4DN1A

Crystal structure of an enolase (mandelate racemase subgroup member) from agrobacterium tumefaciens (target efi-502088) with bound mg and formate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
389
structure length
389
Chain Sequence
HMNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase (mandelate racemase subgroup member) from Agrobacterium tumefaciens (target EFI-502088) with bound mg and formate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
total genus 132
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dn1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dn1A01
2NQLA 3QPEA 5IDZA 1IYXA 2ZC8A 1EC9A 1XS2A 3UGVA 4IZGA 4MGGA 2PPGA 3N4EA 2PTWA 2FYMA 3EEZA 2PCEA 3R0KA 3MUCA 4IHCA 3K1GA 4GYPA 2GSHA 1BQGA 3OW1A 3UCCA 3V5CA 3FVDA 1P43A 4HCLA 4HCDA 3H12A 4MMWA 3QN3A 1NU5A 1SJDA 3DDMA 2AL2A 3V3WA 3T4WA 2OZ3A 3H8AA 2P88A 1WUFA 1XPYA 3ENLA 3SQSA 3D46A 2OFJA 2P8CA 2GGJA 1MDRA 1JPMA 2HXUA 3BJSA 4GGBA 3GD6A 4Z17A 2QDDA 4IL2A 3UCDA 2GGGA 2PMQA 3DG3A 3RGTA 3TOYA 3N6HA 3S5SA 3DIPA 4HCHA 2PU1A 3UXLA 4H2HA 2QJNA 5FJUA 3CB3A 2RDXA 4YWSA 2P8BA 3TJ4A 1MRAA 4EWJA 1ELSA 3SN4A 3UJ2A 1EC8A 2OQHA 4KWSA 2XH4A 3CYJA 3I6TA 3H7VA 3OZYA 1PDZA 2I5QA 4JN7A 3UJFA 3TTEA 3RO6A 1MDLA 3VA8A 3U9IA 2GGEA 1FHVA 4FI4A 4GFIA 4DYEA 2AL2B 2XH7A 1W6TA 3UJSA 1KCZA 3NXLA 4MKSA 2GL5A 3MY9A 4K8GA 3ZVHA 1MNSA 2OZTA 1L8PA 2P3ZA 4KPLA 1NELA 4E5TA 2OZ8A 4JHMA 1JDFA 3ZLFA 3R10A 2DW7A 2PGEA 2OKTA 1ECQA 4K2SA 4H1ZA 2MUCA 1EBHA 5FJTA 1EC7A 2FKPA 2PSNA 2OVLA 2O56A 3R1ZA 2PS2A 4M6UA 2PP1A 6ENLA 3R11A 1BKHA 5J04A 2XH0A 3DFHA 2PTZA 3T9PA 4KT2A 3IJIA 3ZLHA 2PP0A 3GY1A 1TE6A 1KD0A 3JVAA 3MWCA 3V5FA 3FJ4A 2PTYA 3PWGA 2ZADA 3MZNA 2GGHA 3N6JA 3Q4DA 4DN1A 3JZUA 3RCYA 3ZVHB 3GC2A 1OEPA 1R0MA 3NFUA 3NO1A 3MKCA 4DHGA 3VCNA 4H19A 4GMEA 3JW7A 4M0XA 3NZGA 4HNLA 4HYRA 3DESA 3VC5A 3DFYA 3RR1A 3IJQA 4FP1A 2AL1A 4ZCWA 4A3RA 3P0WA 3QKEA 4G8TA 3ZLGA 3Q45A 4J3ZA 3B97A 3OP2A 3TJIA 4E8GA 3MSYA 4A6GA 4H83A 2PODA 4E6MA 1TZZA 4DX3A 1FHUA 4ZA0A 3DGBA 3VDGA 4E4FA 2MNRA 3P93A 3DG6A 1YEYA 3KUMA 1JCTA 2QVHA 3H70A 3SN0A 1F9CA 5FJOA 3I4KA 3VCCA 2QJJA 4HN8A 3R25A 4JN8A 2DW6A 1EBGA 3GO2A 3DERA 3QLDA 3RRAA 3N4FA 2AKZA 3FYYA 2GGIA 3MQTA 1SJCA 2PGWA 4ENLA 3IK4A 2PA6A 2OQYA 4KEMA 3SSZA 3R0UA 3DG7A 5BOEA 2OPJA 2CHRA 2QDEA 2XH2A 3BOXA 4IP4A 1MUCA 2PTXA 3FCPA 3PFRA 1KKOA 3ES7A 4K1WA 3I6EA 5FJPA 3THUA 3TW9A 1DTNA 1TKKA 3SBFA 1SJAA 3TCSA 3UXKA 3RITA 1P48A 3OTRA 4Z1YA 1JPDX 3T6CA 3S47A 2OLAA 7ENLA 2OO6A 1R6WA 2HXTA 2PP3A 3SJNA 4ROPA 4E4UA 4HNCA 2QGYA 4GGHA 4IT1A 3ZVIA 5FJRA 4GISA 3CAWA 3STPA 4IP5A 2OX4A 2PU0A 2AKMA 3FV9A 5EU9A 1KKRA 3TQPA 4F4RA 2ONEA 3PK7A 3QTPA 2HZGA 2P0IA 3UJRA 4HPNA 3T8QA 3CXOA 2HNEA 3PWIA 3CT2A 2XGZA 3VFCA 1SJBA 2XSXA 3HPFA 3EKGA 3U4FA 3OZMA 3UJEA 3TWAA 3VC6A 4J1OA 3ES8A 4DXKA 4X2PA 3P3BA 4IL0A 5ENLA 5BOFA 2QQ6A 4A35A 3D47A 4GYPC 1WUEA 1RVKA 3FXGA 1PDYA 3TWBA 3CK5A 3IJLA 4G7FA 2OG9A 3SN1A 2GDQA 4GIRA 3DEQA 3BSMA 4DWDA 1ONEA 3V4BA 1E9IA 2QJMA 3OPSA 2POZA
chains in the Genus database with same CATH superfamily
4UQ9A 3S3GA 1PJ9A 1KWKA 1KFLA 4WSHA 4B5VA 3RYSA 4MGGA 2O9OA 3ZSSA 3VPLA 3U2EA 3WH7A 4MB4A 2NSOA 2VT0A 1F8MA 2PCEA 5JBDA 2XWEA 5CBBA 1I9CB 5EMLA 3YPIA 4B15A 4IHCA 4WR3A 3SCOA 1A53A 2CETA 1MYRA 3WIJA 1E6PA 4MMWA 3HFYA 1KQYA 1VBUA 5HMSA 4LX4A 5C2XA 5FMHA 4PCFA 1QW8A 4K8HA 3C2OA 3NZQA 1J01A 1XPYA 2PTDA 4L9ZA 2QR6A 4D71A 2NVAA 5I09A 6TIMA 4AZGA 3WH5A 5E09A 1A4LA 3AMDA 4MG4A 1TPUA 4LS0A 1PV8A 4GJIA 5XIAA 3WL0A 1KW1A 4IIFA 1EJWC 1HO1A 5AY7A 1HKKA 1EA0A 4LOCA 5AKQA 4EIVA 9XIAA 1Q13A 3PG6A 4O1DA 4OOUA 4G5DA 5FJJA 3SY5A 2ZX8A 3NQAA 1Z48A 3NL3A 1QFEA 2OQHA 4G2DA 1R3VA 5KVIA 3VOJA 2Q8ZA 3I6TA 3OZYA 3BW2A 2NUYA 4HPJA 2P5NA 5CXPA 1Q6LA 1GVIA 4XKYB 2I9UA 2J9YA 1KNWA 1XD0A 5CLTA 1DKWA 4KRZA 1ENUA 1P0NA 4AU0A 2WV8A 4Q7IA 3TQVA 2VGIA 2VEIA 3VINA 4FO4A 3W1TA 1H60A 1FWIC 2J7CA 3EOSA 3NL2A 5E1QA 2A7NA 4ONVA 1JCJA 2R1MA 3C0QA 4Z0JA 4EM3A 3W7OA 3CC1A 1EYWA 1AZ1A 4JY8A 1GXFA 5CJ5A 1XIGA 5KITA 3CHDA 5DEZA 5EY5A 3R10A 2Y0FA 4UCGA 1X2GA 4PMQA 4Y8FA 5CGQA 4AWTA 4GQBA 3CIVA 2FJKA 3VNMA 3L5OA 3S1WA 3CLWA 2GZXA 1B0IA 2P76A 1AW1A 3GRIA 2QUUA 1H7WA 2Q6ZA 3IIXA 4RDVA 3OQEA 2VTFA 1C91A 1H7NA 2DZSA 1BG4A 3ARVA 3WNKA 3E6EA 1JZ5A 1WXZA 4AUBA 2X42A 1R9YA 2XSAA 3OLGA 2YVFA 5BYWA 3S2JA 3Q4DA 2Z6JA 4PN2A 2EXOA 4ZVJA 1Q8AA 1VEPA 1V6TA 1CGTA 4BI7A 3KZPA 1H2JA 4JYFA 4DF0A 1OCQA 1TV3A 3TFCA 1US3A 1KBIA 4PE8A 3GSMA 2NSXA 1EDGA 2IPGA 2XZ7A 3B0UX 3WQVA 3ZWSA 2HS8A 2ZRZA 1MEHA 3APGA 5LHEA 1F8IA 3W22A 1AUSL 1NY1A 3Q45A 1VJIA 3H2OA 1RM6B 3W6MA 3QEZA 3KBNA 4YCPA 1CXFA 4GUHA 1H0IA 3WLJA 5M17A 1QNVA 1PTDA 5HNNA 1TJ1A 2QJGA 1J6PA 1PYFA 1GVQA 1YEYA 5KETA 4JTJA 2DP3A 2A79A 2G3MA 1F9CA 3W7KA 4JIQA 1TCMA 2I56A 4BEUA 3ZMRA 4RKAA 4OJYA 3LPOA 4KWVA 3LD5A 5D9PA 5LNSA 3CUXA 4IH3A 2WQPA 4XK2A 1W31A 2XFWA 3BJTA 3O9NA 1AK5A 2OQYA 2JK6A 4OECA 2BGSA 4Z2IA 4O1AA 1F07A 3VD5A 1PX8A 3EWDA 7ODCA 3LBOA 5HBFA 1US0A 3CWNA 2CLMA 1A3WA 3CZJA 4K1WA 4GI9A 1FY6A 4B90A 3K1DA 4RCXA 1J9YA 2WPBA 4HBKA 3QPZA 1TVNA 2O92A 3D6NA 2G95A 2WMIA 1ME9A 4H04A 5CC5A 1UROA 