 5BYAA 5KVCA 1T2NA 3EA0A 3TGLA 3R6DA 1H2EA 4OHVA 4PFQA 4QXAA 3R44A 2ETVA 1TMGE 2PVCA 3EFHA 1TK2A 2DAPA 1RAEA 5A4KA 1MV5A 4R9SA 2J30A 3IIMA 4QPCA 4QUJA 4Y6RA 4CCSA 2FQYA 3VOSA 1ZNQO 3W6NA 3COJA 3IAAA 2D1QA 1UBNA 3L40A 3DDNA 5FADA 2I1QA 1A50B 2KLBA 4H3HB 3ZS8A 2CDNA 3WMXA 3MFYA 4PS1A 3UFXA 2AYZA 1IY1A 3UAOA 4YJ2A 4JR0A 1SBZA 2X0RA 3ILYA 5H5JA 2O8CB 1ND6A 1P7CA 2PS3A 5JC1A 4TS4A 4EARA 3PKIA 2OYRA 1YZQA 2J45A 1NNEA 3WGZA 2JJ1A 3K31A 3V46A 1CZOA 1Y4DE 3QFHA 3A05A 3OT4A 1ZCBA 5FAXA 4XFKA 5CD9A 2QR2A 1C5KA 1MNAA 1SVWA 2J46A 4DZRA 2JLAA 3M5PA 2PL9A 1P2BA 5AHWA 1L7AA 5DGTA 1F4LA 5EEHA 1EAYA 5E7IA 1T0IA 1PNTA 4CVNA 3O38A 2C5EA 3QX8A 4GLLA 4OG2A 3GLGB 5JAOA 3SX0A 2BP7A 2CDCA 1GZ4A 2CXQA 3CLTD 2IS4A 2RBEA 3UIEA 1LB1B 1TQ2A 3RYFA 1J1UA 1W5BA 1JKMA 2CHUA 2WG0A 1KH1A 2V7EA 3G8CA 3IE0A 3N75A 3M1AA 4JZYA 1T5SA 1M6VB 2BGLA 3BJMA 4JYCA 4WUTA 4GOMD 2V58A 1E2NA 2VSYA 2GCPA 2PMWB 4HY3A 3OHSX 5B6PA 3OSZA 3D9QX 4NYIR 4B8WA 5JVDA 5LDHA 3K6SA 4WOCA 1ENOA 2JARA 5M04A 1X1AA 4NE7A 2XODA 5T4BA 2W6IA 3UKJA 3IHTA 4IEFB 3UAGA 4DJAA 4S04A 3B9RA 2QN9A 4NZMA 3UWPA 3M82A 3T3DA 3OO0A 3D2CA 4UQOA 1E94E 5LR6A 4LKOA 3MJVA 2C00A 4WXYB 5PNTA 5J40A 2DPHA 3LUKA 2OXFA 1Y1PA 3B2EA 1Z4OA 2FUCA 5KVAA 3I5XA 2HDNB 4M8SA 4YACA 5HCNA 4CM1A 4AZ3A 1L7OA 1LPNA 2X2PA 5CK5A 4ABTA 4Q6BA 5IKEA 4RW0A 1CC1S 5BNIA 4M9SA 1FJ2A 3EEYA 2C2BA 4JC5A 4U7HA 2W43A 2AEMA 1NQOA 1GTVA 4E33A 1JMKC 1R6AA 2X0JA 1YRWA 4HNHA 2O7RA 1R8YA 1UXIA 2Q3JA 5JEEA 4DILA 1I4WA 3M4YA 2B98A 4L28A 3C5HA 3USCS 1FY2A 3GFGA 1TF7A 2WZDA 4AQ7A 2X9VA 4G89A 1M8JA 4N03A 4DV0B 5CBKA 2DLNA 2VTVA 4N7MA 3K09C 4QLBA 1L8AA 5JQWA 1RMYA 3IELA 3C3WA 3ZBPA 3ZH2A 4F96A 4QYSA 4AY4A 4NTZA 4C6TA 1JNYA 3OQIA 2O07A 2DPXA 2FZLA 1Y8QB 2XT9A 3SLKA 1CJUC 1DCMA 4KSBA 3SJ7A 3KM0A 5KQPA 2WYIA 4I99A 1SZJG 2J41A 5CLQA 