4DN1A

Crystal structure of an enolase (mandelate racemase subgroup member) from agrobacterium tumefaciens (target efi-502088) with bound mg and formate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
389
structure length
389
Chain Sequence
b'HMNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal structure of an enolase (mandelate racemase subgroup member) from Agrobacterium tumefaciens (target EFI-502088) with bound mg and formate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 132
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dn1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dn1A01
2XH2A 2QGYA 2HXTA 7ENLA 3SN1A 3FV9A 3VDGA 2PA6A 3UGVA 4HNCA 4IHCA 3H7VA 3TQPA 2ZC8A 3GY1A 3OTRA 2OX4A 2OVLA 3GO2A 3Q45A 2P0IA 3IJIA 3NO1A 3SSZA 3S47A 2AL2A 2OLAA 2ONEA 3STPA 1R0MA 3H70A 2QJNA 4DX3A 1ECQA 1WUEA 3MY9A 1NELA 2ZADA 3JVAA 1KKOA 4MMWA 1ONEA 3IJLA 2OG9A 1TKKA 3P3BA 4DHGA 1ELSA 3VCNA 2P88A 2GGEA 2PP1A 3UJSA 3VC5A 4GGBA 1FHUA 2P3ZA 4GYPC 1MDLA 4KPLA 1BKHA 3Q4DA 4IP4A 2QJJA 2GGIA 4IL2A 3KUMA 3UJFA 4KT2A 4Z1YA 2OZ3A 5FJPA 3V5FA 4F4RA 3VFCA 1OEPA 1XPYA 3QN3A 3VCCA 2OQHA 3DEQA 1MDRA 1MNSA 4K8GA 4K1WA 5J04A 1P43A 4EWJA 3SN4A 1EBHA 5FJUA 1WUFA 2O56A 4GYPA 1EBGA 3TWBA 3R1ZA 4E4FA 5BOFA 3RO6A 4KWSA 1NU5A 2HNEA 3T4WA 1RVKA 3ZVHB 3EKGA 3PWIA 1PDZA 2FYMA 2GSHA 1E9IA 3ES8A 3TJ4A 2RDXA 3QLDA 2PP3A 3TWAA 4GISA 3ZLGA 1XS2A 3N4EA 4H19A 4GGHA 2PU1A 1L8PA 2OFJA 3FXGA 3MKCA 3V4BA 4E8GA 3TCSA 3RCYA 1JPMA 3CT2A 3H12A 3ZVIA 3R0UA 1KKRA 2QDDA 2QVHA 2XH7A 4HCDA 1EC7A 3UXKA 2I5QA 1TZZA 3V3WA 2P8BA 2PPGA 3OZMA 4G8TA 4JN8A 2PGEA 3DDMA 3FCPA 2PTYA 3QPEA 5FJTA 3FYYA 2PS2A 2PU0A 3R25A 1SJDA 3I6TA 1KCZA 3GD6A 1KD0A 4IZGA 2MNRA 1MUCA 4X2PA 4GFIA 1SJAA 3U4FA 2CHRA 2POZA 2AKZA 2FKPA 3I4KA 2XGZA 3UCDA 3CYJA 3BJSA 3MZNA 1FHVA 3UJ2A 4M6UA 2XH0A 3ENLA 3T9PA 2OPJA 3DG7A 3VA8A 2QDEA 2PTXA 3DG6A 2AL2B 1PDYA 3V5CA 4HYRA 3DGBA 3R11A 1W6TA 3TW9A 4IT1A 3ES7A 4YWSA 3P0WA 2OKTA 1SJCA 3D46A 1BQGA 5IDZA 1DTNA 4MGGA 4ZCWA 3NZGA 4E4UA 4ENLA 2PSNA 3GC2A 4HCHA 5BOEA 4DXKA 4GIRA 2XSXA 3THUA 3D47A 2OZTA 2HZGA 3DIPA 2HXUA 3TTEA 4FI4A 3UXLA 2PTZA 2QJMA 4A3RA 2GDQA 4DN1A 4E6MA 3CAWA 4FP1A 2PODA 3PK7A 4M0XA 1IYXA 3SQSA 2P8CA 3S5SA 3MUCA 2PGWA 2AL1A 1F9CA 3U9IA 3DFHA 3CB3A 3P93A 3QKEA 4A6GA 3N4FA 3DFYA 4ROPA 3SN0A 4HN8A 3R10A 3PFRA 4JHMA 4E5TA 4G7FA 2DW7A 4HPNA 3EEZA 2QQ6A 3FJ4A 4DYEA 3OZYA 2XH4A 2GGJA 3I6EA 1P48A 4JN7A 3UJEA 3UCCA 2OQYA 2DW6A 3UJRA 1MRAA 5FJRA 2PCEA 2PTWA 4KEMA 3DG3A 3IK4A 4H2HA 1R6WA 2PP0A 3NXLA 3HPFA 3JW7A 5ENLA 3QTPA 3BSMA 4A35A 3IJQA 4HNLA 3PWGA 4ZA0A 3MWCA 2MUCA 4MKSA 3SBFA 4H1ZA 2GL5A 6ENLA 2OZ8A 3ZLFA 3DERA 1YEYA 3JZUA 3R0KA 3FVDA 2NQLA 4J1OA 3N6JA 1JPDX 3MQTA 3RGTA 3ZVHA 5FJOA 3RR1A 3OP2A 3MSYA 4Z17A 1TE6A 4HCLA 4DWDA 5EU9A 1EC9A 4IP5A 1JCTA 4GMEA 3CK5A 3H8AA 3BOXA 4H83A 3SJNA 3N6HA 3RITA 3TOYA 3DESA 3NFUA 4K2SA 3T6CA 3ZLHA 1EC8A 3RRAA 3CXOA 4J3ZA 3OPSA 2AKMA 2OO6A 1SJBA 3OW1A 3T8QA 3B97A 3VC6A 4IL0A 2PMQA 3TJIA 2GGGA 3K1GA 1JDFA 2GGHA
chains in the Genus database with same CATH superfamily
2XH2A 3WD0A 2QGHA 2JEPA 2WPEA 3MKKA 4C6CA 4CN4A 4K38A 1UD6A 1PZ3A 1N55A 4GJIA 2QCHA 3PNZA 3CNYA 4ADSA 1QVBA 2EPNA 4JIRA 3OU8A 1M1BA 1XDLA 3UYCA 3H7VA 1H7PA 1CXIA 4GIYA 1DL3A 2E3ZA 3WQWA 3TAOA 1T0OA 3CLMA 2YVJA 4PB4A 1ZKQA 5IBXA 4LC6A 1TWSA 5KINA 2HE5A 1W3JA 3C0SA 5GQBA 2AAMA 3RILA 1E0VA 4KEZA 4C6OA 4Q8NA 3WH9A 5I07A 3EAUA 4OTKA 2OEKA 3B8IA 3IJLA 1XICA 2J7EA 3STEA 3T0DA 1ELSA 3LDVA 1P4CA 3N04A 4ICMA 3LBCA 4EMJA 1OIMA 1FHUA 4JEJA 4CQCA 8XIAA 1AL7A 5MKGB 1TB3A 3PSVA 3H2EA 2HK1A 3IVTA 1E0WA 3VCCA 2JK6A 1CXFA 3PN8A 3AWOA 3CMGA 3NDOA 1R3QA 4K6AA 1XD1A 2D2OA 4E2OA 4YHEA 5HWJA 1KXQA 3GR7A 4R7OA 1JQXA 1K4QA 2WB5A 4DAFA 4EP8C 5EPDA 2HBXA 5D30A 1RY0A 4B5SA 3CC1A 1LLOA 4KWUA 1JEZA 3WLTA 4KGLA 3GYEA 2D24A 4B5TA 1N5XA 1Q8JA 1RJQA 4H4IA 1N7KA 4RE0A 3L2MA 4KBXA 3URAA 2XWEA 3U6WA 1EJTC 2GSHA 4GHRA 4DO6A 3TJ4A 2ZXBA 3R58A 4BQ5A 3UXIA 3W9ZA 3KZSA 3KOXA 2A3BA 3CIXA 5CPQA 2QCNA 4GQRA 1XS2A 5BOOA 4IMAA 3U7BA 2CZEA 3AHTA 2WVTA 3B9DA 1HJXA 4JX6A 3FXGA 1RV8A 3MC5A 4POCA 3AICA 5G2WA 1CLVA 2DJLA 4P61A 4GNJA 2RAGA 4K8HA 2V3GA 4HA4A 1XKYA 3APTA 3UXKA 3W01A 4D72A 3KEHA 1H60A 1XLDA 3CO8A 2PPGA 3EB3A 1J96A 2ISDA 4JN8A 1QI3A 4I9MA 3S2MA 3P5YA 4GVIA 5CG0A 4B5NA 3HURA 4GK8A 2JK2A 3R25A 3MMWA 2DDXA 3TA9A 1JOAA 4B2DD 3BCFA 2VM8A 3U4FA 4YVVA 4QBXA 1EXPA 1GHSA 1XDMA 5C54A 1FWIC 3M9YA 1ISZA 3LXAA 2VT0A 2FB2A 4EQXA 3PJWA 2AAAA 5AZ1A 1SFLA 1US3A 3WH5A 1HP5A 4X9YA 1Z32X 3AIEA 3DGBA 4D2JA 4HZ8A 3R11A 4GZ7A 3HOJA 2ZX6A 1K7FA 3WJWA 5MF5A 2G8ZA 4OOZA 2YBTA 4JYDA 4AEFA 4AIEA 4MGGA 3TN3A 2DPEA 4PCPA 2PSNA 4GE8A 1Y5XA 3ZFHA 4LUTA 3DI1A 4XISA 3VMNA 1WV2A 4Q8MA 5G2HA 1XPGA 2XIBA 1KCXA 3W38A 1RZMA 5FA5A 1OINA 4Q22A 4JX5A 3O9NA 2BX7A 3TC6A 1GOMA 2RDWA 5FL0A 2A8XA 1E1FA 2KZHA 2NWRA 1W54A 1E5NA 1DWJM 4Z42C 3CB3A 1WDDA 3QKEA 4AD3A 4WSJA 2YGYA 3OQEA 4R9OA 2ZZ3A 2HPIA 2CKRA 4S2CA 4B3KA 3EAOA 3WLPA 3M0KA 4N0RA 5GNXA 1E4MM 2ZZ1A 3HPAA 4DBUA 1XIIA 3AMLA 4OHQA 3U2CA 3TJXA 4GO8A 3THAA 4XAGA 3SRDA 3PTMA 3W26A 2NVDA 3LTPA 1HIZA 1JPHA 