3UXKA 3N2TA 5K3VA 3TYAA 1KR0A 1JNEA 1R3TA 2H8ZA 4RNHA 3WX7A 3MUIA 5KZ6A 1E0WA 3GXTA 2GFTA 1DE5A 1QPNA 4HJWA 2PD9A 2H8XA 2Y62A 4D8AA 3W2NA 1F05A 4ATDA 2ZWZA 3IAQA 2YL5A 4IIHA 3KL3A 4US5D 4OWGA 2XDFA 5AC8A 1AH0A 2RABA 5CSRA 1QHPA 5A6MA 4GH1A 3B9OA 3GZAA 3R79A 3TU9A 1JFHA 3LV5A 2TAAA 3TYUA 2V63A 4OOZA 4JEQA 4W7WA 2ICSA 4NQ1A 4LEQA 5AB3A 2FZDA 1D7KA 4K8EA 1JYWA 2V3BA 4RE2A 2C14A 3UR7A 4GIEA 4S2CA 2NV2A 4EMIA 5IDIA 3VUPA 3M47A 2V38A 1R2SA 1TWSA 3TTSA 4IL0A 1A3HA 1EP3A 4IFOA 2ZDRA 3VNKA 1YQ2A 2YL9A 3RN6A 1WUEA 1JNDA 1MXGA 3TWBA 1KM1A 3CQIA 1QU4A 1RLCL 3GBDA 5TBOA 1IGWA 4WJXA 4AIBA 1E6SM 2Z1XA 1E9IA 1TWDA 3BC9A 3IWPA 2POZA 4BF7A 1VB9A 2V0TA 4NZ5A 4TO8A 2ZXDA 4EM4A 3T78A 2YR1A 2VP8A 1HKJA 1FWDC 1X7FA 1LL7A 3HGRA 4OHQA 2PD5A 3AXIA 1ZAHA 5KTLA 3AHZA 4QLKA 3K1GA 1QOQA 2ZKMX 1BQGA 4HZMA 4J7RA 1PHWA 1SFSA 4AVNA 3FX4A 3F4NA 4Q8QA 1JZ7A 1RCOB 3G1VA 4GZ7A 1SO4A 1AFSA 1V5XA 2JE8A 4NAFB 1BPLB 2DQXA 3R12A 4HNVA 2Z1VA 3WDPP 1X6UA 4ES4A 3MB9A 1BYBA 1R2TA 2QCFA 1X8CA 4X22A 2Y8UA 4LVAA 4YTSA 2NT0A 4ORIA 1H6VA 4AG0A 2BXVA 2I9EA 5CCZA 5I77A 3GXMA 4DELA 4EMWA 3DN5A 1QI2A 4IL2A 1GETA 1KRBC 3NPUA 1TPH1 3FJ6A 3IJDA 3LB8A 1TELA 3CUJA 2ZVRA 4RZ6A 1MFUA 3ME3A 1UPPA 1B30A 4L56A 5A8QA 3C0SA 1NHSA 3UXIA 1F2JA 1PL9A 4MLJA 3NTYA 2FZBA 4KWSA 3GK0A 4JICA 4ZXOA 1K8CA 3E02A 2XIIA 1HJVA 3ALGA 2GVEA 1OINA 2DH3A 4TIMA 1TSIA 3H53A 2RKXA 5HATA 4BY3A 3WK2A 3ZZ1A 1VLIA 4O0KA 1QWGA 1E70M 1PXGA 2XH7A 3K4AA 4UNIA 2R14A 1DJGA 1E4LA 5K9DA 2VCCA 1W1ZA 3GNNA 2XN1A 3TXVA 2HPMA 5TQLA 3VKBA 3KTSA 3QZAA 1EO5A 3LADA 5DY3A 3SCSA 4NIRA 3N3MA 3MP5A 3N25A 5ABTA 3OA5A 4MJ4A 2F5ZA 3Q6JA 1FFUC 2Y8VA 4PB3A 3OVRA 1F4AA 2WK2A 3A47A 5GNZA 3MKVA 1BKHA 4LYPA 4POCA 2X2YA 3THAA 3SRFA 3S42A 4TVWA 3VCRA 3KWSA 1SFTA 3KVLA 3L4WA 5HR6A 5G2HA 1HJQA 1TE1A 1J0YA 1ZBWA 3GNDA 1AVAA 4O0QA 3NZPA 2ASHA 4M29A 4XSMA 5DMYA 3HIJA 1H1NA 1W0MA 4ADUA 1TPWA 1W17A 2QV5A 5G1TA 1RV8A 2W91A 1EF3A 1GEUA 1XLCA 4KCUA 3WDJA 2DZUA 2WVUA 3WUEA 2G3IA 3L68A 2CESA 1KRMA 5I02A 4AZCA 1SW7A 1CZ1A 3LCIA 2BWGA 3DFYA 2WKLA 1ZLPA 3F03K 1CXLA 2PRLA 2G0WA 3OP2A 4RR4A 2YBUA 1XRVA 3S5NA 1GOMA 3B9NA 2X1TA 1R85A 1KFCA 1TZZA 2J3NA 1CLKA 2VVSA 2BXZA 4CVUA 1ZJIA 3S1VA 5D09A 2D69A 3P93A 1E9YB 1HUVA 1NF0A 4MPKA 2ISDA 4U5KA 1ZY8A 4JEJA 5HQLA 2QVHA 3W7HA 2E1DA 1DE6A 1RVGA 2EPOA 2VFIA 1X39A 1ZBVA 4EPKA 3HZ3A 4HA1A 1N5XA 2AKZA 2INZA 2ZQ0A 2PGWA 1QMLA 4GNVA 3VNLA 1DORA 1G01A 3R0UA 4OBTA 4H4UA 1T96A 2YXXA 4ZE4A 1HGYA 4LS2A 4IP4A 2RHGA 3MP3A 1K1DA 3XINA 5D02A 4Q4QA 2V3DA 4DZ5A 2ZX9A 4LAOA 1HNYA 4XAYA 4FK9A 1VPQA 3WQFA 2WQDA 4MZ1A 3RITA 2Z2UA 4KFPA 3P80A 3K8KA 2ZZ0A 4NYYA 4YVPA 3CHFA 4PMNA 2H9AA 1W2VA 2PP3A 3O06A 3SURA 2CLPA 1EOKA 3AS0A 3NVDA 2CKRA 4YMZA 5LGZA 3HB9A 4GGHA 2PBOA 4QEEA 3EZ4A 3G77A 5IFPA 4ICCX 4YU1A 3PBUA 4M1RA 1Q65A 1FXQA 2WZMA 1VFUA 2GVLA 5K2ZA 3SUVA 3OEXA 2A3LA 1NJJA 2EO7A 4MSSA 3LXAA 4GACA 3W26A 4QAIA 3WFAA 9CGTA 4CU8A 3N18A 4ADWA 1FWBC 3UJRA 4DI9A 3NVVB 1UWUA 1PUDA 1F6KA 1H61A 2HQAA 1TVLA 3HPFA 3MMWA 3R0DA 4JKMA 3UJEA 1CT5A 4FIRA 2INFA 4KERA 4CGTA 5AHMA 1X7IA 1XDJA 1BYCA 1OYCA 3OQ8A 4PRWA 3TQ0A 3S5ZA 4GYPC 5CZTA 3TONA 3ZO9A 1I1WA 2D2OA 4MB1A 1GVSA 1GVYA 2VNCA 3BLFA 4HSNA 1VH7A 1L6GA 4O57A 1BWCA 1MW1A 2WPCA 4XTDA 5H2ZA 1KXVA 2NVCA 1N2VA 3QGAC 1DWFM 2OG9A 5AYXA 3BW4A 3W86A 1N8IA 2CHOA 2QCGA 2XFRA 4WLCA 1GW1A 3BSMA 3A5VA 2JGYA 1QNOA 4C6IA 1PCKA 2QJMA 2F9RA 3T08A 5IDZA 1M04A 3URNA 1QNPA 2X30A 5A8OA 3BANA 3GRSA 1NP0A 1FWWA 3PWAA 4D1IA 3MUCA 2OU4A 1BHGA 5FD0A 2A6NA 1X6NA 3LU2A 1H1YA 2FGLA 1Q7QA 1JDDA 4Q8TA 4YWOA 3QN3A 2Z2BA 4S3JA 4UR8A 4PODA 5MKGA 4H6QA 1LOLA 2FMOA 3WLQA 1D3HA 3T09A 1M53A 2BZNA 3OG2A 1IQ8A 6A3HA 2PLKA 3IAPA 2WVVB 2JKAA 3NYDA 4CCCA 4AIUA 3E2RA 1Y0EA 5DX7A 1GQNA 1VENA 3MI2A 4KFOA 3VGFA 4UTLA 3H2CA 2QT3A 3G8EA 3RLVA 2HRWA 3SADA 3ISIX 1XIIA 3ZJ6A 2PU1A 3L4XA 1JRCA 1MEWA 2J7EA 4ASTA 2A0NA 1DQWA 1E43A 2B7QA 2D2JA 2R82A 2PDLA 5FF0A 4O10A 1ISYA 1V0LA 3APYA 4R9XA 1EC8A 3ZJ8A 2NXIA 1NM9A 5LKYA 1GUVA 2WOQA 3DFTA 3NQMA 4JX6A 3NWRA 3OLDA 4ZB5A 3HW2A 1ZJAA 3NVTA 1DJXA 3CGEA 2Z29A 3KX6A 3CV7A 3U2CA 3B8UA 3AALA 2FZ8A 3EDDA 2GGEA 1SSDA 1R46A 3KCLA 4ZOBA 2OKOA 3UT0A 4QTGA 2DORA 4Z2LA 3ITYA 3VIGA 1JI2A 2NLYA 1J93A 4JIRA 2UY3A 1M7OA 2FTYA 4LYRA 4XIMA 3LB0A 2CXEA 1ADSA 1AL7A 4OVXA 3AS1A 3GDLA 2WNZA 4GZIA 5JH2A 1NELA 3AAMA 1R3QA 4B3ZA 5HANA 3W23A 5U1OA 2G3FA 5IFTA 1FA2A 3A23A 1UMLA 4BQ5A 1G4SA 2WKGA 4H1ZA 4N9EA 4JL1A 3W7NA 4ICNA 1W37A 2VYOA 3XISA 4F0HA 3J7HA 1H4PA 5D05A 4JIPA 2OGJA 1MVYA 2A3CA 2WZTA 3GR4A 4BF9A 4C91A 2C1IA 1AQMA 3WNPA 2ZTJA 1H51A 4KT2A 3AUJA 3GY1A 2VC5A 4FX9A 4NJHA 1HL8A 4AW7A 4TQTA 2WXDM 1OC7A 4A8RA 5DFAA 2RJHA 1W9DM 4Q4KA 3R8HA 4PTVA 4CD6A 4JCMA 1KXTA 3N6JA 5I07A 4C6OA 2FVKA 3GWQA 3H21A 1O60A 4M56A 1REQA 4DJEA 3PY2A 5IHRA 2CLLA 2B4GA 3RG6A 4MDPA 3WLMA 5EMYA 2YFNA 1LOQA 3CV1A 4LBUA 1DIEA 1L6SA 5AHEA 1O1HA 4L6HA 3II4A 4NZCA 3B05A 4FSAA 1FCVA 1Z7AA 3TYDA 4B5NA 3CQ0A 4FF7A 2AL1A 4L4PA 3P0WA 2PDHA 4HK6A 1PWLA 1XL9A 1EXPA 3B8DA 3TJIA 1F4HA 3AXXA 3O63A 5BU9A 4JTIA 3OODA 1EGMA 1IGSA 3C86A 1XUUA 4YS1A 1A4MA 2GPTA 1ZL1A 3UESA 3GG0A 1NH6A 3VDHA 3RMEA 