4DN1A

Crystal structure of an enolase (mandelate racemase subgroup member) from agrobacterium tumefaciens (target efi-502088) with bound mg and formate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
389
structure length
389
Chain Sequence
HMNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal structure of an enolase (mandelate racemase subgroup member) from Agrobacterium tumefaciens (target EFI-502088) with bound mg and formate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 132
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dn1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dn1A01
2OFJA 2OKTA 3CT2A 3R10A 3OZYA 3IJQA 2MUCA 3SSZA 3DG6A 2FYMA 3UJEA 2ONEA 1EC7A 1PDZA 5FJPA 2PODA 1R6WA 4MMWA 2POZA 4H19A 1MNSA 2GDQA 4KT2A 1EC9A 4IP4A 3TQPA 2PTYA 3ES8A 2PP1A 4GGHA 2P8CA 3V4BA 1ELSA 4IL0A 2XH2A 3B97A 5BOEA 3HPFA 3V5CA 4A35A 3CXOA 3N6JA 2OVLA 3OPSA 4JN8A 4K2SA 3RO6A 3STPA 4YWSA 4HCHA 1EC8A 4A6GA 4GISA 4GYPA 3DDMA 4Z17A 2PP0A 2PP3A 3DG3A 4DX3A 3CAWA 1XPYA 3OP2A 4EWJA 1JPMA 3DGBA 3EKGA 3TWAA 3UJRA 2HXTA 4GGBA 3FJ4A 4X2PA 2PGWA 1FHUA 3TOYA 3NZGA 3RR1A 2OZTA 1FHVA 2AKMA 3PFRA 3VDGA 2GGEA 3DEQA 3GC2A 3DESA 3MSYA 2OPJA 1F9CA 3ZVIA 2XGZA 2FKPA 1DTNA 3V5FA 3GO2A 3RRAA 3ENLA 1SJCA 4FP1A 3TJIA 2AKZA 2QGYA 2DW6A 4F4RA 2OO6A 3R0UA 4DYEA 3EEZA 2GGJA 3MQTA 4DN1A 4GMEA 1MUCA 3R25A 5EU9A 3ZLHA 3Q45A 4K1WA 3SQSA 3I6TA 2OX4A 4ZA0A 2ZADA 4M0XA 3SN1A 4H1ZA 2AL1A 2OQHA 2XSXA 2PCEA 3MY9A 1EBHA 1E9IA 2PTWA 4HNCA 3DFYA 4MGGA 3PWGA 1IYXA 4E5TA 3H7VA 3BJSA 3JVAA 4ZCWA 3T6CA 3UXLA 3KUMA 4G8TA 3PWIA 4DHGA 5J04A 2QJJA 1WUFA 4IP5A 1MRAA 4Z1YA 3NO1A 3P3BA 4H83A 1MDRA 1KCZA 3I4KA 2OLAA 4HPNA 2PS2A 4HCLA 3SN0A 1BKHA 3K1GA 2PMQA 3FVDA 2GGHA 3BOXA 5ENLA 3UJSA 3U4FA 3CB3A 1P43A 4GFIA 2AL2A 1NU5A 2MNRA 1XS2A 5FJRA 3SJNA 3RCYA 2O56A 3RGTA 4IL2A 1BQGA 2XH4A 3H8AA 3SN4A 2PU0A 3I6EA 3Q4DA 2PGEA 1PDYA 3ZVHB 2PU1A 1SJBA 4E4FA 4ENLA 1MDLA 4JN7A 3RITA 2P8BA 3QN3A 5FJOA 4E8GA 3ZLGA 2P88A 3JZUA 3VC5A 2QJNA 2ZC8A 3QLDA 3TW9A 6ENLA 1WUEA 1JCTA 3N4EA 3UJFA 4IT1A 3UJ2A 1JPDX 2QVHA 3VCNA 2PTZA 2DW7A 3FYYA 3S5SA 5BOFA 1P48A 3FV9A 3VC6A 4GIRA 5FJUA 3UXKA 4M6UA 4A3RA 3DFHA 2PTXA 2HNEA 3BSMA 1EBGA 3H12A 3DIPA 1NELA 2PA6A 5IDZA 1SJDA 1W6TA 2P3ZA 1OEPA 3ES7A 2PPGA 2OQYA 1KD0A 1L8PA 4J3ZA 3P0WA 3QTPA 4KEMA 2RDXA 4J1OA 2PSNA 3V3WA 3MWCA 4DWDA 3GY1A 3VCCA 4G7FA 3TWBA 3R0KA 2GSHA 3IK4A 2HZGA 1TKKA 3N4FA 3DG7A 4GYPC 2OZ8A 3QPEA 4HNLA 3NFUA 3T8QA 4HYRA 4HN8A 4JHMA 2QDEA 2CHRA 3VA8A 3CK5A 2GGIA 3U9IA 3N6HA 1YEYA 3SBFA 2QJMA 3IJLA 3MZNA 3UCCA 5FJTA 2OZ3A 3GD6A 4ROPA 2I5QA 3TJ4A 3NXLA 3PK7A 1R0MA 1TZZA 3QKEA 3S47A 2GL5A 1ONEA 3ZVHA 1KKOA 3ZLFA 1SJAA 3UGVA 4E6MA 1KKRA 4KPLA 2AL2B 2OG9A 3FCPA 3R1ZA 4FI4A 3D46A 3TTEA 3THUA 3MUCA 3TCSA 1ECQA 2XH7A 7ENLA 3OW1A 4IHCA 2HXUA 4IZGA 4E4UA 4K8GA 3UCDA 3OZMA 4KWSA 2GGGA 3JW7A 3H70A 4H2HA 3MKCA 1JDFA 4MKSA 1RVKA 3DERA 2P0IA 3T9PA 3VFCA 4HCDA 3OTRA 3CYJA 3R11A 3D47A 2XH0A 3FXGA 4DXKA 1TE6A 3IJIA 3P93A 3T4WA 2QQ6A 2NQLA 2QDDA
chains in the Genus database with same CATH superfamily
1EPVA 4L61A 3R10A 3A4WA 1UD2A 3OO2A 5E6YA 3HB9A 3ECQA 1E1EA 2GJXA 4KGJA 2D2HA 3EUB3 5U1OA 2WMHA 4BY3A 4LXFA 3TQKA 2ISWA 4NXSA 1TMQA 3OVRA 1DBTA 4QHRA 4JTSA 3VU2A 1GYMA 4RDVA 1F3PA 1V6XA 4H8HA 1T96A 1CGWA 3S46A 1WCGA 2YBVA 1REQA 3NDZA 1C90A 2XH2A 2I7GA 3KBNA 3V5CA 1W1B1 5BRBA 2XYLA 3P0XA 1MO0A 4NJHA 3B4YA 4HPJA 1F6KA 3ITGA 1DNCA 3VNDA 1RCOB 3T78A 4ECLA 4HNUA 3GG0A 3W23A 3WBYA 3BPWA 5HATA 5HINA 3T0TA 5C7HA 4Z1DA 3N11A 3DGBA 3EKGA 5LIUX 3I3DA 4Q7IA 2ZE0A 3CQJA 1HXJA 2DSZA 2PDCA 3B8IA 3S0CA 4B92A 3IK2A 4IXHA 1FHVA 1W31A 3AZTA 4Y9AA 4A3HA 4S38A 3RX2A 3MUAA 4O13A 4O10A 2OPJA 1GVOA 1A4LA 5F1UA 1F9CA 1BHGA 3DKJA 3HJZA 1V3LA 2YXGA 3C56A 2QCEA 2PURA 2YAUA 4OE7A 4LEFA 2NV2A 4GC3A 1M7PA 3QY6A 4PGLA 3PAJA 3SIZA 1E6XM 4J2MA 3ALGA 1FFRA 1UHVA 2PDMA 1MUCA 3QJAA 3WF0A 1AH0A 2ZUVA 3S1VA 1PKYA 1R3SA 2P50A 4Q22A 4JQ9A 3TXZA 3H4GA 5BMXA 2PDFA 2GSEA 4LRTA 1WYIA 1XXXA 4XK2A 2Y2WA 3B03A 2GVEA 4UTMA 3E5BA 5G4WA 5BWAA 3ARSA 1TTIA 3N6QA 4TX9A 2Z1VA 5C7VA 1FFVC 2ZOXA 4JTQA 4CD6A 1P5BA 3VZYA 1HL9A 3KUMA 4I7VA 3WF2A 2YCLB 4QJ5B 1FQ0A 2A5HA 1QVBA 1WZAA 3GNXA 2EPHA 4FAMA 1VYRA 1EDTA 1MDRA 3I4KA 2G95A 1UZ1A 1VEMA 3DAQA 2NQHA 4DLMA 1P0KA 1RD5A 1QHOA 1AK5A 4L1XA 2E25A 4D1IA 1E6SM 3N1AA 3BOXA 3CB3A 4EOUA 1WXYA 1NU5A 4GJJA 3OLEA 1E6ZA 2WSYA 5TR3A 1LWIA 4QP0A 2IS7A 3K1DA 2Q01A 1R86A 1RBOB 2W3RA 1V5XA 3FY1A 2X0SA 4JKMA 2NXHA 1Z89A 2AOSA 2AMXA 1TO3A 1TZ9A 3LZ5A 1XDLA 1CB2A 3VGFA 1PBGA 3AOFA 1QI3A 3MV01 4OV9A 1VB9A 1V0MA 1SO6A 3SJ3A 3CZKA 3AQUA 1GOWA 1TUXA 2WVVA 5LKYA 1HVQA 5CKSA 6PTDA 5FI8A 5JCNA 3MV11 2XZ9A 2VR4A 1WUEA 3D3AA 1US3A 1TSIA 4Q32A 3SY1A 2EJAA 3NM3A 1H50A 4B5SA 3LD5A 2FGZA 1A3HA 4L9ZA 3JU2A 3VC6A 4GIRA 1H3GA 4FNUA 2WJDA 3FXYA 4W5ZA 3TW7A 3IV8A 3BK0A 3GFXA 2X1TA 2YFNA 3KBJA 1X1OA 3FNDA 5K9XA 3AROA 1VLWA 4IUOA 5DXXA 1NM9A 2D3LA 1KD0A 4XKYA 1L8PA 1NHPA 4JYDA 4KETA 3KOZA 4DBWA 5D03A 4MDOA 3ZM8A 4AZGA 2ACRA 1W9UA 2QF7A 4Y9MA 2J74A 4AC1X 1QI2A 3SUTA 1KBJA 1AUSL 1R9ZA 1W8GA 1KBLA 1XDIA 4F0RA 2RFGA 4IIGA 