1C7TA 3TFXA 1VIWA 3N29A 1H5YA 1ZL1A 3G18A 4QP0A 5AC4A 1OF6A 5JBFA 3O0HA 6ALDA 2O9TA 2E4TA 1FA2A 1SSGA 1I2QA 1XANA 5LZLA 2EPOA 3ZT6A 3IK4A 5LA2A 2PWVA 4AUBA 1XRSA 5HNRA 3MDWA 4YS1A 4H50A 2V0TA 5CGMA 4XD6A 2VZUA 4KS0A 3M0IA 4H04A 3FYOA 4EQRA 1SYTA 1NJJA 3CH9A 4OFCA 3V18A 3FVDA 1W2VA 3H2MA 1O60A 3N1AA 4BJHA 4IPJA 1LT7A 4P8UA 4JIEA 5F4WA 1EOMA 2GZXA 5KZDA 1EIXA 4JTLA 3VE9A 3VFLA 2WZTA 4IP5A 1YXDA 4M6QA 3AJ7A 3EMCA 2PDMA 3PG6A 4S3JA 2YXOA 3GHUA 5LNVA 1YHTA 4JDRA 1EC8A 2C3DA 3CTTA 1RBAA 2GVLA 2C3CA 3NGFA 1RA5A 3SI9A 5CZ0A 3CO4A 1DHKA 3LHVA 2GWNA 3G1RA 1FFQA 2X41A 3W2MA 1OFDA 3VIJA 2IXVA 1E4NA 4WSKA 2WPFA 3K1GA 1JDFA 5JIWA 2QGYA 2HXTA 3EWUA 7ENLA 2JKAA 3B04A 4EOUA 1RBOB 3ZWTA 5G4EA 3TEVA 4YVXA 3W7NA 4PUUA 3RM8A 2YFOA 1SR0A 3OIHA 5I78A 3SDOA 4C1KA 3UXAA 2W0HA 3OTRA 3IIXA 4HNOA 4P7LA 1HO1A 3NO1A 3TSMA 4Q8VA 3HRDC 2AL2A 2OWWA 1YRRA 3AMZA 1RQHA 1XLLA 3RXZA 3YPIA 2Z6JA 5KMYA 4DX3A 3WK1A 2DP3A 3MY9A 2DUAA 3G1FA 1W3HA 1FWGC 1TV8A 3ATYA 3P3BA 2Y61A 1OZQA 2REQB 3ERPA 4HU3A 5AC7A 1UKOA 1MUWA 3UWWA 4JIPA 1N82A 1ITUA 4O14A 3CUHA 3VGGA 3WLOA 3R6IA 5A8PA 3EGJA 1KM1A 1WP6A 1PSCA 5CXPA 3PZOA 4JAWA 3L5AA 3LSCA 1F3TA 5BMXA 3PS7A 3D3FA 1MDRA 3VUPA 3TUUA 4FR6A 4YL2A 1JD9A 5GNZA 2O92A 4PGLA 2VEFA 4PUJA 2AMGA 3MBDA 3VKJA 2PLCA 3ITOA 3GFZA 2F7FA 1IIHA 1K6AA 1Q65A 2GPTA 3F4CA 2PUZA 3H2OA 1ESWA 3IANA 4NJJA 3PAJA 4MADA 3RO6A 2BGSA 4JZ5A 3AMDA 3L4TA 3FX4A 3EKGA 2R94A 1V4YA 2PP3A 1VPQA 5CPMA 3RLUA 2HCVA 1OGGA 3S1GA 1QNPA 1ADSA 1R3WA 3EX3A 2Z1KA 5FKYA 5G4WA 3DHUA 4ROQA 4LUJA 3TYCA 3PPFA 1KLZA 3TXVA 1V3IA 3LZ3A 1P7TB 1UD8A 4UTWA 3ZVIA 4HMNA 3ALFA 2ZCGA 5JCKA 2I56A 1JR1A 1QW8A 4HNVA 3HM7A 3ZR4A 2WNQA 1EOKA 3M7WA 2DH3A 4XSLA 4CQDA 3EOLA 3HTWA 1BVNP 1FO4A 2O4MA 1UIPA 4H8VA 5D05A 3PBVA 2V3AA 3RPDA 2CYGA 4QQUA 2B4GA 2W66A 4KPRA 3NVYB 1B4EA 4LALA 1HO4A 4RK8A 3ID7A 4JY9A 2C71A 3OIXA 2MNRA 3UESA 1Z8AA 4GVHA 4K8EA 3T08A 4EXAA 5D2VA 1PAMA 2FH8A 2POZA 2FKPA 1JD7A 4OWGA 4K68A 4EQSA 3UCDA 1RCQA 2GLKA 5AYXA 1JZ4A 1AOGA 5EFDA 2WJEA 1IR1A 3T9PA 4O18A 1TZ7A 4U28A 3WCZA 6TIMA 3HQPA 3COTA 1OGSA 5F1UA 4QRNA 2FH6A 4UQDA 4DEFA 2Z4GA 5TIMA 2YCJA 3MCMA 4UOQA 3WQFA 4PEKA 3TXZA 1VJZA 3GIQA 4BF9A 3KBSA 3H2CA 1K70A 1NTHA 3LCGA 4XVDA 1N8WA 2PRMA 4ENLA 4F0HA 3W7PA 1UR3M 4A4AA 2VX6A 3HG2A 3ITTA 8RUCA 5GRTA 2PZ0A 4L56A 3RR4A 4DXKA 1DE5A 5FAJA 1ICSA 2XDFA 3E0LA 3KBNA 1XIDA 2PDHA 1S39A 3GXDA 4DN1A 3PK7A 1AW1A 1T41A 4AZBA 1YPFA 2WBAA 4KRTA 3QPYA 4U33A 3MSDA 5KVHA 4UQEA 3E12A 1GOXA 1XBZA 4E4PA 2NUYA 2GOKA 2Y5JA 1WZAA 3T42A 1LRQA 3ZWSA 1P6WA 3M46A 4EK7A 4MWAD 3W1UA 1WDPA 4AIOA 4MLJA 3UNTA 1TR9A 1UPMB 3FOKA 3TC7A 3W7CA 3CQJA 5CEWA 3AIVA 2FTYA 2HWGA 4LVFA 3I6EA 4N02A 4RDWA 2WOQA 3WUGA 4AVNA 4MB3A 1PVNA 2PC8A 1C29A 2PTWA 1RJPA 5CQ1A 4XQ6A 1DWAM 1R2RA 5T91A 2YDSA 3GVGA 5FF3A 1UKSA 2OOGA 4QS6A 1VFUA 3VNKA 4XZNX 2QVNA 1JCYA 4N9CA 2PDXA 4HOZA 3E0WA 3PANA 2C3ZA 5ABHA 1LPFA 1FCVA 4O4VA 3TYZA 2VFEA 2G95A 3HGJA 2X7VA 4S3AA 4ILSA 2JALA 1G4SA 1EGMA 3IC9A 4LANA 1P6BA 4PRRA 2J27A 1TE1A 1Q2SA 2CLFA 4IIGA 4S3CA 3PFMA 1KBJA 2HQAA 3CPRA 1DE6A 2W61A 5AHMA 2BXZA 3NZRA 2Q8ZA 1PCKA 5A6TC 2NXHA 3IV3A 1H4PA 1K8YA 2YCKX 2W67A 2QCLA 1GVSA 1AQ0A 3N25A 4REQA 3RITA 4QLKA 1X7FA 1TVNA 1OADA 3EBVA 1A3WA 4JFUA 4UBPC 4K2SA 1TPEA 2V5DA 4IGNA 4M7TA 1E55A 4DJFA 1NVMA 1X7IA 3ABZA 1BXBA 1WZMA 5HNUA 1WXJA 1NY1A 1XLIA 3MUIA 1HL2A 3WLMA 2DV0A 3N6QA 3H24A 4PMYA 5TNVA 2V2CA 4Z2JA 2WPGA 3EEGA 3HO8A 3NCOA 1EZ2A 3AC0A 3S5YA 2QV5A 1LJYA 3ZJ6A 1PO9A 4RNFA 1IT8A 4NG3A 1RH9A 1PHQA 4IWWA 3WF2A 2Y70A 2NWSA 1QI0A 3MMDA 2OR2A 4TX6A 1O5XA 4RZ5A 3G0UA 1F3EA 1RAKA 2P0IA 3WLNA 2QCEA 4M5PA 4UZUA 3AIRA 4FF5A 2VUYA 7TAAA 3J7HA 4AC7C 1EGZA 2Y2WA 1REQA 1VFHA 3SSJA 4RDVA 1P0BA 4ZO9A 3UR8A 3VUSA 1VFSA 2FB3A 3MKVA 4H41A 2YDQA 1DYSA 1TKKA 3QMTA 1GNXA 1BQCA 3UJSA 1IE7C 3VC5A 5F2GA 2BV9A 2DVTA 1OM0A 3EXSA 2PWGA 3HQOA 3TX9A 2ALDA 4BEQA 1KXVA 1C8XA 3L23A 3VFCA 4IMDA 5BU9A 3NQFA 1LCOA 4NUWA 2BOEX 3SY1A 1B30A 4K8GA 2GSJA 4WK9A 3VGBA 2WHMA 1M7XA 2NQHA 3QGVA 4QITA 3LNMA 4N9EA 2YBVA 2FGBA 4OIFA 7REQB 2BP1A 2GJXA 3TWBA 3M0MA 4B15A 3AZRA 3VIPA 1EH9A 3H4KA 4ZQRA 4FR1A 3MCOA 1GJPA 1ZRQA 3KCOA 1FP9A 1UIOA 4E2BA 4XBSA 9XIAA 1S2VA 3TMLA 2NPXA 4PUNA 3LN3A 2ZVIA 3UT0A 3W00A 4ZZ9A 2E3TA 2J47A 3L5LA 4DPQA 3GHTA 2A3HA 4GGHA 1FWRA 2AAQA 1W17A 1UUQA 3QKZA 1GW9A 3QQWA 4IMFA 3CUJA 3C0JA 3FAXA 3RM9A 2VGIA 2NX9A 3LXCA 1HKJA 2GR0A 2WMHA 2WCAA 2V5BA 1JXJA 1OFAA 4JFWA 2GR3A 4HD5A 1GTHA 3B3DA 3AMGA 3T07A 2QCDA 1YYAA 1OFRA 3KCJA 3ZSSA 2QPUA 1PZ1A 1K8CA 2VZOA 1TIMA 2C7FA 2FGLA 2ZE3A 2Z24A 3MUAA 4DO5A 3TE9A 3ARPA 1W9VA 3AS1A 2WXDM 2WVSA 5C8BB 4IZGA 1J4EA 3EDEA 3HMJG 4LCQA 3IGSA 9CGTA 2NQZA 1CIUA 4DY1A 3VIKA 1LRNA 2PEVA 4FX9A 4AD5A 2R9ZA 2Y5SA 2D2HA 4CQAA 1KGUA 3DFNA 4B3LA 4C6DA 2J8TA 1OFBA 2QDEA 3DG6A 3KLLA 3BG5A 3U2ZA 1J11A 4V1YA 2YL5A 1H7OA 4PRWA 4PA8A 4D1IA 1P1MA 3I4EA 3TU9A 3GUGA 4YMZA 1TV3A 5BYWA 3O0FA 2Y7GA 4EF8A 3P0WA 1NFBA 2HQMA 1GEHA 1T99A 2V38A 2WSPA 3L2LA 2PDIA 2DZPA 4ZBCA 4FX6M 1ZFJA 1AW5A 3GLCA 1W31A 1UMYA 3GC2A 2P3EA 5LSMA 4A8RA 2O4QA 4D6FA 2C13A 4CU6A 4ZOBA 5TAOA 4N6EA 1DXLA 4NX5A 1V7AA 