4DNPA

Crystal structure of dad2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
QTLLDALNVRVVGSGERVLVLAHGFGTDQSAWNRILPFFLRDYRVVLYDLVCAGSVNPDFFDFRRYTTLDPYVDDLLHILDALGIDCCAYVGHSVSAMIGILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPASVATYLKNHLGGKNTVHWLNIEGHLPHLSAPTLLAQELRRALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAD2 Is an alpha/beta Hydrolase likely to Be Involved in the Perception of the Plant Branching Hormone, Strigolactone
pubmed doi rcsb
source organism Petunia hybrida
molecule tags Hydrolase
molecule keywords DAD2
total genus 89
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dnpA00
4AN1A 1JJBA 3C8DA 5ALXA 1GQSA 1BE0A 3A6ZA 2WHRA 5ALNA 4J0JA 4UFOA 5C8ZA 1LZKA 3HC7A 5D7BA 3ANTA 1JU3A 2WHQA 4C87A 1ORVA 3KXPA 1YASA 2I3ZA 2EDAA 3S2ZA 2VAVA 1MT3A 1F0PA 1VXOA 1CUUA 4MEBA 1GXSA 1CUZA 3W9BA 1MNAA 3E3AA 3N2ZB 4BC0A 4W1RA 3QBJA 1UT6A 5DTJA 1QTRA 4A5SA 3KOOA 4DGQA 1MX9A 4L3WA 1L7AA 4FBLA 4C4XA 2HU7A 4UBIA 4TGLA 1LBTA 5HKBA 5CW2A 3CCBA 3BXPA 4GEGA 1ODCA 3PICA 5AKJA 4CIAA 2B20A 1QE3A 1E8NA 4KE6A 4UHDA 3H2GA 4HS9A 3PFCA 4PF1A 1KEZA 1H22A 5CT5A 4Q3KA 2VATA 1F8UA 4H0CA 2OCLA 3STWA 1N5RA 3STTA 4EA6A 3VDXA 2IIVA 5JD5A 3FCYA 4H7DA 1WB6A 4QNNA 1FFDA 1TCCA 2CEKA 4N5HX 3WK5A 5A7HA 3WK7A 2HL6A 1CIJA 2XQJA 4CG3A 5T4BA 3OURA 1MJ5A 1E66A 4OUKX 5ALWA 4M0FA 3O9VA 4CCYB 5CT6A 3VVMA 5AJHA 4K6HA 3V9AA 3HRHA 2CUTA 3L1JA 3PF8A 4WFJA 1QIHA 4X85A 5K3DA 1A8UA 2XUOA 1BRTA 1EXWA 1QIJA 2HA5A 1ACJA 1BCRA 4J0KA 5EFZA 1GQRA 4U2DA 2PKYX 3MUOA 5ALZA 2CZQA 2QXUA 5IVDA 2DHDA 1LPAB 1JMKC 4X91A 5ALUA 4LHEA 4EHBA 2XQGA 1P0MA 5C8XA 5EHQA 2CB9A 5I7UA 3AINA 4OB6A 3R3XA 5A62A 1Y37A 4DMCA 5HZGA 5JZ9A 3OPMA 2WJ4A 3C5WP 5ALSA 2CJPA 3D3NA 7YASA 1CUYA 4QWMA 2DQYA 4F5ZA 1E3QA 1YB6A 3HJUA 4X6UA 1YB7A 3N0TA 4P08A 1DINA 2XQIA 1SC9A 4EY7A 3H2HA 5HK9A 5DWDA 1Q84A 2BCEA 4P9NA 5LZ5A 5JAPA 4ZWNA 2X76A 4QDOA 4NS4A 1OCEA 4E11A 4FBMA 2HA3A 1NU6A 4Y2XA 1CQWA 2ZJ7A 4FKBA 3BF8A 4QWWA 4E15A 1CVLA 3TRDA 1UK7A 4WDRA 1CRLA 1YR2A 3G9TA 3DS8A 2XE4A 5F4ZA 4NMWA 3CXUA 5K3EA 3I6ZA 1M33A 5K3BA 3FYTA 5FP0A 1AC5A 3WKBA 2BJHA 2IITA 2FUKA 3OOSA 4KEAA 3SK0A 3G9XA 3G0GA 4MXDA 1EDDA 3FYUB 5LYYA 4ARBA 2GZSA 2WFZA 2XLCA 4BTVA 4J0GA 3I6YA 2H7CA 1XZEA 1VE7A 3WWPA 3QMMA 4CG1A 1WCYA 1CUHA 1A7UA 4BDTA 5CXUA 2FJ0A 1XRLA 3D59A 4FDMA 4V2IA 5HF9A 1A8SA 1B6GA 3E0XA 4BTLA 3BL8A 2O2HA 1P0QA 1RWQA 4W9RA 3D7RA 1L7QA 5ALRA 1QIGA 1MNQA 2HA4A 2C58A 1R9NA 2DFPA 5A7FA 5SYMA 3QMWA 4X7BA 2QJRA 1MX5A 6YASA 3G0BA 2XMZA 2C5GA 4KAJA 1R50A 4JNCA 3V1NA 3S8YA 5ALGA 4BCDA 4IH1A 2XQFA 1ACLA 1H2WA 5A71A 4EZIA 1KU0A 3H1BA 2Q0XA 5JAHA 4YPVA 3LIIA 3C6BA 4UBKA 1Q0RA 3HLKA 4JUIA 4K5QA 4BYMA 4AO7A 5ALQA 1UKCA 3ILSA 1XQWA 4I19A 3F98A 4EY8A 5CT8A 1WB4A 2XUQA 2FJPA 2RONA 1CR6A 3WK6A 2VA9A 5T4EA 2JGMA 2V98A 2WIKA 3LIPA 5HF8A 1XRQA 2VTVA 1XQYA 5FDFA 3WWEA 3WYDA 2PUHA 1CUEA 2AJDA 1CFJA 3R3ZA 2GYVA 1VXRA 2B4KA 1EDBA 4J0HA 1XZLA 1Z68A 4M0MA 5LZ7A 1ZD4A 2JEZA 1JKMA 2BUCA 5A2GA 4BVLA 2ECFA 4MYDA 5AK6A 5KWJA 1XZHA 3GELA 1W75A 2XUGA 5AM2A 1GPNA 4RE6A 4MYSA 3AIKA 3OC0A 4AQDA 1T2NA 2V97A 2I03A 4BCCA 2BAGA 2QZPA 5ALIA 1XLUA 1MAHA 3OG9A 3STVA 2BKLA 2C0PA 4Y2UA 2ZYHA 3QVMA 4QDXA 4J0CA 4ZI5A 2ROQA 1CUWA 2Z8ZA 1VZ2A 2RIPA 3DDUA 1TIBA 2VJCA 2GBGA 4H77A 1JU4A 3FLEA 2GYWA 1EH5A 3EIOA 4JH0A 3DOIA 4MQMA 5CMLA 1DWPA 2J3QA 2XUIA 4N5IX 4BDSA 2CKMA 5AM0A 5AI6A 1XZAA 4GHWA 1JT2A 4BRZA 3FYUA 1J07A 2Z3ZA 3BDVA 3ZLVA 5YASA 4ETWA 1QIKA 4OB7A 2H1IA 4AB1A 1XRPA 2XI4A 1GKKA 5C81A 5AHXA 1XQVA 2AJLI 5DNUA 1U4NA 1Q0ZA 4B84A 2RHTA 4QEKA 3IUQA 5JARA 1JFRA 1LBSA 4ZXFA 4RE5A 4QDUA 2H7YA 3K2IA 5H3HA 2BGRA 2ORYA 4BZWA 4KRYA 5JASA 5LLSA 4Y2QA 3BF7A 4QE3A 5ALVA 3C5VA 1K6EA 4UFPA 4Q3LA 4B83A 3T4UA 1JMYA 1GT6A 3H19A 3E4DA 5DNVA 5JALA 4TVKA 2VQ6A 3QH4A 1QTIA 3H2JA 3ANSA 3HYSA 2PSEA 1XZGA 4C89A 2HFKA 3WZMA 1ZJ4A 4YX9A 3WL5A 3QMVA 3RM3A 1CEXA 2EDCA 4F21A 1WHSA 1ZI6A 5IVKA 2HU8A 3AZPA 1XRMA 3JWEA 2OG1A 4PSDA 3I2FA 1KU6A 3FWHA 2AXEA 3TGLA 