1FCQA 4GG9A 2W54A 4IP7A 1OB0A 3UZJA 2WPBA 1VPXA 1J9YA 3S1WA 3A13A 7CGTA 3SDOA 1OYAA 3W01A 1R7AA 5D32A 4A2SA 1I1XA 5JCLA 1NQ6A 5FJTA 1V02E 1H4PA 3KAOA 1PX3A 2WZEA 3Q37A 5DRCA 4EQWA 1H63A 4OOZA 5HMFA 5D2WA 2NX1A 4GKTA 3QKEA 1C3FA 1S46A 2GL5A 2YCKX 6CGTA 3HQPA 1G1YA 1ZJIA 1OK6A 5CH9A 1MVYA 2FJKA 5JMUA 1N63C 2NPXA 1N8WA 2XVNA 5I3JA 2WSPA 1XG4A 3M46A 3TFCA 2ZIDA 1DXFA 3R1ZA 4FX6M 1UB3A 3TW6A 4Q8VA 4JTJA 4MPKA 1XYZA 1HGWA 3MA8A 1G94A 1G7UA 3AJXA 3FAXA 2G50A 3VKKA 3BLKA 5LNSA 2VENA 5LA0A 5DCBA 1YE4A 3UZYA 1KM3A 1UG6A 4Q7NA 1UUOA 3G77A 3MO7A 3Q65A 3CQIA 4WY0F 1RVGA 3A4AA 3LDVA 1I2PA 5HNUA 3T9PA 4HCDA 2C3ZA 3VNLA 4KEZA 4GD0A 1DJGA 3W7GA 5BWFA 3L4XA 1K4QA 2OSXA 2X42A 3FXGA 1AQMA 2I1OA 3AALA 2EG8A 1MXGA 3NQDA 3NQ8A 3L2MA 4O52A 1SSDA 4ZGYA 1XSKA 1V3KA 3VIMA 5LGZA 5T8GA 3SO7A 1C8YA 2IPWA 2J6XA 1G4TA 3AU2A 4BKNA 2ONEA 3M0IA 2CPUA 3R79A 3OHMB 2C79A 4XZHA 4LS1A 4PUDA 4HJWA 4RZ5A 4XD5A 4IP4A 1VCGA 5U25A 5B80A 3BTNA 4HA3A 1EGZA 4U5KA 4MYXA 3U2EA 3A5VA 1PTGA 3BOFA 5ABHA 2A3BA 3WK3A 4N6EA 3HPFA 1US2A 5BCAA 3WD1A 4MWAB 1J11A 5XIAA 1GYNA 3STPA 4IIBA 1JZ8A 4CLMA 4DUOA 2C0HA 4YU1A 3VDBA 4QEEA 5HANA 4LUSB 1R2RA 4D6HA 3TYZA 3WBEA 1XUZA 3ZZ1A 1HFBA 3MVIA 3BH4A 3RIKA 4PCFA 3MUY1 2Y70A 1GXFA 3UG3A 3BANA 1O5QA 3NAVA 5D9NA 2FGBA 3W1TA 1S2AA 3W7DA 2IQDA 3VGGA 3W1MA 2EAWA 4Q8PA 3GC2A 4BFAA 1P0DA 4DO6A 1Y0EA 3USBA 3E12A 3AMDA 4JTGA 7A3HA 1YTEA 2WMIA 3STEA 4KPRA 7PTDA 3SR7A 2GVJA 4PEEA 5DLCA 4AH7A 5A6TC 2TPSA 1FWNA 2ABBA 1U5VA 2GWGA 2W62A 3IS4A 3F1QA 5EMJA 1DYSA 4NT0A 4HOZA 1DJHA 1QR7A 3W7LA 1CGVA 3K5XA 1NDAA 1V8EA 4ATLA 3E38A 4F66A 5DFAA 4DWSC 5F2LA 3N14A 3ZLHA 4HBKA 3FA4A 1IEQA 2WMGA 4NX5A 2OX4A 3TIMA 1QCWA 4AWUA 4MJ4A 1F74A 3M0ZA 5LIYX 5DMNA 4K39A 3D5HA 4MGGA 5CPNA 3C0SA 2VX7A 5LSMA 4US5D 1CW2A 1UA7A 4H50A 5FEZA 1L8NA 3LGEA 4LAOA 1XLHA 3RXZA 3FA5A 3WLRA 1HN1A 4AEOA 3NO5A 2ZZ2A 4UTWA 2GJXB 4UTLA 1T41A 2QLYA 4JIIX 5LIXX 1E9LA 4GBUA 3I6RA 4ZQCA 2RGLA 4P8WA 3AS3A 3QR1A 4DZIA 4OT7A 1LWJA 3V1PA 5D2VA 4S3KA 4Q4MA 3L4UA 4Q33A 1S2TA 2O9OA 3F5JA 3DENA 3W1RA 3EMZA 2CZEA 2Y7DA 2WOWA 1XCXA 1NFGA 1UH4A 4GH1A 2PBGA 3U3HA 4WDUA 2W55A 2DIKA 3LXAA 3MMTA 2WAGA 2PU0A 3MKVA 5DO8A 4N02A 3ZS4A 1TREA 3B8DA 3VOFA 2PF8A 2CEQA 4IX2A 3TTQA 1YNYA 4PB3A 3IUDA 4UIOA 1U1UA 2P8BA 3B0YA 4KFPA 2WV8A 5GNXA 2PDUA 3KP0A 3PTKA 3IIXA 1UOKA 5I3HA 2NX9A 3LBMA 3R12A 4TV6A 1QHZA 4HVXA 4AYSA 4BEUA 3HPSA 4YWOA 5HWNA 2PDHA 2YW3A 4EK7A 2A21A 2QV5A 4JS3A 2A6NA 3W1NA 3K30A 3K8KA 4HMNA 2ZX5A 3G0SA 4AISA 3E0LA 3W4RA 2QVHA 3GXIA 4I9MA 4I9TA 4N9CA 4QNEA 3WH9A 2IUZA 2HE8A 4CNTA 3L23A 5HNNA 2WSRA 4BI5A 4LAKA 1JPIA 2BBFA 3LCWA 4LYKA 2HNEA 2JBMA 1GRAA 1ZKQA 3SCSA 1S5TA 3DIPA 2QT3A 1YTDA 5C9ZA 4AIBA 4D6CA 4I7UA 4IGSA 3F4VA 3BVJA 3DHPA 5BZAA 4N9BA 4C1KA 3EA2A 3CLMA 2NWSA 3WMCA 3EX2A 4IJBA 4MJZA 3BSHA 3TH6A 4E3VA 4AY8A 4LA1A 2OZ8A 2V5LA 1I0BA 1EL3A 2QJIA 1QMLA 3SY5A 4YYFA 1N7KA 4MB1A 1GESA 4WDWA 3W6MA 5HK4A 2F38A 3UVIA 3UXAA 1ITUA 2VR5A 4ROPA 3TJ4A 3C2OA 5CAKA 1IGSA 3LCGA 1FHLA 1NSJA 3VVGA 1R0MA 3SCVA 1EYEA 2HMCA 1WP6A 3TYAA 1K03A 5CC5A 1VZWA 4IMGA 1LUCA 2PBOA 3VOCA 5H8UA 2YIHA 3M6DA 2V0TA 1H0GA 2CBIA 4FDCB 3Q6JA 3MSDA 2Y85A 4E8DA 1JL8A 1L0PA 4XG1A 1J96A 4JD4A 5FF4A 1B9BA 2WHLA 1DJQA 2DIEA 3MUCA 3TCSA 2P1FA 3MP3A 1C8XA 1KW1A 2O55A 3WEOA 1JCYA 2PE4A 1A0EA 4A4AA 2RHGA 4XTIA 2BB0A 4XB3A 1YXDA 1VYPX 3OIHA 4K8GA 5KSWA 4KWSA 3F5LA 3JW7A 4KS0A 5JIPA 2W67A 2HRWA 3A23A 4GABA 1JDFA 3A22A 5MHBA 2PGFA 4IPNB 1X97A 5FL0A 2WVVB 3EX1A 1QNSA 1YBQA 4NI8A 4B3ZA 3B9NA 4ZTYA 1W5PA 1GQIA 3WNPA 3UY7A 2PD5A 2E3TA 4O8AA 2HTMA 2VWTA 1QPKA 1VEOA 2NSXA 3P93A 1DXIA 3LOTA 5LYRA 1UD5A 2XN2A 3C0LA 3TZNA 2J9ZA 1EIBA 4QCFA 1LL4A 5C9XA 3BMVA 2ZZCA 3GU1A 4PH6A 1TYGA 4OJYA 2E09A 3MUZ1 5LIKX 1I4NA 4YL2A 4CQBA 3ABSA 1E40A 4AZCA 4ZOCA 3MUIA 3WYZA 4ZO6A 3L8KA 5D30A 2TODA 5EMUA 5C8BB 3B4UA 1WDSA 3PANA 2QR6A 3ES8A 3LPOA 4XKYB 1GV4A 3PAOA 2QPUA 3FG2P 4GQQA 4O28A 4ZB5A 2CHOA 1F05A 3FLUA 1N8IA 5IRPA 4Q6JA 2OYKA 4QG8A 3GNOA 3WUBA 3KCJA 5A8NA 2X1RA 1QRQA 4YWSA 2OT1A 3D6NA 1TYTA 3L5MA 1F3EA 1PZ2A 2HVMA 3V1HA 1EJXC 3OLDA 3WMSA 3WFZA 3OP2A 1PIGA 2WCSA 4GK8A 2FHFA 1MW3A 2ZZ7A 5K9CA 3TYCA 4KRUA 3W82A 4HHMA 1M1BA 1JUEA 5CPLA 1M6IA 4CQ9A 2CLLA 1JPKA 5DQPA 5EA9A 5CSRA 4WIWA 1A3WA 4UXDA 5EBAA 2ZTJA 1KM2A 1VFOA 4JGDA 3KRUA 2DV0A 1M3UA 3LHTA 5D38A 5DANA 5JCIA 3PHAA 3N9RA 4EACA 2XGZA 5HBFA 2FTWA 1Q6QA 4H4UA 3BZGA 1DTNA 1DV7A 1JF6A 5A2CA 3TQ0A 3LPPA 4PBFA 4YTQA 4NP7A 2W0UA 4QR6A 1N62C 1VENA 4RV3A 1KWKA 4G6CA 3PJXA 4WD0A 3OA5A 4KMQA 3RM8A 3IGSA 2CXEA 4UCFA 2VD8A 3GK0A 2GR2A 5MF5A 4P5UA 2VX5A 1BGGA 1X1NA 1IT8A 2E6DA 3NGJA 4NQ1A 1OFQA 2Q02A 2WCGA 3SQSA 4D6GA 1GVQA 1Q6CA 3QV7A 2I14A 1IXOA 4D6FA 3RLHA 1ZSXA 2ZXAA 2FH8A 4FOUA 1KRBC 3E2VA 5BXSA 2CLMA 4FLQA 1TJRA 3BJSA 3MBDA 1IZCA 3SQPA 2KZHA 5IXEA 3EGJA 4O11A 1TPB1 2VGFA 1J4EA 3FDKA 1HKVA 4IXXA 1FHDA 1S38A 1LWHA 3UNDA 1VRXA 1OM0A 4WOZA 1MRAA 3PZGA 2X8GA 4W4QA 4NAEB 1ITXA 3H6OA 4A3QA 3AU6A 5IFTA 2VEPA 1FWJC 2EBNA 3WQDA 3K1GA 2PMQA 2X8RA 1WYGA 4FLOA 5ENLA 1GEUA 2DVXA 2INZA 4W5UA 3WJXA 1VBUA 2PC8A 1IEVA 3AYVA 3W7MA 1FY6A 1VIWA 2A2IA 3FJ6A 1EUAA 