1QRQA 1GQJA 4JS3A 4UTFA 4UCGA 4H4PA 3TQKA 3WY1A 4HU4A 2E09A 1UR9A 1X39A 3I10A 4S3BA 3GXNA 1OFEA 3BANA 2ISWA 3BPWA 4HA3A 1MZHA 3SW6A 3E3HA 1YQ2A 2DIKA 4O1FA 2HTMA 1O66A 1PKYA 1ZS2A 4ERGA 4M24A 1V0MA 1O12A 3KP0A 1CXKA 5KETA 3N4FA 5HR7A 4LBSA 3GSMA 3KFTA 1UD5A 5FESA 2ZC1A 2E40A 3CZKA 4IIEA 4MOZA 2ZX8A 3AXXA 3W7RA 3M0YA 3UZZA 4B3ZA 1TREA 4IJBA 1OCNA 2Z1XA 1GQKA 4V28A 4H6QA 2CZ5A 3NSXA 2PRLA 2HS8A 2NLIA 1KLYA 3TNBA 1EJRC 4CNUA 2CBJA 3APYA 2XSAA 1PX3A 4HOWA 5FJRA 2WYSA 1ISVA 3KRSA 4XVEA 3E0FA 1XG3A 3KS6A 2I5IA 4UNIA 4DBWA 1SW3A 4PMJA 1E73M 1VJIA 2Y63A 1EJUC 3RJXA 1MEHA 1T40A 1U5JA 1XI3A 1WKYA 5I03A 1A5BA 4KWWA 4J3UA 2NXIA 4MKSA 3QGKC 3KOWA 1VR6A 1WZLA 3C2EA 2D0FA 3W7KA 1PS9A 3FXYA 2CLHA 4PEEA 1GRTA 3IV8A 3N3MA 1ZCCA 2V2DA 3VD9A 2QW5A 4MFEA 1JPDX 4LGXA 3CUZA 3W1MA 3WYZA 1J2BA 3W88A 1OX4B 2PWFA 3CEUA 3NQEA 4H6EA 4CD6A 2HRWA 1FOBA 4TR9A 3N4AA 3UZYA 2ATMA 1PIIA 3I3EA 2CWNA 2Y8KA 3FW6A 3P6LA 1V3KA 3QHNA 2I9EA 3N6HA 3QHOA 5CJ5A 4GZEA 4RE3A 2RABA 5XIMA 4OV9A 4CVWA 1GV4A 2CITA 4W7WA 4DJDD 1MVYA 2Y7FA 5H1WA 3LM3A 4R33A 4K36A 5DQPA 1UMLA 2GJPA 2VFFA 3CT7A 4B90A 4NF7A 1T6MA 3CL6A 3E49A 3T81A 4R5EA 2ASHA 3PG9A 4JNZA 3AS0A 4IUOA 5DLCA 4QNWA 2JGYA 2QDGA 1VHNA 5DMLA 3VMOA 4LUTB 3P2VA 2GQ9A 3N19B 1UH2A 3WLSA 2A3LA 3H23A 1AVAA 4W89A 5C9WA 1BD0A 1CDGA 3GHSA 4LNCA 1TSIA 4CQ9A 2QPSA 2ZZ7A 3OOQA 3W76A 4YHGA 4QTGA 3CS2A 3KVKA 4WXYA 3LD5A 3GNXA 1EO5A 1FHLA 5DY2A 2ZRUA 1FX6A 2UV8G 4OECA 4PFHA 3SCSA 1XD0A 3NVWB 3H70A 1NOUA 2VX4A 1Q13A 4UMCA 2P1FA 4QDWA 3RX2A 1Z44A 3DECA 5CJMA 4AXNA 4CNTA 4V27A 2B0MA 3PP7A 1FWDC 4O16A 4BZYA 3FFSA 2J79A 3GUWA 1P5BA 1EJWC 4C7DA 4AZ5A 3PTQA 5A8GA 3Q4DA 3NGJA 1OC6A 4IQDA 3MHFA 4ZOAA 2EGZA 3GS6A 4XBKA 1PYFA 1I45A 4LEFA 1V0KA 3G22A 3G3DA 3VU2A 4DJDC 2GYIA 1CGYA 3LK6A 3QN3A 1ZXIC 2E6FA 3CQKA 2HEJA 1QU4A 1J10A 1JCMP 2V67A 3EA2A 2ADAA 2DSVA 3GNRA 4EX4A 5J04A 1XDIA 1W9UA 4MNKA 5AHIA 4JQ3A 3SN4A 4LS0A 3GTIA 2G3NA 1CX9A 3K13A 1XIGA 5H8PA 2VWTA 4YYCA 5JUVA 3F7JA 1EBGA 4JTCA 3ALGA 4DJEA 3GNPA 3A4WA 2FJKA 1VGAA 4OUIA 4H9ZA 3LYEA 4C6KA 1MXSA 3N15A 1X1OA 4KWSA 1GCYA 1VB9A 1XRVA 1QO2A 4IISA 1H62A 3A12A 4IJRA 4D6IA 1VQZA 3O0KA 1EL3A 4CQ8A 4EQWA 1XW8A 3NDZA 4IFRA 5D33A 4D6JA 1B1YA 4AMAA 2WHLA 5F4SA 3BW4A 2YXXA 1TPB1 5KSWA 5EMJA 4NAFA 4UTTA 2QCCA 4HN4A 5K4ZA 3E2QA 3AHXA 4W88A 4H4XA 4AQLA 1TJPA 5D02A 3EANA 1KKRA 2QVHA 1US2A 2J9YA 4G1NA 3WX7A 3KWSA 3UGRA 4HIBA 3KVLA 1PV8A 4C6BA 2PGEA 1P0DA 2C1GA 1DJNA 3THDA 1UG6A 3JS3A 1QOXA 3L4UA 1XRFA 4LYQA 4GR1A 4IF2A 1EPXA 1Q7ZA 4J35A 4C7GA 3U3HA 1W5NA 2GVGA 3NA8A 3N17A 1AK5A 3ZT5A 1EA0A 5FMHA 2OMAA 3VABA 4M6UA 2YQUA 2WP5A 3P8IA 3ENLA 3PULA 1VCFA 4L6DA 4ZTXA 1W3NA 2AL2B 5FCZA 4Q32A 3A4JA 5KEZA 2ZVRA 4X22A 3WNLA 4O53A 2J62A 4E8DA 3KE0A 2VC5A 4O15A 5JVLA 1K9DA 1S3TC 5CSUA 3TC3A 3ORWA 4MPQA 4C7FA 1DTNA 1E6ZA 1XGZA 2CNCA 1L0PA 3BH4A 4HCHA 1FWEC 3WBAA 2PWDA 5HMDA 2V5KA 2RKXA 1RBLA 4TU1A 1GYLA 2OSYA 3TTYA 1QWGA 2E8ZA 3TTEA 3NO3A 4Y7EA 2P0OA 3DHFA 3G8EA 4O4WA 3QV6A 3D9XA 4AIBA 3LCIA 4Y6GA 4CN1A 2CLOA 1X2HA 3SN0A 1VFOA 4LFYA 3O16A 3K4AA 5HNTA 1MQPA 4YWIA 1A5OC 4JQAA 3LV5A 3VO0A 3W28A 4HPNA 3EEZA 1R9XA 4XAYA 1X8FA 5ECVA 2OTDA 2XIOA 2WVUA 1TVPA 1CNVA 1AMYA 1O5RA 1QXLA 1VPXA 1KGXA 3OLDA 3GTNA 2ZX5A 4PFMA 1AA1B 2WOVA 3NQVA 2DU2A 1N61C 4P7QA 3VPLA 5CZKA 5C71A 5LA1A 1FEAA 1EA9C 5G1YA 4MNMA 4MJZA 4ZQMA 4L4OA 1QNVA 3LSBA 3QGAC 4AW7A 4B5WA 3U5YA 4GXPA 3LHYA 2EQ8A 3WG6A 2YL6A 3LZ5A 3WF1A 3LCLA 4IQJA 4DBDA 3GC4A 1VFLA 4IMCA 2GJRA 3UVAA 5K9CA 3L21A 2HISA 1TWWA 4HNLA 2X8GA 4YCOA 3R7MA 2NV1A 4C6LA 3B8DA 3L68A 2GL5A 2FJUB 1TYGA 3OEXA 3R0KA 2D73A 3FG2P 3ZVHA 1X8CA 3NAVA 4FALA 4KEUA 1E1EA 1EQPA 3GU1A 1TPC1 4OUEA 3PTDA 1XC4A 4JD4A 1O94A 5HMSA 3M07A 3WK0A 2Z2BA 3HZ3A 2PC4A 5I3JA 1SZEA 4DXXA 4FA3A 1I60A 3G5EA 4K7ZA 2I7GA 5L9FA 2AKMA 4K1GA 4URIA 5H8UA 4NNBA 1B0IA 1OABA 1WDSA 3UA4A 1H0IA 1WOBA 4Q4MA 1RD5A 4FIQA 2I57A 2HSAA 2ZUTA 5DANA 3S1VA 2R24A 5DBTA 2ZOXA 2WAGA 2V82A 4I6VA 1JNDA 4LNYA 4DUWA 1UH4A 3BCJA 1DJZA 1UCWA 3VDGA 1F6PA 3KHJA 3UGVA 2W63A 4JYEA 4H6KA 3B0YA 5A2BA 4C5YA 1ME9A 3P8JA 1XLBA 5J8LA 1Z6KA 4PC8A 1DQWA 3HGRA 3BLFA 4Q4RA 2VGBA 4IG2B 2OVLA 2CWXA 4L9XA 3Q45A 1QASA 2XM1A 1G5AA 4UR9A 3RPMA 4A21A 8XIMA 2GJLA 3CASA 3PBWA 1NIUA 1AQHA 4B2DA 4GKLA 4EXBA 1S2TA 3WD1A 3UPMA 4GD0A 3NQCA 4JFSA 3EWDA 1RK5A 3C8NA 3VKDA 1GVRA 3THQA 4TTUA 2DT0A 1KRMA 1KV8A 1XYFA 1NEYA 1ME8A 1VD6A 2P3ZA 4KERA 3BV4A 4FAMA 1NOWA 1TCMA 3WH6A 5C7HA 1NHPA 2QJJA 1OHLA 2HVNA 1V7YA 4X63A 1G94A 4H7VA 1XIBA 1G67A 1OBAA 3WNOA 2XFFA 1KM4A 3MU7A 3NL5A 5HPOA 1A5UA 1CTNA 4Y9OA 1K03A 4NZJA 3QFAA 1E5JA 1ZBWA 3N9RA 1DNCA 4NI8A 3AYTA 1B5TA 5DO8A 1OK6A 1I2OA 2XGIA 3UR2A 3BMXA 3QC3A 3VNJA 4LWWA 3G77A 3NL2A 1JCJA 2VENA 3E74A 5HINA 5BXTA 1K9EA 2GUUA 3OBEA 4GC4A 1NM9A 1SR9A 1SFTA 4GABA 4ADWA 5M5DA 3CUIA 4YTSA 3TWAA 1B4KA 1VAHA 3H55A 4GINA 5G5GB 1Z41A 4F0LA 5M1TA 1GERA 1IZJA 3GB6A 3GH4A 3TR2A 3A7AA 1G01A 3TZFA 3CT2A 1RCOB 2YXGA 3GXIA 1NSJA 1W9DM 4Q8TA 3PWAA 2XH7A 4DUVA 1BWVA 2V3FA 3BQ6A 3C2FA 3BO9A 3BK0A 2X09A 4TX8A 5EMYA 3BZGA 2OCZA 4N6FA 4NJGA 1MWOA 2R1KA 1JAKA 1E6NA 3GTHA 4KWVA 2PDWA 3GVQA 