4R9UC 4NPCA 4LXUA 4L75A 4OHKA 3D8HA 3TBKA 2JJ1D 3IAEA 4U0JA 2IHVA 3LWNA 2R6DA 1SQGA 1WPXA 1D04A 4Q00A 2YKGA 1U6KA 1FFXB 3LXMA 2ZVJA 3FYUA 3CRRA 5TF0A 3RGWS 2DPMA 3H18A 2Z0MA 1NV8A 3K05A 5FTNA 5A7HA 4D46A 4Q9NA 3H9JA 3H5WA 3SM9A 1QRTA 4TYYA 5AFSA 1DJNA 3C3PA 3SKYA 4DA0A 3C3XA 5CDYA 3ADKA 3U7GA 4PN3A 1PSDA 1KSJA 4DV4B 3I8OA 2G6TA 2YS7A 3C85A 1IB0A 1JDJA 2P0EA 4KHPB 1JG6A 2NU9A 5ALSA 2TS1A 2VP9A 2P5TB 1XTUA 3M6LA 1DFGA 3H8JA 4MRSA 3ORSA 2JLZA 4YLEA 4ZDJA 1UMKA 2HDOA 1GR0A 4MP6A 5B2EA 5BW4A 1RWQA 4IOKA 3HCAA 3VI4B 1W75A 3ABIA 3ZK7A 1E2IA 4RD4A 1JQ3A 4OBBA 2VQDA 4IIVA 3TWOA 4IOLA 1T36A 3WKCA 1WZ2A 1M76A 3KXDA 4N8DA 1UBTS 2WOJA 4Y6PA 5ANRB 3CVXA 2LDBA 1UZMA 2I8AA 2XBLA 3AJ9A 5T64A 2NYUA 3U44A 2PGOA 3VJMA 4CKYA 1N5IA 1XZDA 3O9MA 5B58C 4TWAA 1BGVA 1OZ0A 2CFSA 1WXQA 1V16B 2FKNA 2LCFA 5D2CA 3KDPA 1N8TA 3WR5A 3ZHYA 2PGXA 3FSRA 4QBIA 1OX5A 2VPIA 4G85A 1R15A 2H8GA 2PAAA 4U2DA 5EYPA 5L7YA 5C51B 2AQHA 3MB8A 5ILQA 4MQMA 3K5PA 1NVKA 1P3DA 4QYIB 3L6RA 5CLGA 3AHCA 5FI0B 4Q21A 4PZPA 3PC8C 4K9KA 1UQUA 5TS3A 5EE5B 4MGYR 5AJUA 2BH9A 3LX5A 5YASA 2X22A 4CTMA 2QDKA 2CV2A 1NY6A 4AO7A 3GIWA 1J2JA 2CUZA 1A96A 1UBFA 3HXPA 3AFNA 3IHKA 4U5QA 3K1ZA 1XMPA 3MWDB 3S6JA 1KAGA 2X14A 3H75A 4EB8A 1XTKA 2I3AA 4ZAVA 1U2RA 1GV1A 4CLEA 1N2XA 4JENA 2OKCA 1SCJA 3B89A 1OZGA 4G86A 2FJ0A 4KSCA 1IEWA 2J6CA 5HJ2A 4A36A 1QFMA 2VRBA 4BLPA 3CZPA 3RC7A 3O9ZA 1IUNA 1Q77A 4H15A 4NBNA 5LYJF 2QTVA 4H4DA 1KXZA 3QYFA 1RIIA 1SGWA 1W6UA 1T2UA 3L43A 4UVHA 4BBJA 2P4EA 5C2JB 1TZJA 1WNTA 4V0LA 5JRZA 4CN8A 1IY2A 1UBSB 4E3ZA 1V43A 2QI9F 5DNCA 5AVXA 2X0DA 1T1GA 1BROA 1LPAB 3A3OA 3LX8A 4HDOB 3ADOA 4IV8A 1YFLA 1GZ3A 2G5GX 2V98A 3NT4A 3CY6A 4RS3A 5EUMA 4B35A 5J4KA 5LYJB 1XPUA 3H2JA 1GVNB 2XA2A 3PFBA 3CR3C 5AI9A 4KX5A 5GQSA 5EVCA 3DKPA 3TQHA 4LY3A 4NS1A 4ND8B 1V71A 