3TROA 1EFZA 1XLKA 1QOXA 3QQ0A 3I65A 1XPGA 1WV2A 3POHA 2BBFA 2GVJA 5HJLA 5A94A 1P5BA 1S3HA 2NQ9A 4LFYA 4ZSUA 3KW3A 4HZ6A 3M5VA 4C7FA 4W7VA 4MNJA 4L65A 2B31A 4NT0A 4D6JA 4NG3A 1OIMA 4BJHA 4LQ1A 2F7FA 3FCPA 3CMFA 4OIFA 3ES7A 1UD8A 3CEUA 1S2CA 4A8LA 2X7WA 5HDRA 3E96A 3WEMA 4M7TA 3GUGA 3LX9A 5EMKA 3OC4A 3VDCA 1UHVA 2VX6A 4RE3A 5A95A 5HMDA 3QSRA 3NVZB 3O3RA 4Z2JA 3WUGA 4NASA 3ARZA 1GRBA 4KETA 4CLMA 4FLSA 3VIOA 5SWUA 2JIWA 2E9MA 1XX1A 3E9AA 2VI0A 1YX1A 1VJSA 5B7ZA 2AKMA 3GKFA 3RNDA 2QCDA 2QJIA 4F4RA 4DXVA 3EB4A 3SCNA 2D23A 1AQ0A 2ZOXA 4D8ZA 3OIHA 4PR4A 3S2NA 2FVMA 2DZTA 3SFWA 1E72M 1SYTA 1TVPA 2WP5A 1JZ2A 1KO0A 3KOXA 1W1TA 2EQ7A 4JIHA 2O9TA 4IMAA 4OE7A 3G0SA 5CJMA 1LUCA 1Y5WA 3VGGA 2X41A 3LSBA 3C5QA 1QO2A 4Y9NA 3S9YA 3D47A 2DU2A 1XBZA 2Y8KA 1A5OC 3NQ6A 1MO9A 1AZ2A 2ZA3A 3LLFA 5LA0A 2PRHA 1UBPC 1ZXIC 5HMEA 1B3ZA 3NCOA 4YN5A 3O6CA 3CPUA 2YW3A 5FESA 3DEQA 2DY3A 3N04A 3R6IA 2VUYA 2WM0A 3RMJA 3T1GA 3S46A 1Q3NA 1HN1A 1Q4NX 4H4TA 5E6ZA 3QR1A 1JDCA 2FTPA 3UZXA 3ABRA 3PVFA 5E70A 4I9MA 4UNLA 3NQDA 1XGZA 2QF7A 4F79A 2V6OA 3DJGX 3P8IA 3RU8X 1LWHA 4EXQA 4AIOA 3VXGA 4CNNA 1EIBA 2X8RA 1WDRA 4UQDA 1WDSA 5IXEA 1K77A 5HJYA 5JCMA 3OW1A 3UCCA 1HKIA 1VQZA 4DUXA 4DWSD 7TAAA 1EP2A 2A1YA 2WJFA 1OSEA 4F0RA 1VCFA 1M6IA 4M19A 4DLMA 2A3HA 3G5EA 5KSWA 3H8AA 3N14A 5CPTA 2ZUSA 4C6LA 2FB3A 1EJRC 2QAFA 3LTYA 2P8CA 5CC3A 5CZ0A 4GA8A 4OGZA 1W5QA 5B80A 2L5HA 4TV6A 4IX0A 4S3KA 5BXRA 3GD6A 2QJHA 4W93A 4XB3A 3ALFA 2VFEA 3KE0A 1FCUA 1SW3A 1HJUA 5H8MA 5I03A 4UZSA 1UR9A 3IGUA 4M3PA 1XRFA 3GB6A 3FY1A 3IUIA 2YKKA 3N11A 1PIIA 3AROA 4WXZA 1LL4A 4LNCA 3UGRA 1TPEA 2W5FA 1TUFA 4X9SA 2WHMA 4LUJA 4RDYA 2R8WA 2GDUA 3CYJA 3ARWA 1DXFA 3EANA 1EHNA 4ZQNA 3ARTA 3W81A 4WDXA 5ABGA 4NF7A 2PDPA 4V15A 1OZMA 1WYGA 3HURA 2YZ5A 1E56A 3EA3A 4DPQA 1J2WA 5K4ZA 5TAOA 4S2BA 4GJJA 4UFJA 4GVFA 4O18A 3VIHA 4BFAA 3GH7A 1ZDLA 3LI0A 3WL1A 3MY9A 1ONWA 4BS0A 3SQMA 2D2HA 3CAVA 3T44A 4DZHA 1UA7A 3IUDA 4KFNA 4CQDA 1WNOA 1CB7B 1JOAA 2CLOA 3ZWTA 4H00A 3AIUA 4LB4A 1UUQA 1G7VA 2HK1A 3RO8A 2GJLA 2HJPA 1UZDA 3GVQA 2DW7A 3LN3A 3V35A 3HGOA 1K7XA 1J5TA 3SUSA 1LZOA 3WMSA 3IVTA 1EJXC 3FA4A 5L9FA 4LY4A 3VOCA 4CQAA 2PGRA 4LEFA 5FI8A 4E4PA 1WP6A 3RXZA 3A4XA 3VIPA 5FCZA 4NAEA 3TSBA 4YNGA 3DFHA 3PBGA 2ZE0A 5DT7A 1VFLA 3BQ6A 3TVAA 2FTWA 5HNRA 2CXGA 2VGBA 1HFBA 3L4UA 4GUIA 1HO4A 1OGBA 1TMHA 2FZ9A 1KA9F 1EGVA 2BCPA 1U83A 1YPFA 2IW0A 3GU1A 1XBVA 4MJ2A 3H4WA 5DCBA 2ZZ4A 3GC2A 1NF7A 6CGTA 1N5WC 2YCIX 3F4VA 4QXIA 2RJGA 3VIIA 2D24A 3JR2A 2VO5A 2W27A 2YX0A 2OSWA 2A2IA 1BRLB 4LYQA 4NX0A 3LGEA 3CUGA 4CUCA 3MO4A 1VYSX 3JW7A 4IG2A 1UWSA 1UOKA 2C1HA 4HYRA 5REQB 1NOFA 4AAJA 1PZ3A 2TSYA 2CERA 3M0XA 4IWWA 3GVWA 1O66A 1MXSA 3GTXA 4XZ9A 5A6BD 4A6GA 3W71A 3CAQA 5XIMA 4F3HA 3CXBA 1FHUA 1GPWA 3FDKA 5D2WA 1JCXA 4AEOA 2VFHA 3IK2A 3GNOA 3PBYA 4LVGA 1FWSA 3KRBA 1XDLA 1B31A 1QJWA 4L61A 4LU0A 2QUNA 4W9TA 1ZENA 3SCRA 2Y70A 1IT0A 4QDPA 4XTIA 1VZWA 2GGIA 4JKKA 4LALA 3N9KA 1SW0A 3M0ZA 3M4HA 4NI3A 2X16A 1C29A 2ESCA 1UD5A 1RPXA 5TNVA 3QV8A 3A7AA 3WD1A 3RPDA 4O4VA 2I5IA 5JU6A 3QSTA 3LS9A 1W9XA 3UG4A 1VJZA 5I3IA 1H50A 3W4RA 1FFVC 3MYPA 3HQNA 4H7VA 3WD4A 1DJWA 1WO2A 4XBSA 3O0KA 2ZE3A 2J79A 3GD4A 1OX4A 4FLOA 1YKWA 4R53A 4C6EA 1ZGDA 1KM6A 3CAKA 3GG7A 3QMTA 4IIDA 2O9PA 1IWPA 4CD8A 1OT2A 4JFSA 5HQMA 1KM3A 3HO8A 3T0CA 5E5CA 1DV7A 3TJXA 1G69A 4WJEA 4PB4A 1HG3A 2V3FA 1V7AA 5CPLA 5J5DA 1XCFA 1N7KA 2TRSA 3TLLA 3SRHA 2VEFA 1B3OA 5CQ1A 2Q8LA 3F1QA 1H11A 2B0MA 3HOJA 4HN4A 4D6EA 4IISA 4LC8A 4GYKA 2BHYA 3EX3A 3NUKA 2VC7A 1M7JA 1MZRA 5AECA 2VQTA 1QO5A 3TNOA 2QPUA 4NZFA 3TYBA 2HNEA 2QUVA 1Q63A 2X0HA 2C0AA 4QG8A 4PGLA 2VCAA 3F4WA 5G5GB 1XLAA 1LYXA 2OT1A 3MKKA 3EYPA 1UOZA 3ONCA 2VZVA 5F2LA 3UVAA 3RX2A 5LXEA 5C9ZA 1MFVA 4HP5A 3R5EA 2VEGA 3VIMA 3GX9A 4C6NA 2QQ6A 1FFRA 1RA5A 4CCZA 4PBGA 4WOZA 3WK0A 1C9WA 2QUMA 3FXGA 4X0NA 2J47A 5AC6A 2ZRXA 3WH6A 1GQIA 4GRSA 1E5JA 1R9XA 8RUCA 1TRDA 3GRTA 3M1ZA 3QYQA 4AZ5A 1ONEA 4L4MA 3OGRA 4MY1A 2H3BA 2ZZ2A 4WDTA 4C6FA 3V1PA 1CNVA 4GIYA 1CEOA 3OHIA 3WQWA 1SMAA 4QS5A 4AB4A 4L6DA 3W2UA 2IKJA 2PTWA 3WLIA 2GOUA 6PTDA 1GG0A 5LIUX 1OC5A 1XIHA 4LB3A 4W8AA 1U1UA 2GJXB 3BK0A 3EXTA 3LV6A 1NFGA 1UKOA 3B03A 4IPJA 5FS6A 3BV4A 4RUBA 1CXIA 3ABSA 3TX9A 1DWHM 3BAYA 1U30A 1EX5A 1XKJA 4ACZA 2E1WA 7REQA 3IVSA 2QV4A 3GXFA 2OFJA 3A9BA 3JRKA 1S1RA 3NQVA 5HJXA 4UQAA 4F0LA 1PCWA 1XC6A 4KKXA 5D2TA 4PMRA 2DJLA 1TA3A 1D7YA 1NQ6A 2R9ZA 3P60A 2V82A 3N3TA 3NQ2A 2V67A 3EDKA 4HCHA 5BW6A 4DUWA 3WBYA 2QS8A 3GVGA 1NOWA 1YNYA 2Z24A 4OFCA 2J7HA 1ELSA 3M0YA 3GTFA 2D0HA 1JGMA 3E2QA 3P7YA 4KCTA 3L4VA 3N2MA 4WVXA 1LG1A 4HNNA 3AO0A 2P10A 4U33A 4NY2A 2ALDA 2ZZ3A 4P8UA 3CZKA 4HKPA 4UOJA 4D6CA 3W2JA 3PS7A 2QCCA 4YTTA 3M0LA 3I3EA 4FNUA 2D73A 4O1EA 1MSSA 4XBJA 2GUYA 3BICA 1VCVA 1AOGA 4OBSA 1E0TA 3LTSA 1CTNA 4LAZA 4QROA 1A5KC 4IPLA 2BY3A 1G67A 3N13A 4PUKA 3G1YA 2ZWYA 4H8NA 4IXXA 3ZR4A 4UB9A 2R1KA 2CYGA 1SZRA 2KAUC 2EG7A 3VGDA 1GTHA 4GIAA 1AMYA 1CECA 4A21A 2ZVIA 1GZ1A 2B7NA 2OVLA 2FLIA 4UTHA 4PSRA 4ML9A 2GYIA 3LG3A 4KWOA 1JAKA 3D0CA 5JIPA 3N1AA 3CZLA 3I10A 3BUVA 3LGDA 1GYNA 5ABHA 5CKSA 2E6AA 3W73A 3E12A 3AS3A 