2DSWA 4JTIA 3QZAA 3D6NA 3FYYA 4FXFA 4KESA 1J0ZA 4OBTA 1VP5A 2PI6A 1KD0A 2R14A 4QLLA 1TMQA 1RXOB 1K9TA 4GFIA 4HPJA 4ACZA 2QV4A 1XGDA 3TN5A 4NXSA 4QR6A 3EOUA 3NQDA 1GW1A 5JBEA 1JGMA 1GZ1A 1GONA 1ODZA 2NX1A 2PGRA 1UP0A 3CYJA 1EPVA 2C15A 4L4MA 1Q6QA 1VBJA 3CU2A 3DFPA 4EPKA 1XHGA 2Y85A 4A3QA 2ZUNA 3SEPA 4APNA 5A69A 1ZJAA 4PUWA 2BY3A 4X3ZA 4ZO6A 1L9WA 1REQB 3LQGA 3TW9A 1RD6A 1FCQA 5IDIA 3W72A 7TIMA 3RHGA 3OYXA 1TTJA 1NH6A 3ABXA 4PR4A 4XD3A 4HK6A 4ZCWA 4HGXA 1LWHA 1VFTA 3FYPA 1UQZA 3B05A 1WKFA 1MW0A 3E02A 3F4VA 2XSXA 1EJVC 1BG4A 2XFWA 3KTSA 3AI0A 3NYZA 5K7JA 1XFCA 4MPKA 3GZAA 1BHGA 3S1XA 2P8CA 3B03A 4C6IA 5A95A 1SB3B 5DELA 3O05A 5I3HA 1QDSA 3N2TA 3UWZA 5JXQA 1SVDA 5I79A 3W23A 3GX9A 4MB4A 3G1AA 4JTRA 4EKJA 2GJXB 1GJUA 3PJXA 3II4A 1UR2A 3T09A 5XIAA 3U2OA 4YU1A 4CCDA 4R7JA 2J7FA 4JL2A 3OZYA 5FL1A 3RX3A 2D23A 3JU2A 3MI3A 2GJNA 2F6XA 1QI2A 4LS1A 2OQYA 3W7IA 3UJRA 2UWFA 1RA0A 3F4NA 2DZTA 3HW2A 3OODA 2WMIA 4F9DA 1HVXA 4A22A 1O7AA 5FS7A 3ZO9A 2PP0A 4XV0A 3EZ4A 4LAKA 1QI4A 5ENLA 2VXNA 2WKJA 2ALRA 1R85A 3W83A 4MB5A 3L7RA 2MUCA 3USZA 3HU7A 5D38A 4FLRA 4H1ZA 2ZQ0A 3SCVA 1SMAA 2QCDB 4HP5A 3LPFA 4GNKB 1MQRA 2NQLA 2VVSA 5HUOA 3W82A 4GI4A 3GE7A 5FJOA 2TSYA 2C91A 3OP2A 4BFAA 1TE6A 2E5AA 2XJ7A 3M5ZA 5EU9A 3VOCA 4AFYA 2FZ8A 3QQ1A 3WQGA 4WY0B 1OYAA 2X1TA 4AG0A 4O10A 3UYIA 3S1UA 4H9TA 1GOQA 4W7UA 1EP1A 3BJFA 3LG3A 3GG0A 1A50A 4JFTA 2R6OA 3RRAA 1NDVA 2WOIA 4ERAA 4F0KA 3AXIA 3IIPA 5JMUA 1SZRA 4S23A 4IL0A 1B57A 1UWIA 5DMMA 3WL0A 2WHKA 2Q09A 2OYMA 3KTCA 3LU2A 5EA9A 4JL1A 1HX0A 2OWCA 1S2UA 1D3CA 4HTYA 2VFIA 1JYVA 4PTVA 2VX5A 4X60A 2H6RA 3GKFA 1R5YA 5LXXA 2H8XA 3A9BA 2VDGA 4XK2A 1MYRA 1WO2A 3ITVA 3GY1A 1XL9A 3W7HA 2CIPA 1E15A 2GUBA 1BVZA 3LX9A 1W0MA 1BWCA 1HKVA 2V30A 3A47A 5EBKA 2ONEA 4US5D 3W7LA 1TMHA 3TQ0A 1F7BA 4GXMA 1NELA 3UR7A 1JZ5A 3NZQA 1IWPA 3PUEA 2OG9A 4DHGA 3DKJA 3TJLA 1EGVA 1M53A 2NT0A 4OBSA 4WHBA 4U5KA 3AIWA 2X2GA 4GGBA 1BKHA 1TA3B 3N2MA 3P62A 3I7SA 4IL2A 2Y6ZA 3QMSA 2OZ3A 5HXMA 1Q8AA 4TVCA 1GESA 1NHRA 1W56A 1W37A 1U30A 2WNNA 4V33A 4DM2A 3VOHA 2WHJA 7ODCA 3Q37A 3RX4A 1KTBA 2VEGA 3TTQA 3IACA 2BHZA 4S3GA 1H2JA 4O13A 3PVFA 3T2OA 5FEWA 3AROA 5FJUA 5EBAA 3PBMA 1ZBVA 3K30A 2YCLB 3HJEA 3CHCA 4GYPA 2PDFA 3FN9A 3H4WA 4JDYA 4NASA 1ISYA 1QHPA 3R1ZA 4TVUA 1Q45A 4KRUA 1QK0A 3QFBA 1R7OA 3K4DA 5U1OA 1TJ2A 1Q6FA 3BLIA 1A4LA 5AHFA 3VVGA 2QUUA 2FYMA 1F61A 4JCLA 3B0XA 1M41A 3SZ8A 3B0VC 3CGDA 1IIGA 3W1AA 1DPMA 4HBKA 1GYMA 3PB2A 3O6CA 3QZEA 5GNYA 3QMRA 5G5HB 3IAPA 4MWAA 4D8AA 5A94A 5LIUX 5AC5A 4V15A 3CV2A 1KNWA 2DT1A 3TTSA 1M3UA 2HDJA 4LUYA 3W27A 4WEVX 4XB3A 3W1TA 2ZBTA 3QR0A 1JDAA 2QDDA 3UWVA 4KCVA 5AYBA 3H53A 3LGDA 3U48A 2HE8A 1J9YA 2ZDSA 2WK2A 2XG9A 3LOTA 4FLSA 3THCA 1IHIA 1KWGA 1XBVA 2I5QA 4JFVA 2IPFA 4CCZA 2P8BA 1N2VA 3R12A 1YNPA 1C9DA 2NW0A 3LRKA 3ARZA 3HV9A 4Z2GA 4FK9A 1CECA 1VENA 3W84A 1WPCA 1JL8A 4LB3A 5H8MA 3UZJA 2IKHA 3OVPA 6REQA 5H2ZA 2XN2A 4MVAA 4QE4A 1TTQA 4MUPA 4D71A 4QS5A 4EVZA 3SECA 4EM3A 1A5KC 3NTYA 3C8FA 2CHNA 2PTXA 3M47A 2EPKX 2C0AA 4UTMA 4FZIA 8TIMA 4F2TA 1Q7QA 4JDBA 4Y9AA 3RLGA 1ISWA 1SJCA 2ZZBA 1EUNA 1BQGA 5E9XA 2FDMA 3SUWA 2Z2UA 3CAVA 2QCMA 3WDPP 3N2CA 3LLFA 4ML9A 3LHUA 1MW2A 5D03A 1XCXA 3P0XA 1OT2A 3HV8A 1PJ9A 3TLLA 3O3RA 1ZY9A 4MY1A 4A3RA 4B9YA 1ZMCA 1I0DA 1TPH1 2VURA 4Y90A 3S5SA 4I7WA 5TF0A 3GVWA 1ICQA 4O19A 3T40A 1D8WA 4X2RA 2J8GA 1FWSA 3K8MA 2VZSA 4W9TA 3GTFA 1DIKA 4UWMA 4DZIA 4J27A 1KBKA 1FTXA 4JKKA 3G1XA 4BWLC 1IEQA 1VJSA 3OHMB 4PTNA 1ZB5A 1IGWA 3FJ4A 4UNKA 2TPRA 5G1MA 3SFKA 4O17A 3UJEA 4JN7A 5CC5A 3WQPA 2YYUA 4AEOA 3WFZA 2YZRA 1EKOA 2G37A 1HL8A 2H9AB 4AYSA 5A6SA 4NYYA 4JGDA 2V6AA 4I90A 4MHBA 3WLHA 4RL3A 3C2RA 1KO0A 2FZ9A 1W5MA 4CKQA 1UZHA 4HMEA 3ETRB 1B31A 3EA3A 4G6CA 1JRCA 2H3BA 1KFEA 4H9VA 2C1IA 1J0HA 3MP3A 3NUKA 5D2YA 1R2TA 1CGXA 3PWGA 3SIZA 3M1ZA 1HKMA 1UUOA 3ITGA 1CENA 1V8EA 2FZBA 3CZ8A 3EYPA 5T9BG 1IWAA 1H1NA 2WNWA 3CUXA 5LKYA 2EQ9A 3ZLFA 4Q8UA 1FH8A 3Q2DA 4H2CA 1QNRA 3NL6A 3CPGA 1IZKA 5FJJA 1QW7A 3ARRA 1W91A 4FPSA 3AJXA 4X9SA 3AUJA 3O06A 3MP5A 4XAFA 1D2KA 3URBA 2JQXA 1PYMA 2QIIA 2EPLX 4LAOA 4NL1A 4DLMA 3L65A 4PYSA 4B4HA 3G1YA 3FSTA 4WR3A 1C8QA 3EDFA 3IWPA 4L80A 3UFYA 2ZXQA 4HZMA 2PWUA 4ZQCA 3DESA 4MF4A 1G4EA 1LQ0A 3GTXA 1UWUA 1P6CA 2PRHA 3KCLA 1AD4A 4NSBA 4C1NB 5BCAA 1UOKA 3O1NA 3RFAA 1OC7A 2QJIA 4QFUA 3B97A 3AUOA 4GBDA 3EOOA 1RR2A 1I9CB 3KLJA 4X61A 4AXKA 4F79A 1N8IA 3KX6A 3BLPX 7A3HA 5A3HA 2VC9A 5IBXC 2GGHA 3SQLA 3NO5A 3C4UA 5HOSA 3DENA 3PPHA 1WYIA 1EDGA 2PA6A 3PZNA 7PTDA 1R46A 2DY3A 1Y65A 3NPWA 4U2ZA 4H00A 4IHCA 1MO9A 2BBFA 3EKLA 1VYSX 2OSWA 4GUIA 5M17A 1VYPX 2HNHA 2O55A 2DSKA 5REQA 3VM5A 3WQ6A 3QYSA 1JG9A 3KBJA 1QPQA 3N9KA 4XO7A 3LCWA 4IXXA 4UFKA 2PBOA 3N34A 1KFLA 1NPXA 3RJYA 3FA5A 2JGQA 1UJPA 4RW5A 4L5ZA 5I3GA 1K3UA 1YDVA 3MANA 1KBBA 4KCWA 4C6MA 4BA0A 1FWAC 1GVIA 5C7VA 2H3DA 1LWJA 5ABFB 5K4XA 3AZSA 1WAWA 2DUXA 3WNPA 1ADOA 1H50A 2XIIA 2QS8A 5C2CA 4DZ5A 2CCRA 1ONXA 3S5ZA 1J0KA 4MB1A 4GFSA 3TW7A 1XR2A 1R3YA 3AMCA 3B4UA 4Z1BA 3L67A 2WM1A 4MYXA 2YOCA 5EY5A 3RAOA 3W29A 4HTBA 5IFTA 3WH7A 1UKQA 3TW6A 1OYCA 2HVMA 1LG2A 2DVXA 4PMUA 4Z0JA 2VYOA 