3VZSA 1RWVA 4U7JA 3SR0A 1KU6A 3NKLA 4CODB 4DUZB 1LLDA 5GV8A 2FMKA 1M54A 2OG2A 1E58A 2RIRA 3TCXB 4FHZA 5A9TA 1T9GR 4P0QB 2AWNA 1GFSA 5ILOA 3EQ7A 4D26A 4YA6A 3OF2A 1D2AA 2HIHA 2DUMA 1CY1A 3JASA 3N2KB 4L95C 5JZSA 1M8KA 5DTMA 4MVYA 3WADA 2WUVA 3T5BA 4NFHA 3P2EA 3WP0A 1AMUA 1QQ5A 3STHA 2JDIA 4I14A 3A10A 2PBFA 2RHOA 1XD8A 3MD0A 1F3OA 1D09A 2VCHA 1ZK2A 5IWCA 5AOBA 4E14A 3WSVA 1O96A 2VBIA 3NTVA 3I0ZA 4GKVA 4ZYUA 4PZ0A 5BSFA 4R69A 3VR5A 1P18A 3RLFA 1L5MA 3AI1A 3VR4H 4BZZA 2GD6A 4LHEA 1AU9A 5AICA 5T3YA 5EOVA 4BFXA 3KETA 3VJRA 3ABRB 4WY5A 4C1BA 4WN3A 4RHUA 2HJHA 4YDQA 5K8IA 1QPBA 2HWUA 3WDSA 1SVLA 3JRXA 4HL6A 2VK1A 1JFFA 3TGPA 2WB2A 3O7WA 5JU6A 3GRFA 2G07A 1T8RA 3ZZUA 3M1IA 4EG0A 3QSGA 3TOSA 4JXXA 3KZKA 2REQA 2DHQA 2O5VA 2WIFA 3PEFA 3WLFA 3TPZA 4LGVA 1IXKA 2GQ0A 2Q5HA 2Y05A 4TTRA 4CM8B 3WL3A 4EGSA 1MO5A 1YQQA 2EBHX 3BWYA 3I32A 2WMNB 1MC8A 1Q2XA 3GN2A 4PWYA 1EJ6A 1M1YB 1SZCA 2HFJA 3IXLA 5HF9A 4L16A 1IVSA 4PCLA 3ZY3A 2J0UA 1HYEA 4P3OA 3RS3A 5JJBA 2WTEA 2VN8A 4LFCB 4OMUA 5TQ0B 2GRJA 3AO0B 3IVGA 2GI4A 4B7ZA 1U9CA 4R2JA 3X3HA 4CM4A 3BL6A 2VJAA 2B0CA 1ZS9A 4RZHA 4YAEA 2IY8A 5KNCD 4P8RA 4GM0A 1EFRA 4BVEA 3D7RA 1TM7E 2ZVDA 3RRZA 3VZDA 4QRIA 1D7AA 1K27A 3WBJA 4ZZ0A 2MINB 4JVNA 2VNHA 1SQ5A 1N3LA 2A0UA 2OV1A 3GEDA 3DFIA 1QIJA 4PCUA 1AQUA 1OV6A 2CLDX 4HQOA 2VUIB 4ACBA 1VMKA 4D42A 4TV8B 4JI7B 2WJYA 3LC2O 2AR9A 1AQJA 3HRIA 5LDGA 1CT9A 1SU7A 1K7SN 2WHXA 2NO9A 2R6AA 3HO8A 1EG2A 1OC2A 3LUHA 1Z3CA 4OKNA 4PW0A 3E1KA 2HHCA 1CDEA 2QRGA 2YV1A 4WA7A 3V4SA 4ZFNA 1T1SA 5ABPA 1QCZA 1Y63A 1E3WA 1JRLA 2IELA 4MR7A 1P7PA 3PHLA 1E1RD 1ZZGA 4P2BA 1BVHA 2IBMA 3FCCA 3F9CA 3SSAA 1KSGA 5IWAB 2B8NA 1HK7A 1X80A 5JYCA 1FUIA 5B5SA 3ZK9A 2XUAA 5TMPA 4DY6A 3ABOB 4AYTA 4ZK6A 3ESQA 3SXUA 2NMVA 4G1UC 4N0EA 5A5FA 4QE3A 2QV0A 2RK4A 1LQUA 1A5ZA 4TROA 