1PDYA 1OX6A 3PWAA 2B7NA 4EMWA 3DI1A 4AHOA 1MDLA 4JN7A 4JNYA 1XYLA 4RNFA 1K8ZA 3L0KA 4F0MA 2ZZ6A 4IF2A 1RPKA 4O50A 4F0HA 3WJYA 1ECEA 2F61A 3AMZA 1ZK7A 3KM8A 4ALDA 3VD4A 1UKPA 3BG3A 2EG7A 3SRHA 2WMIB 4G1KA 1V6UA 1Y7VA 5AVHA 3UJ2A 3S6OA 4PYSA 9CGTA 5AZ0A 1E72M 3T07A 3ZJKA 1GTHA 4MY8A 2D23A 1Z32X 1CECA 1TZ7A 4TR9A 3ITCA 1YNQA 1OF8A 3VIIA 3SCRA 1YPXA 2HJPA 4XWUA 1F4AA 2X30A 3WQ6A 3KS6A 5HJYA 1W1VA 3II1A 3BCJA 1DJIA 2DSWA 2HBXA 1JZ7A 1UCWA 1IV8A 1VD6A 4KEMA 5DF0A 4Z2LA 2DU2A 3NVVB 3PSWA 4JFUA 4DJEA 1Q8AA 1PO9A 4DWDA 3L9CA 4MNJA 4Y8FA 4GJIA 4C65A 2J79A 4GZIA 2X09A 2VUNA 4XAYA 3TNBA 2PWDA 4B9ZA 2ISVA 2BY1A 3H23A 5D4YA 4MSSA 4JHMA 3C4UA 1G4EA 1FWIC 4ZB0A 5EKYA 5XIMA 1OFBA 3W7CA 1ALDA 1EGVA 3M07A 1SO3A 3RX4A 3BGJA 4Z1CA 1S5MA 4AZIA 1FTXA 3IUHA 1H2JA 1K70A 5F4WA 1RXOB 4X0NA 1UMLA 2EEXA 4C6KA 5A6JA 2NUXA 2HBVA 1QO5A 3QZAA 3EPMA 1NWSA 1R3QA 5CGTA 4Y8EA 2UY5A 1LDCA 1XKYA 3VIGA 3NSXA 4S39A 3C0JA 7REQA 5AC6A 2FVLA 2A3LA 4QITA 4UFLA 2HXUA 3KDNA 1Q7QA 5KITA 2FZDA 2WYSA 5A1AA 1UASA 2P3EA 1H1ZA 4NASA 1UWAA 1XQKA 4ACYA 3FSTA 3BC9A 2FFCA 3E1F1 5I03A 3EB4A 3B0VC 1JRBA 1SQ7A 3UFYA 3AZSA 1C8VA 1I2QA 3R11A 2J47A 2QCCA 1OD0A 3QFBA 1SMAA 1DWIM 3M0KA 4OVXA 5GNYA 3H4XA 4Z1BA 1QW9A 2WMFA 2I56A 4NYYA 4IICA 4FXSA 2E28A 3RG6A 1MUMA 2WLZA 3GXPA 2JKAA 5I00A 2GWNA 3TQVA 4EPDC 3TLQA 1R3RA 3SFKA 1EC7A 1FWAC 2E6AA 4HTBA 5AHFA 4DY1A 4OIFA 1R85A 4MMWA 1V3MA 2IMRA 2XISA 3C5QA 4ZO7A 3HGOA 1UUMA 3K4AA 4IMEA 2JK6A 5KVHA 3L4WA 1VQTA 2P8CA 3SIMA 3V4BA 3PY2A 3KTSA 4JX4A 4J4KA 5HWMA 1JI1A 1DQWA 9XIAA 1QWGA 1XISA 2OVLA 3QF0A 3HRDC 3RO6A 3OB8A 1P0EA 3BO9A 3NGFA 4JQ3A 3BMXA 4M1RA 4W93A 5EMLA 4M19A 4A8IA 3HV9A 5TBOA 4L1WA 8XIAA 3SEPA 1V77A 3PPFA 2GUUA 2ODOA 3DYOA 3LXBA 1CI1A 4JX6A 4WSJA 3VD9A 3CMGA 4JDRA 5BXRA 1FHUA 2YBUA 1B5TA 1V3HA 2OZTA 2RGMA 5C70A 4DO4A 1HJSA 3B9AA 1FVPA 3NR0A 3MHUA 1TWWA 1LUCB 4IIHA 1FRBA 1KR0A 5D8ZA 3WCZA 4BR1A 1XDMA 1XLLA 5CC3A 4BQ2A 1BXBA 4DM2A 3BUVA 1MW2A 4LUTA 3M0LA 4S3CA 1H60A 1TJPA 2A79A 2AKZA 3PNUA 3U7BA 3WSUA 2Y8KA 4KESA 4TXEA 1JD9A 3MANA 4KEUA 5T9CE 3VIFA 1E51A 4TU1A 2PZ0A 3GYEA 3I3EA 4C5ZA 3FHAA 1X8CA 3KL3A 1T6MA 4WX2A 2BP1A 4XAGA 3N9SA 3H7RA 4GQRA 5ER0A 1AD1A 5K3VA 5LXXA 3HU7A 4JQ2A 2PLMA 4EM3A 1MEIA 4DF0A 5G2WA 3QPYA 4TTGA 4X9SA 2YZ5A 1WDDA 4WQ6A 3FN9A 4B5TA 3ZT7A 1GOOA 5BW6A 3PB2A 2VFFA 1AH3A 3POHA 1GZGA 1PS9A 3QR0A 4H3DA 1XW8A 1HKKA 4IH3A 3TXVA 3JVAA 4HZ6A 2IPGA 1W1PA 4UCGA 3PPCA 5BU9A 3RNMA 3P5ZA 4IP5A 3SECA 1HGYA 3VXGA 1XIMA 1X38A 3DFPA 2V2DA 3NOEA 4LNYA 3NO1A 2WBAA 3AICA 3E0WA 1IQ8A 1GPFA 1K8CA 7ODCA 4UR9A 3H21A 3FVDA 4PUJA 3AIQA 3Q67A 2G5WA 3P2VA 3H4WA 1WKDA 5CG7A 1E9YB 4BJHA 3TSMA 1JUKA 4C5YA 3O6YX 3BW4A 4HZ7A 3A7UA 1R3YA 1K1DA 4ACZA 3MTWA 2FB3A 4TVUA 3NZRA 1VS1A 4E4FA 4MUZA 3GNPA 2Q71A 5FJOA 3WD3A 3NS1B 4O15A 3S5NA 1GVYA 1NH6A 2CERA 3O63A 2FPVA 4N9DA 2J9XA 5C55A 3L2IA 1RY8A 2PAJA 2ZZ0A 3CXBA 1FFQA 3WEZA 4FLRA 4JTKA 1A4MA 3N4EA 2JEQA 3UJFA 2GR0A 3A6OA 5I06A 1JPDX 1U22A 4O8RA 2RABA 1EPXA 2Y7EA 1Q3NA 1GVIA 3CPGA 3WK1A 4XSLA 3FYYA 1NWUA 1VF8A 3QYSA 2J7DA 1QOQA 3E49A 4XKMA 4MJ2A 1QW7A 1TQJA 1F76A 3R43A 2NXIA 4JTDA 1X98A 2DSKA 2WVUA 1J6PA 4J28A 3PZIA 3N29A 2BVTA 5E0KA 3UEQA 5FACA 4KBXA 4LPCA 1E70M 4IQEA 2C0AA 5C9RA 2I57A 4TVYA 5JQ9A 4QEHA 2G4FA 2Z2AA 3CM4A 3ZR4A 5FL1A 4K6AA 4LF1A 1TVPA 5BU6A 1O95A 3WUEA 3VILA 1V3JA 1V03A 1SB3B 2YDAA 5ABFA 3OA3A 4IPPA 3W37A 1TKKA 2WBKA 4W7UA 2GDUA 3W28A 3QY7A 1G5AA 5G2IA 4LU0A 4X0VA 3H2OA 4Z42C 1W1ZA 1OJTA 4GY0A 4YJ5A 3L5AA 1GQJA 4IJCA 1FECA 1AMKA 1YQZA 1RLCL 2VTFA 2ISSA 2YVGA 3A9BA 5GJNA 2YW4A 1K77A 3M4HA 3HGJA 2VDHA 1T7LA 3T2OA 1JQVA 5AN7A 3E0VA 3QW3A 3KBMA 3GYCA 4TMCA 1UR2A 4UQBA 4ZXLA 4HZ8A 1GHSA 4GH3A 5KZMA 1PZ3A 1J93A 3CZLA 1WBJA 3TMLA 3S9ZA 4W7WA 5CLWA 2ZBTA 4R9OA 3IJ7A 2DUZA 3KLKA 1Q13A 3AXIA 1VPQA 2PLJA 4F2TA 3CEPA 5HMDA 3W2JA 2X0YA 1OC6A 3UWQA 3LCLA 6REQA 2G3NA 2ZCGA 4LYQA 5BXTA 4L4LA 1F2JA 3GQYA 4YVXA 3FJLA 3UPBA 3WENA 2V3DA 2YZRA 3G1AA 3K13A 4F79A 4HPHA 1OCJA 2QULA 4G5DA 2Z7GA 4JCMA 1JG9A 1EB3A 3A47A 4GC4A 3VFCA 2X1UA 1KXVA 2HE5A 2CBVA 3CYJA 3G6MA 2CIPA 1YMYA 1JCLA 4GVFA 1KCLA 4QLLA 3GS6A 4K8EA 4JDYA 4U28A 3CAKA 3KE0A 3W75A 2GLKA 3ARZA 4PR4A 4TUFA 1Q8JA 1LYXA 2F9RA 3IJQA 4JEJA 4YLWA 1H7WA 1ZP4A 2PWEA 3EDFA 1QNVA 5CXPA 3W71A 2WK2A 3WN6A 2DY3A 2GDQA 3RHGA 4ZE5A 3GW0A 5L6UA 1MQQA 4IGHA 1TJ0A 2UY2A 3BMWA 1A5CA 2VZSA 5DY3A 3TV8A 4TX6A 3CPRA 3W2MA 2ZA3A 1J0JA 3GE7A 1FEBA 4Q8QA 2EF9A 1TV4A 3B40A 4BQ3A 4NI3A 2PWFA 3VFLA 3DG3A 1BXNA 3QH2A 9XIMA 3UQNA 4JKLA 1FWRA 1A50A 3TZFA 3LG3A 1FWEC 3V0UA 1F61A 2B4GA 3COTA 4IPJA 2ZUUA 2V68A 2CLKA 3C2FA 4F9DA 3DOPA 1M03A 4S3EA 1A5BA 3PFRA 4JKKA 3GAYA 1EXPA 3TC3A 2QJHA 2V9DA 4OKDA 1F07A 4I7WA 3BGGA 4E8CA 2D24A 5D09A 4LS2A 1QOPA 2A7PA 2GZXA 3QHNA 5I3DA 4FP1A 1UMYA 4FOKA 3PS7A 2WJFA 4AIOA 2O7SA 2Y6ZA 4CNUA 1PIIA 1A5MC 1EP3A 5CPTA 3M5VA 4JTIA 4CUCA 7REQB 1Q63A 3C8FA 3MYOA 2OWCA 3TA6A 3ZOAA 4BS0A 1BWCA 5EBKA 1QI4A 2BGQA 1UBSA 4MDPA 3WBAA 3HG2A 1D3CA 1BF2A 1V6WA 5HQEA 3HQNA 3H2NA 3Q45A 4IIFA 5AOUA 5CGQA 1B3VA 2F6UA 1TJ2A 3TX9A 2XSXA 1PWLA 5FIPA 4DJDA 1MFUA 4DUWA 3L0NA 2REQA 2CZVA 3GR4A 