3WUFA 5IXEA 4E3TA 4LUIA 3M43A 4E3VA 2ZUMA 4WF7A 3Q58A 3RG6A 3W1PA 1Q7MA 1EWEA 3VMPA 2YVGA 2J6XA 2WC7A 4DNHA 2C1HA 2X7WA 3ZVHB 5A8NA 3AXHA 1JEHA 3R4IA 4IH3A 1UZ4A 2FFCA 1N8FA 1S2AA 4JTGA 1ONFA 1KBIA 2QPXA 1SQ7A 5A5WA 2WKGA 3AIUA 2BXVA 1GPFA 1RQEA 3MKCA 1LYXA 1EBDA 3W25A 3F4DA 3SCRA 2IKIA 3W75A 1NFPA 3QBUA 2VWSA 4GQQA 1P0KA 4H4QA 2NV2A 1H6VA 3MSRA 4NZ3A 5DMNA 5T8GA 3R8HA 2J77A 4R9XA 4Y9NA 5CGTA 3SB0A 4OZOA 2E5BA 1N5WC 2A6NA 1EC7A 2C8NA 5HDRA 2V5JA 3WNMA 1UASA 2DIJA 4XZLX 2FMOA 1JGIA 2E8YA 1M5WA 5HR6A 3OZOA 1AL8A 2J24A 3RRXA 3W7MA 4Z1DA 1IF2A 1GGOA 2Q01A 1S1RA 1OZMA 4JHZA 1F4HA 1R7AA 1UZ1A 5SWUA 4NNAA 5F4XA 4UTHA 3TH6A 1G6CA 4HHPA 2YZ5A 2L5HA 3MMUA 2X1RA 3GRIA 2ZXAA 3MBFA 4U3CA 4AZHA 2OU4A 3WSUA 5CBBA 1TJ1A 4ATDA 4QROA 5C9UA 4IT1A 1VEOA 1AUSL 1A5CA 5HWMA 3MJMA 2VO5A 1XG4A 3KOFA 5IOBA 5FIPA 2SFPA 3S6DA 4IIDA 1E0XA 1GRAA 1OQFA 2BOFX 4WUIA 2FTWA 3QH2A 4JTTA 1VEMA 4ZMGA 3IAQA 3W1RA 5MHBA 2WZIA 4RUBA 4OGZA 2OZTA 4MNJA 2ZZ2A 4EF9A 5C9XA 2F8QA 1DTUA 2HZGA 2Y8UA 4KFOA 4EXQA 1J0YA 3CEPA 1FRBA 3BICA 4KETA 3U8GA 3GD4A 1PUDA 4Q33A 5A6JA 3BLDA 4FXJA 5PTDA 1IYXA 1Z9AA 3CWNA 3GYCA 4BF5A 2AL1A 1BYBA 4HMCA 2CXEA 1UB3A 3U9IA 3A22A 1VQTA 1DJHA 2GSEA 4UR8A 4F8XA 2VHLA 4NJIA 1XUUA 2YA0A 1FP8A 4K7VA 3VIIA 2TMDA 1VBUA 5AKQA 2QHAA 3LA4A 4GXWA 2B7NA 5I02A 3HGOA 4G7FA 1EJ7L 1AMKA 3P5ZA 4H01A 1E51A 3WLKX 1JXKA 4B9ZA 3ECQA 3QM3A 2OB3A 1JDCA 4BI6A 4GNVA 1Q2RA 3UZ5A 3ZT7A 3ZM8A 2OJPA 2G5WA 4FS9A 1H7XA 5CC3A 1NF0A 5KITA 4AF0B 4FLOA 3GDTA 4QCEA 3ARYA 2UY2A 4C6QA 4LU0A 1JQVA 4F0MA 1SFSA 3GG7A 4XSMA 3A4AA 3I3BA 1WYGA 1K8ZA 3CL7A 3ELFA 3LERA 4GJ1A 3EF6A 3ARXA 1FY6A 4RV8A 1UD4A 3QY7A 1YE6A 4LW7A 3HG5A 1A5AA 2VZTA 2V5CA 2ISSA 5CLTA 1JRPA 1VCGA 4O8AA 1XYZA 3VIOA 5HJYA 4RNHA 3F5KA 3NVDA 3QY8A 4M80A 1PWMA 3V0TA 1IZCA 1TPFA 5F2IA 4HCLA 3PM6A 2QCGA 1RJRA 3A3WA 4O1BA 2FQIA 2J7BA 1LLWA 3SQPA 1XYBA 2JKPA 5TQLA 1GUVA 2DFAA 3H8AA 3KRUA 2X0HA 4NYUA 1V6UA 1E9LA 2OELA 1GVFA 3IRSA 3LCXA 3F1QA 1GRBA 4OKDA 3WL1A 4HNUA 4M3PA 4J3ZA 1VF8A 3N18A 1JNEA 5CSSA 3BWWA 5TBOA 5H91A 2VR4A 1QOQA 1TRDA 2W5FA 3LI1A 3EKZA 1E6QM 3CIVA 1AW2A 3OG3A 1TO3A 1L6FA 4RDZA 1YNQA 5B7YA 2O7QA 1D3HA 1HKKA 4UCFA 2XVPA 5E93A 4C5ZA 1R3VA 4Z08A 3UA3A 3K4WA 5EMUA 1VHCA 2A3AA 4JPGA 1U5VA 1JIBA 2WWDA 4BY3A 3T0BA 3QSRA 2A85A 2ZZ5A 3PUOA 3URNA 2FTPA 3VGEA 2CZDA 4J7RA 4KWOA 1FDZA 4FX7A 2P76A 5IHRA 4JTAA 4GI9A 3POCA 4EMIA 2Z7GA 4LIIA 4ICCX 5D2WA 3TYEA 4JIIX 1H7RA 4ERIA 4ZOEA 4ZSUA 1M01A 1QI5A 3CH0A 4AZCA 2YB1A 2OQLA 5K9DA 2E6DA 1XLGA 3C5QA 4IMGA 2QJNA 3PBGA 1ECQA 2V3EA 2QMJA 3ARUA 1KKOA 3RDKA 4LAUA 3R8RA 1EZWA 3H2NA 1CT5A 3VD3A 3G1SA 4IIFA 4RPQA 3WF3A 4YTUA 1GZJA 3SCWA 2EXOA 1HJQA 4LBRA 1R8LA 5AY7A 1THFD 2EG7A 5CPNA 4B4FA 3PZMA 4A3HA 4B92A 3AHVA 4K7YA 2WMIB 1HF6A 4Z2IA 3BG3A 4BHYA 3DEQA 3F5LA 3PZIA 3O7UA 3Q65A 1MNSA 2H90A 2EQDA 1P43A 3ZOAA 2C19A 1BLIA 1XSIA 4IPLA 2WSYA 3A3XA 1S7MA 4MNLA 2RGLA 4DF2A 1DQUA 2FPYA 3ARTA 1UP3A 1B90A 1V3JA 1K4HA 2JE8A 2FMNA 4TMBA 1GSNA 2HNEA 4EWND 4UTWC 4QG9A 2B31A 2CERA 2Q02A 4J28A 4PN2A 6PTDA 2A2IA 3WQEA 2DIEA 2J7DA 4JQ1A 3L4ZA 1CGUA 2P50A 2AQWA 3WD4A 4UR7A 3SM0A 1LVLA 1ZMDA 2YJQA 3UVIA 3WLLA 4IJCA 3WDJA 4LF2A 3K5XA 3H4GA 1IV8A 3B0PA 3W02A 3WJSA 4JY8A 1SM9A 3FDKA 1W2PA 1Y8BA 3KBWA 3R0UA 1FH7A 1KR1A 4G7EA 1HXJA 1VFMA 2BWGA 4LVAA 3VNLA 1DIEA 4GO9A 1B3XA 1R9YA 4K37A 3VILA 3BW2A 1NP0A 1T96A 1BGGA 4G2DA 2CEQA 2E9MA 5T9CE 4ZXLA 2B7OA 3XISA 2IS7A 4WGHA 1LDCA 2QEZA 2VR5A 3I65A 5AFDA 3SCTA 1VBGA 1W9BM 1XKJA 3RM4A 1YIXA 2BGNE 1ITQA 1DJWA 1H51A 2ZUVA 3W7DA 3SRHA 3QSTA 3UWYA 3LHWA 2ZWZA 4Z2LA 3OHIA 3GXPA 4LS2A 3H21A 4BQ2A 4KW2A 8CGTA 1DJYA 2I5GA 1ONRA 4AC1X 1T7LA 2GVYA 1XYMA 4DI8A 4NT0A 2NQ5A 3R5EA 2GDUA 1U2YA 2YL9A 3NURA 3JRKA 4HYWA 5D37A 3WIJA 2EEXA 2BNJA 3FKRA 4P5UA 4ZOCA 2BSLA 1W6TA 1VC4A 5D4YA 2EQ6A 1KTCA 4WCJA 4GBUA 5E0CA 2OKTA 4H8HA 2RHGA 3S3GA 2Y24A 3EOEA 2X1UA 3CHFA 4C6EA 3WQCA 3GIYA 3M5XA 4D6EA 4FF7A 1HJUA 2FHBA 2DZSA 1BFNA 3MWAA 1ZBCA 4EPBC 5A6MA 4FI4A 3V35A 1TUXA 1SSDA 1OY0A 3UG3A 3HPZA 2AGKA 3LPOA 2PODA 4NZ4A 2W27A 2XHYA 1KR0A 1GEUA 4EMWA 1PIFA 3VIHA 3SY8A 1XV8A 3HF3A 1WX0A 3P93A 2V2HA 1PTDA 4A6GA 3NR0A 3BG9A 4I7VA 3LCFA 3BAIA 1EJSC 1QPOA 1ECEA 3FA4A 3W2UA 3WQOA 1NWUA 4RW3A 1VYRA 2YDRA 3QW3A 1XLAA 4LTSA 3NQ8A 1FWCC 4Y96A 3GG8A 1P48A 4NZ5A 2CLEA 1GKRA 4XO6A 3S2JA 4RX0A 2A1YA 4YVPA 3EWZA 1ZPTA 4JTUA 1J0IA 2YFNA 4IGHA 3A6OA 5F2MA 3O63A 5LXEA 1GK8A 1ZGDA 1MEIA 4NP7A 3R13A 4FIRA 1UW9A 3AIBA 3W7JA 1XLJA 4DWSA 1K1DA 2Z29A 3L12A 4TQTA 1D8CA 3OGRA 4K39A 1B54A 4P7OA 4ZR8A 3QC0A 1YTDA 4L65A 4QHRA 2NSOA 5FF2A 4RDYA 2ACSA 3SBFA 2AQOA 1WA3A 4ZTYA 1NWTA 3HQ1A 5BRQA 1FEBA 1YEYA 1LG1A 5E70A 2P53A 3VKKA 3W71A 1Z3NA 3NQBA 1GEQA 4PCFA 4DJFC 4HVXA 5BXRA 3E38A 2GUYA 3L0GA 3T0TA 4CLMA 1PKMA 1W1A1 3A21A 4PTXA 4F40A 3W4RA 2E1DA 4AY7A 2J74A 3ARWA 3AS3A 1EC9A 3G0XA 3CK5A 1TPDA 4LV9A 2Z0IA 1GG0A 2PDJA 5A1AA 3DXIA 1Z42A 3CGBA 5D2XA 4XZWA 4CCCA 3SR6B 3RPTA 4Y9MA 3N2BA 1QNSA 3TP4A 4OBRA 5JCLA 4Z0SA 3GU9A 1R86A 1SO6A 2BHUA 4L9YA 3VOFA 1E3ZA 3VNMA 4ZEPA 2ZRXA 4N4PA 9RUBA 3W7OA 3WMCA 1I8JA 3KDOA 4MY9A 3WUEA 4JEQA 2ZE0A 3HB9A 4WXZA 