1AX9A 4HXFB 5AKXA 2WUGA 2WG1A 4FFWA 3O4GA 1THTA 1Y7IA 4JYMA 2C7BA 1XQXA 4J0IA 3R3VA 3M3DA 5I8PA 2C5FA 3WA6A 1YCDA 2PU5A 5SYNA 4KACA 2OXEA 3OM8A 1W6RA 4X3CA 1IMJA 5LIPA 1ZI8A 1U65A 4MWTA 2OQIA 1QO7A 5FKJA 1IUPA 5HFAA 4HZGA 2PU7A 3BIWA 4KRXA 1CUJA 1HQDA 4U2GA 3DEAA 3F67A 1VKHA 3C43A 1RP1A 3QYJA 4XIIA 1J1IA 5KWIA 3M81A 4BB0A 1UXOA 3ESBA 1CUCA 3WJ2A 5HF5A 1TK3A 3PI6A 3ESDA 5J3JA 2XMBA 2JGLA 1G42A 2XMSA 1VZ3A 3F97A 1TKRA 4N8EA 2OCKA 1YS1X 2H9YA 3KWFA 4Y2JA 5EIHA 1XZJA 4G5XA 3K9BA 5JANA 1ZOIA 2JGFA 2I78A 5AM3A 5DLPA 1EK2A 4A16A 4CCWA 2ES4A 2OAEA 3C70A 1C7JA 4KE8A 1BN6A 2ZSIA 5ISMA 4UBJA 4QDZA 3W2TA 3IIIA 3ZV7A 3PF9A 3DL7A 3DL4A 4AO6A 4QDTA 3LCRA 4AO8A 1MU0A 2WHPA 1DX4A 5FXMA 4BAGA 1GKLA 3ICVA 4RGYA 1WPRA 3PDCA 5BV7A 3F96A 4HAIA 1CUXA 4WY5A 3IUJA 3AUKA 2CBGA 4B82A 2QJWA 4UHHA 4JEIA 1CUSA 3PFBA 4Y2TA 2RHWA 1ZICA 5AM1A 4QLAA 3B12A 3G9UA 4U2EA 5JAUA 4AN0A 1IZ8A 5DJ5A 4RPCA 1SCKA 2HIHA 3FVTA 1TAHA 5ALPA 1AGYA 1YA8A 2WU3A 2HADA 3W05A 3GROA 3YASA 3PE6A 4GI1A 4HRXA 3BDIA 1P0IA 2FX5A 5HQ3A 1A8QA 3SC2A 4X6YA 2ZYIA 1C7IA 3MVEA 3A2LA 3A70A 2VJAA 1U2EA 3EQ9A 4CI9A 3FNBA 3WL6A 2OCIA 5JZSA 2DHCA 3C8HA 1R88A 1FJ2A 1JJFA 4PQEA 1EK1A 2Y6VA 5E4YA 4G8DA 3T52A 2AJ8A 4FLFA 4DM7A 4KAAA 4EBBA 5A6VA 4WDQA 4GW3A 4KAFA 2V9ZA 1GPLA 3HEAA 5FV4A 1UOOA 1R4ZA 3V1LA 4X92A 3E1GA 2HRQA 4G4GA 2O7VA 2WG0A 1AKNA 4FWBA 3FYUC 5KBYA 5IVHA 4X90A 3G8YA 1LPPA 1WHTA 5LZ8A 5CBKA 3RKSA 2WJ3A 3FSGD 1UOPA 4OCZA 3I2HA 2VSQA 4EY6A 5LKRA 3WZLA 1LPSA 4H7EA 2XUPA 2VF2A 3C45A 1ODSA 5ALLA 2G5PA 2I3DA 1IZ7A 5C7YA 3DCNA 4AMYA 4OYYA 2WFLA 4Q3OA 4BCBA 2DQZA 4E46A 1B41A 1XROA 3KSRA 3LP5A 3O4HA 2V96A 2PSDA 3K6KA 3R3WA 4BP8A 3KWJA 1CUVA 1LGYA 4B9EA 2UZ0A 1XKLA 2QUAA 3KD2A 4S0XA 2WILA 5D3ZA 2OLEA 4EY5A 5BOVA 4OU5A 5AOBA 2DHEA 2HM7A 4PO3X 4BE9A 2RGUA 1P0PA 2OGSA 3G0DA 2LIPA 2WFMA 4AZ0A 2Y2VA 3L1HA 5AKIA 5AM5A 1JJIA 2QTBA 1USWA 4BBZA 2QOEA 4BZZA 5ALFA 1FFBA 3GUUA 4G8CA 4DSZA 3TJMA 5AKEA 3DKKA 3AFIA 1MN6A 1QZ3A 1MX1A 2O2GA 2X5XA 2ZSHA 1QGED 1XRRA 1XZFA 2JF0A 3LLCA 1SCQA 1HBJA 5CH5A 1CUBA 4C4YA 5ALHA 1XZBA 4AXBA 3FCXA 5AIAA 1EHYA 1QO9A 4KE7A 5KREA 1W52X 1DWQA 4EY4A 1DT5A 3VJMA 4DYHA 3STYA 2WUEA 4AZ3A 1IVYA 4XJVA 1QIIA 2WFLB 3WMRA 4BP9A 4AX4A 1UKAA 1LPNA 1YSCA 4EUSA 3EF3A 1WB5A 4H7KA 4D9JA 3DYVA 1BEZA 1SOMA 1VJ5A 5K3CA 2ZYSA 2IX9A 3AIOA 4H7FA 4RNCA 2HA7A 2XQKA 4XVCA 1EINA 3HSSA 1AZWA 1E8MA 5AO9A 2XMDA 3WWOA 5AIBA 2HA6A 2WUDA 4MQLA 2BUBA 4F60A 2H7XA 3WKDA 1C4XA 1I6WA 3R41A 3C6ZA 1ZD2P 1QIMA 5JD4A 2ZJ6A 3R0VA 1RYYA 1E5TA 3D0KA 4DSAA 3D2BA 3BJRA 1EDEA 3UMJA 5DTIA 4CG2A 4UFNA 5E2IA 2X8BA 3QM1A 4E14A 3I2JA 1ZD5A 5JADA 1CV2A 4HRYA 2PVSA 2R8BA 1VLQA 4Q82A 5HCUA 1E89A 5ESRA 1CUGA 1HPLA 3VXKA 3H0CA 4B80A 4KYVA 3GFFA 4FOLA 2QS9A 5K3FA 2YH2A 2J4FA 2YXPX 4CFSA 4CCYA 3O9MA 5K3AA 1UFOA 3H2KA 1WOMA 5EGNA 2B61A 2OGTA 4J03A 1W1IA 1SCIA 4UBLA 4GLBA 5DYWA 3JYHA 4FTWA 4FLMA 5ALDA 2WLSA 3VKFA 5EI5A 4M0EA 4LIPD 5CTAA 1HL7A 4DNPA 1UKBA 3BJMA 5HK8A 1TCBA 3SX4A 1F6WA 2JBWA 3AZOA 4IH9A 3WKEA 4W63A 3ZLTA 3WK4A 4J3JA 4OB8A 4XX1A 1GPKA 4YASA 4FNMA 4BAUA 5CURA 4CIBA 3G0IA 3ZI7A 3AIMA 1ODTC 1W4LA 5FRDA 4GECA 4I3FA 5HFNA 2VJBA 3PUIA 4JYPA 4DNOA 3ZPXA 4B81A 2O2IA 4IO0A 3WL8A 5AKHA 1O6FA 2ACEA 2XMQA 5EIEA 4Q34A 2PUJA 4LXHA 2WTNA 3I2KA 4H7HA 3FOBA 2OGZA 3PUHA 3I2IA 4HVTA 5LZ9A 4DIUA 4B9AA 3DYIA 2GBCA 2OCGA 2BFNA 1LNSA 4BC1A 2XMGA 4K6GA 1TQHA 1XRNA 4DMHA 3Q8WA 4KE9A 4ITVA 5LKAA 1XLVA 5IH7A 1UOQA 5JYCA 1EA5A 1UK9A 4OYLA 4U2FA 4UHEA 2QT9A 4L72A 2QKYA 2QRUA 1AUOA 4LKOA 4X95A 1T4MA 3IA2A 1BCSA 5E4JA 4Q05A 1X2BA 4ARAA 5ALTA 4J0DA 5EHXA 1LZLA 4C4ZA 2DCMA 4UPDA 5ALKA 5AI8A 1GGVA 4HTAA 2VEOA 1XZIA 4ZV7A 3ZLUA 5AI9A 1Y7HA 1QIFA 2AJCA 1VA4A 2Y6UA 2XUKA 2ZYRA 1EVQA 2Z3WA 2B9VA 3FVRA 1TCAA 3R3UA 2J3DA 2PPLA 2BUAA 5CXXA 3H1AA 2AJBA 2HA2A 3NOXA 4H7JA 4NZZA 2HU5A 3EBLA 3C87A 2WIGA 4G1FA 5DNWA 2GZRA 4BE4A 5FUMA 2C4HA 4WCVA 1X2EA 1EB9A 3ICWA 3WWDA 3DLTA 2XDWA 2GBIA 3ED1A 1YAHA 2JEYA 3IURA 1EB8A 2G63A 3SWWA 5JATA 3H04A 