3RS5A 3TB6A 3DB2A 1BW9A 2Z1NA 3A4IA 4PVCA 1NG9A 4HDSB 4ARCA 4B6OA 1GGFA 5FI3A 4BIMA 4RULA 3H9UA 3VR5D 2G28A 3JTEA 5FR2A 1V1RA 5B37A 2EKQA 5I6DA 3O74A 4ZJYA 4DMGA 2LTAA 3CZMA 2EC5A 4LXIA 1AHIA 2CN1A 2XKAA 2YWJA 1G6OA 5CMLA 3GLIA 5HNKA 4KLRA 4OKSA 2PX6A 1IOWA 1WJGA 3UAXA 1NW5A 3AJ8A 2ZSDA 1KC3A 2I6FA 4BP9A 3BHMA 1ML3A 2RGCA 1VGQA 5SYAA 1OFUX 3GPLA 1PQWA 4E7PA 3AF6A 1OLUB 3WBKA 2Z8XA 4JVLA 1YZHA 5JAHA 2EFEB 3T1HB 1QFSA 4IMIB 4R6WA 1M66A 2PLNA 1WHTB 1S2OA 4GMFA 3T7AA 3R3ZA 5DDIP 5F9HA 3CLSD 4Q47A 3ZTWA 5EHZA 1WU8A 4MVXA 4PPGA 4D6PA 3RREA 1MXHA 1KMCA 5DBEX 3AY3A 3NXSA 4TN1A 5LQAA 4BFUA 3U7RA 2ZTLA 1L4BA 4F11A 3F7NA 3BCHA 2DTDA 2YW9A 1VI6A 2H06A 4XX0A 2XMPA 1UPFA 3GCGA 2CLMB 4DQDA 3W0LB 1GGJA 1TUGA 3LXXA 1P17A 1VGVA 1Z5VA 4Q3OA 1E0JA 3U80A 3WJ2A 4D5EA 2J3MA 3O9VA 3AVXA 3M2TA 1G55A 3JSAA 1UXOA 3AF4A 1NYQA 2Q0HA 4KVFA 5H82A 3HVJA 5A03A 2Q2VA 3GJ8A 4FE3A 1XQWA 5AIAA 5DWDA 3FDZB 2QRQA 5IJ0A 4WNYA 4Z53A 4WDQA 2YOGA 1WMDA 5CXUA 4F3TA 4XQ0A 4HS9A 1E0SA 2GUGA 4BEJA 4BV8A 3OZ7A 4EKDA 3TLGA 1EDEA 1X8JA 3PQ8A 2ASVA 3DO6A 3EGOA 5ARBA 1XF1A 3KFVA 1ILWA 1MH1A 1WQ3A 1PT8A 2XTAA 4XWTA 3ZDEA 3HU2A 4RVNA 4AG5A 3L9WA 5J4VA 3DMGA 1FDIA 4I6GA 2CBXA 1I2MA 4JI3B 3TW8A 4A6PA 2LCIA 4M55A 2YW2A 5ALEA 2AZ4A 4QQKA 3VR0A 4EYOA 3OJXA 3HP4A 3IP3A 3MUFA 3A1SA 3CNQS 4HTFB 4K9LA 4E30A 5JDIC 1Z7WA 1ID8A 1CUDA 4WNCA 2BFDA 3FMVA 5BXQC 2VQEB 1WPRA 1P6XA 4RPCA 1VCHA 4OUDB 1M0EA 1SBTA 4NOKA 5TB5A 5EXEA 3W4IA 3AY0A 1L8OA 1FS6A 1QV7A 3K8YA 2WB4A 4EECA 3KOWA 2GRUA 1SKQA 1L4LA 1NUPA 2PUDA 3BHJA 1SPXA 2FPUA 4K81B 4PR0A 2ZCVA 3U3OA 1JHUA 1KMNA 4A8JB 4HVCA 2PX4A 4PYJA 3DCYA 4BB5A 1Q0LA 4EI2A 3NNNA 4DCJA 5AW2A 1FDSA 4D02A 3OQHA 4L6CA 5AK6A 4ZQHA 5A7FA 5CA0A 4NAHA 1KZ4A 2WAYA 4AROA 3QX7A 3L05A 2PNFA 1O97C 3ZYZA 2AQKA 1C9NA 1TVEA 2MYPA 2RGGA 5A3VA 