5EMKA 3NRZB 2QCFA 4AY8A 4M1BA 4XZBA 3SN1A 1FCUA 1QPNA 1QNQA 4ZB5A 4JN6A 5D9NA 1JZ8A 4I8YA 3MT1A 1HGYA 3OC4A 1X1NA 3E2VA 4FNSA 2XIQA 4E8CA 2V6OA 2V68A 2VGFA 4AZ6A 4PL2A 4OJYA 5JBDA 4GQGA 1F5ZA 3S5OA 3ZQ9A 2OX4A 3MO4A 4AZIA 1WKDA 2CLPA 1V0NA 3ABSA 4DO4A 3WLRA 2BCPA 4ZQOA 5IFPA 1BYAA 1EF3A 3D3AA 2XVKA 4IM4A 1CGVA 5IRPA 1H5VA 4QQ3A 1PHWA 1O4UA 2IKGA 1VKFA 4L1GA 1IT0A 2IMRA 2D1ZA 1F74A 3BCDA 1JRBA 1MDLA 4H9UA 1K9FA 2BLEA 1KB3A 1W5QA 1M6IA 2UY3A 3V5FA 1MO0A 2PD9A 5D9PA 3WDQA 4H4UA 1XPYA 4PCTA 2CXGA 5LNSA 4WJ8A 1U22A 3BGJA 2XUCA 4EWJA 4TVYA 1JFXA 3MJYA 3LNPA 2WO5A 5I06A 2VEIA 5D04C 5L6UA 4Q4OA 2XFRA 5AVHA 3DFTA 4IP7A 4DM1A 3B4YA 1MW3A 1OFPA 3MS8A 4H7CA 5I7GA 5FF4A 3M0HA 4GG9A 4H9MA 4I5UA 4IX2A 1GORA 1HW6A 4TV5A 4MJ2A 2CU0A 4H4VA 3W6LA 2W6RA 4GX9A 2QAPA 5ABEA 1HFBA 3DJGX 3HPXA 2ZZCA 4M6PA 4PCNA 1ZBKA 3REQA 3STGA 3G1DA 2PAJA 5AYIA 2J13A 3MPGA 3II1A 4IPPA 1SO3A 2G41A 3IUIA 4P8XA 4HA1A 3OLEA 3NM1A 3OA3A 4LYKA 1W3TA 2XTKA 4ADUA 3S9IA 3QW4B 3IIZA 1R87A 4HCDA 1DWGM 4Q8PA 4MAZA 4J3TA 2R9RA 2ZXDA 3W2LA 4XD5A 2DORA 4BCEA 2Z7KA 4G8TA 1ENUA 3IJ7A 2NUWA 3W70A 3B40A 3DDMA 1SW7A 3EWWA 2Z6IA 1BPLB 4MUZA 4IGSA 4WVXA 3NS1B 1B3VA 1P0EA 1BTCA 4YCPA 1Z7AA 3MCNA 5AC6A 1SU5A 4EAYA 5REQB 1BSIA 4GRTA 5E1QA 3DG7A 2OZ0A 2OXNA 2WW5A 4ML4A 1ALDA 1Y7VA 4NILA 2FDSA 1JAEA 4N9DA 1GHRA 6XIAA 3W0KA 1KWKA 1MMFA 1PZ2A 3OLGA 4MFDA 5DFAA 3OO2A 4QNEA 1GKPA 1HUVA 4H4SA 3KXQA 4QJ5B 2VCCA 2IW0A 4TVWA 1UBSA 2DZAA 3SY5A 3W2KA 3SCUA 5K3VA 1MUMA 3EX4A 4TO8A 3LXBA 4KMQA 5M2FX 2XIMA 1RPKA 4BURA 3KHDA 3ITCA 5C5YA 5EGRA 5HANA 4HPGA 4MYAA 3TYAA 5GJNA 1AZ2A 4KCUA 2WOWA 4UFJA 2GDQA 4ZGYA 3CUFA 4ZOHB 4PULA 4Y9PA 4I6KA 1DJGA 5I0DA 1GREA 2ISVA 3LPPA 3W37A 4BI7A 1E56A 2OGYA 1GVQA 1MFUA 3UWQA 3VD4A 4P7NA 3GW3A 2PDKA 3USBA 3QF0A 3GAYA 4R85A 4ADTA 3L4WA 5A6LA 3TKFA 3C3NA 4GI6A 3WMBA 4RZ4A 1S2WA 2XH4A 1UYQA 1EB3A 3BVJA 1XLHA 3HFYA 4ATWA 1RCXB 1QNOA 2A7RA 2D3LA 5HATA 4C65A 4LCRA 4F0SA 2YAUA 1DXFA 3NXFA 4H4TA 4CNSA 5F2LA 4NEVA 1XYAA 1FDYA 4IPNB 3V1PA 3WQVA 4DYKA 3N2OA 3Q67A 4XKYA 1F3XA 4TXEA 3NXLA 3CWHA 4WSHA 5LHFA 2WWCA 1KCKA 1J5TA 4MAVA 3OVQA 4HJWA 3IJQA 1O68A 4U4MA 1GOIA 1DKWA 1PZ0A 1MXDA 3MWCA 3EPMA 4GIEA 2P10A 5AZ0A 4IPIA 4LQ1A 4NEWA 2Q71A 4RLIA 3FVMA 1I0BA 3DERA 2VKZG 3IGHX 5GPRA 3V7PA 2CFFA 2YA1A 1PWLA 4L6OA 2NQ9A 1QW9A 1ODUA 3MQTA 3S2LA 3VD5A 1V02A 4N7QA 2X05A 1UC4A 3BDKA 4CU7A 3MYPA 3WENA 3WH8A 1S5NA 5E09A 3KVJA 2BC0A 3M5YA 3A5FA 3VKBA 1HGWA 2E6AA 2XVGA 5A6KA 5C2XA 1F6YA 5D32A 1QPRA 3L2IA 4H83A 4JQ9A 5CGQA 5DN1A 3DFQA 3NFUA 5BXSA 4GCXA 2VQTA 4MKNA 4AWUA 3O8AA 4S3KA 4AX6A 4KGJA 1JZ3A 1SO4A 2Z25A 4IFOA 1LL7A 2EG8A 3MSGA 3QR1A 3G8RA 3AYVA 5HK4A 1EHAA 5EFFA 1JF5A 3WFAA 3U5UA 3NG3A 5CG7A 1EXBA 4GJJA 3SUTA 1BXNA 2V63A 1Q66A 4LVBA 4I9JA 3RO8A 5A6BD 5FS8A 2BGQA 2ZZ6A 4W7VA 4ZSTA 4AD4A 1E4IA 3DC8A 1UWTA 5I3KA 1QMLA 1FWNA 4UNLA 3JUGA 1PEZA 3ZZ1A 3NPUA 1ADDA 1V6XA 4EACA 3CUGA 4ASTA 3BLOA 4S3EA 3S47A 3UWEA 2OLAA 1BGAA 3STPA 3CL8A 1TV7A 3LY0A 4AD0A 1KGWA 3VOJA 5LNRA 3JVAA 3OGSA 1T8QA 3AO0A 1W8GA 1FXPA 4INFA 1NDAA 1ONEA 3FJNA 1LBMA 1I2PA 4H6RA 7REQA 1QR7A 4Q4QA 1DV7A 5FF7A 2VCBA 2IKJA 4F2BA 2PP1A 1B3ZA 4QX4A 1WQ5A 2WM0A 4IXHA 1NAL1 2YKKA 4DJEC 4AVFA 1UR8A 4XAZA 5JU6A 4JCMA 3NVTA 4WGXA 3KP1A 3UJFA 4NRSA 3TONA 1DXEA 2GVJA 1XLFA 2XGBA 2F61A 1CXEA 1Y5WA 3WK3A 1G4TA 3AIQA 3E0VA 4ZVJA 2Z28A 1EBHA 3ANYA 3PPGA 4UQCA 4NJKA 5A2AA 2O56A 2OWXA 1XLEA 5TD4A 1RSCA 3PUGA 1XH1A 2G3MA 5I00A 4UTTC 5I3IA 2VZVA 1FFVC 4FXRA 4QE1A 3L4YA 5IM51 5BMWA 3GNOA 4H9XA 4M52A 1POKA 4W84A 1MXGA 2A4AA 3GHRA 1PDZA 4JICA 2I17A 4M6VA 5EBUA 5DT7A 1M9HA 5LNWA 3B8UA 4NQ1A 3V5OA 1JCLA 1XQKA 4CNOA 3N4EA 3VXGA 3N14A 1AZ1A 4WRHA 5CPLA 1SZFA 3NQAA 1VLWA 1XC6A 3TCSA 1KBLA 4DF1A 3UU0A 4JOMA 1ME7A 1B9ZA 4PL1A 3C0QA 5HUPA 4HT3A 2BVWA 3N13A 2IXUA 4MJ4A 4J57A 2A79A 5D9MA 4UZSA 2HROA 2PGFA 3DCPA 1VDVA 5FAGA 5FOOA 3N9SA 2EO7A 4OT7A 3OZMA 3WBEA 5AOUA 1C90A 2E67A 4C6NA 3QPEA 3M7SA 5FJTA 1XCWA 2PU0A 1FCBA 1W32A 3LRMA 2BZNA 3EA1A 4XTDA 5KZMA 4AWSA 6XIMA 3WELA 2ZDRA 3WMSA 3IJ9A 2VQUA 2VELA 3E5BA 1OVDA 4NNCA 5AYYA 1O5KA 1FIQB 3IPWA 3T8LA 3S2CA 4F2UA 3H7RA 3WNKA 3VA8A 1RPXA 2TPSA 4AZCB 5LIWX 5HA7A 4GUHA 4HYRA 1C93A 3E0IA 5ER0A 3ES7A 1KM3A 2QF7A 2VR2A 3NM3A 4GKTA 4WD0A 2EKCA 1Q63A 3LLXA 2X1IA 4U31A 3MI2A 1Q6OA 3PUDA 3UW6A 4C60A 3S6TA 2VP8A 4FOUA 1PTAA 5DCDA 4FNRA 3U7VA 1J6OA 5C9RA 4LUSA 2UY4A 5FS6A 2PTZA 3W7GA 1G9HA 2ZX7A 4CN6A 4HSNA 3EWXA 3TROA 3SQSA 1V5XA 1OCQA 1PXGA 3NOYA 4QJ4B 2XINA 1FWBC 2PGWA 4FNUA 1B3WA 1E4LA 4U2YA 3A24A 3EPOA 4P7RA 2O0TA 3GXTA 1O95A 4IICA 3M5VA 4HKPA 1HL9A 4J9JA 2PDBA 1FECA 4ORIA 3MUZ1 4ZQPA 1XGEA 3VK5A 2G4JA 2ZRZA 1TTPA 4GY1A 4PUMA 3R94A 3L66A 1E6SM 3OVRA 1Q6CA 3BLKA 5A8QA 3LHZA 3U2EA 1EP2A 2FHCA 4HA0A 4RCXA 1IQ8A 1O5QA 1OX4A 1N60C 1BTMA 2XIJA 2BY2A 2QXWA 4PTDA 3W22A 2BC1A 3AM9A 2DZXA 3W81A 2NVAA 2D2GA 3T0CA 4GC3A 1KN0A 4A35A 4G7EB 4A2RA 1CGTA 4N9BA 4XWUA 3TYUA 2WJZA 5C9ZA 2Z26A 4XIAA 2A3EA 4AB4A 3CM4A 2FHFA 3GM8A 4MLRA 2NQJA 1EFZA 1VH7A 3HMCA 1LTDA 3JZUA 2W54A 2WPBA 4O0ZA 3N6JA 4Z2HA 4HJFA 3A5VA 2GK1A 4PH6A 2CZFA 5M03A 3KTXA 4LX4A 1AQMA 3F2CA 