3UP8A 1H6VA 2W3SA 1RK5A 2D20A 1KR1A 3VGDA 5FAGA 3U5UA 2YCEA 2IQTA 1K9FA 1VKFA 2G37A 3EXTA 4KRTA 2QW5A 2VURA 1TCDA 3LV6A 2IW0A 4W86A 3ARQA 3RLVA 2INEA 4Y6GA 3RU6A 3T81A 2ZZ1A 1SZNA 1P7TA 4RNJA 1OFPA 4LIIA 1KRMA 5AC5A 3ARXA 4S1FA 1V7AA 2GGHA 3PBWA 5D9OA 1EO5A 3W2UA 3H2FA 2O56A 1K4GA 2VM8A 4UFHA 1OY0A 1JZ5A 1XHCA 4JAWA 3OLIA 3VNZA 4CU8A 2PGEA 1ADOA 4MKVA 3EPOA 3NEVA 4O16A 3PSVA 3G1FA 4DBSA 4O4WA 3IVUA 3H2CA 3QN3A 3VDCA 3BAIA 4LX4A 5IHRA 2BC1A 1K3UA 1S5VA 4GIAA 4M3PA 4FPSA 5GQBA 4IMFA 1H51A 4WK9A 1AW5A 5HJXA 3IANA 1X6UA 1XDJA 3QLDA 3RJXA 3IJ8A 3WFAA 1N61C 3KOWA 4L65A 1W2VA 1CLKA 2VEIA 4JL1A 3E2SA 1PWMA 4GI6A 3UYCA 3WQVA 4NZ3A 3AHVA 4GQ0A 3FV9A 3O3RA 3WQGA 1E1CA 5REQA 3CO4A 4D9PA 1JUBA 2E0PA 5A6SA 2UBPC 4J7RA 2GK1A 4JFTA 3OVGA 5IDZA 1XSJA 3NL2A 1IXQA 1LORA 5A5WA 2PPGA 4C7GA 4RUBA 1SZEA 1YLVA 2YA0A 3DK9A 3G3MA 1KLYA 2ZZ4A 1NWRA 1RALA 5KINA 3W1XA 4LY8A 3AFBA 4I5RA 4G7FA 5F7UA 1JULA 3TWBA 3R0KA 4PN2A 1KN0A 4AWSA 7XIMA 3O6DA 3QPEA 3QFEA 3T8QA 4HYRA 3POCA 2V2HA 1R87A 1UD3A 3TONA 2X2GA 4B5XA 4DBUA 1SU5A 3R8RA 3W2KA 2G97A 4S3DA 4LYPA 3IJLA 4ZL1A 3L66A 4Z2IA 2QUNA 3IGHX 4YTRA 2FHBA 1UD6A 3KBSA 2V67A 4E2OA 4Q3MA 2EJ1A 3MYPA 3S47A 4NZJA 4B90A 1KKOA 4BQ5A 3GVWA 2DDXA 4ATWA 2BGNE 2X50A 4QISA 1Q7MA 1UKOA 3DFNA 1FOBA 5EFDA 2DP3A 3MVTA 4MNMA 2VZVA 4Q7BA 4DJED 3CGTA 2IKGA 5LNVA 5FF0A 3MT1A 3VIJA 2WC7A 1NIUA 1XQLA 4RLIA 5TNVA 4UTFA 2GOKA 1FA2A 3PF3A 4ACZB 3M1ZA 1J5SA 2DUXA 3ARWA 3M7SA 2VKZG 3THDA 4E4UA 4QX4A 2BASA 1BD0A 3UZXA 3DX5A 4QLJA 4HNOA 1V0LA 2YJQA 3NSMA 3OGRA 2QZRA 3WDIA 2WBGA 1VFUA 1QAPA 4AQLA 3BAWA 1TV5A 2ZZBA 1XJBA 4J3TA 4UUIA 3BCFA 2NVAA 4MZ1A 3PPGA 1CXKA 3BICA 5EGRA 3GH4A 2BMBA 4JYEA 2O9TA 2WWCA 1TWIA 2B7QA 2QCMA 3W53A 1TPWA 5AHNA 1QPOA 1S2VA 3K8MA 3UA4A 4YNGA 3LRMA 3S2CA 4U5IA 3E6EA 3WQCA 3DG6A 1A49A 2IKJA 4MB5A 1UP0A 5A95A 3SB0A 3TR9A 4K3ZA 4ONVA 2PDJA 1OINA 1XR2A 2QUVA 4P7NA 3AIBA 3DK8A 1KGUA 2W92A 4HHLA 4GCAA 2EQ9A 3AIWA 3B97A 2FPTA 1EZWA 1QK2A 2V5DA 1HX0A 2C6QA 5CZKA 1M7XA 1DPMA 2J24A 4GISA 4V28A 1UYQA 1IIGA 3KVKA 4UQAA 4GY1A 2BDQA 4U31A 3WK0A 1EKOA 4DX3A 3SCUA 1TV2A 3WD4A 1GJPA 3GNNA 3STCA 2HXTA 5ECVA 4L9YA 5DMMA 1PKNA 1GVFA 1Q6DA 3WH8A 2XTKA 4AU0A 1NWTA 3RR1A 4LY4A 3T09A 8RUCA 1T8XA 4LCSA 1RK6A 3DEQA 3EXSA 1ZXIC 2Z28A 1NP2A 3MSYA 2ZZ3A 3W70A 2QHAA 1W54A 1GUVA 4NKCA 1E6PA 4O0QA 3G8EA 3ZQ9A 1OT2A 2VWSA 3KRSA 3HMCA 4GVIA 2QGYA 1EHNA 1AH4A 1GYLA 4GE8A 5HQLA 2GGJA 2XFYA 3SRDA 2V3FA 1WZLA 6REQB 3B8WA 3TROA 2D22A 4K37A 4XBSA 5CG0A 1HJUA 2Z1SA 4WJXA 1SMDA 2E9BA 1P0BA 3NDYA 1TFVA 1VAHA 1PTDA 4MOZA 2OQHA 2PCEA 4LWWA 5D33A 1WZKA 2ZX8A 4KCVA 3KTXA 2ZWZA 3M47A 2ZZ5A 3GSMA 4IQJA 1JRPA 1XICA 2P10A 4HNVA 1DEDA 3MSRA 4E5TA 3W85A 2OQLA 1DWGM 4AIEA 5AVNA 4Q8NA 5BRPA 5ABGA 3UXLA 5FF2A 1XCWA 4QDWA 2D69A 1AVAA 3KCOA 1PX4A 4YTUA 4P7LA 1THFD 3DBPA 3CHVA 4IFKA 1HNYA 3F2BA 3BQ6A 1B2YA 4PB4A 4WDXA 1J10A 1FWBC 1BKHA 4NJKA 2HQMA 3LNPA 3U4FA 1E9ZB 2CITA 2O4MA 3M0VA 1OADA 4LV9A 3GTHA 1W1A1 2GVGA 2XGIA 3W7QA 3RGTA 4IL2A 1GNXA 3DFOA 1L6SA 3XINA 3LLXA 3SN4A 2XWEA 4ERIA 3F7JA 1IXPA 4F9JA 3LHVA 3WNMA 2YFOA 4CGTA 3CHFA 4OECA 3S6TA 3UD6A 1JPHA 1XUUA 4PL1A 4PBGA 4H9MA 3VMNA 5C5YA 3WQFA 4WVXA 1J0HA 1XGEA 2PEVA 2BVDA 4X22A 2G3FA 3HPZA 2H6RA 1G4SA 3CUIA 2DFAA 2WVSA 2ZC1A 2Z1BA 3DGRA 5AHEA 3RYSA 4LVGA 2ZRUA 3VNYA 4U2ZA 2VFEA 4XO6A 4GXMA 1Z44A 4OGZA 1JDAA 3SCOA 3N15A 4H4IA 1OFOA 4ZR8A 3MPGA 3G8RA 2ATSA 4A3RA 2V5BA 4KFOA 1BQCA 3E2QA 3S42A 8TIMA 1RSCA 3LS9A 1L6GA 1JI2A 3GRIA 2EQ8A 5LGXA 3WG6A 2GJRA 1Z41A 1AG1O 1NVMA 1XIDA 5HUOA 2YX0A 3SUVA 4DEFA 4XIMA 2Z29A 1WB0A 1V4YA 3UG8A 3CIXA 4HK6A 5BYWA 2REQB 1KM1A 5D9PA 3O06A 2GSHA 3PJWA 4GYPC 3FKRA 4JL2A 4MADA 4DAIA 3W87A 1H0IA 1E0UA 3WFLA 4XZLX 2WLYA 1ZY8A 1TRIA 1G67A 1WDRA 1IEWA 1KFCA 1WXJA 2OYMA 3AYSA 3R8HA 2QJMA 4ZQMA 1PTAA 3EWWA 2QXWA 1V02A 2EG6A 3NQMA 3TR2A 5TAOA 1H11A 1UW9A 4EVZA 3LGGA 4YCPA 1ONFA 3NYZA 2P0OA 1Q2RA 3B9OA 2NWRA 1UJQA 2CLOA 3AJ7A 5PTDA 2J9YA 4J56A 1P7TB 1I45A 4QJ4B 1BRLA 4W87A 3O05A 3O9NA 2JE8A 3DFQA 4AF0A 2ZTKA 1DORA 3EX4A 1W9DM 4LAMA 1V08A 1H41A 1OGSA 2FVKA 4MZYA 1D3GA 1T99A 4PUWA 3UZWA 3Q94A 3T7VA 2VCBA 2E6FA 3WNKA 4PTMA 4JNMA 2XH7A 1SZRA 3M5YA 4WKFA 1F3WA 3T55A 4YYCA 2VC7A 2WSKA 3APTA 1LRNA 2PD9A 1GQLA 4KCUA 3W7KA 1CIUA 3LA4A 4GWEA 3ANVA 3KRBA 1KM4A 5H8PA 3OHIA 3W25A 3P80A 5GNZA 3RMEA 1TELA 3ISIX 3FIGA 1TVNA 3MMWA 3QMSA 4F0SA 5K2ZA 3ITLA 5E9XA 4GUGA 3GBEA 5A69A 3GTIA 3PVFA 1DQUA 3VDHA 3D47A 4QSFA 3PUOA 2J4GA 3F03K 2WZHA 1EX5A 4HOXA 2QDDA 2OKTA 2EQ7A 3NEHA 2JFEX 3WKZA 1MW1A 3HV8A 2MUCA 4ICMA 1E1CB 4ZSTA 4ML9A 5REQB 1M65A 1BVNP 4B4HA 4QG9A 2QAEA 4ZFCA 2HSAA 1J0IA 2AMGA 4AZ6A 3UWWA 1EX1A 3HGRA 2DQXA 4FXJA 4Y90A 3P7YA 1MNSA 2PDNA 5G4EA 1AMYA 1NOFA 4KT2A 2J8TA 3TQPA 2VJXA 1YKWA 1RLDA 3G2GA 2E1WA 2R9ZA 2PP1A 4XZWA 5TQLA 1NHQA 1MMFA 2RUSA 4OU1A 2TYSA 3PTQA 4ZQPA 1RA5A 4DVOA 1BEUA 6XIAA 3OPSA 3PG9A 1MSSA 3W7IA 2ZUTA 4A6GA 4GACA 3V36A 4PMXA 1MOKA 2HEJA 1DWFM 1H2IA 3L4VA 3AMKA 2VC6A 3W02A 4EWJA 4LGXA 1K9EA 1KTNA 2OELA 1V51A 1AD4A 1OF6A 2Z2BA 2ZUSA 4KERA 2ZYFA 2OEMA 3VDGA 4AZHA 3S1GA 4B5VA 2QDHA 1GZ1A 4O53A 2WHKA 3CHCA 