1GOKA 4LS1A 1K03A 2PWVA 2VDGA 3ZT6A 4JTHA 4FAMA 3KM8A 4QG9A 4AZ6A 5JBFA 4XZMX 4QS6A 2PDMA 1BXNA 4R3UA 3MBFA 1J2BA 4ZL1A 1FEBA 1GV4A 4UTMA 3GG1A 3WF2A 1D3GA 5FS9A 1A47A 3RU6A 4TV5A 3S1UA 1VLWA 4KH2A 3NM3A 3TK7A 1ZUAX 2OLHA 4H9VA 5LIXX 1U5VA 1V8EA 4HA4A 3WJXA 4LCSA 4HNLA 4K7ZA 2A4AA 3Q65A 2Z25A 2WMIB 4FF5A 2Y5SA 4AY1A 1N55A 2V5KA 4OV4A 2GDVA 4G8TA 4B9YA 5JRBA 1TYGA 2ZUTA 3VAVA 1SZFA 4E6MA 2PC4A 2Q8XA 4MWAA 4NJGA 4N9BA 1IT8A 4ZFMA 3BLPX 4QBXA 3AYSA 2A3BA 4EQWA 1TJPA 4K7YA 4P8WA 2XVGA 5CGTA 1OK6A 3WFLA 1GREA 4XO7A 3FKKA 3MTWA 3A7RA 1CI1A 1CLVA 3UZYA 4P7LA 1WB0A 1OX6A 3UWYA 3HFTA 3B8VA 4IUGA 4I5XA 4PCSA 1E4IA 1NP2A 1NWUA 1DP0A 1HVQA 3DG7A 3PPGA 3LTPA 2QDEA 1LJYA 1J4EA 2Z2AA 3ABQA 1MUCA 1RJRA 4UTTA 1A80A 2GH5A 3IEBA 2FDSA 3CMGA 3Q58A 3R4IA 1S5MA 1SJAA 3TCSA 3ERPA 4PRTA 1PZ0A 4KCVA 1GRTA 1WX0A 4PTNA 1HF6A 2QGYA 2VOTA 5E0CA 2BVYA 4GC3A 4M1BA 3A4JA 3PUEA 4U28A 3HN3A 3VDBA 5I3HA 4NZJA 1IXOA 4U5IA 2QXWA 3WLPA 4QG6A 4RNJA 4K6AA 2W0HA 4I9AA 1D3CA 5F7UA 3EX6A 5HOSA 1OFAA 2BFGA 4I6KA 1ITUA 4GPNA 3BJFA 3MP4A 1XYZA 3MJMA 1N60C 1P6CA 3UPBA 1S39A 3PK7A 4QJ3B 3TFXA 3EOEA 3AI0A 4WK9A 3MMUA 1PBGA 3HQ1A 3L5MA 4OKDA 4G1KA 3IUHA 2GJXA 3OJGA 1SJBA 1Y7VA 3ZXWA 1EJVC 4MJZA 3VKJA 4HT3A 2R1LA 3ARYA 3EWWA 3VGEA 4HNUA 4OZOA 1PTAA 2E5DA 4AD0A 2GQ9A 2EPLX 3BW3A 2ZXAA 1D2KA 1ZY9A 4UTJA 5U25A 2CLFA 1LWIA 5F4WA 2W55A 2O7SA 2DJXA 3CK5A 4QSFA 3IJLA 4H3DA 3FDGA 4QE1A 1I45A 1EX1A 3C6CA 1BF6A 2YJQA 1OFDA 4CU7A 5JUVA 1LPFA 4XUGA 4RPQA 4REQA 4Y9MA 1JZ4A 3CV2A 4Q4PA 4ATWA 2EQDA 4JNYA 1YE6A 2VHLA 3V4BA 1UP3A 1K8YA 1XQKA 4MADA 3U5YA 2XGBA 2NQLA 3NZRA 2PE4A 3WQ6A 1KV8A 4BK9A 1RK5A 4UR9A 1MXDA 4A3YA 2AAMA 3L4TA 1JFXA 1VFMA 3PJUA 1NQKA 2FYMA 4JNZA 1HP5A 2YQUA 1UYQA 1EWDA 3TAKA 1EHAA 1FFQA 1Z44A 1DWGM 4TMCA 5JMUA 3G1FA 3CQHA 1Q1RA 4D8LA 2Y24A 4MVAA 1I6NA 3R07C 3C52A 1AW5A 3HGSA 4LVBA 2F6XA 4A2SA 3V3WA 4UXDA 4IF2A 2X1SA 1UQYA 3HV9A 3U6WA 5C7VA 4F2UA 2FPYA 2TODA 5CZJA 4ERAA 4PMZA 2GWNA 2PZNA 4F66A 1V03A 3NZ1A 2EGZA 2OWXA 2XINA 4URIA 3W01A 1ISWA 3WF0A 1C90A 4RV3A 5JCLA 3BJSA 2VR4A 2BGQA 4I9TA 4Z17A 5H1WA 3QV7A 2W3RA 4NZ4A 3S8HA 1R3SA 2WMHA 1BXCA 2GGGA 4O14A 2C7FA 3DG3A 3G1DA 5H6HA 3UXLA 5D03A 3ITLA 5FJUA 4ERIA 5JIWA 2P8BA 3B40A 4EWJA 3AU2A 1U1JA 3NXFA 3MWAA 1OYAA 3UJ2A 3KVMA 3AHYA 5DCEA 3W6YA 1PZ1A 2VGFA 2ZZBA 4AY7A 3PJTA 3PAOA 2I5QA 3M6DA 3PC0A 4NP7A 4DIAA 4IPPA 1DJQA 1UD2A 1KXQA 3DC8A 3CEPA 2Z7GA 2FHCA 4R88A 1OFQA 4Q8OA 1M1BA 3CTLA 4HZ7A 2AQOA 2Z28A 1N8WA 1W5NA 3QYSA 4GO9A 4N9CA 4F9JA 4IGMA 2OWCA 4O12A 3TH6A 3OBKA 1P4CA 5LIKX 4AHPA 3GXIA 5LYRA 3B3DA 4QFUA 4W4QA 5ABFA 2XN2A 3UERA 4ICMA 4WY0A 3AMZA 5FACA 5HWJA 4LWWA 4IGSA 1EQCA 4Z1AA 1UA3A 2BOGX 4LRTA 2J78A 1KGUA 3U2ZA 3B8WA 3BAIA 2QAPA 2HNHA 4QCEA 5A6JA 3AXHA 3T0AA 4W5ZA 4QHRA 3SGUA 4EPDC 2PDNA 1H5VA 3L2LA 2FPTA 1TFVA 3W74A 1J6OA 2HBVA 4C7GA 4XKYA 4GJ1A 1FCBA 3W3OA 3CQJA 5HA7A 3II1A 3GQYA 2DT2A 1UC5A 4YCOA 3BO9A 3B0VC 4PUEA 1FECA 1H7XA 4L1XA 1CGYA 1SM9A 4I8DA 3PTDA 1E6XM 1R0MA 2ZZ7A 2QMKA 3WFZA 3H4XA 4R9OA 1XM3A 4H19A 3WD0A 2J27A 1CPUA 1K8ZA 1VYRA 2OTDA 4DM2A 2YCJA 3VK5A 5CAHA 4FXRA 2IMRA 3TC3A 1KTBA 4QLJA 4TVCA 3B97A 3K5XA 1ZSXA 4JTDA 3C8NA 3PNUA 3PULA 4B5WA 3THCA 3WZ0E 3R13A 1PKLA 2CC0A 1RY8A 3BLOA 3NGFA 3AISA 3GD3A 4GYJA 1W1IE 1E15A 1NFPA 3RDKA 1E9LA 2BODX 4HN8A 2X8HA 1LF1A 3M41A 6TAAA 4MFDA 1DL3A 3GO2A 3K13A 3UU0A 1QVBA 2HWGA 4KMQA 5F2IA 4B2DD 4Y7EA 5D2VA 3WNLA 2Y88A 1H7RA 3T05A 3B04A 3FSTA 5EA9A 5HULA 1M9HA 1GTEA 3GG8A 1OFRA 3TIMA 1PHQA 1GESA 3OVQA 3HG3A 3AHVA 3V18A 3W2MA 1JCYA 2DIEA 3AIEA 4H9MA 4IFKB 1LG2A 1UP0A 1SZNA 1E0XA 3MA8A 3H24A 1POKA 1YMYA 4KWWA 3EUB3 3N9SA 1LBFA 2HXTA 1FQ0A 3G24A 3FLUA 3HMJG 5EB8A 1OVDA 5HINA 4Z1BA 2PWFA 3AUOA 1EJTC 1TV5A 3N73A 3PUOA 3ZVIA 3FA5A 4UR7A 3STPA 2UV8G 2JK2A 3UD6A 3TSMA 1ADDA 2QVNA 1KBJA 3TAOA 4C1NB 2R1NA 4LUSA 1WXJA 3W1UA 1UP2A 2ZFAA 3W7MA 1KFBA 4LUYA 3Q2DA 5HMFA 1K9DA 1FP9A 4B91A 1A5BA 4OQVA 3NVYB 3K30A 3NOYA 1EUAA 3DC0A 4QNEA 4Z0SA 1GSNA 3PTKA 1ICPA 3ETRB 4Q8MA 3HA1A 3CXOA 5H8PA 3K4DA 5D8ZA 1W3IA 4LANA 4MIMA 3QFEA 2INEA 1M68A 1E1FA 3OZMA 5C0QA 1WDPA 3SSJA 1L9WA 4CN1A 4AVFA 4JFTA 4LAMA 3LUTA 3PR2A 1K8XA 3LY0A 4L80A 7XIMA 3SB0A 4GY0A 3QY7A 1RR2A 1PO9A 1TX0A 3RLHA 4FX6M 4E2BA 3UYIA 4QNWA 2WC4A 1RD5A 3DGHA 5DANA 3QM3A 5A8NA 5F4XA 3PSWA 2E9LA 1WOBA 4NNAA 1Y65A 1B4EA 1QWKA 3IGSA 3KOWA 3QPEA 3F4CA 5G4WA 4FOJA 5AOUA 4JBRA 3WQEA 1XYCA 3OYZA 1UWAA 3BTNA 5AFDA 1IHIA 4E3TA 4BHYA 3L65A 2E8YA 1PX4A 2O7QA 1TR1A 2GSHA 4HPGA 4LBRA 3GNXA 3H12A 3E2VA 1DJNA 1EDQA 1FWFC 4IMFA 3USBA 1XHCA 3NDOA 3FVMA 2CPUA 1VF8A 1XYBA 5C71A 4J28A 4LIIA 3UA3A 4IP7A 2WJDA 4R7OA 5B7YA 2I16A 4M51A 3D46A 2C79A 4GBUA 3IRSA 1UD4A 3VD7A 1TV2A 2CLKA 1JPMA 3HG2A 2EQ8A 3UG8A 2V30A 3P61A 1ZAJA 1TPB1 3W37A 1ZBCA 1FIQB 1QI4A 4XQ6A 1T3QC 1LLZA 1SFLA 2F84A 5E0FA 1KFJA 4H2HA 1EL3A 3PAJA 1O94A 3WDQA 2J25A 2V2DA 2J75A 3SEPA 4LGXA 4AD5A 4NJIA 4N9DA 5D2XA 2PDGA 1JCLA 3SZ8A 2JEPA 1R47A 3ABOA 3FS2A 5JVLA 2ZZCA 4JNMA 1ISVA 1TWZA 1QCWA 4JN7A 4UTFA 3WDRA 2DT0A 4ILSA 3U9IA 1XISA 4N42A 4XKMA 5EBAA 1GZGA 1FHVA 3PTMA 1UZHA 1EQPA 3VUSA 3UXAA 2AL2B 3S2CA 