3K71B 3G9XA 1NJFA 3R7SA 4KWCA 3ZGVA 4H3VA 2YBDA 3BGIA 2IP2A 2J08A 2QTMA 3SIWA 4WTOA 4R1LA 5KHOC 1CZUA 3HO6A 5E1BA 2YS6A 3ASUA 2B0JA 4RADA 2OXTA 2OLJA 4UHJA 2HIAA 2J4FA 3EC7A 2R79A 4JCOA 5FTMA 2PT9A 2VHYA 3PVSA 2HAEA 4F06A 1H9AA 2C1EA 3W5SA 3VHRA 2XQGA 1Y9AA 3N70A 3GMIA 2PEYA 4CE6A 4JUCA 2ZIEA 4HDAA 5LA6A 4MQ4A 3ZR4B 2REXB 4QICA 2ZIWB 1CUJA 1SFRA 1XL0A 1E2LA 2AZDA 2XBUA 2HF2A 4LJ8A 4OM8A 2W90A 2NNLD 4MMZB 2WQZA 3ZQKA 4E2FA 4YRZA 5TC4A 4DYDA 4D98A 1PJQA 4HYYA 2F8LA 1BYIA 4DIOA 3MCVA 4QUDA 4J16A 2CDAA 4D9NA 1A76A 1GDHA 1ZI8A 1PGJA 4P4GA 3SIXA 4UTNA 4V03A 1W4BA 1SCQA 1DIBA 4H7HA 5LP6F 1HBJA 1RP1A 3R76A 1A8SA 1VMDA 5ICGA 1K4YA 3KK0A 2C9ZA 4DXAA 1X8LA 5J58A 1QR6A 1BKSB 4C4PA 2ZR7A 4J0KA 5FLKA 5BN4B 4CDGA 4DT1A 4YN3A 3SR4A 3DEJA 1MX3A 3MTJA 2CNWD 2FMTA 3AEUA 4HDRA 5ALTA 3HRHA 2R6JA 5FPQA 3TEFA 1YJXA 4EHKA 2A84A 2QD1A 2FLVA 3CG0A 1GGEA 2XRFA 3EYWA 3SE7A 4B6SA 2XHEA 1FTSA 3WYGA 4AKHA 1H2RS 2XEDA 2WYOA 4PLYA 3ETCA 4LSGA 1WOYA 4PZYA 1C7IA 3WMFA 3LA8A 4KACA 1K89A 2EDCA 3WSTA 4ALNA 5LMCA 3RC8A 4MCJA 4O29A 3H86A 3K92A 1C8LA 3NVDA 2ZR8A 4LJYA 4BJ6A 1J0AA 3QU7A 4NCIA 4CJXA 3H99A 1VP9A 3LY7A 1RP7A 2AMVA 2QTBA 3AHGA 4HDQB 4Q4HB 3RVRA 2F1JA 4PPNA 2C2WA 1VXOA 3BJIC 3AKYA 1J5PA 1Z39A 4UZSA 5K3FA 3ZWWA 4B9AA 2ZCJA 3AFGA 4KDCA 4TZKA 5DCLA 4FPXA 4DJTA 1G6KA 1UPUA 3B7WA 1JQKA 1JSZA 3FDXA 3PHIA 4KFSA 3UG6A 4A8PA 1LWNA 2X3YA 3C45A 4MZDA 1VJCA 1PW7A 3QUQA 2ZM6B 1KJQA 5DI3A 1YDHA 1OJLA 4CQMB 1Y33E 4II7A 1O5TA 1DHRA 1UC9A 3G5UA 2QHXA 3KQQA 3IUSA 4B3FX 3KEOA 4P4UA 4MTCA 2H1OA 4OUKX 3K9NA 1UBCA 4KLAA 2JG3A 3FFXA 1E1YA 2B35A 1M34E 1FRNA 5JRDS 3GLSA 4OI2A 4JNKA 1UFKA 3JAKB 1E4YA 5AW5A 3O8NA 1JE1A 1M6YA 1XDZA 2NYRA 1HFJA 1RI5A 4HDKA 1K9SA 4JLSA 5TS2A 1KOFA 2X2OA 3D3WA 3KJHA 1USUA 5AHRA 1PT9A 4TMYA 2BMFA 2ZTUA 4K6KA 4G25A 3CB2A 1Q12A 