3JUGA 3AC0A 4UR7A 4J3VA 3RO8A 1EJSC 1G69A 2WPCA 2Q8LA 1A80A 3AISA 1M6JA 4NAFA 2Q8XA 1AZ2A 3TJIA 2JIEA 3S3GA 3TVAA 3DH9A 3W24A 2SFPA 1EDQA 2WM1A 3VGBA 1W5NA 1WOAA 3SSJA 2G0WA 3CV2A 1SZFA 3EKLA 4PRRA 5C2XA 2VFGA 4GBDA 4QS5A 5HA7A 5SWUA 1IT0A 1FCUA 3YPIA 4C60A 4O1AA 1EUNA 2BHZA 3MY9A 1W1IE 1TR1A 4BZYA 2ZE3A 2OSWA 1I6NA 2XIJA 3TE9A 3VIHA 1HKWA 2Z1WA 1W9XA 1U5HA 1NQKA 1SPQA 3GH7A 3QW4B 1MWOA 1JIBA 4NRSA 3D9XA 3NQFA 3WBWA 2VNCA 1H1YA 1OGGA 3S1XA 1QXLA 3UESA 4JFWA 3KL5A 2H8ZA 1F6YA 5LNWA 4MWAA 3N04A 4OQVA 1Q1WA 3GWQA 4ZBCA 3BDKA 1Q6OA 3DKLA 5FEXA 4Z1YA 5GRTA 3WLSA 2UV8G 5AKQA 4E2BA 1O5KA 5GJMA 5CC6A 4JTEA 4DZHA 1LT8A 2HNHA 1Q2SA 5F2MA 4MUPA 5D37A 4HIBA 1N8FA 3M0XA 1BFNA 2ZUMA 4HSOA 4DJDD 3EWUA 2MNRA 5KETA 5HXMA 4DI9A 1UIPA 4QROA 1BQGA 4D71A 3VD5A 2V6OA 2CZFA 1OCBA 4GPNA 2GQAA 3GZ3A 2RH9A 1ODZA 1ESWA 2G96A 5AB3A 3Q4DA 2J13A 1E0VA 3GDBA 1MNZA 3BAKA 3H24A 2YCIX 1ZAJA 3UVAA 1XLDA 2V2CA 3AUOA 4E8GA 2GQWA 2I16A 4RNHA 5CJ5A 3Q2DA 3LHYA 1YQ2A 4A8LA 5CC7A 1M7OA 2I9EA 3DYPA 2R82A 4J5NA 2BXZA 5JBFA 1VFTA 1FUYA 1PHQA 4AEEA 4FNTA 3WO8A 3PFMA 3L5LA 1OC5A 4AAJA 2VCAA 2A8XA 3VCRA 3L7RA 3TSDA 3FJNA 2ZVIA 4H4WA 4DF2A 3T2PA 2GJLA 5M5DA 4QG6A 5TF0A 2DUAA 4ZODA 1GG0A 1RCXB 4RX0A 4CNNA 1KCKA 2DQWA 3OBKA 1FBAA 2Z7KA 1Q66A 5CJNA 5CJMA 3WLQA 2ALRA 4K38A 3IWPA 2P3ZA 4H41A 4IIDA 1LVLA 1EYWA 1EEPA 3WMLA 4N7QA 5KZ6A 1VHCA 4IGNA 4PMDA 2FMOA 5DT7A 1Q4WA 5J8LA 3W07A 3GHTA 2A7NA 4FSAA 3V3WA 5AHLA 3PP7A 3W7EA 4HU8A 1OIMA 2WHMA 3HW2A 2IPFA 3BG5A 1JEZA 3LXDA 4K8HA 1UR8A 3AS2A 4GIEA 3TN4A 4S2CA 1V79A 2JALA 3B05A 1SVDA 1Z8AA 3OIXA 4HN8A 4HA1A 4XV0A 4ZO9A 1OG0A 3ONBA 3NO3A 5D2XA 3SY8A 3LCIA 4PUNA 4YVVA 1ITQA 3I65A 1MQPA 4LOCA 2VC5A 2I5QA 1J01A 1OCNA 1ZBVA 3KVMA 4IFKB 5I0DA 1H5YA 3R13A 2CZ5A 5KEZA 2VYOA 4CD4A 4EQRA 1E15A 3HQOA 1Z7AA 4IMDA 3ITYA 3U57A 3U2ZA 5HDRA 2XVPA 3RU8X 3VKDA 1CENA 2ABAA 5FF3A 3P84A 2C15A 3CL6A 4LVDA 3TN6A 3ETRB 1JAEA 1YNPA 4PCPA 2OEJA 4OOUA 1TRDA 1TPH1 1GZJA 5CBJA 1ICSA 4LCQA 4CN6A 1CT5A 1VJSA 2X8HA 2PZNA 2G3MA 3BJFA 3NG3A 1F73A 1QHPA 3H70A 3TN5A 3AIUA 1XKJA 4JR5A 4B5NA 2PCQA 3ME3A 1TPEA 5AYYA 1XI3A 4LTSA 2ZUNA 2P0IA 1J0ZA 5IHSA 2OB3A 3LUTA 1O12A 3NQAA 1EP1A 4U4MA 1V0NA 2DZXA 5CBBA 2XSBA 3WK2A 1TWDA 3WUFA 3PBMA 4WJEA 1QJWA 2J7HA 2Z1XA 5I7GA 3IJIA 4HYWA 1QDSA 2QQ6A 2P76A 3CHDA 1XFBA 1GQNA 3VM5A 2Q09A 3CTTA 4R7WA 4MZ8A 1KRCC 4CCCA 3GG1A 4IX0A 2OLHA 1HVXA 5CZJA 3VGHA 4MVAA 5C2CA 1SO4A 1JCNA 4O12A 1DIDA 4DWSB 3MO4A 1E6NA 4GKLA 3FYPA 1BVWA 1WX0A 2W5FA 1R9YA 2TPRA 5I79A 3LBCA 3NRZB 1GOQA 3G0UA 3HG3A 5FSEC 4KWUA 4A8NA 4QLKA 3HN3A 4R33A 1L9WA 2QCLA 3NZPA 4NNBA 4FA3A 4Z17A 3H2MA 4FMVA 4KW2A 4I8DA 1JAKA 3S8HA 4AD3A 1ZDLA 2BGSA 4HB7A 2VD9A 3KBWA 1JPMA 5G4HC 4X2PA 2WZIA 3C3NA 1TX2A 1U33A 1EXBA 4AX6A 3O6AA 2ZQ0A 1SW3A 5F1VA 5I3IA 1A3XA 1RV8A 3EWBX 1BRLB 4ZOEA 1O5XA 1A47A 1V6TA 2D0FA 3C2VA 4XZMX 3WJZA 5BNKA 4AF0B 3VKBA 1I2NA 3OQ8A 3T08A 2I5IA 2FKPA 3LPFA 4F48A 5D2YA 3NL5A 3S5YA 2QVNA 4QQUA 3IIZA 4FHAA 3QXBA 1IGWA 2J7GA 4DYEA 3AXXA 3RCMA 4JTTA 3WNOA 2CESA 3UA3A 1DJYA 1VFLA 4AWTA 2RDUA 4HK7A 2PGRA 4JQ4A 4Q8OA 3TOPA 4NU7A 3AIVA 4MB4A 1QO2A 1TR9A 1YADA 3HPAA 2BSLA 5HOSA 1JXJA 4S3AA 3GDMA 1FXPA 3S5ZA 1PL9A 4JY8A 3EWXA 4A3YA 4NNCA 3M5ZA 4L6OA 1PHWA 1ZGDA 1EBHA 2VL4A 1H09A 3H7UA 4NXKA 3CGDA 3R0DA 3I7SA 3ZFHA 2J75A 2RJHA 4YHGA 3WZ0E 3QLLA 3W7JA 2ANUA 1KM6A 4OFCA 3W7PA 4CCDA 1KB3A 2VUYA 4W9TA 1HT6A 1HJQA 5BOOA 2YL5A 2PLCA 4B91A 3GG7A 4LC6A 4EAYA 2QJJA 1WUFA 3FHQA 2XUCA 5T26A 4UTUA 1OX5A 3T2QA 2DT2A 1ZCOA 3AO0A 4QXIA 3NA8A 1KO0A 4J27A 1L6FA 5B7YA 5DY2A 1YDVA 3KVJA 3T1GA 3SM0A 4Q6XA 2FJUB 2OLAA 1IWBA 1W9VA 1U1HA 2B0MA 2PWVA 4ORMA 1VP5A 4F40A 3FVMA 3O07A 1A5AA 2BHUA 3HO8A 3MS8A 1JFXA 3I68A 1HZYA 1C9DA 3TJLA 2E3ZA 1JYXA 2A3HA 1JRCA 2WXDM 3EEGA 4DPQA 3UWZA 3GU2A 4NF7A 1GGOA 4RPPA 5IDIA 3RR4A 1RQBA 2J62A 2VI0A 3LRKA 3WH6A 4WSHA 1KV8A 2FQIA 2OX1A 1M53A 3E2RA 2FFIA 2PDLA 3PG8A 4LAZA 1LOLA 1QW8A 4CD7A 1QI0A 4WHBA 1DJZA 3JZUA 1PYMA 1CNVA 5LIWX 3CYVA 3PBGA 2XFFA 4FIRA 3IIPA 2Y5EA 1E71M 4DJFC 3EAOA 5AC7A 4Q4QA 3T0DA 3A3XA 5DMLA 4NAFB 5CPOA 2V6AA 3URHA 2DT0A 3V0SA 5DBTA 3I7RA 4LBRA 1ZMCA 4CEXC 4FLSA 4DJEC 3VNJA 5FMHA 4CNOA 4NG3A 5K4ZA 2Q3OA 1UPMB 1QTWA 1OHLA 3WD2A 4PMOA 4ADTA 3BSMA 3GTXA 4DYKA 4JHOA 3G1XA 1NELA 2PA6A 3A3HA 2NV1A 1RJPA 2PF0A 1W6TA 2QPXA 1JF5A 1QNOA 3LENA 3OG2A 3GUGA 4KCWA 1PEZA 1ZUAX 3KL0A 1VH7A 4A22A 3VUPA 5K9DA 5A2BA 4NIRA 1A5OC 1GOKA 3UW6A 5FS7A 4RV8A 4Q8TA 2G8ZA 1VBGA 4I6VA 4NAEA 1TPUA 1ISVA 1R3WA 3QZ6A 1NFPA 1VIZA 2OOGA 1K02A 1BYDA 3FOKA 4B9YA 1Q85A 4KFNA 1F8MA 1PSCA 1YEYA 3GAKA 3S2NA 1AJ0A 5JUVA 3A7RA 4JTCA 1TCMA 4MFDA 4DXXA 3TDFA 4O19A 1XV8A 1DE5A 4K8DA 3PZQA 1YE6A 2G3JA 3VAVA 3CZJA 1C93A 4GOAA 1BPLB 4BQ4A 4I6KA 2XJ7A 3CZEA 3ZJ6A 4EF8A 1H49A 3MP4A 3CC1A 3FCPA 3T0AA 3N2XA 4LUYA 4OUIA 3CUZA 1P6WA 5I09A 3LI1A 3THUA 2ZRWA 3CPUA 1ECQA 2VOMA 1FWSA 3W1AA 1X1ZA 1M41A 4L4PA 5CSSA 2VP8A 4QAWA 3UF9A 1GRHA 1WXZA 3QTGA 2EPKX 1RA0A 2YL9A 1R9XA 2XINA 2VRJA 2AAMA 3MMDA 3RF9A 4QM1A 2UY4A 3DUGA 3QV8A 2PDBA 2YA2A 2CFYA 1XC6A 2FTYA 2H9AB 3A21A 1K7XA 1ONXA 1KM5A 1BLIA 3CZGA 4EPKA 3BSGA 3TP4A 