1AQLA 1J06A 3AZQA 4Y2SA 1R3DA 2VT6A 3BIXA 3DJYA 3DNMA 4ZRDA 4BAZA 4XWGA 4G9GA 2PSFA 1Q83A 5E4TA 1DWOA 3FAKA 3WYNA 3C6XA 2JGIA 1LPMA 2C0QA 1MO2A 1QOZA 3ESAA 5CT4A 2WQZA 3D2AA 4GDMA 3I6MA 4I4CA 1PFQA 5CH3A 3BE8A 4LYDA 4QA9A 3GA7A 2XMRA 4IH4A 1H2XA 2BGNA 4HXEB 2OQVA 2CMFA 3RLIA 2Z8XA 3WIOA 4LYEA 1XZCA 2WU4A 4H18A 1PJAA 1XZDA 5AOCA 3DOHA 4K6KA 1K4YA 3NWOA 1AURA 2YYSA 4N8SA 4F0JA 4PNZA 5AH0A 3GBSA 1THGA 2PBLA 4Y9SA 4L0CA 2QM0A 4AMZA 3DQZA 4C01A 5FOQA 2EEPA 4TPKA 4W1SA 3CCCA 1GZ7A 3WLAA 2PSHA 1ZIYA 2YASA 2Y1KA 2WG2A 3HXKA 5LP1A 1XFDA 3A2MA 2XUDA 3WJ1A 1FFEA 2WSLA 1AMNA 5AM4A 4PSUA 3UUFA 2O7RA 1WPXA 4LXIA 4C88A 1DQZA 3WQHA 2JIDA 3IBTA 1BROA 2ACKA 1MPXA 1K63A 3EQ8A 5T4HA 1CPYA 2D0DA 4BVJA 1CLEA 2WIDA 1QFSA 2WKWA 3O4JA 3FBWA 4H35A 4B85A 1X70A 1CUDA 1O6GA 3NGMA 1QFMA 2WIFA 1N8SA 2VT7A 2XUHA 4W1PA 4X93A 3ZWQA 3WWCA 3GZJA 1IUOA 3AILA 1S8OA 3STXA 1ZIXA 1OXMA 2NW6A 3F9CA 1QJ4A 1R1DA 4X97A 4DNQA 3P2MA 5AP9A 2WUFA 3O4IA 4H7IA 2WJ6A 3IUMA 5ALEA 5DYTA 1QIEA 2ZVDA 5CT9A 1G5FA 1HKHA 1VA5A 3V48A 4P92A 5T4FA 5D3KA 3HZOA 2HA0A 2HDWA 4B0OA 3R40A 5JIBA 3X3HA 1LLFA 4G4IA 4U2CA 2G4LA 3CN7A 1H2ZA 4FNGA 2OPHA 3JW8A 4ZGBA 2RI6A 4UHBA 5ALYA 3TEJA 3C6YA 3AJAA 3HI4A 5JD6A 1XKTA 3WKCA 1ETHA 3MGAA 3H2IA 4GXNA 1VE6A 1IUNA 4PSCA 4LXGA 1EI9A 2PM8A 3H17A 2G5TA 3HACA 2W6CX 1YS2X 4KR0A 3LS2A 3B5EA 4MEAA 1G4HA 3G9ZA 3QPCA 4UBMA 1G66A 2ONCA 1ORWA 2XB6A 3M83A 1YAJA 3BWXA 5FLKA 4W1QA 1H2YA 4DMFA 5AKZA 5ALJA 5EHZA 5K3FB 3WL7A 2XT0A 1MTZA 3D2CA 1K8QA 4PW0A 2GBFA 4Q1VA 5JZBA 1YA4A 2XUFA 1FFAA 3WK9A 2D5LA 2QUBA 3I28A 3I2GA 3F8SA 3W9UA 4X00A 4UHCA 3QITA 2WIJA 1CUFA 2P8SA 4G4JA 5HQ3B 2Y2UA 3RARA 1JI3A 2JGKA 1H23A 1F0NA 1ZGBA 1EVEA 4J7AA 5ALOA 1DTEA 4X6XA 3O95A 3VISA 2E3JA 3D5EA 3DD5A 4UBNA 5AKKA 4Y2PA 3U0VA 4FMPA 4KJXA 4B7ZA 5LZ4A 1TRHA 1QONA 5FPQA 2PX6A 5EHNA 1R9MA 2VAXA 4WJLA 5A7GA 4YK7A 5FPPA 3DKRA 5AK3A 3UUEA 3MUNA 5BWBA 2PL5A 2JGJA 5AI5A 2W22A 1VOTA 1ZJ5A 1DX6A 3B3QA 4U2BA 3FLBA 4UHFA 4MWSA 4DTCA 4BVKA 5AI4A 3IDAA 4X71A 2R11A 1XZMA 1CUAA 1SFRA 4Z49A 3VVLA 3V1KA 3OTQA 2VJDA 1UK6A 2QVBA 4O08A 4IQ4A 3U1TA 3IULA 4IHAA 5HF6A 1UZAA 1DU4A 4HXGA 1ZGCA 3O0DA 1ZI9A 4C6HA 3EQ7A 5BWCA 3V1MA 4INZA 1HLGA 1NX9A 1QIDA 1XLWA 1BEEA 4Y2RA 2XLBA 5IVIA 4EB0A 2RAUA 4QLOA 1BU8A 5I9IA 4Y2YA 2Z5GA 1BN7A 4WFIA 4BATA 1UWCA 2ZJFA 4WFKA 5ALMA 3Q0TA 2GYUA 3ESCA 5D6OA 1UK8A 3W04A 3WKAA 2QMQA 4ZV9A 2WHPB 4UBOA 1J2EA 4Y2VA 4OU4A 5JAOA 5AI0A 4QZVA 1U8EA 3H18A 1FSSA 5EIAA 1QLWA 5LZ2A 3M82A 4NVRA 3STUA 4GWLA 1D07A 4BRSA 3CN9A 3VJLA 1N1MA 3IUNA 4OPMA 1PV1A 4OSEA 3VJKA 2HFJA 4ROTA 5K5EA 2WM2A 1CUIA 3WIBA 1WM1A 1CQZA 3QPDA 4DLNA 2QXTA 3D4LA 2PSJA 5AOAA 1OILA 2DR0A 4DNFA 2WTMA 4DMKA 5AK5A 3L1IA 4B6GA 4UUQA 3G02A 4FFVA 5DYYA 1DT3A 3R3YA 1BS9A 3G7NA 1DQYA 4K2AA 4FHZA 4B0PA 5AK4A 2K2QB 5AKLA 1ISPA 1FFCA 4A23A 2XMCA 1L7RA 3WK8A 5CH8A 5AKGA 4FLEA 2OAGA 4Y7DA 5AICA 2DSNA 2J4CA 4MJ3A 4P93A 2HHAA 3QPAA 5CRIA 4G8BA 1A88A 5AKYA 3I1IA 3FLAA 5IKXA 1E8DA 4N8DA 1NU8A 3IVMA 4ZREA 3W06A 3WA7A 1MAAA 4L9AA 3G0CA 4GBGA 3RK4A 1XZKA 1ZD3A 1EX9A 2XUAA 2JGEA 2XUJA 3FSGA 2HRRA 1K5PA 2QR5A 5HKAA 5C8VA 1HDEA 3KDAA 4OD0A 3WI7A 1LPBB 3IB3A 3I1YA 4G9EA 1W76A 1LPOA 4PV7A 3QZUA 3HABA 3NUZA 4WY8A 4X94A 3A2NA 1N5MA
chains in the Genus database with same CATH superfamily
1NOKA 1TYZA 2L82A 1QP0A 1OT5A 1Z08A 2H4ZA 1LQUA 1BE0A 1GU1A 3U4MA 3AWDA 4A8TA 1GHTA 1BE1A 3DHYA 3PC6A 2HGSA 3M4YA 2LWIA 4ZAFA 2HSDA 4FDTA 3TFWA 1EHCA 3BHIA 3OHPA 4ASUA 4B3IA 4BV3A 1H8HA 1P3Y1 5BSRA 4GLFA 4KO8A 4F38A 4PRZA 2ZIXA 3KXPA 2QX4A 2YV4A 3AEKA 3H0EA 3N2YA 1QJCA 1L0BA 2C4WA 2V03A 4P58A 2Z9DA 4X45A 2IL1A 3VAAA 1R0KA 2OZKA 4HTFB 2VAVA 7MDHA 4ZZ0A 5IAAA 3RAGA 1F0PA 3UWPA 1VXOA 4ZO9A 2BP7B 3FMGA 2B8NA 4O1IA 1OMOA 1Q57A 4ZCMA 3S2EA 1Y4DE 4FFSA 1N5JA 2TYSB 1H2RS 1WWKA 2R6AA 2FR8C 2WW8A 4URHA 1JE0A 5JHGB 4M88A 4W1RA 5A5VA 4CWAA 2IXDA 1UT6A 2IXEA 5MN4A 4MCIA 2HDHA 4IVNA 4P38A 2GD0A 1JVNA 1SRRA 3M5DA 1W85A 1A7JA 1DOZA 2O8DB 1NQWA 2JLRA 2ZSJA 