3P74A 5C70A 2W62A 1HN1A 5JRBA 3MSYA 4RNJA 5FEXA 4ZFCA 5HJXA 4WOZA 1Q85A 3VI2A 3VD7A 1GVEA 1NQKA 1UHVA 1YXCA 4AD1A 4U10A 2R1NA 2AQVA 3AFBA 2V3BA 1JYWA 2VJXA 1OFQA 4G5DA 4H8NA 4JQ2A 2W79A 3M0VA 2QF8A 1KRBC 1W1TA 4A8LA 3QLLA 3U57A 3ZLHA 4KIRA 1Q3NA 1KC7A 2RGMA 4HNNA 2QMKA 5CC6A 3P61A 3EX2A 4UMAA 4XD4A 1QFEA 1JPKA 2EQ7A 5J5DA 4YIWA 2VX7A 1HJVA 1UR1A 2O9OA 4M81A 4HZ6A 1LT8A 2GVEA 2ZTKA 3GNDA 3LBMA 3P82A 5BRBA 4H4YA 3SIMA 1LBLA 4PMOA 1OG6A 4GVFA 3FV9A 1KXTA 4U5IA 3VKAA 1TELA 4XAPA 1G7VA 3RN6A 4EM4A 3AXKA 3VDAA 4F3HA 3IJDA 3VZYA 3EPNA 2EJ1A 2HK0A 1M7OA 1E6RA 2OSXA 2RFGA 4ZL1A 3MVIA 2V5LA 3UG5A 5G5IA 1QHOA 3EDKA 1QOPA 5GJMA 3EDDA 3TQPA 4AIUA 3TMQA 4NZ1A 2OLSA 3S83A 4LVDA 3GO2A 4XG1A 4N2YA 4AWTA 2OYKA 3NDYA 3VYLA 5CCZA 2QDHA 2EKGA 3EMZA 2VEMA 3UEQA 2GR2A 1ML1A 3L4VA 1CI1A 3P84A 1BWLA 2P88A 3CQHA 2GGEA 4DNMA 5EYWA 4DUOA 3B06A 3S9YA 1QJWA 3F03K 5M3WA 2CPUA 2EG6A 3S0CA 2GGIA 4WKAA 3LLDA 3KWXA 1G0CA 1HG3A 3B9NA 4KT2A 2A21A 4LT9A 5CJNA 4M82A 4G1KA 5AN7A 1XSKA 3QOKA 3BAWA 4KH2A 4UIOA 1F07A 1GG1A 3CLWA 4K1WA 3DKLA 1W1B1 4DWSB 3CZEA 2W3RA 1X38A 3P60A 1MRQA 1WDWA 2I16A 1JDEA 3IJ8A 2HBVA 4PSPA 2D2JA 1ZSXA 4XTIA 3SQMA 1OCJA 5AHLA 1XWYA 2E5CA 2DGAA 3T4WA 2GR1A 4A3YA 5ABGA 4Y8FA 3FA3A 4NRRA 4DF0A 2RDXA 1VS1A 4WJEA 1P0NA 3TSBA 3WBWA 4DLFA 2IQDA 4MDOA 5FEZA 3IRDA 1F76A 1LM1A 3PY2A 4KEVA 1RM6B 5DRCA 1RP9A 4ZO7A 1V6VA 1A5NC 3IARA 3CMFA 1KXHA 5D2TA 1CPUA 1TQJA 1L6SA 4AYGA 1D3GA 3PZQA 5JQ9A 3C56A 1A53A 3LMZA 4DB7A 1V93A 3HN3A 2C14A 2E7FA 1UD3A 1I1XA 3PAOA 2WMGA 3FHAA 4XX6A 2E68A 3ANVA 1Q1WA 3ARQA 3WN6A 2X40A 1KV5A 2I1OA 1XHCA 2BOGX 4PB5A 2VDIA 4WDTA 2VUNA 2QKFA 3OLIA 3ICJA 2Z1VA 3FDGA 1KCZA 1LLZA 3RUBL 1TV4A 2E9BA 2RJHA 4HK7A 3W1XA 2ATSA 2G0WA 1RVGA 2CHRA 1GJWA 3N11A 4UTKA 1OD0A 2YW4A 3P81A 2WANA 4S3DA 1T5AA 3CHDA 3RK8A 1M03A 4U3AA 1GOOA 2BY0A 1C9WA 2NVCA 2OLHA 2OPJA 3W7EA 4K3ZA 3EXRA 4ORMA 1A0DA 1ZDLA 1J12A 4R53A 1M68A 4UXDA 2XVLA 1Q4NX 4ZO8A 2DZUA 2WQDA 4O28A 4I5RA 1BXCA 1JULA 3QVQA 3QQ0A 3BLEA 3NQ7A 5G2IA 3TK7A 1BG9A 2CW6A 4E4UA 1ZZMA 3OVGA 4DUXA 5FEPA 3D47A 2YLLA 3FGCA 3LRLA 2WJDA 4FEZA 1UPPA 2PWHA 3I6RA 3AXMA 2W92A 3KRZA 4NVTA 2QUVA 1HQTA 5FF0A 1NQ6A 4AHQA 3FSUA 4L61A 5BZAA 1V08A 4MZ1A 3QHMA 1IXPA 4GY0A 2BG5A 2D20A 1A80A 3CZGA 4PB3A 3O6YX 4ZFMA 3EMQA 3JR2A 5FI8A 3VINA 2EHHA 1XH0A 3OA5A 3WEMA 3DGRA 4HSHA 1OFOA 3F2DA 2OOFA 3E2SA 1XP3A 3W53A 2DW7A 2PLJA 3LXDA 3P67A 2NZLA 4I7UA 2GGJA 5CAKA 2X50A 1ZTVA 1J79A 5CBIA 1JI2A 1IEVA 3ITLA 1EP3A 4QEHA 3B0UX 4H3DA 3VDBA 2TRSA 2CBUA 4QEEA 1YE4A 4HHMA 4CUCA 4XZ9A 3GIPA 4O12A 2Y7EA 3KAOA 1VFFA 5KZ6A 2YX0A 1CLXA 1JROA 3ISIX 2DSZA 3BGGA 4R3UA 3V0SA 1EDQA 2ZA3A 3IGXA 5LIYX 3REQB 4FDCB 1A3XA 1CCWB 3UG8A 4HOXA 4GYFA 6A3HA 3GFXA 3PHAA 5DMYA 3OYZA 1RK6A 1LF1A 3C2YA 4QSHA 1DJXA 3BAXA 2C18A 2WMJA 3UZXA 4RXFA 2NLYA 2IQTA 4M19A 2XZ7A 4MKVA 4Q8OA 4YTQA 2G3IA 2DH2A 3T78A 6ENLA 3OG2A 2VOTA 4GUJA 2OZ8A 3T7VA 4DRSA 1SO5A 2WPCA 1OG0A 4M8UA 2F84A 3ABOA 1F05A 1US0A 3AHZA 3STCA 1ZAJA 1LOQA 2WZEA 4DWDA 4MWAE 4Q6JA 4D6DA 4ZB2A 4AZGA 1XLKA 1AJ0A 2ZZ0A 3GDMA 3SJNA 3DZ1A 1I2RA 1UP2A 3NQGA 4EANA 4CEUC 4E2VA 1FWFC 1POJA 1S5VA 2PWEA 3T6CA 3GZ3A 1MW1A 2O9RA 1ZUAX 5FACA 4K8DA 3L4XA 1V79A 3UD6A 3P14A 1XJBA 1SJBA 3TFCA 1H63A 3T8QA 2W4XA 4IG2A 4O0KA 3IVUA 3VC6A 4GLEA 3CIWA 3DK8A 2ZIDA 4D6GA 3KZPA 4RXGA 1AG1O 4M1RA 4WX2A 3OBAA 1TX2A 3LTSA 4FLQA 3GBEA 4KRZA 1GXFA 2W3SA 4GA8A 2DEPA 4REQB 2PB1A 2NXGA 4M29A 4D9PA 4BR1A 1QTWA 4WY0F 4UTJA 2A6LA 3CTLA 2J25A 4E38A 5I24A 1ZP4A 2DUZA 1N62C 1AFSA 1UWSA 3OQ8A 2IUZA 3AOFA 3NSMA 5KZEA 3IEBA 3IJ6A 5DXYA 3BZJA 1YLVA 2JIWA 3KDNA 2PTDA 1E0UA 2WQPA 4W5UA 1CGWA 3QFEA 1KM6A 4RR4A 4OV4A 1YKWA 1NWSA 1WNOA 1R0MA 5HNNA 4NXKA 4C6JA 2NSXA 1YPXA 3FEQA 3LTYA 5HULA 2IQ0A 4W87A 1LOSA 3M4HA 3RIKA 2D69A 4W8BA 4NIRA 3VCNA 1CZ1A 4TIMA 1D7FA 1DWIM 1UWQA 2VVNA 4GYPC 4IQLA 4LV4A 4IP4A 4GQ0A 1YBQA 3ATZA 3QOMA 1W3IA 2OGJA 5U4NA 3VGHA 5H6HA 4YXGA 1RHCA 1AJ2A 1P1XA 2P5NA 4XKYB 4PMDA 2F2KA 1NHSA 4MZYA 3DYPA 1TTIA 3MYOA 4GIAA 1ZALA 5B7ZA 1KQYA 4MWAC 2Z00A 3H26A 1JZ6A 1X6NA 1SMDA 2OT0A 3EWYA 4UQAA 1H11A 3OGVA 4HHLA 4WZHA 4KIEA 4E4FA 2X2YA 4O0QA 4QG8A 1KFKA 2NX3A 1DJQA 1EJXC 4UTLA 1H49A 4AX7A 3PWIA 1LUCA 3IVSA 2BVTA 4BQ3A 3VAVA 2WLZA 1EEPA 4H19A 4MZ8A 3LM7A 2OODA 3QEZA 3EB2A 1ICPA 4AU0A 1AD1A 2Y62A 2GWGA 4RV3A 3FY1A 2NVKX 1Z69A 2HPMA 4CNNA 4AWEA 1A0CA 1GWJA 1R38A 3DFOA 1HKIA 1DVJA 1EO7A 1R9ZA 4Q8WA 1KFJA 1UKPA 5D8ZA 3ZIZA 3BQ5A 5LA0A 1WCGA 4H7ZA 2X1SA 3ITYA 4QXIA 3W6MA 2PZNA 4GI8A 2V8ZA 3B8VA 3V36A 5JH1A 1E1CA 3GH5A 4DVOA 2ISFA 2PS2A 1SJDA 3I68A 4OU1A 2VEPA 4W8LA 1G4PA 1VIZA 3I4KA 3PJUA 4CGTA 5CSRA 1FH9A 4BV6A 1CWYA 2VRQA 5HBFA 3L0NA 2XH0A 4I5XA 4PRTA 4WJXA 3INPA 4QCFA 3KS5A 5I77A 1FFRA 4F0RA 3TTOA 4Y8EA 4E2DA 4CVUA 3NEVA 4GWEA 4H4ZA 4TX9A 4EE9A 4RPPA 4BKNA 4AMCA 1MI3A 2J4GA 2XN0A 1JZ7A 1LP6A 5CZJA 3TOPA 1SW0A 5AHNA 2J8FA 5BWFA 1HJSA 5DBUA 4AY1A 2HXUA 3WQ5A 2XYLA 1A49A 4PTWA 5KVIA 1XUZA 5CAHA 4WKFA 4FP1A 1UA7A 3GW0A 4M0XA 1VBRA 2J9XA 3UXDA 3RMEA 5HMFA 4UTIA 1NF7A 1DQXA 4IX0A 2AMXA 4J4KA 4HYVA 4NAEA 4NZCA 2OKOA 5F7UA 1X6UA 3UP8A 2G3JA 3ITXA 1XFBA 2Y7DA 