3AZRA 1VGAA 1RQEA 3GXNA 1XLFA 4ML4A 2CKRA 1XHGA 1G7VA 4NY2A 2V3BA 2QMKA 5AC4A 3NM1A 4GHRA 1E56A 1A5LC 1XLJA 4QNWA 2WC4A 1GJWA 3EWCA 4EXAA 4D6EA 1GOXA 4BV6A 1SR9A 4QRNA 4QE1A 1SUXA 3VGEA 1S7MA 5G1YA 4FNRA 1L6WA 2YB1A 3B8VA 1JNDA 1CXLA 1B0IA 1UROA 1JROA 4MHBA 1ELSA 1OZQA 4IL0A 4I3GA 3TN3A 3QV6A 4NHVA 1K7EA 4FK9A 4AYGA 1EA9C 3URBA 2ZA2A 3A4XA 4JN8A 2OMAA 1YXCA 3DDMA 4RW5A 4HD5A 4EKJA 3TTOA 1CBGA 3RM9A 1I0DA 2MANA 3N3TA 4O17A 4GO8A 1K4HA 3TWAA 4WY0B 4LW7A 4AEFA 5FS6A 3TOYA 3U8GA 1F4HA 1J12A 4PCNA 4E2DA 4BF9A 5A94A 1JYNA 1S3HA 3LCXA 1FCBA 1V59A 4Z0JA 4PMQA 4ZMGA 1ME7A 4DZ5A 1GERA 4PEKA 4XZNX 2WKLA 4TX8A 3WQ5A 4GUFA 1WKYA 1E3XA 4PRTA 2DZUA 1IZJA 4MLRA 3E3HA 1B3ZA 1NTHA 3MI3A 2WB5A 1TPFA 4LT9A 1O5RA 3B9JB 2BXVA 1BXCA 3DI0A 4RL3A 1PKLA 3R25A 2PDPA 1TWZA 1D7KA 2BC0A 2PDIA 3LSCA 2CW6A 1UD8A 5FF7A 2RDWA 2VFHA 2JKEA 4UFIA 1Z6KA 4Z1AA 3SCWA 4PCTA 1CXHA 3EB2A 1G0CA 1Q6LA 5BMWA 2DT1A 4D2JA 1FFUC 2CLIA 2WMKA 1EF2A 1IYXA 1DL3A 1YIXA 4IPIA 1LL7A 3KTCA 3W1LA 3R7MA 1A5SA 2WANA 1WO2A 1WKEA 2PRLA 1MO9A 4C7FA 1M9HA 5IBXA 5FS8A 2OT0A 1E6RA 3UPMA 2UWFA 4REQA 2FDSA 4GQGA 4UZUA 1T3QC 4I5XA 1PJ9A 4CD8A 1B57A 1N5XA 2PS2A 2PDQA 4J3UA 4ASTA 3RLGA 2C18A 5CLTA 2R1MA 1Z48A 4AVFA 1P43A 4R5EA 4ZXOA 1SFTA 4RPQA 1VFMA 1LZOA 1FKWA 5A6BA 4H9UA 3WDHA 3VIOA 4LRSA 1SFLA 3E0IA 2WMJA 3FSUA 2GQ8A 3P67A 1PX8A 3BLIA 1TV8A 4LYRA 2GJNA 2I17A 4HJFA 2NT1A 2BODX 2OCZA 2Y5SA 1XH2A 2E8YA 3STFA 3VE9A 4ENLA 5DBUA 3K4WA 2F84A 2ICSA 3L68A 3AN1A 1R7OA 3DH7A 1BF6A 4MWAD 2IKHA 3PBYA 1BYBA 1ZAHA 1NF0A 3H2EA 4OWGA 1CPUA 1B3YA 1BTCA 3WNLA 4FR6A 3ABXA 3M6YA 4BI6A 1KV5A 3CUJA 1KXQA 1UR9A 1PKMA 1KQZA 2BY3A 2GUBA 4ILSA 4QE4A 1T5AA 3LXCA 3SFWA 5HR7A 1W3NA 2ZRZA 3HIJA 4YPJA 2YSWA 3LADA 1XLEA 1HG3A 1XL9A 5ABEA 3MCNA 4JTRA 4C6PA 2IQ0A 2XVKA 2W79A 4K36A 2HK0A 4OHQA 3L21A 3S1UA 3HOJA 1OEPA 3BLEA 5CQ1A 2VX6A 2OQYA 3GBDA 1KLZA 4CU6A 3WLNA 5CZSA 4PUUA 4GZJA 1XIBA 1EEXA 5JCMA 1E73M 1FH7A 3HJEA 2AQWA 1BYAA 2EPLX 4L5ZA 2C13A 1PYFA 3N19B 3NFUA 5A3HA 3AS0A 2VEMA 4C6OA 4CVUA 2QDEA 3LMZA 4CU7A 3IVSA 2CLHA 4PTVA 4A05A 3EMQA 3N6HA 3ABOA 3SUSA 3B3DA 3OYZA 3O0FA 3B9EA 4Z2HA 2F8QA 3IEBA 3ZMRA 4F2UA 1UWTA 3WDRA 4M5PA 3ZJ7A 4F3HA 3AYRA 4UOJA 4TQTA 2DSUA 2PRMA 1ZX9A 1EWEA 1VCVA 3G1VA 3H22A 4EQXA 3O1NA 2FZNA 3PNZA 1KKRA 3ATYA 3M43A 3PZNA 1DIKA 4C6DA 1LRTA 1UOZA 4D8ZA 4LFYA 4RK8A 1TJ1A 2JQXA 1POKA 4A21A 5A6LA 3GTNA 2XM2A 4L64A 3PJTA 1LTDA 2UZ9A 4IHCA 4IZGA 4IQDA 1ISZA 3QRHA 1LBFA 3UWYA 4FX8A 3UR7A 3BAYA 4AD5A 1FWCC 4H2HA 3MKCA 4PRWA 2QNEA 4H8VA 3GVQA 2V81A 1S2CA 3P8JA 4NUWA 3H53A 1CTNA 1H1NA 1L2QA 3DGZA 3TTYA 4GZEA 3GDTA 5G1TA 5I3FA 3T44A 3DFSA 3CT2A 1EIXA 3ITVA 4LVAA 3RM4A 4HP5A 4G7EA 4PODA 5I5RA 2C14A 4HNTA 3PZVA 1H7XA 4XVEA 4XO7A 1Y5WA 1MW0A 1NFBA 3G1SA 3VKAA 2D0HA 5FJPA 1AA1B 4BF5A 1ZLPA 3WL0A 2NXGA 1IZKA 2BCPA 1QI5A 3OBEA 4NZ4A 4NZFA 4XVDA 1JCMP 3OEXA 4MNLA 4GGHA 4UBPC 3K46A 3IC9A 4DRSA 3GXFA 1N2VA 3DC8A 4HNNA 1QPQA 1V93A 5BOEA 3KP1A 1NARA 1KM0A 2B7OA 4EIVA 2J8FA 2WCAA 3CQ0A 5HAOA 4HK5A 4HCHA 2J7BA 4W84A 4J40A 1TA3B 1RZMA 5JIWA 1D8CA 3CWHA 2E40A 2Z6IA 2Q6ZA 1X6NA 4JIPA 6TAAA 3G5EA 4IGMA 1QNQA 3NZGA 3LRLA 3J7HA 5KZEA 2E5BA 3RJYA 3MW7A 4AMAA 3ZIZA 5M03A 2Z1KA 3BL3A 4PMUA 1KBIA 1GVSA 4FO4A 2R94A 1W3KA 5HQMA 1ZJHA 3UETA 1NDYA 5H6HA 2OOFA 2NZLA 1XYCA 4CD5A 1RPXA 3KWSA 3S6DA 1N60C 3PBUA 4ZB2A 1GRFA 1DHPA 2TSYA 4H6EA 3IVTA 4H9YA 2WO5A 2J27A 1I60A 1XIHA 3TCEA 4DJDC 2WNZA 4LBUA 4Q4RA 1OFAA 4FXFA 3EEZA 3SCNA 4JTLA 4RW3A 3G1RA 1BZLA 2C1HA 4NNAA 2HCVA 1UP2A 3VTRA 4AG0A 1GCYA 5H1WA 4W8BA 4GR1A 2ZDRA 4P8XA 4M0XA 3LM7A 4E2VA 3UR8A 3PZTA 2QF8A 1E0XA 1EGMA 1W17A 1L2UA 5AHIA 1CX9A 3IARA 5DX7A 3HM7A 4MAZA 1XLGA 1ZPTA 2Y8UA 3LB8A 1S39A 1XANA 1S5NA 4HYVA 4ZQNA 1JDDA 2W63A 3DHDA 5E0CA 4IPLA 5M2FX 5J5DA 4Z0SA 1CYGA 1XD0A 2E5CA 2Z4GA 7TAAA 4DM1A 1CGTA 5C54A 1MRQA 4DHGA 3ABQA 1RBLA 5GJPA 1LCOA 4O18A 1YPFA 4IQLA 3ANUA 1C7TA 2Y4SA 4FIQA 4RJEA 1NPXA 3P3BA 4H83A 3N2MA 1F8IA 2WNNA 1P4CA 2Y0FA 5E5CA 2VFIA 3V35A 1D8WA 5A6AA 3W3OA 1E6QM 2QKFA 3SN0A 3O0HA 4JIRA 3T0BA 3W38A 3ITOA 3EKZA 2O9PA 4DYJA 2O4QA 2FGLA 5IFPA 3WLIA 2JK2A 4J3SA 4US6A 4KEVA 4Q8MA 3B8TA 3LGDA 3SGGA 4AD0A 4E4PA 2R8WA 4FR1A 5G5IA 3UT0A 1BG9A 4H04A 4QFUA 4BA0A 1GRTA 3NDOA 3EDEA 3ZR5A 3ZVHB 1SJBA 5RUBA 2WQDA 3B06A 5A8QA 1J18A 2R1NA 2ACSA 1XYBA 3VOJA 1EJVC 1NP0A 1W5MA 3P62A 1HO4A 1EA0A 1LM1A 4QIUA 1PE1A 4U3CA 5I3GA 4B4FA 4R27A 2YB4A 4DI8A 3C2EA 3CAVA 1JCTA 3P61A 4ERAA 3HTWA 2E9MA 4L4MA 4ADSA 5GPRA 2QEZA 3AWOA 2Z00A 4MFEA 5EMMA 1TG7A 3B9DA 4C6BA 1NDWA 5FEPA 1FCVA 3AHYA 3WH7A 1UZDA 4BWLC 4RXFA 2YCJA 5EL1A 4AXNA 5DMYA 4Y9PA 1GREA 3DJJA 1TV7A 2YDSA 4JEQA 3PN8A 4DZAA 2Z27A 1H7RA 3Q58A 1ML1A 4N42A 4UOZA 3URQA 1SJDA 3D3FA 1W3IA 2A3AA 4HA0A 2JGQA 1XLKA 1FO4A 5CZ0A 3VK5A 2CWXA 2WZTA 4OBRA 1PAMA 3MZ2A 3I7QA 4C1LA 4JHZA 1OC7A 3NXFA 3VINA 1KGXA 4ZOBA 3WF1A 3VZZA 2OZ0A 2J77A 5LXEA 4HNLA 1KQYA 4LV4A 4NSBA 1NHSA 2DORA 3MMUA 5FEWA 5A6MA 1W3LA 2VRQA 3CU2A 1BKSA 1D7YA 2DPEA 4UTKA 2GDVA 1IF2A 1QNPA 3L4ZA 1ODUA 4DBEA 3C86A 3R5EA 3ATZA 4QDPA 5JH1A 4REQB 4N0RA 5FD0A 1POJA 1GETA 1GG1A 3EX6A 1MQRA 1RQHA 2WM0A 4L9XA 