2Q5HA 3FR8A 1QAMA 4HGQA 2A4KA 4HS4A 5CXSA 3W6NA 4A2PA 3JYNA 2QN6A 4DGQA 3QSYA 4X44A 1U2DC 3F47A 2H52A 2QG4A 4S0ZA 1H5QA 1T26A 3ENVA 3HR8A 1ND5A 4UBIA 3L4BC 4TGLA 1LBTA 5HKBA 2ZAGA 1BQEA 5A9SB 4OXXA 2CHUA 4L1KA 3TKYA 3QF4B 2A9QA 3HCEA 3BXPA 3ROTA 1P2VA 3LT4A 4GEGA 1AD2A 1VPTA 4ZAYA 3PICA 3TSAA 4FYKA 4M86A 4AU1A 2D7DA 4ROSA 3IUYA 3KJZA 4K9SA 1N3YA 3EWSA 3NHWA 3IEKA 3IT0A 1NIPA 3WDSA 3RC9A 5BW4A 4KE6A 2X4GA 3UUGA 4AS2A 3GEHA 5FTNA 5HXAA 3V1YA 4PF1A 4KO4S 4MZXA 2FN4A 2PRJA 3OY2A 1XQ9A 2YC4C 4HCJA 2OKCA 2IPLA 4BLQA 1I5RA 1Y48E 3PRJA 3QEMA 5CT5A 2EFHB 1R8QA 2KX7A 5J2TA 1PV4A 4U3JA 3OUTA 3AETB 1D09A 1F8UA 1Y4UA 4MR8A 3ABIA 4H0CA 4R3WA 3STWA 4MYUA 1N5RA 3CZAA 3MBOA 3QELB 2ATVA 4EA6A 5LQCA 3M9XA 1Z7YA 2OZLB 5F33A 1SCJA 2Z3VA 4YXWA 1WCXA 1X8JA 2XKJE 2A67A 3RRBA 4IMJB 3WK5A 4X20B 1L5HB 2JLAA 3VR6D 2XJ4A 1G8FA 2SCUB 1XU9A 3H3FA 3ONVA 4TVBA 1CIJA 2XQJA 4D8VA 4PZCA 4L78A 4PYIA 4KRFA 3DVLA 2I8AA 4CG3A 1L4HA 3Q98A 4OHRA 2BI7A 5T4BA 4RTRA 3HRIA 2OZVA 1DXOA 2VKTA 1FP7A 2QL6A 4OHUA 3DTNA 2HSZA 2JI9A 3QKRA 1Z0JA 2H1CA 2ZM6B 1SG0A 4KQIA 5ALWA 3ZY5A 3DJFA 3WB2A 5FBWB 1G8JA 3LUAA 4KVGA 6REQB 5HWSA 3BRCA 3K72B 4CCYB 3B7WA 3VSBA 4A5OA 3ANLA 3EWNA 4UZFA 5AJHA 4F71A 2Y0PA 2UYOA 2JZCA 1WCV1 4M0LA 4F6LA 1CS4C 2J85A 4E3WA 1WXXA 1QIHA 2WJPA 3PWZA 3ADBA 1VDZA 2GAFA 4UHJA 2FMUA 5K3DA 4DIFA 1SIWA 5BUZA 1Q17A 1JZTA 1WMBA 2QLFA 1LNQA 2YHSA 2FWJA 3N76A 4IHQA 3RFVA 1KPIA 1EXWA 3QEMB 1E6MA 2HA5A 2AOXA 2EG9A 5AVQA 2GILA 3VYVA 3GGPA 4YRRA 3LLUA 2Z2IA 3OCWA 1GQRA 3KZMA 1CS0A 4TS1A 2D1YA 2RKWA 1UZUA 4B6EA 3MUOA 4OYRA 1NOJA 1V7ZA 2CZQA 1SHTX 3RHSA 3U26A 4DG9A 1IWPB 2IP1A 5JXJA 1ACMA 1SUWA 4P0QB 1MEEA 3GDFA 1IXSB 3T6KA 4I81A 4DZTA 2EJBA 1HV8A 4GL4A 2BM8A 2ZXFA 5ES3A 5TPZA 5K0BA 3NKLA 1Z28A 3LXRA 1V39A 4R1NA 2CNLA 3HXLA 2XA2A 2ZSAA 4A0SA 4B8ZA 1Y34E 1D7AA 5AXAA 5DTMA 4LYJA 1J70A 1V8OA 1UMCB 2GPYA 2OVFA 2RK4A 3KLPX 1P0MA 1MZVA 3AEUB 1ZSYA 3K1TA 2P1ZA 2IW1A 2E89A 3IR5A 3MS7A 4NWIA 1KJ8A 1XPJA 3B1YA 3D6HA 1O5IA 1VYUA 2CUKA 2J6HA 3GVXA 4CLEA 5C8XA 3GMSA 5HE9A 3N0VA 3BMCB 5A62A 4DMCA 5CAEA 3BD7A 1AQ6A 3OPMA 1A27A 2OECA 4KWCA 3JD0A 4JP5A 5FR1A 3VTZA 2IYWA 2IOYA 4R2IA 1M0TA 1MTOA 2R4TA 2X40A 4FZ5A 4P4GA 4YLEA 3ADDA 1I7PA 3T1QA 5KYYA 1BS2A 1UT5A 3K71B 2EBHX 3L9WA 3JWPA 4R0NA 4GMDA 4BNNA 1Q1QA 4RKRA 2PKEA 4XLTA 1HE2A 2FUG1 4I6EA 2B1JA 4I50F 3ZG6A 1QAOA 4LJAA 4BWVA 2GM5A 2QQEA 1AKWA 1OE0A 2W6ID 4IQFA 4ZTBA 3BH6A 1X80A 1MW9X 2J32A 3L7DA 4RDCA 5IUKC 2Q46A 4YMUA 2H4XA 4JZKA 2ZSFA 4MB0A 4YJ3F 3WFZA 4OK3A 5G3YA 2AFHA 5EG5A 1YJCA 4M1KA 2BPOA 2FLKA 1TVEA 2VJMA 5DWQA 2ZQZA 1H3EA 1S96A 3VHQA 1ND6A 4F5ZA 2MSWA 1RFGE 1E3QA 2DZDA 3GH3A 4X6UA 2NSDA 2D4HA 5K0ZA 4B3RB 4XXHA 2RCNA 4EY7A 4FZJA 5DTEA 2AV6A 3RKUA 1OAOA 3U3MA 4J16C 3KPVA 4PAWA 4HOYA 1AGRA 2NX2A 4IDAA 5DWDA 4BZPA 5A6SA 4R2JA 2BCEA 3K09A 3GW8A 2VBCA 5LZ5A 3NVAA 3OETA 1XCOA 5JAPA 4ZWNA 3D8RA 5I9TA 4B87A 2IC5A 3FPBA 2J9YB 4NS4A 5CB4A 4G0YA 4O25A 3HNPA 1KDOA 1UDXA 3EEBA 1R4MB 3H5RA 4PX2A 4R1OA 3WLKX 2PX3A 1RWKA 1IN5A 5GJCA 1NU6A 2YJZA 3PIIA 3ND7A 1VE1A 4ZQBA 3EC7A 5FL3A 2QN2A 4QWWA 3BQNB 1QRSA 4MA4A 1XAHA 4OJNA 2X15A 4YRTA 3NAZA 2A4MA 3T3PB 3OZEA 3DMTA 3AJRA 3OLCX 2XE4A 1P9WA 5FOUA 4CR8A 3JZIA 5JUWA 4YRMA 3ZYZA 4IF4A 2FG6C 4XUEA 2ZQ5A 3PD0A 2H31A 2NSYA 1Z4NA 1MAWA 1UXKA 3D4NA 3MJVA 4JBGA 4LBWA 2A5FA 1IIRA 1VSUA 2R97A 4TYMA 5FP0A 1U2DA 2RCYA 1MAUA 2CNWD 4V0SA 5LXTF 5I9LA 1KZ6A 3RAFC 3A1NA 2YIMA 2YV1A 3AI1A 1BWRA 4GM4A 4RHTA 4G0WA 3KQWA 4MKIA 3JQ9A 3AVUA 4Q7EA 4MW9A 2BJHA 1MB9A 4LF5B 2A3NA 4YCCA 4Y3UA 3TDNA 1NF3A 3CNLA 3OTWA 3EOZA 1E3TA 2Y92A 5DE3A 2XVMA 3IL2A 4QQRA 4B79A 3X2FA 3G9XA 1SC4A 1VHDA 4MXDA 1OBHA 3FYUB 3QBEA 2ZOSA 3E3OA 1C4WA 5LYYA 4JI0B 1VMIA 1JQDA 4Q00A 5F64A 1CY8A 2GZSA 2IQIA 2WFZA 2XLCA 3AC0A 3EULA 1O97C 3M9LA 4TTPA 4CIWA 3PXEA 4J0GA 2VCEA 4BKPA 3V4RA 5D8DA 2C5BA 1EUDB 4PC7A 3RVSA 1XZEA 4DDTA 2VHEA 4R05A 1QDUA 3ZV5A 5B7GA 2D2IA 3ETJA 5JMWA 1PK7A 4JGBA 1THZA 3SJAA 4Q1CA 3SYTA 5JNUA 3H6GA 4DXHA 