4DI8A 2PDFA 3CUHA 5JCIA 2EHHA 3VD4A 3NRZB 4MKSA 1NAL1 4W89A 2FPVA 3UWWA 4GKTA 3ZSTA 3W07A 3ID7A 3M7WA 1J18A 1E0VA 1VD6A 4IJRA 3TJLA 2ZCGA 2VRKA 3UFYA 3CHCA 1R38A 1A5UA 2A3EA 4U2YA 6XIAA 2D3LA 1TG7A 1Y5XA 1LWJA 3UP8A 4PMDA 1XH1A 1AJ0A 1S5NA 3W7LA 2UY5A 3A22A 3IACA 4Y9PA 1XYLA 1POJA 2FKPA 5DY2A 1KBKA 1JG9A 3PZTA 4M6UA 4UBPC 3TN6A 4QJ4B 1GQKA 3TTOA 3W7GA 5J04A 1Y5VA 1PKYA 4PZVA 2VR5A 5JCKA 3BVJA 3KDNA 3M0VA 3WNOA 2XIOA 3ZLHA 3MWCA 4A05A 4CD4A 2A7RA 3FJ4A 3ABZA 2QCEA 4GY1A 1JXJA 1OZQA 3M0KA 4G6CA 1UC4A 3NDZA 1Q6RA 1I2RA 1C9DA 2D0GA 4N7QA 3W76A 1LQ0A 4GFSA 3CH0A 1OX5A 4MY8A 3UCQA 1V3IA 3CT7A 1YDNA 1PPIA 1KB3A 4IQDA 5LSMA 2BHUA 3STCA 1YDOA 3PPFA 1TTQA 2E28A 4EWND 3FSUA 3W84A 4M0XA 4Z08A 4PEEA 4ORMA 1TQXA 8CGTA 3PJXA 1XIJA 1H63A 4IX2A 1V0NA 5U4NA 1J8VA 3RR1A 5CBJA 3IJQA 1WZLA 1A5MC 2ZX5A 4REQB 5BWFA 3DHDA 3W6LA 1E0UA 1YQZA 3MSYA 1RD6A 2WHKA 3EWYA 1UKSA 3W24A 1GHSA 1GGOA 3NNTA 4JHZA 3GHRA 3SR6B 2Y6ZA 2HEJA 4UTWC 2Q02A 3KUMA 3GIYA 4QJ1A 2AOSA 1F6YA 1GCYA 3TEVA 3U7VA 1L2QA 5FEPA 4R33A 4PUWA 3MSGA 4QITA 3GDBA 2J77A 3R25A 4NU7A 1TMLA 2NZLA 3FYOA 3AJXA 3S6TA 2FH6A 3REQA 3QGKC 5M03A 4ALDA 1UKTA 3FEQA 4E3VA 1TWWA 5A6KA 4HZ8A 2UY4A 5BOEA 2Y85A 1A0CA 3CIWA 4MWAE 4EACA 2WOVA 3QF0A 1I2OA 1E5NA 3CU2A 2TPSA 3CASA 2I57A 1X1OA 3I6EA 3MI6A 3B0PA 1OCJA 3P6LA 4Z2HA 1TX2A 3BAXA 2VZUA 2AMXA 4UZUA 4FX7A 1IIGA 3S47A 4PL1A 4K7VA 2BHZA 2WYSA 1GYLA 2ZRUA 1E9ZB 4XAGA 3AFBA 4MY9A 4ZENA 3C56A 4L1WA 1CGXA 3S6OA 1QW7A 2PBGA 4H7CA 1VPYA 2PWUA 1G4TA 4K39A 1RBLA 2A85A 3I68A 2IXVA 3L0NA 1HJWA 1HT6A 1XLLA 3WF3A 3KRUA 1S7MA 1OABA 2EQ6A 5DBUA 3LM3A 1WZMA 3BCDA 4G7EB 3OGVA 3C4UA 4YJ5A 1MUWA 4JAWA 2IPJA 2ONEA 3WNNA 3V1HA 2QIIA 2SFPA 4AYSA 4EOUA 4AZIA 3QTPA 3VI2A 2OCZA 1LORA 2HZGA 4J5NA 2HBXA 2EAWA 1DHPA 4IMGA 1XFCA 1R7OA 5D9MA 3O2LA 4D6IA 3VFCA 3IS4A 1LDCA 4RJEA 1NSJA 2PDKA 5E0KA 3WQPA 3BMWA 1GVRA 4A2RA 4XZBA 4MUPA 2GRTA 1MEIA 1S2AA 3ES8A 5D33A 1FEAA 4GX9A 2Z1KA 2ISVA 1K9TA 2YCLA 3U2OA 3EMCA 2WMKA 2Y61A 3HM7A 3WN6A 4CVWA 1RHCA 2DZPA 3KLLA 2WWCA 3LCLA 2PLCA 3E74A 2JF7A 4FLQA 4AF0B 4X3ZA 1I60A 3L23A 1C92A 3RAOA 3QFWA 1MQRA 3LHUA 3AMGA 5A1AA 2BNJA 4H4RA 2ZUWA 3R8GA 1UPMB 1IV8A 2WC3A 3IARA 3VFLA 2YLAA 4C1NA 3AC0A 2YVJA 3ZQ9A 1P0BA 3FN9A 4DBWA 2CITA 3HBLA 1JCMP 3DH9A 1F61A 1FKWA 1KWGA 3T42A 3URHA 3EA1A 3GFZA 4MDOA 1MW3A 2GK1A 1GRHA 1ZP3A 3FVDA 3DFSA 2HTMA 3MCOA 1UD3A 5BWAA 3UG5A 1NU5A 2NQ5A 3LI1A 3UZ5A 1B3WA 2PGFA 5C9XA 1ZK7A 2VD8A 3T4WA 4NRSA 4QEHA 4JIEA 1EZ2A 3JS3A 4OU1A 4P8VA 2DDXA 1NHPA 2QPXA 5CC6A 4JS3A 1C8QA 1SR9A 3W7JA 4N0RA 2ZX6A 2Q09A 4UUIA 2YA2A 1BVNP 5F1VA 1GG1A 3FGCB 4KIRA 4TTGA 3G0UA 4G7EA 1VRXA 1OBAA 1UR2A 5FEZA 1RUSA 2OEMA 2QJNA 2A6LA 4WF7A 1P6WA 3CB3A 3O1NA 2XIJA 3TJ4A 1V7YA 4K3ZA 1WCGA 1X2HA 3PG9A 1TREA 5GRTA 4HU3A 3IV3A 3I7SA 2WM1A 1P7TB 4I7UA 4AISA 1M03A 3GH5A 3CUIA 4DBDA 1FBAA 4XZLX 4LXFA 5I3GA 1J0HA 1B3YA 2ZYFA 3VA8A 4WZHA 1OQFA 2TYSA 1R87A 3GS6A 4JL2A 4O13A 1VHCA 5HNTA 2WWDA 4FNPA 1F73A 4KGJA 4I90A 1CBGA 2IPFA 3P81A 3WO8A 3AWOA 2DUAA 5HR7A 2PDCA 3CB8A 2Z6IA 2DSWA 1M7XA 4FS9A 3HG5A 4O53A 1D8CA 4PTXA 2BSLA 1DJZA 1KFWA 3R89A 3XIMA 2G8ZA 4ZOCA 5EGRA 2WCAA 2VKZG 4X60A 4GQGA 1JUEA 2YW4A 3BURA 1Q85A 1K3UA 1PKMA 1OFOA 1YXDA 3QVQA 4GABA 2XIQA 3LRLA 4FR6A 2PEVA 2MUCA 1MWOA 3W1XA 3RF9A 4QP0A 1EEPA 4MUZA 2CWNA 4M7SA 2X1UA 4LUTB 3UEQA 3QRHA 1GVOA 1CGWA 3HPSA 3NG3A 5A69A 2XSBA 1UZ1A 1YPIA 1AL8A 2OSYA 2E6YA 1TE6A 3M16A 3L0KA 2VOMA 3SO7A 2J4GA 1WKYA 2NX1A 1ITQA 1F6PA 4FHAA 2ANUA 3H2EA 4C1LA 2XFYA 1ME8A 2J7GA 4FNQA 2Y7FA 4GXPA 5AYBA 4JTRA 5F2GA 2HDJA 2VC9A 5H91A 4HOZA 3M9YA 3WJZA 3IIPA 4I8YA 5DELA 3BMXA 4CNOA 3MSRA 1G4EA 1TA3B 4YLWA 1XGDA 3VCNA 1KFKA 2YDQA 3JUGA 2CBVA 2J8FA 3D3FA 3TW7A 4DJEC 3ITXA 3THQA 3BPWA 4MNKA 4QISA 4GMEA 2UBPC 3G1HA 1RCQA 3C2EA 2ISSA 3ITCA 4IIBA 3B9DA 1WKFA 4S1FA 4V27A 2E5AA 1JD9A 2Y89A 2Y7EA 3VZZA 3NQCA 3MC5A 3E0LA 4RNIA 3W87A 1BVWA 2YDAA 4M80A 3L2IA 3OVPA 4MM1A 4NJKA 1UQZA 4V1XA 3KBVA 1CDGA 3VNDA 4O16A 4FLRA 1BTCA 1DJYA 1T41A 2CBIA 1WZKA 2VZOA 3CLMA 3A5FA 4AIEA 2QCDB 2DW6A 1IEWA 4PCPA 1X8FA 4US6A 3N4FA 4E2OA 3W27A 1XSKA 1GJUA 2I5GA 4GUJA 4S3DA 1PTGA 1HP4A 3ITGA 4UFLA 3IK4A 2NWRA 3NDYA 4B4FA 5K9XA 1UR8A 5TD4A 4JTUA 1VCGA 3R7MA 3QOKA 3PB2A 1RY0A 4HK7A 2OPJA 4P7RA 1GK8A 1QK0A 5KMYA 1LROA 3O6DA 2WJEA 1CW2A 4B16A 1F3XA 3ZIZA 1TMQA 3DH7A 3VZXA 4AEEA 3A21A 3CPGA 1BSIA 1HKWA 4X63A 4JKLA 1GORA 4Y6GA 1DEDA 3THUA 3P5YA 4ATLA 1YNPA 1CX9A 1TKKA 2QCNA 3PZMA 5I3JA 1GPFA 4Z1YA 1WKDA 3QW4B 5A3HA 3SJNA 4KGLA 1KXHA 1NFBA 2R1PA 4R7JA 3KBWA 5CSUA 4DNHA 3ZOAA 4GISA 4KW2A 3W72A 1MMFA 4J9JA 2VUNA 4RLIA 2OLSA 1EXBA 1PZ2A 4RZ4A 3TXZA 3N2CA 1KM2A 2C16A 4NZ1A 2YL6A 4N02A 3O6YX 2CEQA 4Q8UA 3G1XA 4Y90A 4A29A 2XU2A 4RDZA 5G1YA 4NNCA 2G4JA 3BAJA 1XLFA 1NWTA 5CG0A 4IPNB 4X61A 1YHTA 1KLYA 3LSCA 5DO8A 1BWKA 3KP0A 4CNSA 4RE0A 3DHPA 3BGGA 3T2PA 4DXKA 2OOGA 3S4TA 3PN8A 4AWUA 5I5RA 3H22A 3MW7A 1OM0A 4AC1X 4NEWA 4JIIX 4J35A 5E6YA 1RVKA 3NGJA 5KZMA 2GQ8A 1NDVA 1UUOA 1T0OA 2DSVA 5GJNA 4ZSTA 1DIKA 1HGWA 2FZNA 3TUUA 6REQB 2DGAA 4IMEA 5M3WA 2IUZA 3KLJA 3FIGA 2GQAA 1XLJA 1XD1A 3LRMA 3QY6A 3WNMA 4PMUA 