3GDLA 1K77A 4X0NA 1M6JA 1V03A 4E5TA 4JHOA 1BWKA 4ATLA 2TODA 1YDOA 3FK4A 4JYFA 3DHPA 3C61A 1W1VA 3B9OA 1FQ0A 1G69A 3BOFA 1GRFA 3C2OA 5FSDC 3I7RA 1FUYA 1KRAC 3G1HA 1YDYA 3W7QA 3H7UA 3UCCA 5G4HC 2G50A 1FKXA 2ZX9A 1QBBA 1F6KA 2CZVA 3PBUA 4MIMA 2FIQA 3NQ6A 1U33A 3SO7A 4HU8A 2I14A 2IPGA 2CETA 4DO7A 2O9PA 3NSNA 3DG3A 4LBUA 2WZMA 5BRPA 4XZMX 1R6WA 3U0HA 4M7SA 4WY0A 1NDYA 4JTKA 4M56A 4ZA0A 3WUBA 2OEMA 4J3VA 2X0SA 1VEPA 3GC5A 4L1XA 2CC0A 4LY8A 1A5SA 4P8WA 3DYMA 1R3SA 4IGMA 1ZY8A 3QZ6A 4HNTA 1TX0A 1KQZA 2BB0A 4WLCA 2BTMA 3RGTA 2B7QA 3BTNA 3RR1A 1XIJA 1UZDA 1OT1A 2ON3A 1BF2A 1PPIA 3M0ZA 2ZUWA 3UCQA 3GDRA 1JJKA 1CB2A 3PPCA 4B5VA 4KCTA 5BNKA 3WO8A 1J0JA 3NQ2A 1JFHA 3MI6A 2WKLA 1E6PA 3B8WA 1O6IA 4HPHA 1QHZA 7CGTA 3F2BA 5HQLA 3HGSA 5I23A 3CXOA 4PMRA 2OO6A 3TN6A 4B5UA 1UQYA 3LBOA 1H09A 5D09A 2YPIA 3WNNA 4BF7A 1F8IA 3L0KA 1KM0A 3WLIA 4HK5A 1OIFA 1FHDA 1GPWA 4WOQA 3I3DA 1B2YA 4RE4A 2ZRWA 5EMMA 5C2GA 2YA2A 4DAIA 4KKXA 4LC8A 4LUSB 3GNNA 2PDGA 3QRHA 3LHTA 4TTGA 3SRKA 2VD8A 2Q3RA 1U1UA 1TA3A 1GT8A 4HSOA 2ZC8A 2E1WA 2FZMA 2QJHA 2FZNA 1AQFA 3WLQA 4Q4PA 1QBAA 3E96A 3O2LA 1E9YB 1WBJA 5CPSA 1PIGA 4EIVA 4R27A 3SSZA 3LB0A 3N73A 3NVVB 3VE7A 3WJXA 2CESA 4I8DA 3W2JA 4L64A 3BW3A 2GDVA 3NEHA 1FBAA 3M0XA 2I9UA 4CD7A 3UWUA 3WD3A 2BVYA 2RDTA 2AOSA 1E43A 2WCGA 3T0AA 2YCLA 3V16A 2QT3A 2INFA 1EF2A 1TCDA 4CD8A 3PZTA 1V97A 1ZJIA 4KPLA 1VZWA 3L9CA 4EAMA 4N42A 4E0CA 4OE7A 1Q6DA 4QIUA 3BMWA 1B3YA 2X99A 4D8ZA 4F4RA 4WDXA 4MY8A 3SADA 5A8MA 1UWRA 2OYLA 1OK4A 1AJZA 3WZ0E 3AMKA 3BARA 1E3XA 3QV7A 1OJXA 3FS2A 4AEEA 1AODA 3ZR6A 1BYCA 2LLEA 4RKAA 1L6YA 3OJGA 4NX0A 3AAMA 4QM1A 1OYBA 3ZYZA 1DORA 4IIHA 4YPJA 2GK1B 1WE5A 4Q4KA 3LV6A 3KRBA 2FZDA 1ZHAA 3ES8A 4PMQA 2G97A 3QLDA 4FSAA 3S4TA 3WF4A 3L8KA 1U1HA 3C6CA 3O15A 1GYNA 2YB4A 1L6GA 2EPMX 2PDUA 1IEWA 4Q6XA 2Q3OA 2Y5EA 1NDZA 2Z2AA 4GUFA 2NV9A 3BSHA 2EJAA 4O1DA 2WV8A 1FVPA 3RNMA 2BHYA 1L2UA 1M04A 3TVAA 4G9PA 1FFUC 3S42A 1A0EA 5ABTA 4XUGA 3BOLA 4ICNA 1KW1A 5A2CA 2WC3A 1V6TA 4LH8A 1TZZA 5AHEA 3IGUA 5EL1A 4ZB0A 3KBVA 1YTKA 2ZUSA 3WBXA 1IWBA 1S5TA 3VIMA 3FCPA 2PTYA 4LJ3A 1YADA 1TFVA 1V3HA 3EX1A 3NPXA 4PE8A 3NYDA 2EBNA 4DIAA 3KL5A 3TDFA 4NAFB 2YBUA 2INZA 4PODA 3KM8A 2PF0A 4QLJA 2AKZA 1X96A 4A05A 3NVZB 3M6DA 3MB9A 3SCOA 3DBNA 4JKMA 2XGZA 2DZVA 3BJSA 3MZNA 3DN5A 3UJ2A 1M65A 3S9ZA 1J2WA 1K4GA 3LEPA 3TYDA 4L6HA 2JKEA 1XF0A 1J18A 4J3SA 4YWSA 1DXIA 2J3NA 5JIPA 3PJTA 1UJQA 3EDJA 4GY7A 4UC5A 2G96A 1MSSA 3W73A 3KW3A 2E77A 3VDCA 3GDKA 4KFNA 1ZAHA 3N2XA 2PDCA 3E6EA 5JCMA 4KFPA 4PMNA 3TLQA 1YDNA 1L2QA 3DIPA 3R43A 1UWAA 1JYNA 3BURA 2V9DA 3MUY1 2C6QA 1WDQA 4HHHA 2FLIA 4W8AA 1S38A 5CKSA 4J3XA 5LHEA 2H9AA 4FX8A 2EF9A 3MUCA 4DZHA 3U4AA 3FHQA 1XIHA 1F9CA 2VRKA 5U7SA 1TUFA 5E5CA 5T26A 3AN1A 3SURA 3DH9A 3DFHA 2WCSA 1YTEA 4PCSA 1C8YA 4D6HA 3DBPA 1YNYA 2QIWA 3R10A 4CQBA 5A6BA 1ONWA 2C79A 1FDJA 1OX5A 3TA6A 1STZA 5F1VA 4S39A 3MP4A 3DGZA 2R1LA 5RUBA 2D0HA 1OWQA 3FJLA 3LGEA 1V3MA 3UF9A 2ACRA 2ABBA 3PZUA 1DEDA 3G0SA 3MHUA 4F66A 1ISXA 5LIXX 3IUDA 4LAZA 5FS9A 2VRJA 1S3HA 3NOEA 1WOAA 3MV01 3C52A 4MJMA 4YYFA 5A8OA 1T8XA 3W74A 4Q4SA 3KVMA 2RH9A 4LYRA 4F48A 1E40A 1LROA 3DAQA 5I3FA 4H2HA 4L7ZA 4XZHA 3GRSA 3VIGA 2GQWA 4B16A 4BS0A 3SUSA 3BSMA 3GFYA 5K2ZA 1KRCC 4C1LA 2BDQA 4CEXC 2WZHA 1KFWA 2PDLA 4ZE5A 1KFBA 3CAKA 4D1JA 4GVGA 2DT3A 1EQCA 4O50A 1QUMA 3CYVA 4C1NA 4JQ4A 3CHVA 3E9AA 1WDRA 4LYPA 2OX1A 2XWDA 1XIFA 1E0TA 3BXWA 4GQBA 3RF9A 1SUXA 4H4RA 2J7CA 3HIJA 2WC4A 1BZLA 1GRGA 5D8WA 1LRTA 3B8TA 1JCTA 3GR4A 3H54A 1ITXA 2BS9A 4LB4A 4C6PA 4B5XA 3IUHA 4WDWA 2Q8XA 2BASA 2VGGA 4GYJA 1X2GA 2F2HA 1UR4A 3QR3A 5EMLA 3BE7A 3C3UA 1R47A 3OW1A 3PG8A 3HPSA 2Z1BA 4Q7NA 1X98A 2DZBA 3GWQA 2PMQA 4ES4A 1V77A 4NZFA 1DBTA 2YSWA 2GGGA 1BF6A 2VD9A 3G6MA 1W8SA 5DX7A 1C7SA 3AS2A 3FGCB 1ZP3A 2POTA 3PTKA 3SGZA 1F8WA 3VDHA 4D6CA 5ABFA 2QAFA 4Z2KA 3W6YA 1GETA 4Q7BA 4H8UA 4H4WA 2J7HA 4O57A 3HG3A 1LWIA 3IJIA 1O1HA 1UROA 1LORA 3VNIA 4V1XA 1JI1A 2RDUA 2PLMA 2ZICA 3VGFA 1NFGA 2PBGA 1W1IE 4JX4A 1W3LA 4MMWA 3EOSA 3M6YA 3QPZA 1GRHA 4AISA 3O6AA 3ABRA 1RLCL 3R8GA 4R34A 5JH2A 5D9OA 2DQXA 4GACA 3HQNA 1MZRA 1ZNNA 4QSFA 2WVVA 3CV6A 4ZQNA 2WSKA 3WDIA 3ZXWA 1DIDA 1TV2A 4IFKA 4XIMA 4MSSA 1QAPA 2VFGA 3EWCA 3M16A 5LGZA 4Z1YA 2PFHA 5FJPA 1OEPA 3DFSA 4I3GA 2J78A 1OF8A 2GOUA 4AZ7A 3GVVA 3M44A 2ZYFA 3XIMA 2PDYA 3PSWA 5KTLA 1XLMA 3MHGA 2O7SA 1TJRA 4HU0A 3K8LA 1B3OA 1C8VA 3UPBA 2GH5A 1TVLA 2Y89A 1IXQA 3G2GA 3ZS4A 1CXHA 2VEKA 3GG1A 5DCBA 1FWWA 2X8HA 3G1VA 5A6AA 2J6VA 3CV7A 2VTFA 4HPXA 3AU2A 1XIEA 1K7XA 1OCBA 3A23A 5BOFA 1RLDA 2XM2A 4O52A 4DJDA 1RVKA 4DXVA 6CGTA 1HP4A 4N4QA 1E9IA 4B91A 1M7PA 3ME3A 3H2FA 1UOZA 2W55A 2HV5A 4QJ1A 3AZTA 3AHYA 4L4PA 1PTGA 4PSRA 1V3LA 3LPGA 4FNTA 3G24A 1XIMA 3MO7A 5I6SA 2X42A 1XINA 3WMLA 2WLYA 4JTHA 1N63C 4FOKA 2CDUA 1WKEA 1TQXA 3H22A 3DK9A 3FLUA 3SCQA 3Q94A 3M64A 5DRIA 1HJWA 4FNPA 4W85A 5CLWA 4JNMA 1LQAA 4IIBA 3DH7A 3V1HA 1V6YA 1VPYA 3KL0A 4BI5A 3H6OA 2CFYA 3CQIA 3SFWA 3CB8A 2QUNA 3V3WA 1QWKA 5DT5A 1F4AA 4JIHA 3RU8X 2ZRVA 4UFLA 1GOWA 3KOYA 3PZVA 2JFEX 3RLHA 2W91A 1PX8A 1O1ZA 1BRLA 2ZRYA 4L9ZA 3QFWA 2RUSA 4DWSD 2QULA