3RYCB 1XHEA 3MCZA 4NARA 4XWOA 3KHSA 3RE1A 4FDMA 3VDQA 3K8YA 3CR3C 5IKPA 3WISA 5LBTA 3KT6A 4LJ7A 1LLCA 4EG4A 1A8SA 4RKYA 3D4IA 4XPZA 2JZNA 1NBAA 1Q7TA 3AETA 4FEGA 1PP4A 1R7RA 3LC2O 3BL8A 3JVDA 2ETVA 2O2HA 4ZAXA 2IH2A 2B5WA 5H59A 5TDHA 1TA9A 1RWQA 2H57A 3RFTA 4BL5A 3V6LA 1E94E 1L7QA 1VMKA 1GPYA 2Y0CA 5ALRA 2F90A 3W5SA 3FG9A 2D1SA 1KS9A 1E9CA 1G55A 2H4HA 3DP9A 3FUXA 1N2ZA 4GH5A 4F4IA 1X74A 3C4QA 2O2EA 1R9NA 1RWBA 1XALA 3A36A 3PKZA 4WXPA 5EJ6A 1FVHA 1G7CA 5EMHA 4KYUA 3SNKA 2XJ9A 3BRSA 5IF3A 4X7RA 3AESA 3B2EA 2CT8A 4JSRA 3QQPA 1O6CA 4AQYB 3ONEA 1JDBC 3U37A 3RIXA 3RTGA 1R50A 4JNCA 4JJKA 3VU0A 3S8YA 1PJRA 4M8IA 1W5AA 4QBHA 5ALGA 4BZQA 4BCDA 4IIBA 5FOSA 5BQ5A 2V5AA 3RWOA 2O6LA 2OP0A 2ZJ8A 4DUYB 2MSCB 3HN2A 2J6CA 2E1RA 3CUTA 5K99A 4JSTA 1W36B 4FYPA 4CL0A 1K66A 2B34A 1NBIA 1RU3A 2YFYA 3HYNA 4HPJB 4MW5A 1XDDA 4XE5A 4RLFA 5EQDA 2BELA 3HLKA 4KCGA 4QBIA 4KSCA 4K5QA 2BDTA 2H2AA 2ZWOA 4AO7A 3E1KA 2YMPA 3QTBA 4JJ4A 1GWNA 4K9MA 4GOJA 5F7JA 5CDUA 4I19A 1DIBA 3MCWA 4KSBA 1B4DA 1VYTA 2A58A 4LJ5A 3F98A 4W6QA 4CEJA 4HKTA 1D6SA 1ZW6A 3D8TA 3DT8A 4BBJA 5CT8A 1WB4A 1Q1NA 3N39C 2ZWPA 1WD7A 4WKPA 3TI9A 1NXOA 2A30A 2H9IA 2Y3IA 2MWMA 1US8B 3GVCA 2P9ZA 4F5EA 5KKNB 4RIEA 2GEUA 5FORA 1FS6A 4WOBA 2HSEA 3NZEA 1GFZA 1SELA 1HYGA 2WIKA 5TARA 5HF8A 4KPGA 1Z6AA 3B1VA 621PA 4KLRA 1LB1B 6LDHA 1GZHB 2VH2A 5AVOA 2VAPA 5AW8A 5BNZA 1UWKA 3HWWA 4DCUA 4X9XA 1JFVA 1UODA 4YUXA 4CMBA 3R3ZA 2A35A 4GLLA 4GPTA 1RI3A 4MS4A 5EPEA 4DDHA 3U6BA 3ZDAA 3HR7A 2WMNB 5DIFA 4ZQEA 3HMKA 4NNOA 1U8UA 4ER3A 2M6KA 1ODFA 1AGPA 2R25B 3L1UA 2BN4A 3L7KA 4YUZA 4UHKA 5I7SA 2VOEA 3MCTA 3WRXC 1BXGA 3C98A 2QRGA 4OXYA 3SC6A 4KKXB 4CNBA 1XZLA 4I36A 2I9PA 2R8YA 1AB6A 1KR2A 2WWFA 4IJVA 5EXXA 4ZZ2A 2CLEB 4LSZA 5FPSA 4GR4A 4RPJA 1M8JA 1ZHHA 4UVHA 1QFYA 2VZ0A 5GPBA 1QKJA 1EFRA 2DUJA 3OQOA 1JKMA 2WQ6A 3I6BA 1NDHA 1M6NA 4D4JA 3D6UA 1NQUA 2IOQA 3GLQA 4UQOA 3G0OA 4YQYA 4EECA 4PGFA 5A2GA 3HSYA 3I6IA 5IU6A 2WF5A 2E4UA 5FO0A 4QM6A 1V6SA 3SQXA 1MXFA 5JC8A 1RXYA 2PT6A 4PZYA 5KWJA 4TMYA 1U31A 5JNRA 5IRCD 5C18A 4Y0AA 4JYZA 1JKXA 4B48A 1Q1EA 1T3HA 2FUEA 1JJ7A 1Y3IA 3KT8A 1U9IA 3E03A 3NKVA 4MKGA 4KMSA 3VFDA 2C2XA 1ZDMA 1KVQA 1PUXA 3AIKA 3OHMA 4M0DA 4YPOA 3D5TA 2PH1A 3AR9A 3CLSD 3TTTA 1WBDA 3Q72A 1C8BA 3CPSA 4KLAA 3KR9A 2V97A 3BL6A 2WTUA 3EIHA 3ZIAA 4H7PA 4ERXA 4QARA 1JHVA 2XVAA 4FC7A 1XZQA 3KEGA 1ZRNA 4PTZA 1CF4A 1C1XA 1XZPA 2W2LD 3OZDA 2X7JA 3P0RA 4P83A 3SP1A 4KR6A 4QTUB 4XJSA 4YV7A 5KOYA 1U7HA 3CR8A 2RHJA 3EXAA 4KQFA 1G21B 3OO1A 4RU1A 1QYVA 3OG9A 3STVA 2NXJA 3GWZA 4Y2UA 2IUUA 1DEOA 3X43A 1E2EA 5B7PA 5GIPE 3HY3A 4E03A 4W5NA 3Q85A 1QQ7A 4J0CA 1X0XA 1ANKA 4KXLA 2OK7A 2FPXA 4TRNA 4ZARA 3QHAA 4AYTA 1E3WA 1TZKA 1W7AA 4ZMBA 4L5AA 1PI3A 1WCWA 3G2QA 5IHXA 4EYSA 3AESB 2AWNA 4GE3A 3S1AB 2Y05A 1E7WA 5GMOA 2AF3C 2CHEA 1V7PC 1CT9A 1C4OA 3O7WA 3JATB 3CZ9A 3E5RA 1AXGA 1M2JA 1V16B 1YZYA 1AZLA 1UT8A 2VJCA 3E9EA 3NCTA 3ND5A 4MO9A 4O4LA 1Q77A 4D26A 4H77A 4FI3F 1OXUA 1L5KA 3T12A 1UZMA 3FLEA 4W5HA 4BFYA 2O3UA 3LVBA 3JPWA 4E2YA 2OA0A 4QRHA 4JHXA 3DC7A 2OENG 4ZYVA 5J47A 5K0EA 3P0HA 4B32A 1BDHA 3DOIA 3REGA 3ZDEA 3JU3A 4L7VA 1DWPA 2BW0A 3GNQA 1OZ0A 3TOZA 3V8QA 1R8XA 1E0DA 3IOCA 4ZDIA 1QV7A 1LK7A 4ND8A 2HJGA 1BKDR 4L75A 1NJGA 2PHZA 4JVLA 2WJGA 4I1IA 4R2LA 4OQYA 5DX8A 1P74A 3LZDA 3H1PA 5FNZA 1I2DA 3FYUA 3V7WA 2OAP1 4JB0A 2Z3ZA 4BRZA 5CCBA 1PHPA 3I39X 3KOYA 4JKYA 1X38A 2GEFA 2AOUB 4A82A 3VHXB 4Q21A 1JQLB 3KT0A 5K0FA 4V03A 1EUDA 4GFDA 4HWTA 1RQRA 2O7QA 3DKVA 2VIIA 3FZNA 3J7AC 4V38A 3OQPA 3P9PA 3WBKA 5ED4A 5BN5B 3E6AA 3IP1A 4MEJA 3ED5A 3IFSA 3CRZA 5FLEX 4AB1A 3WQQA 4EVIA 1BW9A 1E9DA 2CUZA 5FBKA 4JD5A 2XI4A 4DLZA 1GKKA 2NYUA 3MTIA 1OWLA 4Q7JB 1GQYA 2GYYA 2DFVA 2R4UA 3VPBA 5EWMB 5ELLA 1WF6A 5AHXA 3SXJA 2BM9A 1DELA 2IDZA 1GTMA 1ZBQA 1GADO 3HVIA 2X4LA 4G81A 4LRYA 2O8CA 2F59A 3IPRA 4D96A 4K9KA 2X0NA 5DNUA 1NXSA 1U4NA 3RVKA 4BMDA 2ZFUA 1R64A 1UDCA 3MS4A 2WYHA 5E7JA 2DCUA 3ZOZA 1F8XA 1KXZA 2JW5A 1RYNA 2GPSA 3SR4A 1M34B 5E3HA 