1OJTA 2WVSA 3WH9A 4LJ3A 1RA0A 2BGNE 2XM2A 1LL6A 4XD6A 1PIGA 3CL6A 1NIUA 4NEVA 3KCJA 4YPJA 5ABEA 4PMYA 2Y7DA 1AJ2A 3A24A 3R0KA 2CU0A 3M0IA 4O15A 2ZUUA 4RPPA 1K9FA 1UKPA 1Q4WA 1W1A1 4BEQA 5M5DA 1BYDA 4HCLA 1V3LA 2XIMA 2GSJA 2CLIA 1K70A 1VBGA 5U7SA 3EOLA 3AZSA 3VNJA 4GHRA 4GQ0A 3HTWA 3ZYZA 2CZDA 2OZ3A 2VVNA 1SB3B 2HMCA 2IKIA 3RILA 1E55A 2P1FA 3ABXA 4DWSC 4Q7BA 5LHFA 2GGJA 1Z41A 2Y5EA 3DFPA 4P7NA 1K7EA 1PE1A 4BQ2A 1OD8A 3MVIA 2OJPA 3IIZA 5LIYX 4DPPA 2PF0A 4ECLA 5HQEA 4GR1A 5CSSA 4C6PA 3VX1A 1PAMA 1HKMA 1PS9A 3DBNA 2QW5A 4EE9A 3C8FA 4W88A 1S5TA 1XXXA 1XG3A 4ZOAA 1OY0A 5AC4A 2NXHA 4TTUA 4HGXA 3NURA 2CKSA 1J79A 4OUEA 3W9ZA 3GDKA 3RO6A 1MDLA 2V69A 2JIEA 5CJNA 3L12A 3U4AA 3ARSA 5LNUA 3RK8A 4DO4A 4KRUA 2NV9A 4GCXA 3RIKA 3S5OA 1IF2A 4CNPA 2V3EA 1US2A 1IEIA 4O50A 4L4LA 4I5UA 3ZVHA 1VIWA 4W8LA 1MNSA 2FMNA 3WLHA 4H4QA 2VFDA 3UY8A 1MRQA 4JX4A 4UQBA 3EDJA 3CS2A 2R24A 3UYCA 3FHQA 3OGSA 1RP8A 1B2YA 2VL4A 1K4HA 2BS9A 1TPDA 1BWVA 1ECQA 3LCHA 1NDZA 5FSEC 2WMFA 1U22A 1TTPA 3CO4A 2E25A 4L1GA 4AH7A 3R1ZA 1XH2A 4AZBA 4O4WA 2PP1A 3OU8A 3ITOA 5C55A 1R3RA 4BKNA 3I3BA 3SCQA 1R30A 5BRBA 3AIQA 3IJIA 3T0BA 3GLCA 4LBSA 1EGZA 5LIWX 2VDIA 4N4QA 4GLEA 4B4HA 1Q5MA 4PTWA 5HPOA 4TU1A 2DT3A 1XBYA 3GR7A 4J4KA 1VEMA 3IIOA 1UIPA 3U5UA 3I6RA 3M5YA 2QHAA 1R86A 1S5WA 5A6TC 3MANA 1W5MA 3P8JA 5BROA 3QH2A 2ACQA 2HCVA 4B5TA 3EPNA 2HE8A 1XQLA 1Q6DA 2XG9A 3O8AA 1G5AA 2WVTA 4GNKB 4PUMA 1BWLA 3UPWA 3E49A 4C1KA 2CNCA 3G1SA 1W54A 5AC7A 3GC4A 3TSDA 3KDOA 3DGZA 2GOKA 3C3UA 3W00A 1DWJM 4E8GA 1FWAC 2WSYA 1DYSA 3NEVA 4DJDA 4EQSA 2WZIA 1TJ2A 4MFEA 4ZA0A 5FA5A 2BY0A 5C5YA 3NQ7A 4CCDA 3LDVA 1UR0A 1EH9A 5MHBA 1Q6QA 1W9VA 2Y63A 3VCCA 2IQTA 3SGZA 3RM8A 3UR2A 4JN8A 2IKHA 3POCA 3VVGA 4RX0A 1RBOB 1S1PA 2OWWA 1MW2A 1P1MA 3TTYA 1FKXA 1O95A 3VDAA 3LMYA 1HW6A 3B9JB 1UR1A 4PCTA 1EZWA 4JOMA 2IXUA 3GHSA 3P67A 4D6HA 3CM4A 3H6OA 4M24A 2I17A 3M0JA 3TQKA 3DOPA 1O7AA 2IQDA 1ZBKA 1EDTA 3P84A 1W1PA 2DZBA 4S3CA 3EXRA 5A2AA 4EPBC 1TZ9A 1H2IA 2E5BA 1H62A 1DJHA 1BVZA 1L6FA 2X99A 4Q7NA 2X09A 3KXQA 1QR7A 3TN4A 1FH9A 3KTXA 3FOKA 4WY0B 1TJ0A 4FOUA 3C61A 1QXLA 2J24A 1ICQA 4JQ1A 1IIHA 3K2GA 4HNTA 1ECEA 1XCWA 1CYGA 4W84A 5EFFA 3SFKA 5BOOA 1LBMA 1AJZA 3FV9A 4GG9A 5GJMA 3WJYA 3REQB 1GQLA 3U57A 4DM1A 3E5PA 1O68A 3BH4A 5ECUA 4Q4SA 2V5LA 2IS7A 4R27A 3Q37A 2AQWA 2AMGA 3T8QA 3KLKA 4AX6A 4ZEPA 3DFNA 1YXCA 2WANA 3OBEA 2WHLA 1U5JA 1MW0A 3EKGA 4ZQRA 1UBSA 2LLEA 4J1OA 1GOIA 7REQB 4MAZA 1B9ZA 4N2YA 4A35A 5EMJA 3OZOA 8XIMA 4MOZA 4ZFCA 2IPWA 1GNXA 5GJPA 2C0HA 3EEGA 5CZKA 3TDFA 1GYMA 2E40A 4UFKA 1KTCA 3SAZA 1SUXA 5CZSA 3GZ3A 4ZO6A 4HB7A 2BC0A 4FOKA 2PUZA 1L2UA 2NLIA 4IMCA 1W56A 1GERA 1FWRA 2ZC8A 4QAWA 3H4KA 2PPGA 4DBSA 2OR2A 1EWEA 4UCFA 2ACSA 2ZZ5A 3EXSA 2V5BA 1K7FA 1OT1A 4MYAA 3C0JA 1B1YA 3ZJKA 3FAXA 3TKFA 4R85A 5DRCA 1R8LA 4KESA 4GQRA 1Z6KA 3LCFA 1T7LA 3JZEA 4O8AA 1W9UA 1ZMDA 4RW5A 1JYNA 2AL2A 2ATSA 2NUWA 3PBVA 5IOBA 2WSPA 3BLLA 3T2OA 4Q3MA 2P88A 2YA1A 4MWAD 2WBKA 3SQSA 2I7GA 1RQEA 2HROA 3RCNA 4Z2GA 3L67A 3PZVA 3CBWA 2FH8A 3JU2A 3W25A 2WMJA 3R58A 3V16A 4JQ3A 5D38A 4ZQMA 2ACRA 1YYAA 1LOSA 2JKPA 3EB2A 3MSDA 1JCNA 2WZHA 3LA4A 4NX5A 3CZ8A 5A2CA 3B0YA 3SN4A 1WOAA 2J9ZA 1PYMA 3R2GA 3WF1A 7TIMA 4IJCA 3W1RA 1JGIA 3L21A 4HU0A 1JEZA 1ICSA 1HQTA 1PDZA 3PZGA 5DLCA 4GI4A 1EEXA 4INFA 2PLMA 5G5HB 4NHVA 3A3HA 3FW6A 1Z9AA 3FHAA 5AZ1A 1WXYA 4LV4A 3FJLA 4FI4A 3EX1A 3UWEA 4Z2KA 4DY1A 3TR2A 4AQLA 3PTQA 1TIMA 4L5ZA 2DSZA 2EEXA 2VX4A 4K8GA 1FWNA 2ZA1A 4FA3A 1JQVA 2CHNA 3U48A 3UF9A 3S2LA 1U33A 1PB0A 1I1XA 3VE7A 3WQCA 4WCJA 3O0FA 1BGGA 2X2GA 3URQA 1TYTA 4UOQA 3OVGA 4HK5A 1O5QA 4MF4A 1KQZA 4JHMA 4UFMA 2XN0A 1F8WA 2OKTA 3HPAA 3QQWA 3HQOA 4WKHA 3H7UA 1E3ZA 2ZIDA 1Q6CA 3WBXA 3ZM8A 4MWAB 1S3TC 4HSHA 1NDAA 2PF8A 4XSLA 1AG1O 3EWCA 4GVIA 2VDHA 3C2YA 1H5YA 4O54A 5BRPA 4EK7A 3QHMA 2OB3A 3GR8A 4NAFA 2GQWA 1XLIA 4HYWA 2JKEA 1EBDA 3DGRA 4QQ3A 3L8KA 3HPZA 1OJXA 4R5EA 4K36A 1PWMA 3A3XA 1GOOA 4A3QA 3NPXA 4IJBA 3UBPC 5D37A 3RCYA 2ZC1A 4WHBA 1OEPA 2D2GA 2VC6A 3BZGA 3G0XA 2PLJA 1NHRA 4EPEC 3QXBA 1GONA 3VU2A 1Z42A 1JULA 3K8LA 3H2NA 3LXCA 2YPIA 1DOSA 4FXSA 3BCFA 1PEZA 4PUUA 1S46A 2CBJA 3G1RA 3ZT5A 2VURA 3MZ2A 3DYOA 1MNZA 9XIMA 3DFOA 1W3NA 1W91A 3E2SA 1WBHA 4PTDA 4H6RA 3V0SA 1KM0A 2H90A 3MJYA 3EMQA 4LVFA 3KHJA 3S6DA 4RE4A 3ZT7A 4QIUA 1B9BA 5A2BA 1ADOA 3RM9A 2QMJA 1G6CA 1JCTA 3QHNA 2D1ZA 1ODZA 1LM1A 1FDJA 4GK8A 4H9TA 1XC4A 1UB3A 3AMLA 4J3VA 1E6QM 4Y96A 3L5LA 5C2CA 3GXNA 1VRDA 4F48A 3VGHA 2C18A 3PP7A 3MQTA 1UW9A 5DN1A 1M41A 2WOWA 2HPIA 1NDYA 4F8XA 3LEPA 1FRBA 3VTRA 2VENA 2AGKA 2JGQA 4QE5A 4C60A 1XLGA 1S2UA 4WRHA 3W1QA 3G18A 3GYCA 3VIJA 1K02A 2VM8A 4RDWA 4WXYA 3DJJA 3B0XA 2DFAA 3PFRA 3A4AA 4QQUA 1GKQA 5FJPA 3OLIA 4PRRA 3ATZA 4TVDA 1UD6A 4UMCA 4AC7C 4HHHA 3N12A 3BZJA 1P48A 3ARQA 3UETA 1X38A 3W53A 5I78A 1ZNNA 3PF3A 4ROPA 2PDXA 4A3UA 2YDRA 2P50A 2J6XA 2XWDA 3AMKA 2V3GA 1WDQA 4PFHA 1DWAM 4WD0A 4UTKA 2YCEA 3L9CA 4AY8A 2YYUA 4KWUA 2OEKA 3N29A 4NVTA 1GW9A 3OB8A 1RPKA 1J0KA 1W3JA 4J27A 3VD9A 1UH3A 1NEYA 3UWVA 3RPTA 4V2XA 2YGYA 4B3KA 4Q8NA 4P7OA 1JRBA 3WDHA 1WBJA 3QLLA 2VRJA 2GWGA 2OELA 1ML1A 1DXLA 