1MXDA 1QOXA 3AAMA 4MAVA 3GDLA 4GY7A 1RP8A 1KFLA 3UGVA 5XINA 2C71A 3LLFA 3WLHA 2BVWA 4Z2JA 2F2HA 4Z2GA 4BHYA 2OG9A 4PA8A 2Y1HA 5BXPA 1DXEA 3AM9A 3TKFA 1XINA 5EB8A 4NRRA 4OUEA 4EXBA 4XBJA 3KBVA 4B2DA 3DYMA 1DIOA 1OYCA 1BWLA 4MTVA 2FLIA 3GW3A 3IIOA 2OWXA 4FXRA 2VT0A 4GNVA 1K9TA 3BAXA 3KEHA 4QE5A 4AMCA 5GVJA 3CV7A 4XZIA 3NUKA 4M51A 1MUWA 3WH5A 5M1TA 4C6CA 1A5KC 4HU0A 1VBRA 3GVRA 4S3GA 3V0TA 4WGHA 1RBAA 4Q8UA 4Q4PA 2X05A 2VXNA 1JCXA 3A5FA 1O1ZA 1EWDA 1IT7A 3CJPA 3W72A 5M3WA 1W9PA 1J79A 5FOOA 1QATA 3GX9A 2W6RA 3QC0A 3TSBA 1LJYA 3PUGA 3GXMA 5CAHA 1N5WC 3NVWB 1SM9A 2A1YA 3T4WA 1I9CB 1UKSA 1VFSA 2BOFX 2WP5A 3EOUA 1P0NA 3XISA 3QFAA 3QV9A 1YDNA 2OEKA 4CQDA 3SSZA 1OFRA 3SZ8A 1PDZA 1X6LA 4J57A 4DAFA 1ISXA 2BX7A 3THAA 3MJMA 3WQEA 1EC9A 2YPIA 2BY0A 4XISA 3OLGA 4UTTA 4H6RA 2BV9A 1ADSA 4ZE4A 2AAQA 3BLLA 3OU8A 4XTDA 4UFJA 1V6YA 4PMVA 4L6DA 1BTMA 4QCEA 4B16A 1WE5A 1Z3NA 2VR2A 3N12A 2ZA1A 4INFA 2J78A 4U3AA 1AQFA 4GQBA 2DH3A 4GYPA 1IWPA 3A3WA 3N34A 2B31A 3FGCA 3L4YA 1NAL1 1B30A 1B3WA 4UNKA 4TTUA 3LHZA 2XFWA 4IG2B 3W0KA 1EOKA 2OSYA 4JTAA 3UJRA 3RCNA 1K7FA 4HPGA 3ZSSA 3EA3A 2HVNA 1G6CA 2GRTA 4UTHA 1X8FA 5F4XA 2YL6A 4L6HA 1MEWA 1GKPA 3DESA 1HW6A 1ISYA 4IMAA 4RCXA 3PR2A 2O92A 4PFHA 3SR6B 5KTLA 1K9DA 3MC5A 2QAFA 1JD7A 1DJWA 3GKFA 4HZMA 2JKPA 2NT0A 2V63A 3FDGA 3RRAA 3DU0A 4O1EA 2DW6A 2E67A 4F4RA 3QPZA 2OO6A 2Y89A 1TMHA 4Y7EA 5FS9A 5FAJA 1GTEA 5CBIA 1K6WA 1BVZA 2FDMA 2CLFA 2HQAA 1TTQA 1VDVA 5AECA 1NEYA 5ABTA 3UZZA 2QJGA 1IHIA 4R34A 2BS9A 4ADUA 4JZ5A 4GI4A 3VE7A 4CCEA 4V27A 4JTFA 2BTMA 3W7HA 1G01A 4J2PA 1BSIA 1LT7A 1ITCA 4QBXA 2YYTA 4F8XA 1FH9A 3KX6A 3DFYA 3LTPA 3HMJG 2DEPA 2GFTA 3KOFA 3HURA 4AFYA 4PMNA 5E93A 4J9JA 3EWYA 3H7VA 4C1NB 3A64A 2PB1A 1GSNA 4I5UA 4G7EB 3SCTA 5E6ZA 2A4AA 2ADAA 2V5JA 2YBTA 1XBXA 2CXGA 3FX4A 3BE7A 2VFDA 1D7FA 1V3IA 4XUYA 4U10A 5AYIA 2E6YA 3CO8A 1LL6A 2HS6A 2Y8VA 2IKIA 1XRFA 5C6MA 4V1XA 4G56A 5FA5A 2RAGA 5CSUA 5FJRA 3W83A 1NJJA 2QCGA 3QOMA 1TPDA 3ZXWA 3UNTA 2AAAA 4K1GA 2FZMA 2TAAA 2D2OA 4GYKA 3QC3A 1ZQ5A 4WXZA 3PULA 1DP0A 3ONCA 4YWIA 1ICPA 2YLAA 4FB7A 1XH1A 3W2LA 5AYZA 3LX9A 4L4OA 1B90A 1R3TA 1CCWB 4S3FA 5B7ZA 2ZDSA 2P88A 3LM3A 4KKXA 3WLTA 1TUFA 4NEWA 2EO7A 2FMNA 2F5ZA 5MKGA 4WEVX 4NJJA 2NLIA 2XU2A 3WQ8A 4PSPA 1P1MA 3VNKA 4Q4OA 2CWNA 5JBDA 3WF3A 1TTJA 1GOIA 2H8XA 2XSAA 2QAPA 4HTYA 3WMBA 3ARYA 5A6BD 1B31A 1W91A 3E9AA 4JXCA 2ALDA 3S5SA 1P48A 1G9HA 5FJUA 2A3CA 4BCEA 3N9KA 3M0MA 3WY1A 4AD2A 4CQ8A 1DVJA 3TMQA 3W1UA 4W7VA 1HKMA 2Y24A 2YA1A 5A2AA 1JR1A 4LNCA 3R4IA 1JGIA 1OX4A 3CBWA 3TJXA 2ZRVA 3II4A 1Q1RA 2PSNA 3NQBA 1Q5MA 4MWAE 4G1NA 2I5GA 5H2ZA 4W8AA 2PI6A 4GVGA 3GHRA 2YXXA 1T0OA 2F6KA 4CCZA 3VA8A 4AX7A 4FEZA 4B3LA 1REQB 4D1JA 1ZHAA 4GFSA 3U2OA 1JYVA 4X3ZA 3OVPA 5CEWA 1XLAA 5EPDA 3VOGA 1Q6EA 4GUHA 1LPFA 2CDUA 4LB3A 3GLCA 5I24A 1TMLA 4R53A 1ONWA 3WBXA 3JRKA 3ZLFA 3DGHA 3NQVA 6A3HA 1IEIA 1EQPA 1GT8A 3K8LA 5C9UA 1W8SA 3MHGA 1AW1A 1AQHA 3LHWA 1IR1A 1ZU8A 4AHPA 4FI4A 1IIHA 3MI2A 2PC4A 1TPC1 1KFWA 1XPGA 3E5PA 5AYXA 1F5ZA 4HU4A 4LVBA 2DJXA 5JCKA 2CHNA 4KWWA 3O16A 1BGAA 4PTXA 3GDRA 4V1YA 5I78A 2R1LA 3LNMA 4GYJA 1O66A 1RUSA 2C1IA 4YVPA 1RVKA 4YXGA 1LP6A 3VI2A 3VD7A 3N73A 1O6IA 2WKGA 2W61A 2DZPA 3TA9A 2GVLA 1U5JA 4L80A 3F2DA 4XD6A 3CASA 3PZ9A 4O1BA 4KIEA 3WLKX 1TWSA 3D0CA 2WPGA 3GB6A 3NSNA 4AVNA 3HG5A 3KDOA 3CUFA 3QEZA 3WDQA 3BLOA 3TTSA 2WVTA 1K8XA 4NL1A 4XAPA 1LG2A 3OYXA 4CNSA 3GG8A 4M29A 3BGAA 3P6LA 3NJ3A 2HS8A 4H19A 3CMFA 5DXYA 4MLJA 3VABA 1Q65A 3KW3A 4ATDA 2V3AA 3NQ6A 2HISA 3MDUA 4WGXA 4TOQA 3THQA 4LALA 3HPXA 4TVWA 4A35A 1ZP3A 3NPXA 2PFHA 3P5YA 1XC4A 4K2SA 3V18A 1KTCA 4S2BA 1OCQA 1LROA 3QZEA 2V3GA 4X2RA 2C3CA 2ZWYA 4FX9A 2V3EA 4JOMA 3W2NA 3GRSA 4H9VA 3GH5A 1IR2A 7TIMA 5CGMA 2CLPA 1OWQA 2CCRA 5BROA 4WXYA 4IFRA 4M1BA 1AL8A 2W4XA 3WLOA 1Z9AA 4LCRA 4H4TA 1VQZA 1XYFA 1Z69A 3WUGA 3AYTA 1FP9A 4MKNA 1KA9F 4HN4A 2GGEA 1J2WA 1DJXA 1ZBCA 2XVLA 1J6OA 1RD6A 3GNDA 3LBOA 1RP9A 3T4CA 3NVDA 3AMLA 2J6VA 3LZ3A 1U2YA 3DJGX 4HGXA 1XIFA 3GO2A 1WA3A 2CBJA 3FK4A 1CDGA 3WD0A 1EDGA 3F4DA 3H54A 3VNMA 3NL6A 1V7YA 3NVZB 4PTNA 1YPIA 4RR4A 3N17A 1M7JA 4C6IA 1P6BA 4WCJA 1WZMA 2GR3A 1J0YA 3A4JA 4I8YA 4M56A 4UFKA 1UP3A 1SFJA 3EOSA 3M0JA 3FA3A 2HVOA 3ARRA 5JXQA 2X1SA 3I10A 3LEPA 4PTDA 3W88A 2QMJA 1T40A 4DNAA 4MWAC 2VGIA 2PTWA 2FIQA 2OJPA 1J8VA 2XDFA 3UXIA 3R6IA 3DFTA 1O68A 1LF1A 3IRSA 1F3TA 1OFDA 2XIQA 5H91A 2EPOA 3H26A 3BAJA 1EBDA 3EDJA 2FZBA 4H4VA 2YKKA 1JCJA 4P8VA 3S2JA 2NW0A 5J04A 3W1QA 2VGGA 1VYSX 4PMRA 4DELA 1NOWA 4IMCA 2NUWA 4MJMA 2Y61A 2H3BA 4W85A 3RUBL 4ZOHB 3EAUA 1EQCA 2QDGA 3CGBA 5LA1A 3APGA 3P60A 2GJPA 3BW2A 4PULA 1UR4A 2VMFA 1R47A 1PCWA 2X40A 2ACQA 2YXOA 4WSKA 2CYGA 1S2UA 1RY0A 3AHXA 4UQEA 4PMJA 1OBAA 3UGRA 4EWND 4JN6A 1CXIA 2XH4A 3H8AA 1C7SA 1EJUC 3RN6A 3I6EA 3FEMA 3NQGA 1IE7C 2FB2A 2DH2A 4IIEA 3FGCB 3NYDA 1KFKA 4P2VA 2JIWA 4N6FA 4CNPA 1YXYA 4AIUA 2PDXA 3RLUA 2ZUWA 3MHFA 3WDPP 3RPMA 3R89A 1AJ2A 4ROQA 3M0YA 4WKAA 5K7JA 3VC5A 4KQNA 3T8LA 5A8MA 5HUPA 2ZC8A 2VDIA 6ENLA 1PUDA 2CU0A 2YYUA 1UZHA 3G18A 3IJDA 3QSTA 2A6LA 3MP5A 3IIVA 4ZOAA 1FWGC 3N2BA 1HQTA 1BWKA 3NQ2A 4GIYA 2CZDA 