4QPZA 1XEXB 4G5SA 2ZI7A 4K3UA 2FGKA 4JVNA 5GV8A 4D0SA 1JFRA 1LBSA 2Z8YM 2J6BA 3HV2A 3OZTA 4IDFA 4O02B 3PVCA 3G2PA 4GVXA 2IYZA 2V1XA 3PXAA 4ZXFA 4BX2A 3WNZA 4RE5A 3B5IA 4QDUA 4MCJA 2W6JD 3VPDA 1E2DA 2H7YA 1KZ1A 5H3HA 1K75A 3BKXA 3L04A 2ORYA 2NV6A 4BZWA 2JHGA 1AXEA 1SBIA 3H7AA 3LH5A 2R6R1 1DZ3A 2Z9CA 5TQ2A 2BONA 4KRYA 4N6OA 5JASA 1U0GA 4MWGA 2O9JA 4EWLA 4FB5A 4D80A 3WGUA 1Z4PX 4W5OA 2DETA 3E5HA 4IVPA 3OE5A 3ZNNA 2JIOA 1NVUQ 2NUPA 3BMNB 4FNAA 5F77A 3WYFA 4FE4A 4TV8B 2VNIA 1T91A 2Q5EA 1GV0A 3D8UA 1AKUA 1H5NA 2GAIA 2ZE5A 3HUFA 1Y3HA 4Q3LA 4RLHA 2RHCA 1A8PA 3HI6A 3G7UA 3IPLA 4MPPA 5EIWA 4DQ0A 1O0BA 2H63A 4R6XA 4OHPA 4ZCSA 4PIMA 5DNVA 4XX0A 1GTG1 4AJKA 3ORSA 4PLTA 1YL5A 3A1VA 3BXZA 3NOOA 4OIMA 3BD8A 4HR7A 4MDYA 4MWCA 1STOA 4PYLA 4MDEA 3OQHA 2ZRGA 2PL3A 4AULA 1OWPA 4LSMA 2ZKIA 4HLQB 3OJWA 2HFKA 3CS3A 4I4TB 2BWJA 5J4VA 4BFWA 2BKEA 3ZDBA 4C04A 3AKZA 2AVDA 4JN6B 4YMTA 2FRXA 3ZC3A 1R6TA 1IQPA 1DZIA 1B6RA 3AB7A 3ZXUB 4YLGA 3SF0A 3EC2A 3IERA 3NLLA 3ZDQA 1CEXA 4CNQA 2J67A 4DARA 3JX9A 3ZWNA 4U7PB 3WMEA 4F21A 2ZXEA 1Q5PA 2VK4A 5FTWA 5MHTA 4F2DA 2FR0A 1I14A 4BMVA 5LMCA 4LE1A 3AM5A 4HI0E 2R00A 5DI3B 3ZHUA 2C7QA 2FW7A 4QXQA 1E0KA 1Y1KE 2ZPUA 1JZQA 3ZGNA 4BQFA 2PLAA 3AZPA 4K46A 2OG1A 3I4FA 1EUCB 3B82A 4K40A 3TVTA 4BX0A 3NVDA 4EG6A 2ZTVA 1Y3FE 4TSFD 3KZNA 3ZXYA 2VNJA 1K7YA 2AXEA 3VX3A 3LYAA 3TGLA 4BYGA 1QF9A 3QFTA 2PUVA 3BAFA 1V1RA 2QZZA 1JAHA 1FYDA 2YY5A 3LC7O 2B1RA 5CAEB 2IU4A 2WUGA 4MX8A 1PSZA 1RRVA 4FFWA 1ZXBA 5AKXA 2EBWA 5LP6C 4BVFA 2ZWAA 4JYMA 1C9YA 2AIRA 3NHLA 4QGFA 1I6KA 2C7BA 4P4SB 4WLEA 2BE9A 2BISA 5BNTA 4NYMQ 1Q3KA 3U40A 2QSYA 4WZ6A 2GI4A 2OB1A 4IZIA 2OM6A 3UEOA 2L17A 2C0CA 3V00A 3CLVA 3TZKA 3ODGA 1IN6A 1X9IA 4RA9A 1UBCA 1SXJE 3DHNA 3OOHA 5SYNA 1O6BA 1DDIA 3CNBA 3DZIA 4IDPA 4RGBA 4XUDA 3O73A 3BGVA 3OM8A 3WYCA 5LUBA 1JHXA 1W6RA 1ZITA 3B9BA 3NNDA 1WSBA 5L45A 3KAKA 2C94A 2XOKA 3CRMA 4Q01A 4BV8A 3ZE8A 4BVHA 4RS3A 1QO7A 2A59A 2WWIA 3C0KA 4M1MA 1QVRA 2VYCA 1IUPA 4HZGA 1WUTA 4L4YA 2PU7A 3AY0A 7REQA 3BIWA 1NOIA 4WCFB 1HQDA 4FYXA 1SXIA 5I7RA 4TUYB 2GK4A 2ZTUA 2PKXA 3NBZC 3L0CA 4HFNA 1QOPB 1J2RA 1ZX1A 2NNLD 3R0XA 3DEAA 4YREA 4ITRC 3TMAA 4BNLA 4YCAA 2V7QD 3EVCA 3F67A 1C0KA 2ZSEA 2PT7A 2P68A 3F6BX 4GLOA 4I5FA 2QORA 3D4OA 3D64A 3HWSA 5AW1A 2YICA 4OH7A 1J1IA 1IDOA 3BULA 2H6EA 3L8EA 4XB6B 4C5BA 3JARA 4DADA 5HKOA 4A8PA 3QU2A 3FCEA 3WR5A 3ESBA 3T9DA 4YYZA 2NNWB 3OMWA 4NZYA 1SVNA 2NXWA 3GU3A 1NUTA 4ZGGA 1DGQA 1QPGA 1R6BX 5IX8A 3SXPA 3PI6A 3RHFA 1RWWA 1YKGA 3AYXB 3SLGA 3SZLA 3VH1A 5LQJA 5B58T 4D9EA 2QMEA 2PT5A 3NBQA 1HDGO 2VRWA 3RIEA 2WJIA 2QZSA 2CL6X 2XMSA 3F97A 1SC1A 4M8SA 1B43A 4N8EA 4YFVA 5IM4A 4YJ2B 3GK3A 4PYKA 2LKCA 2OYSA 3ABRB 1P1CA 2I4NA 4G0PA 1IQUA 1DX9A 4IHJF 3T38A 3NEAA 3LBNA 5JQGF 4Y2JA 1WMSA 3HH8A 3NAQA 3OZAA 2D5BA 1JWBB 4JQCA 4EZBA 4URUR 1X7ZB 3P71T 3QVGB 2EZ4A 2ACWA 3BREA 4KN5A 1N75A 4NZPA 4H3VA 1BVHA 2J0UA 1I33A 1FFWA 2R44A 4HQRA 4CV3A 1KY2A 5E3IA 3IDZA 2AFIE 2ANBA 1AZSC 3DBRA 1X7XA 1XUOA 4I3GA 4NS1A 4PE5B 4BO8A 3QA3E 4FOTA 2YC2C 5AM3A 3TLZA 5FD8A 2HK7A 5F52A 3AF3A 4FXOA 3I5AA 4WH0A 1SQ5A 2OAEA 1KVTA 1PGNA 3LBAA 3BRQA 2FR8A 4NFHA 2Q0QA 1AY0A 2IPOA 4LI0A 4MRMA 3AF6A 1GPBA 1YDGA 3PLNA 4O0MA 2QZ9A 1C1YA 3EIEA 1DP4A 3NVKI 4JYCA 2Z5FA 1JSXA 2PWYA 3DT9A 4NZOA 2BFEA 1DEKA 1N0HA 2O7SA 3W2TA 4ZZIA 5BOSA 1FB5A 2F1RA 4XR9A 2EP8A 3ZCQA 1B73A 1P62B 2FEXA 4IGIA 4EHHA 3KZVA 1EWRA 4OYHA 3FLMA 3WBJA 2C31A 1TTQB 3TQRA 2AG8A 3H97A 4GMHA 3K0AA 8ABPA 5JSZB 4GR9A 3UJ8A 1NT2A 1K6JA 3QW4B 3H86A 5F76A 4Q4HB 4E1BA 1DX4A 5FXMA 3WWZA 1H42A 2FQ1A 4C0SA 4MVJG 2UXDB 5BSMA 2ZJ3A 4ZV4A 3ICVA 2DEUA 4RGYA 5CX1A 3JQ7B 2DPMA 1Y3BE 3PC2A 1I3MA 2J5BA 2P9BA 3T3HA 1KFCB 1CUXA 4WY5A 1VGRA 2QROA 2XCSB 3AUKA 4N5NA 4M49A 1ECBA 3NKFA 2OKGA 1X1BA 2CBGA 4JIGA 3T9CA 2BFDB 4LBYA 4PSVA 3M1AA 4BFVA 2QJWA 1TLTA 2NO5A 3VTAA 1FXUA 1A2KC 3E9ZA 4UUOA 5JCPA 3LM8A 3IQWA 2PKCA 4Q7LA 1BMQA 1KO5A 1SQGA 2GT1A 2F9FA 2RHWA 4PXYA 2BT4A 1T9ZA 3L0ZA 3TG8A 1NNSA 2OO5C 5DJ5A 