4XFJA 3MMSA 4R31A 4ALKA 4N47A 4DPKA 5HKOA 3NOXA 4MUHA 5CEEA 4L4SA 2ATCA 2CLIB 3DSRA 2OCXA 4C3UA 2QKYA 3NWOA 2H1LA 1CE8A 5IYZB 4L6IA 5B1SA 3F8WA 4BX3A 3CKKA 1U8CB 2DUNA 5EJAA 4RTMA 2PD4A 1U2PA 2G7ZA 3COZA 3EXFB 3PQ5A 4GPTA 4MUNA 4Y1RA 2YVQA 4YH1A 1ULBA 3ONDA 4HX2A 5NULA 3ZJVA 4HH3C 1IQRA 3QBTA 2D5LA 4LGCA 3UW3A 3LL7A 4H6XA 2OO3A 4DARA 1BCSB 4O8CA 3CUEF 5HZMA 4FN4A 4QTZA 1SOWA 3HEBA 2XADA 1AN0A 3S2ZA 2OCGA 1CEYA 1D5WA 3JR7A 1Y6ZA 5J3JA 2GBGA 2LKCA 3JAWA 2OQRA 2C5LA 4FYWA 4LE1A 4MQEA 5H59A 3NAMA 5KOHA 4D7AA 1E3MA 3QPAA 5L40A 4Q4AA 4P93A 5DVZA 2O3UA 4KUEA 2CSXA 3Q0TA 3Q3EA 2XITA 2IXFA 1JDTA 4MNTA 5DGIA 3ZI0A 1U8EA 5IUJC 3FCOA 3WV5A 4IQFA 2QTGA 5JR3A 1DWOA 4EFKA 2B4TO 4XOIA 4J3NA 2GZ2A 1B8PA 1UT8A 5EC8A 3RS8A 3G3EA 2L82A 1JKFA 2X7HA 3K9LA 1A7UA 1YQTA 4BO5A 1R4MA 1ZKDA 3GL9A 1EVZA 3C3JA 3GQBA 1U0LA 1BD3A 4MP3A 2BJHA 2HF7A 1E6EA 4JJGA 4TMZA 4KAJA 3T94A 3VKFA 4ACAA 4EKIA 3MWKA 2AC4A 3WVNA 5JAIA 1UMCB 2W00A 3G89A 4L4RA 1EQAA 1O7JA 1ZGZA 1MLDA 2ORED 1WCV1 5A2QA 2FNAA 4Q7EA 4RZ2A 2IHNA 5ES4B 5EE0A 3KWJA 3W3AD 1ZMRA 1XZPA 3GCXA 5FA8A 3VSDA 4FE4A 2QZ4A 4FLFA 1IZ9A 3WGQA 1DRJA 1NOKA 1R0SA 2QJWA 1MQSA 4O4JF 2I29A 1C80A 1RXSA 1PE0A 1UKAA 3F4BA 1GUZA 4G97A 1IUPA 4AAYA 2QXYA 2FF5A 4HQRA 3VM6A 4DMMA 4Y67A 1ZI9A 2LUOA 2ZRPA 3HI4A 3L6DA 3V1NA 1PG2A 5G1NA 1UWCA 4JS0A 4FOSA 3RTCA 2VKTA 3HGMA 1OFHA 1O2DA 3RK4A 4MHOA 5GAJA 3W6ZA 3MRXA 2ZTVA 5DWVA 5EIXA 3DP7A 2HPVA 4O4JB 1A9TA 2Z9BA 2CLFB 2D1FA 3IOYA 3IQDB 1JSLA 2BKXA 5AW0A 5KQLA 3PXBA 4GPIB 3TPFA 1Q7BA 3D3EA 1NW9B 2BLNA 2R68A 1U3DA 1TTHA 3GEPA 3GVIA 1WY7A 3N2YA 4R40A 1CXZA 1SVKA 1T2AA 3L7IA 1R9MA 4BKUA 4E5SA 5A5EA 2ECQA 1OAKA 4J6FA 5JMPA 2L0XA 1L5HA 4EHHA 1YL6A 2BMJA 3O3MB 2F43A 2AC7A 3RROA 4AKTA 2AFRA 2J1LA 3LQRA 3FUWA 1LLCA 4TKZA 4U7FA 5K3BA 3WLQA 1KOLA 3AJDA 2GF0A