1UR0A 1XBZA 5BOFA 3U6WA 3P82A 1R2SA 3UXKA 3MBFA 3ARTA 1KFEA 1ZAIA 3TYUA 4GXPA 4ZVJA 1EBGA 3OJGA 1CXFA 2DIJA 2J7FA 4NVTA 2X0HA 2E77A 5TD4A 3CT7A 3NPVA 4HMEA 3M0HA 1WDPA 5DELA 2Z6JA 3NQCA 4H4QA 1R5YA 4GRSA 5C2GA 2AQVA 3GFZA 2EKGA 2QCDA 6TIMA 3MWCA 1R46A 2YGYA 5JRBA 3OVQA 2OXNA 5AY7A 1UR1A 3PC0A 2OGJA 1UR3M 2X7VA 4Y2WA 1OQFA 3GC4A 3FW6A 1XYMA 4NILA 5G5HB 1EO7A 4JIHA 4XUGA 1EFZA 2Z26A 3RILA 3IUIA 1VFFA 3C0QA 4UB9A 2GGIA 1HIZA 4DPPA 3NL3A 5CSYA 3GXDA 2XPKA 1JVNA 3REQA 3GD6A 3L0GA 2D1ZA 2X99A 2CC0A 4GO9A 4FF7A 4C6EA 4DXVA 1TZZA 5FESA 3BG9A 3N18A 2GQ3A 3ABRA 3W74A 4EM4A 3LK6A 3C3UA 2WPEA 2D2GA 1KXTA 1DXLA 1ZL1A 4R7OA 2P5NA 5LZLA 4ICCX 4UC5A 4B15A 4XAZA 3T0CA 1Q7ZA 2FVMA 2JF6A 4Z08A 3TTEA 3LMYA 3IACA 4FOJA 1UWSA 4H00A 1XBYA 1BSLA 2YVJA 5C9WA 4Y9OA 4YTTA 1RHCA 1KXHA 2E7FA 2Y63A 3A9IA 3UCDA 3OZMA 1KGWA 1WDWA 4B5WA 3LN3A 3GUWA 2QGHA 1TPVA 2XWDA 2G41A 4BI7A 4R7JA 5DN1A 4O1FA 3C6CA 2GUYA 1FWFC 2V82A 3OTRA 2X1IA 5MKGB 1I1WA 2L5HA 4LC8A 1F6PA 4DXKA 4DJFA 2VDGA 5A8OA 2NQLA 2ISFA 2CNCA 5A6KA 4XAFA 3AXHA 3ZWTA 2WOVA 2E4TA 1HUVA 4LBSA 1DWAM 4B2DD 4AVOA 1A0CA 1TX0A 3VZXA 3W7RA 4UWMA 1WAUA 3QSRA 4AW7A 3M5XA 1AOGA 3PBVA 3MSGA 2Y7GA 3N2OA 1UUQA 3ARUA 2DZWA 3GR7A 2NQJA 1OX4B 3WL1A 2NQZA 4XZ9A 4ERGA 4WZHA 1QUMA 3WQ4A 4LH8A 3BW3A 3WLPA 3LCHA 1GJUA 3F5KA 4WRHA 1AQ0A 1ICQA 3CUXA 3EF6A 3EBVA 4NZCA 1C91A 4MY9A 4I9AA 1KRAC 3DCPA 2YQUA 1D9EA 4A3UA 3GU9A 3TNOA 4ZENA 3SI9A 2ZX9A 4MM1A 4CVWA 3QGAC 3RPDA 2WJZA 2NVDA 4AZ5A 1CEOA 1XPYA 3AIEA 1QT1A 3UCQA 3H55A 4GX8A 2EXOA 4IFOA 2GH5A 3U2CA 4M52A 2YVFA 4OBSA 4MG4A 1AJZA 1Q45A 3BURA 3CIWA 3N4AA 3MCMA 3VYLA 1YHTA 3GM8A 3S9YA 1OFEA 4PUEA 1ZFJA 4ICNA 5CPQA 3BJTA 3NVYB 3UERA 3NVTA 1AL7A 3TFXA 1J0KA 3SRFA 3VNIA 4M81A 4H4YA 3FYOA 4IOTA 2W9MA 3V5FA 1J2BA 1SJCA 2W3ZA 2E5DA 2UY3A 1RAKA 4LUIA 3VO0A 4NJIA 1D2KA 3FFSA 4AY7A 4R9XA 4D8LA 1ZBKA 3HQ1A 2ACUA 4OBTA 2J3NA 3DZ1A 3KXQA 2ZXQA 3WF4A 1GKQA 2VHLA 4EX4A 3BLFA 4K7VA 3WDJA 5AYBA 2XIIA 2E8ZA 3W7OA 5T9BG 1ZTVA 4EQSA 3CV6A 1FKXA 4CEUC 1XIEA 1OVDA 1O4UA 4C6JA 4UR8A 1KTBA 1FDYA 3KFTA 1RH9A 1GK8A 2BNJA 2XN1A 2X16A 2VVNA 4AD1A 4W89A 1FX6A 3W9ZA 1OIFA 3EA1A 4A8RA 3PWGA 1E4NA 3HFTA 3O15A 1AZ1A 1TTPA 1XIJA 4DWSA 1S1RA 3G22A 4EAMA 4ZO8A 3T05A 4LAUA 2IXUA 1N55A 1E5JA 1UC5A 1ONRA 9RUBA 1PZ1A 2FPYA 1X7FA 3ICJA 3IGXA 4O4VA 3RPTA 2WSQA 2BY2A 4ZSUA 3OBAA 4RNIA 2PDWA 1JZ2A 1KCZA 2A7RA 2V5CA 2BWGA 3NZQA 4DUVA 3FEQA 5AC8A 2WJEA 1N82A 3VIPA 4J3XA 4KH2A 2OGYA 4HPNA 4LUJA 1UWRA 4HCLA 2ZVRA 2PDGA 4H8UA 3ITXA 3UJSA 4GFIA 2PLKA 2AL2A 1H61A 1P6CA 2V5KA 3G1DA 5A8GA 3VM7A 5JH2A 4D6IA 3O6CA 2WKJA 3R2GA 3W6YA 2QUTA 2ZICA 5K4XA 4AZBA 3M41A 5D2TA 3CGCA 4M82A 1EJ7L 2PU1A 1LOQA 3AXKA 3H2AA 4R85A 5HNTA 4EANA 4PBEA 1DOSA 5F4SA 1H7PA 2KAUC 1ZALA 1ZBWA 1ENUA 2HROA 4G9PA 1CLVA 4E3TA 4MF4A 1B1YA 2AGKA 4JPGA 3AUJA 3VDAA 1M01A 4GYFA 3O8AA 2FH6A 2C7FA 1UH2A 1KC7A 1I2RA 3BZJA 3RK8A 1QK0A 1Z42A 2QS8A 3RMJA 4HKPA 1XH0A 1VHNA 4GA8A 3URAA 1PVNA 3O0KA 2VO5A 3OODA 1XM3A 3K4DA 3LTSA 3PTDA 2ZXDA 4GJ1A 2HPMA 3UU0A 2QCFA 3L4TA 1W3JA 1FWDC 4TVCA 4U2YA 4CKQA 1YBQB 3EMCA 4M6UA 2IXVA 1RM6B 3MI6A 3RDKA 1WQ5A 2WNQA 4TMBA 1SGJA 3N2TA 4GXWA 3UG5A 1O60A 4P8UA 2YDQA 1E55A 1HJWA 1TV3A 3ES7A 4P7RA 2X2YA 3CLWA 1PPIA 4RKAA 1SW0A 4J3ZA 4MB3A 3P0WA 3QMTA 4ZEPA 2FTPA 3B8SA 3V75A 1VBJA 4GUJA 1EHAA 1ZCCA 4DO5A 2OU4A 1Y5XA 4X61A 5DT5A 4X63A 3U7VA 3IRDA 3SUUA 4AZCB 2HZGA 4RE3A 1XIIA 3N4FA 3DG7A 3PZUA 3STGA 2H90A 1W5OA 5H8MA 4RZ6A 3UZ5A 2C19A 2XHYA 3EX3A 4APNA 1R2TA 4X60A 3EDDA 1HTIA 5KZDA 3SBFA 3HBLA 4D72A 3MZNA 1TVLA 2O9RA 2OZ3A 1GPWA 1TIWA 4EE9A 8CGTA 1OZMA 5DCDA 2NLYA 4W8LA 4NEVA 3OZPA 1GVRA 1QASA 5BRQA 1U30A 3G0XA 1Y8BA 4P7OA 1NOUA 4O14A 4ADWA 4E6MA 1CLXA 2DVTA 1B4EA 3W81A 4WOQA 3DN5A 4P61A 2NQ5A 3D46A 4LEQA 4ZQRA 2QPSA 2QCHA 3W84A 1NY1A 3DXIA 4HQVA 1TB3A 1XLBA 4C6LA 2EQ6A 3RAOA 2QIIA 2WNWA 2DT3A 3WLMA 3NOYA 1QPNA 2R91A 3PTMA 2VGBA 2GPTA 4D6JA 1ZY9A 1IEXA 3S5OA 2TMDA 4FX7A 2EKCA 1UKQA 1UJPA 4QGCA 1UH3A 3SGZA 5FJJA 4JCLA 4QJ1A 3ZO9A 2ATMA 3NPUA 2Y5JA 2RKXA 4JIEA 4B5UA 1B3XA 4UTWC 3KOYA 3PUEA 1S3TC 3APYA 2VELA 3URNA 1ME8A 5HWJA 5TIMA 1QPRA 2ZKMX 3SW6A 2GYIA 4UOQA 1PCKA 4TO8A 4H9TA 4GCXA 2NSOA 3B04A 4KRZA 1R6WA 1A0DA 2D3NA 2POZA 1JFHA 1JXKA 4ZFMA 3SCPA 1VLIA 5I6SA 1ZS2A 1LBLA 1R8LA 5FKYA 2YL8A 4PL2A 3PJUA 1X2GA 1YTKA 3F4CA 2QCDB 1WBHA 4QS6A 3T40A 2OLSA 3CL7A 4GNKB 5LHEA 5KVIA 4C6MA 2XFRA 4YCOA 2Y62A 2PUZA 2R1PA 3S2MA 1DKWA 1OT1A 4AWEA 3AXMA 4UQDA 1UA3A 1HKIA 1LOSA 2PP0A 3AMGA 2E1DA 6XIMA 2PP3A 3QHMA 3SURA 3LPGA 2D73A 2H3DA 3HF3A 3NIYA 3REQB 1DE6A 4GGBA 4H7VA 4S3BA 2PGWA 5HJLA 3WIJA 1M5WA 4D6DA 3PG6A 2XIOA 1ISWA 2AKMA 4GZ7A 4XD3A 2JF7A 2WOIA 1CZ1A 1XRSA 2Y7FA 4NZ5A 3BXWA 4PFMA 2VQTA 2E68A 2AGTA 3AI0A 3NCOA 3TK7A 4L1GA 1AFSA 2BG5A 3SADA 5IM51 1W56A 4RZBA 1E5NA 2WPFA 3OZOA 4ES4A 1B54A 2VZTA 3VD3A 3R0UA 4FALA 2H9AA 1UC4A 3MQTA 1HF6A 3KVLA 4DN1A 1V97A 1TQXA 3MB9A 1E4LA 4DB7A 4WR3A 1MFVA 4K1WA 2VEGA 3TLLA 2ZADA 3U5YA 2ZXBA 2POTA 2R14A 2DZAA 4H1ZA 3OG3A 4H4SA 4S23A 4TV5A 3ARVA 3SUWA 5IBXC 1VC4A 3HFYA 3GRTA 3EPNA 3R8GA 3NPWA 2X7WA 1UWIA 3TYDA 4AD4A 1L6YA 2J66A 3CV1A