3UB2A 3KJHA 4LY9A 4O2BF 2Q7DA 1SCKA 1ZLYA 4NU8X 3MAGA 3TQFA 2XZDA 1YR9A 3GLGA 5KO2A 2H4YA 4N41A 4LZLA 1M74A 3S4YA 2HADA 1EM8B 2O4CA 2OT3B 3EEQA 3UG6A 3CEJA 4R81A 5IC4A 4W9MC 3JQEA 4P7GA 5G1OA 3VH4A 3EB9A 2NQTA 3GAFA 5IZCA 5HGXA 1K98A 5CNKA 2FX5A 4E2FA 5HQ3A 1A8QA 2X23A 5BN4B 4CLOB 1L7PA 2BF7A 1R0WA 2CSXA 2QBYA 2ZJ4A 4KDRA 3UATA 2WKSA 3BM5A 1DOAA 4CM4A 1D1QA 1Z18A 2X1MA 4ZYXA 2VJAA 2H1SA 1U2EA 3EQ9A 4JA2A 5HS4A 4CI9A 3FNBA 1U6JA 2ERXA 3P96A 3ZGVA 5FAKA 3E1SA 3WYBA 1QVAA 4B34A 2ZIXB 3T7IA 2QLTA 1KJJA 4YMSA 1JEYB 3VR5H 4WSOA 2ADFA 2DHRA 1PT5A 4BN5A 2WTXA 4DUGA 1G20B 4TXHA 1RJEA 2P3OA 3Q1KA 2A57A 5A9SA 2FWPA 4U63A 3AVPA 2LRHA 5FBQB 3IV7A 3HU2A 1HNXB 4GL2A 3OEWA 2BZGA 2V4ZA 2GZ3A 3DMRA 3LV8A 3T52A 4QPPA 1JQJC 1YU9A 5IBPA 3FHTA 4FWIB 4Q7QA 1MUUA 1PIWA 1X3SA 4U5QA 1CY1A 1SBHA 3GFOA 3PB3A 2VXCA 4WDQA 1KHTA 2WJZB 3SDSA 3DULA 4KAFA 3RBXA 5DGDA 5LYJF 2V9ZA 2XNHA 4HYEA 3EDMA 5FV4A 3ORHA 4RKWA 1LTQA 3BIOA 4QEDA 4REOA 1R4ZA 1KVUA 3ASUA 4U7JA 3UJBA 3U60B 3E1GA 2HRQA 3ZD8A 2RH4A 1XYYA 1E6UA 2DBQA 4G4GA 4MQUA 3GJ6A 2ZE6A 1GITA 1K6XA 2BV3A 4FWBA 1U0SY 2ODAA 4G85A 4J94A 1SR8A 4BNUA 5KBYA 2Q1XA 4ND1A 4QRIA 3SHTA 2JCYA 4BMYA 1LPPA 1EWQA 4JCCA 4PLVA 3OJXA 1WXWA 4X3OA 3UXHA 4MKHA 2PUWA 3DEKA 1GG2A 1JDJA 3GEBA 3KPJA 3EGDA 4H16A 4M9XA 4D3DA 5BP7A 3H1GA 3KQVA 3ROEA 3H99A 5L3RA 4B09A 2C7GA 5ENDA 2H0RA 3AUUA 3TUZC 4OCZA 3QLEA 2EFEB 1N9ZA 1XMVA 2YZMA 1Z38A 4MQFA 3WZLA 5LKRA 3F4KA 2CJWA 4EHNA 4JC5A 4LS3A 5HBRA 3KZ1E 1LPSA 2DT5A 3NJ4A 1I94B 2VAMA 3NIBA 1V4BA 1XXHA 3LXMA 3PQFA 2W2QA 4OV6B 1Z7GA 1JP7A 5JSUA 3CVWA 1LDYA 5JLJA 1FUKA 3TKAA 2ODBA 3AOGA 1RC0A 1O94C 2FWIA 5C7YA 4OQ4A 4PPYA 1JHDA 3H13A 4JP3A 3UJ9A 1YWGO 4OYYA 2CK3A 1EA7A 4UTOA 4K05A 5LOVA 2XVXA 1PW7A 3B51X 4G36A 3S28A 3PJEA 1J25A 1XROA 2VFAA 1SCUB 1NATA 3OLYA 3KTAB 4JOBA 4NICA 3SBDA 3O4HA 5TMBA 1QR6A 4JC0A 1U90A 4XQ9A 4B33A 4CQLB 2D59A 5HUHA 4OLHA 1SCDA 5CG1A 1M6VB 1Y4ZA 4U4AA 4YAOA 3O38A 5TT1A 4OGGA 2HK6A 5AOVA 2VDLB 1D1SA 1H6AA 1SIOA 2EBUA 4FHEA 1P4AA 3RYTC 4EL5A 2A1TS 4B9EA 2C4UA 2HIGA 3FXAA 4HO1X 3WGLA 4BIMA 5JCXA 3VZPA 3KD2A 4TTTS 4X8LA 2RE8A 4FDAA 2QLJA 2DECA 4BEBA 2P35A 2WILA 4IZHA 3MFQA 3UMRA 1V1MB 5TQ0A 2W7TA 1ZH2A 2OLEA 3DVAB 5D3ZA 1PWHA 4BFCA 4D56A 4EY5A 4IDOA 1MBZA 5FADA 2ORWA 4UREA 2V0GA 2BVNA 5AOBA 4B5KA 1IBKB 1KZHA 1KI8A 1SXJA 3USES 1GGHA 1NQVA 3V8BA 3RWBA 2O23A 2OGSA 3MT7A 5FCDA 2ZUBA 3VOAA 3ZWMA 4JI2B 1R74A 1GRRA 1OBFO 2LIPA 1RBYA 3BKWA 1E77A 2WFMA 5DN9A 2O8FA 1T36B 2F3UA 3FI0A 1XEWY 2Q6KA 2Y4OA 3IT2A 2XGOA 3Q41A 3IXLA 3UJPA 1JJIA 1G8MA 2QTBA 3WHLA 4C0WA 1B00A 1TCVA 5A4KA 4PLZA 4BRUA 3JQ6A 3V6MA 2IV2X 2ZAIA 2C5LA 1JIUA 1Y8AA 3ENQA 5A3RA 3EZ2A 3TJMA 4GVLA 1U9ZA 1MN6A 2ID7A 2HBZA 2QP4A 2UYYA 1MX1A 4GZ6A 1PS9A 1BAPA 4OJTA 2B1GA 2Q3CA 2RSLA 4LDQA 4NEGA 1C9JA 2VH1A 3TIVA 4FHFA 2CWWA 1PZNA 1XRRA 3JAWA 4UDNA 3OPYI 4EI7A 2JF0A 4GICA 4LG1A 3ANXA 3R7BA 1HLFA 1Q3TA 2X86A 2DPXA 5FA5A 1OKKA 4Q02A 4UQPA 1UAAA 2I6TA 4O4IA 3IODA 3GLIA 4NBWA 3U6KA 2AFVA 1LBHA 1IEWA 1BS1A 1EHYA 2VYND 2YFQA 4N7JA 1GLNA 3SS7X 5KNDH 2JCXA 5L3SB 5KREA 3H2SA 4DCSA 3A27A 1N6PA 4EY4A 1FP2A 5JSKA 3HFJA 5JMTA 1KYTA 5FUBA 1RQXA 3EFEA 4MNTA 4JI5B 4DPLA 1HEUA 1D5WA 1TQ4A 2YN0A 4HFRA 2C2MA 3A6HA 2AN9A 4Z4EA 3GH1A 3PBKA 5KSYA 1I4DD 1TJPB 3TRHA 2YHIB 4AZ3A 2OBXA 2C9CA 4IIFA 4YQZA 3FIJA 1RAIA 4AI6A 3FF4A 4BP9A 4RZHA 3EBOA 3ZQJA 1PR4A 5ICFA 1LPNA 4K6OA 3H42B 4D44A 3EXEA 3U3ZA 4D3YA 3EPRA 4I5DA 1IHYA 3IMKA 4C14A 2ZJ0A 5LSAA 3T9BA 4TQAA 1N3IA 3O4FA 1HWYA 1W88B 1BEZA 3AR3A 1P80A 1SOMA 3NBXX 2FNAA 4I50B 5EERA 3ZH9B 1NTRA 1A5ZA 1VPDA 3I34X 1IM2A 1EAMA 2QVXX 1BD3A 3IOEA 3I3OA 2EP5A 4HATA 4KUHA 4RF3A 4RHXA 4ZQGA 4B6JA 2V54A 2CE7A 3BG5A 1X8XA 5JJCA 4RD6A 1QZUA 2C4TA 4D8XA 1A5TA 1L1EA 2IEBA 1SUCA 2JI7A 1V3UA 3IEPA 3KQTA 5CA0B 4GRAA 4X0EA 1NP7A 5JVDB 3AIOA 4ZI3A 4PHHA 1HFKA 1NR7A 3I9FA 1FOEB 1Y8QA 2V65A 4XVCA 4DXDA 4LOJA 4RJIA 4HNUA 4M1OA 1FW6A 3HSSA 3UH0A 2EBFX 4C2BA 3LA6A 2VRCA 3KWLA 5AO9A 3FE2A 4WXEA 2Q2NA 