3TP4A 3UWQA 4AXNA 4M6QA 2FHBA 2V5CA 1XBXA 4E38A 3HF3A 5MKGB 5BMWA 2W9MA 4WKFA 4DRSA 1TCDA 4HIBA 4EQXA 1BLIA 1CXKA 3N6QA 2CWXA 1V3JA 4Q4RA 1Q45A 1KTNA 2WB5A 1KGXA 1EJSC 1KM4A 1EIXA 2VEMA 2G97A 3E0VA 5GQBA 1PDYA 4DNAA 1H3GA 5AN7A 5J8LA 4NUWA 5C70A 3ANVA 5CGMA 5I0DA 4JQ4A 3HG4A 3TC7A 1IT7A 4ROQA 5FJIA 3D5HA 2JQXA 3SIMA 3UG3A 4KCWA 1RAKA 3UPMA 4H8HA 1XLDA 2HVOA 1J10A 3VD3A 1IYXA 4UNKA 3CO8A 1IWAA 4BQ4A 2Y4SA 2QCMA 1P0DA 3EWUA 4M5PA 1HVXA 2JF6A 1ISXA 1QNSA 3W29A 3WLSA 4ZQPA 4UTTC 4FNTA 4HU4A 3WUBA 4CQ9A 1LP6A 4UFHA 1V93A 4LW7A 4CNTA 2F6UA 1Q1WA 5AHNA 3WYZA 3O0HA 1UWTA 3V75A 2V9DA 1FXPA 4EXBA 2G96A 4NSBA 3AYRA 2ODOA 3HV8A 1B5TA 1AW2A 1BXBA 2OYMA 3AICA 2DZWA 3CZGA 4JD4A 3SCWA 2B7OA 2OZ0A 5A8MA 3U0HA 4Q8WA 2QDDA 2Y7GA 1A5SA 1VIZA 1YPXA 1VQTA 4QLLA 4MWAC 1JVNA 2DVXA 1LT7A 1JJKA 3M5ZA 4M6VA 1VBRA 2VMFA 1L6WA 1YLVA 2J62A 3NSXA 4DF1A 2DT1A 5T9CE 4IOTA 4LCRA 5C9WA 1QPOA 4DB7A 3SCUA 5C2GA 3B9AA 4GZEA 4M6PA 1JR1A 2XM1A 1XH0A 1WAUA 2OYLA 4JN6A 4EAMA 3PPHA 4GI6A 5DBTA 1D7FA 1YADA 1LQ2A 3FK4A 3NQBA 4WSJA 1JZ8A 5JCNA 5EBUA 4DZIA 1GOWA 1LVLA 1G1YA 5ECVA 1O6IA 2VRQA 1IXPA 2VZTA 3TYEA 3SR7A 1RK6A 2FFCA 3ANYA 1HL2A 4DJDD 1AD1A 1IZCA 4AEFA 1DVJA 3RFAA 1VEOA 2D0FA 2YB1A 2VCBA 2OZ8A 4A3HA 2C13A 5KZDA 3VOIA 3T0TA 1CIUA 5FIPA 5FAGA 1OFBA 4CQBA 4O1CA 3W1AA 3CUZA 4WGHA 2HK0A 4NNBA 4H8VA 3T40A 2W4XA 3W88A 1OGSA 2VR2A 5M2FX 4OV9A 1GKRA 2WPGA 3G2GA 1J11A 2F6KA 1ZTVA 3INPA 3WQGA 2ZUMA 1OYBA 3R43A 2Z27A 3KP1A 5FF3A 4F9DA 3WF4A 5EL1A 3LNPA 2X8CA 3FEMA 1JD7A 2X50A 1VFTA 1UCWA 3CGCA 4TXEA 3ZVHB 1CB2A 3NO1A 3VO0A 5FSDC 3S0CA 3GVVA 1OGGA 1QHOA 2Z26A 2CFFA 1QI0A 4EKJA 1GQJA 3OYXA 5G2IA 2WCGA 2QULA 3MUXA 4Y2WA 5C8BB 1YE4A 4IM4A 4XWUA 1NWRA 2OX1A 4ZCWA 4PFMA 4DUOA 2ABAA 3QKEA 3EWZA 2HVMA 4ZBCA 3W38A 2Z4GA 4CU6A 4I5RA 1B54A 5BCAA 2PDJA 6XIMA 1N63C 1GEHA 1FWEC 3TLQA 1WZAA 3VKAA 3CYVA 5K7JA 4IPIA 4DX3A 1I0BA 3VDGA 4TVYA 1YDVA 2ZUNA 5AZ0A 2DIJA 4H4SA 4DBEA 3QOMA 3DFQA 3QR0A 3H70A 4IFRA 3SN0A 4P7QA 3I4KA 1RCXB 4PUDA 2YB4A 2G4FA 3E38A 4Q6XA 4HQVA 3NO3A 3VKDA 2EPHA 2EF9A 2EBNA 4S38A 3RRAA 3VOGA 1IXNA 4ZOHB 3STGA 2ZZ1A 1NOUA 5JQ9A 1GKPA 2DQWA 3EMZA 1E40A 2Q71A 3N15A 3BV7A 3Q67A 4NL1A 2CHRA 3IRDA 3S1XA 2XH2A 1X6LA 3DKLA 5K4XA 3CIXA 3BOXA 1W5PA 2PTXA 1E4NA 1KKOA 4L7ZA 1L6YA 3P2VA 4JFWA 3VMNA 3WKZA 2YLLA 4O1FA 1YNQA 3A12A 3SI9A 2EKCA 1FH7A 1R2RA 3N2BA 3MCNA 4GO8A 1JF6A 3VMOA 1R6WA 3ZR6A 4GOAA 1JQXA 2B81A 4E4UA 3N9RA 4PUJA 1VPXA 4HNCA 4C5YA 3F5KA 2E09A 3P74A 3QR3A 3EGJA 3UQNA 4FXFA 1GJWA 2PDUA 3B8IA 2CLHA 1WYIA 2XPKA 1ME7A 4ZGYA 3BAKA 3C2RA 1T40A 4BF5A 1H7OA 1W8GA 3MUAA 4M82A 1Q66A 3CHVA 2CZVA 1E1CA 4U4MA 2WC7A 3TQPA 4ZQOA 3SY1A 4X9YA 4GD0A 1C93A 1XDIA 1FUYA 1XYAA 4U31A 3CH9A 4HPNA 2YOCA 1GRGA 3PBMA 3DKJA 3PWIA 3CT2A 2IQ0A 4PBFA 3L4YA 4MKVA 2A7PA 3AWNA 5A6BA 1S2WA 4YTQA 2DEPA 3DAQA 3SGGA 3LCXA 4IQJA 2XIBA 2ZZ6A 4GY7A 2NQHA 1GOXA 4P2VA 5ENLA 5D9NA 4H50A 4EQRA 2NVKX 2FGZA 1SVDA 1Z32X 4WKAA 3BXWA 2VQUA 2NVDA 4AHQA 4G7FA 1W1YA 2OT0A 1VC4A 3QW3A 4H8UA 1CLXA 4FEZA 3WJSA 1SO3A 4HJFA 1K4GA 4YTUA 1TZ7A 4DXXA 5HPCA 3CUFA 1AH4A 3E3HA 4YHEA 4HTYA 4AF0A 1GRAA 5HXMA 3EAOA 4PTMA 1P6BA 2CCRA 1TV8A 5EKYA 4X2RA 2NX3A 4H9ZA 3AIBA 3B8SA 1NARA 4XAPA 2QEZA 4W87A 4H7ZA 4K68A 1HIZA 3V5CA 4DYJA 3WDIA 1BGAA 4J3WA 1UASA 1M65A 1EF2A 4LPCA 4TUFA 5FKYA 2VFGA 1WUFA 3PUGA 3NL6A 3GTIA 4B3LA 1QK2A 2Z7KA 4TX8A 1V6VA 3MS8A 3NOEA 3IGHX 2HXUA 3NQ8A 2GR1A 3A6OA 3VM7A 3K46A 2J6VA 4HNOA 1UH4A 5D32A 1OFEA 1KRAC 1QW9A 4QE4A 3S2MA 3B9EA 3GNRA 3LHYA 4QRNA 2VWTA 1JZ3A 2F61A 3N6HA 1QPKA 2VWSA 3BCJA 4CD5A 3CGBA 2VFFA 2O9RA 3PB0A 3CJPA 4D72A 3QV6A 4UFIA 1G4PA 4HTBA 1QHZA 3RRXA 2YVGA 4J40A 2GVYA 3AIVA 3I7RA 4BA0A 1QI3A 1H1ZA 2V8ZA 3H7VA 4ACYA 2WCSA 2CZEA 1F3PA 3TN3A 5KVHA 3BL3A 1HJXA 4EVZA 5AC5A 2AAQA 2WZEA 4DYEA 1C8VA 5H8UA 1L8NA 1QDSA 3DK8A 4LH8A 5AHLA 2RFGA 2C3ZA 2GL5A 4YXGA 2DVTA 4RXGA 3RHGA 1Q7ZA 4XZHA 1EYEA 5CBIA 3P14A 1XF0A 4JQ9A 1ZHAA 4P8XA 4ZB2A 4S23A 1W9PA 4FPSA 4IQEA 2PGEA 1M6JA 4LCQA 1JUBA 1JUKA 2Z0IA 5I6SA 1E6RA 1S38A 1ISZA 2WNQA 2G50A 4JYEA 1GRFA 5FL1A 3W1MA 2E3TA 3NPWA 1E3XA 4ERGA 1QPQA 2KZHA 4GVGA 1M3UA 4L64A 1YIXA 1CCWB 2ON3A 4S3GA 1I2NA 3BOFA 4AD1A 2W54A 4AVOA 3DK9A 1MZHA 3V5FA 3KL0A 1XV8A 3VNIA 5I3KA 2YL8A 3BLKA 1QATA 5LA1A 2NUXA 4MTVA 1F7BA 2ZADA 2BOEX 3MZNA 3SUWA 3T0DA 2QKFA 2AGTA 1YXYA 1BZLA 3CPRA 1T6MA 3DHFA 1G94A 3DX5A 5ER0A 5HUPA 2HISA 2G41A 3W7EA 4CCEA 1V59A 3BARA 4D1JA 3SY8A 1RH9A 1XLHA 1XW8A 3O07A 5ABFB 4BCEA 3EF6A 1LQAA 3VC5A 3GDTA 3QMRA 4MPQA 4CNUA 5LNWA 1C8YA 5BRQA 1NWSA 4JTSA 5FS8A 1SQ7A 3ARUA 3BG5A 4WSKA 1IEQA 5KEZA 1KFEA 4PC8A 1V3MA 4H83A 2PDIA 2PWDA 2PODA 2E5CA 5HK4A 2E6FA 3DGBA 2HQMA 4QJ5B 3QHOA 1O1ZA 5HNUA 2YBTA 4XD3A 1E6NA 4E8DA 1K9EA 2XYLA 5LA2A 3LZ3A 4AD4A 2VJXA 2ALRA 1YW1A 1NPXA 4Y8EA 2WBGA 2QJJA 1KV5A 1EA9C 1TRIA 4GXWA 4RNFA 2TPRA 4DEFA 2DSUA 2PI6A 1RQHA 3QJAA 3FYYA 5TF0A 1A5CA 3AXMA 3AXKA 3GDRA 1EPVA 3ORWA 5I06A 3OLEA 1T5AA 5EMMA 3SIZA 4JTQA 1DHKA 4JQ2A 3DUGA 1Q6GA 3S83A 3PSVA 3C3NA 1XP3A 1BQCA 4V28A 4PMXA 4QR6A 4KQNA 3WSUA 4BURA 2QNEA 2PWEA 3LNMA 3CNYA 1ZX9A 4MKNA 1DTNA 1NHQA 4YWIA 3W1LA 4H4PA 1TV7A 4APNA 3UZZA 4PUNA 5E9AA 3BG3A 1JPHA 2E3ZA 3W7DA 4HMEA 4RL3A 1ITXA 4XD4A 1TPVA 1CXEA 2PWGA 3U3HA 1TUXA 1JPIA 2XUCA 3A13A 2J74A 5FJRA 2GR2A 2QGHA 4RXFA 1VDVA 3GTNA 3GFXA 3F7JA 4DWSB 3WD2A 3HJZA 3H26A 4KBXA 4ZXLA 4XZNX 1FWHC 2J9XA 3FG2P 4W5UA 5D2YA 3MCMA 1FDYA 1W2PA 1Z89A 1HTIA 3PUDA 1AODA 3NM1A 1TR9A 1VAHA 2P0IA 3RX3A 3VIFA 5T91A 2XGZA 5DMMA 1TPC1 3WBAA 2YXGA 3B4UA 2ZBTA 3A3WA 1LRQA 2XVLA 4WDWA 2GR0A 1VS1A 4XG1A 1VGAA 3QC3A 1DJIA 4GC4A 1OF8A 2WSKA 1UWIA 2XTKA 3DI0A 3P3BA 5BOFA 3T7VA 3MMDA 4JGDA 3BOLA 3ZFHA 3LXDA 4Q8VA 1X97A 4A22A 4NYUA 4AYGA 1XKYA 3BLIA 3UY7A 3DYPA 4HPXA 3SRKA 1I0DA 1RQBA 2FQIA 5A8GA 1VR6A 2V3AA 3C2FA 3CWOX 4UQCA 3EAUA 4M52A 4GIRA 1V02A 3PZNA 4V1YA 4LF2A 3M64A 4J3SA 5EMUA 5IBXA 3WELA 1LRTA 3KTCA 4JR5A 2CZFA 3BLDA 5XINA 1XIEA 2E7FA 4H9XA 1EC9A 4L4OA 4NRRA 3UGVA 1LTDA 3WUFA 3BSGA 1U2YA 1DIDA 2WPFA 3IPWA 1W3LA 4CEUC 1ZB5A 1W1VA 1GOQA 4L6OA 5T9BG 1UH2A 1ZPTA 4CD7A 4J3TA 3WMCA 2DIKA 1C3FA 2EKGA 4FB7A 3WK1A 4H4IA 1JPKA 2PFHA 3NSMA 1WPCA 4H6EA 5F2MA 3NA8A 1ZRQA 2YDSA 4AMCA 3TNBA 7CGTA 3F5JA 4GI8A 2PURA 1SFJA 3W85A 2J13A 3TTQA 3VNYA 4A8IA 2BVTA 2J7BA 3LQLA 5JXQA 4N6EA 3UCDA 5LZLA 3NEHA 4LRSA 4UC5A 3G6MA 3GW0A 3LHZA 1AA1B 1V4YA 3TZFA 3E5BA 4YWSA 5G1MA 2CFYA 1XWYA 1ITCA 4C90A 1XRTA 3L66A 2PDWA 4Z1DA 4LV9A 1ONFA 3UWZA 2WPEA 5G4HC 4QGCA 4DZAA 3H2FA 3FFSA 2OODA 1SU5A 3O7UA 1J96A 3VGBA 2EJ1A 4S39A 3M7SA 2R6OA 4US5A 1KCZA 1ZFJA 3DXIA 3PZOA 2OZTA 6REQA 4AX7A 5DXYA 3M0MA 5CH9A 2P3ZA 5DMNA 1CWYA 3DK4A 2A5HA 4M81A 1O5XA 1KC7A 4KPRA 1V97A 4M8UA 4AZCB 1JXKA 2CBUA 4PSPA 3PZIA 3A9IA 4K2SA 2WW5A 3CGDA 4PL2A 1Q6FA 4HMNA 3OHMB 1YTKA 3O16A 2REQA 3W83A 3BE7A 3T8LA 2POTA 3GU9A 3PPCA 3R11A 1DXIA 4KIEA 3E1F1 4BV6A 4GUFA 1RP9A 2PTZA 5DMLA 5G4EA 3KWXA 5I3FA 4ZO9A 1AQHA 1BEUA 1F3EA 1CGUA 4DLFA 3D9XA 1J0ZA 4DJED 1GEQA 4CEXC 4ZODA 4JFVA 1IEXA 1WDWA 4DN1A 2O4MA 4ADTA 1OCNA 3KFTA 4Q6JA 2OQLA 4MNMA 2Q01A 4MJMA 1KR1A 5BXTA 1SO5A 3MVTA 3EB3A 2DUXA 5TIMA 3TYCA 2CLEA 5I23A 4JQAA 2XVNA 1FCQA 4HOXA 3ARPA 5I24A 5EBKA 3DESA 1VHNA 3MUZ1 4L9YA 1SMDA 2WLZA 4A3RA 3V36A 1KM5A 5G5IA 3ZLGA 4HPHA 3OA3A 2YAUA 2D3NA 4J3ZA 2WSRA 1M01A 5D04C 1K6WA 2W3SA 4J57A 1IZKA 2FDMA 3IJ7A 1B3XA 2BTMA 2F8QA 2WMGA 3C2VA 4O11A 4E4FA 5D30A 4H4ZA 4PMJA 2D22A 2I1OA 4PMVA 2Z1BA 3LPPA 4WIWA 2GJPA 4B9ZA 3HRDC 3VM5A 2DZAA 4JTTA 2OGYA 3EX2A 5RUBA 2PB1A 3F2DA 4B5UA 2C19A 3GE7A 1FX6A 1GWJA 3DERA 1A3XA 2D20A 1FHDA 2EQ9A 3PANA 2VZSA 3IANA 5A6SA 4XVEA 3T81A 2FB2A 3SSZA 1OIFA 3V0UA 4WOQA 3ELFA 4DNMA 2PRMA 4IIGA 2RDUA 5CEWA 3GTHA 3MDUA 3PG8A 2HV5A 4ZB0A 4UTUA 3B06A 2FGBA 3SW6A 1UR4A 1IR1A 3S5YA 3OIXA 2V5DA 1N62C 4K8DA 3KEHA 3TW9A 3A64A 1ZMCA 4ZO8A 1JAEA 3OTRA 1UZ4A 1OHLA 2OO6A 3F5LA 1JYVA 4C6QA 1R9ZA 2PDBA 4E2VA 3HGJA 2QCHA 2DV0A 3GXPA 3BMVA 3SUTA 1WAWA 4GNJA 2BY2A 4GWEA 5F4SA 3W02A 3NR0A 3QMSA 1RSCA 4XISA 3MPGA 3R8RA 1SZEA 2REQB 4NXKA 4A4AA 4IP5A 2ZRVA 4G56A 2X05A 2Z1SA 4KRTA 1UJPA 1JYXA 1S5VA 1CGVA 1KKRA 1LCOA 3WY1A 5KZEA 3WBEA 3U8GA 1V51A 2FJUB 3GHTA 3HMCA 1GJPA 4KS0A 3RLUA 1XJBA 1V6UA 1XSJA 4I9JA 5FF4A 2GJNA 4DYKA 3MDWA 2TMDA 2V6AA 1FWJC 3NQEA 1ZJHA 5HAOA 1Y8BA 2X1RA 2P3EA 4D6DA 1OK4A 5C9UA 2X0YA 1R5YA 4W7UA 1LT8A 1OWQA 1PSCA 4YHGA 3MV01 4GYFA 3GC5A 4XBKA 3LGGA 3M0HA 3N19B 3UA4A 4DJFA 1QAPA 4JHOA 1FH8A 3APTA 4EF9A 5K9CA 4FALA 4N6FA 3AZRA 1YTDA 4YVVA 1UIOA 3ICJA 3GIPA 3SUUA 3BGAA 2O55A 4J2MA 2G3JA 2V68A 3ZR5A 1XIFA 3TC6A 2GDQA 1KCXA 4C6KA 3UNTA 4I7WA 1EB3A 3BQ5A 3Q94A 4LUSB 1TO3A 3AU6A 2R91A 1ZCOA 4G1NA 3L0GA 5DRIA 5C7HA 3QZEA 2E8ZA 1OB0A 1XS2A 3HQPA 3DBPA 3MT1A 1T8XA 1YRRA 4NILA 4F0KA 3LZ5A 3TMLA 3CL8A 4XUYA 1V0KA 4MNLA 1XFBA 3WEOA 2FVLA 5FL0A 5FS7A 3LXBA 1ODUA 3GHUA 4DF2A 3H7RA 1RXOB 1L0PA 2ACUA 1P43A 3CGTA 4HCDA 4AD3A 1J0JA 1XINA 4Z42C 1C7SA 1SJDA 3DDMA 4JDBA 3EX4A 3LYEA 2ZICA 3W7IA 1C7TA 3AIWA 1EKOA 5GNYA 1S2VA 4WY0F 4H4YA 3EOUA 3DU0A 4JCLA 4DO6A 3EA2A 4UQEA 4GGBA 4IFKA 4E8CA 4WUIA 1QUMA 5CAKA 1R3YA 2ISWA 3QGVA 3VMPA 2PMQA 1IWBA 1DIOA 3TOYA 3WEZA 2J8GA 4PYSA 3DIPA 3S5SA 3P0XA 3L7RA 4H6KA 2RH9A 2RDXA 2E68A 1V6YA 2PDQA 4ML4A 3TCEA 2Q3RA 4Z1CA 3URAA 1XANA 2J88A 4KEZA 4F40A 1ZKQA 1B57A 3TZNA 2XH4A 3ITTA 1F3TA 3GKAA 1Q8JA 1UJQA 4O28A 3MO7A 2WAGA 3WLOA 4ADSA 2GK1B 1TB3A 1U5HA 2YYTA 1EUNA 2G5WA 1IE7C 4LC6A 3THDA 1E1EA 4ZO7A 1MQPA 1QRQA 2IKGA 3UR8A 4F0MA 2V2HA 4IIEA 1Q6EA 1YTEA 3CL7A 3CQKA 3NXLA 1V3KA 2NX9A 1MO0A 2QDHA 2W66A 1H09A 3LM7A 4XVDA 2C15A 4RW3A 3TYZA 3MBDA 2NQJA 4IGNA 2F2HA 4KEUA 4KPLA 4AFYA 1HKVA 2W3ZA 4LY8A 8XIAA 4JTFA 3OO2A 1LLWA 3NYZA 4U3CA 5REQA 1EPXA 3BG9A 1DQXA 1IEVA 4S3AA 4Q32A 3T2QA 4HHPA 2NW0A 2NT1A 4O1BA 5I00A 4BZYA 5FJTA 1EC7A 2C71A 4BQ3A 3LBCA 2PSNA 4RK8A 4IQLA 4WQ6A 4JYDA 2NQZA 1OFPA 2PAJA 4S3FA 4XIAA 4HMCA 1PKNA 4AWEA 4PEKA 4MHBA 3NQFA 4AWSA 1KD0A 3JVAA 3RUBL 4AXKA 4PULA 4QDMA 1SPQA 1TV4A 3ZJ7A 3NIYA 1OF6A 3LHTA 5A6AA 3FYPA 2E4TA 5CPOA 3NJ3A 5LNRA 4GBDA 3LRKA 3AZTA 5CG7A 3NFUA 4HA3A 4JZ5A 5CC7A 3MKCA 4C6CA 4DHGA 4DJFD 2BVWA 3W2LA 3F2CA 1OC6A 1ZQ5A 2WOIA 3W7QA 3EPOA 2BB0A 4F0SA 4LSBA 3NZGA 4EX4A 1DWIM 3ECQA 4LYKA 3SM0A 2CIPA 1RBAA 5T8GA 4Q4MA 3RNMA 1A5LC 1IZJA 3G3MA 3IV8A