2PMWB 1S3FA 2RC6A 3PVZA 4D57A 3H11B 3NTQA 2QTTA 4M36A 5DLQC 2BUBA 1P0CA 4L07A 1I4LD 3X44A 1BOFA 4CETA 1HOTA 4C0JA 4R1LA 1F38A 1RXUA 1VKZA 1I6WA 2EHJA 3WKDA 3R41A 3EIWA 3KUKA 1HMYA 3M34A 121PA 4AKGA 3JD1A 1EXVA 4OFXA 4ALLA 4YRSA 2J5KA 4FUQA 4E30A 1U0BB 4YLYA 1KEUA 2H0AA 3P45A 1RYYA 3RU9A 3UT6A 2O59A 1DCTA 1E5TA 1W2WB 4WZAE 4ZVPA 3RSQA 1K5GA 3MWEA 2FPUA 5C35A 1H8ED 2H08A 1EDEA 1ZQ1A 5DTIA 3W3AH 4AJOA 3VGJA 5DOVA 2GPAA 2X8BA 3QM1A 4H15A 4P4UA 4E14A 1JZSA 3N6VA 9ATCA 5ECGC 3LCMA 4HQ0A 2CXOA 5A1TA 3PJDA 2R6HA 4HRYA 1E3DA 821PA 1ECLA 1NWCA 3Q15C 3K0CC 2G08A 2F3RA 2YQ4A 1MDFA 3HKCB 4PIVA 1BE8A 1P45A 4Q82A 4TQUS 5AHWA 3WMGA 3ZJUA 1OIVA 2BZSA 2CCKA 3LHDA 3R20A 1JEQA 1RYHA 3H0CA 4G5YA 1KP3A 4O4JB 4LECA 4R9VA 3PC3A 5MGBA 4JL5A 1QKIA 4P3PA 4B80A 2X41A 2GZ2A 1TO1E 2MR5A 1ISRA 1M8PA 3QWIA 5CYGA 3DAPA 3GFFA 3T7KA 1NXTA 2FRDA 4RQBA 4V1CA 4IPTA 3UMBA 4D82A 1NQOA 2J7PA 3EZGA 1O77A 2QS9A 1MJHA 1TM7E 1WW8A 3SQMA 4E08A 3TTSA 2IHJA 2X5KO 5I4BA 2QRZA 2C2WA 2QQ0A 3LPCA 3VHXA 4C76A 1C30B 1YBMA 3MGKA 2PMBA 4HB4A 1E1KA 4MUXA 2J4FA 3RJ5A 1AKYA 3KVVA 4G3XA 4CV0A 1E4EA 1C7RA 1N7JA 3LHSA 5BN1A 4F5DA 5BR8B 4CFSA 1NFRA 4Q9LA 2VHXA 4E33A 2VJQA 1MC8A 1UBOS 2AI1A 1RKBA 2WE8A 5IDWA 1WOMA 1P91A 1RJWA 1GTL1 3B8EA 3KAQA 5ICMA 1A4RA 1RMYA 5CFNA 4MR7B 1QG0A 1JAYA 1SCIA 1W1IA 2SKEA 5JWRA 4ENTA 1RM4A 2O1SA 2KM1A 2WEKA 3CB4A 3DE2X 2RGRA 3A32A 4ZEVA 2QG9A 1X7YA 1ULAA 4FTWA 4GPBA 4PU0A 5IK2A 2QPOA 3N2EA 3FAZA 4UEOA 3VZDA 4PPFA 2WLSA 1HL3A 3O0TA 1KY4A 2F8LA 1V16A 3PXCX 3CURA 4R41A 1X8KA 1OXVA 4BLOA 5K05A 5EI5A 5FFNA 2B4QA 3QVOA 4KIJA 1PTJC 3CO5A 1RC8A 1CU1A 1YHZA 1N6IA 1M72A 2F1KA 2OB2A 3VSAA 2ZIAA 4RVSA 1JFFA 1FRZA 1P2TA 3LC0A 3SX4A 2I7XA 3U4AA 5HRCA 1F6WA 4YRLA 3WB0A 5DXFA 5JY1A 3ZCSA 1G0NA 4L0QA 3ESZA 2X8WA 5JZOA 5EP2A 1ZNZA 5DSZA 3UT5B 3TRFA 1JIVA 3AL2A 4MKZA 5DEIA 5IW8A 2G1UA 4LMRA 2VBFA 5A4JA 3THYB 5T57A 1PG2A 5IKOA 3T7RA 4XRGA 3KFLA 4OSPA 3A7EA 2XDAA 2XY4A 2YHAA 2QTFA 4ZDWA 5BURA 3MXTA 3NXSA 4FCWA 4YASA 3VKVA 3NUQA 2IY7A 5EP4A 5GADl 4CTNA 2VWHA 5DOZA 3QVUA 4U6SA 4BAUA 4EMTA 2PX0A 1PQ4A 2H07A 1T15A 2H18A 4CIBA 2HSJA 3EGOA 2V6IA 4L4XA 2Q7OE 3K8OE 3QA9A 4RJLA 1F0KA 4ZYZA 2YCBA 4MRAA 3HCOA 3O26A 2CHGA 3Q9NA 4DC9A 4LXQA 5KX5B 1Z0DA 1K9SA 3GGSA 3R77A 2FFBA 1PBNA 3IXMA 4E32A 1O6ZA 5KWSA 3OF3A 3UQYS 3QUTA 1OXXK 2DFNA 4B81A 2O2IA 1UDAA 3K32A 1T35A 1HOXA 3L06A 3I8SA 4II7A 4XTRA 1OLSB 4LNUA 1EDZA 1GQFA 1OGIA 4Q24A 4CLXA 1ONBA 5EIEA 5KTKA 3DBHA 3I2KA 1YJAA 2YYYA 1KK2A 1U99A 2J3LA 3CKYA 3KLOA 3EG9B 4HJRA 4HAUA 2C78A 3WHKA 3FSRA 2OGZA 4UM7A 3PUHA 2B99A 3QTLA 3PCXA 2I34A 2PMFA 4B9AA 3F0TA 2X0DA 1B0UA 1GSIA 3MBIA 4F45A 3OCZA 5BYBA 5AVXA 2ZUSA 3ZD7A 4H4CA 1EP1B 3OWXA 5LPNA 2ANCA 2CXXA 3M6UA 4XLLA 2PUAA 1SQ6A 3RV3A 1XP5A 3CGWA 4PRYA 3JQFA 4CHGA 3P9NA 1LNSA 2WPDD 1G2QA 4BC1A 5BQ3A 2XMGA 5TMPA 1MW8X 2FUNB 3T35A 4NPCA 2PR7A 5FPYA 4D45A 3IRVA 1PT8A 2VDUE 4Z51A 2NVUA 2FZKA 2IS6A 4F6RB 1LSUA 1ZUNB 1OWOA 2IPXA 1X9HA 2X0EA 3WAJA 2P62A 5EC8A 1E3MA 2HBQA 3I2YX 3NNSA 1FQJA 4BIIA 1UOQA 1ISJA 2OZPA 3FMOB 1JE1A 1TM2A 3PGA1 1BFKA 1EWTA 1PV2A 5LDDC 1PNOA 3QF7A 4OYLA 3MPOA 5IMSA 2JI8A 2JLYA 1MH9A 1U1GA 4UNPA 3L4JA 1DS6A 3QWAA 4L72A 3LRXA 2HHJA 1YRLA 5I7AA 4B6OA 4GC5A 4G0QA 5IFKA 3DFUA 4MVJA 3OJ0A 1P4RA 2DHQA 2QI9F 2H2FA 2XGMA 2FSFA 4X95A 5ICGA 1KE1A 3QXJA 1UWLA 2RB4A 3L6EA 5CDYA 5E4JA 1E2IA 2CMKA 4YAWA 5DW0A 1KC1A 5IEBA 4JFAA 2CD9A 1N6NA 3D0QA 3T9EA 2YWRA 4N3NA 3DZDA 4GOLD 3VDNB 5CBPB 2X0RA 3WAGA 5AUOB 4CM9D 1OHHA 3LQKA 3DEFA 2ZBGA 3DUFA 4HPWA 3M6MD 4O0LA 1I4TD 1MH1A 1B0ZA 2FFQA 2GKGA 1FJHA 2PE5A 3EF1A 1EIZA 1XFAA 4UPDA 3QQ5A 1UEJA 1Z13A 3B1WA 3QY0A 3MSCA 1NV9A 3OT1A 1H1LA 4XARA 4DIMA 4HTAA 3GRKA 3PT5A 3U3OA 1Z2CA 2PMDA 2RGYA 3ISJA 3AVTA 1Y7HA 4YECA 1QIFA 3RSHA 3E81A 2ID8A 4PHTA 3W5VA 5HKKA 2G04A 4P81A 3UMSA 3EPJA 1GNVA 3P5SA 1QQBA 1EVQA 1ZXLA 1QGDA 4M3NA 1UL1X 2IGTA 5EIXA 3FVRA 4TVSA 3ZKAA 2UUAB 2RBKA 3ROXA 1V1RB 1FU7A 4R4JA 1RADA 4D5EA 3EZXA 5FPTA 4PXAA 1T4DA 2PPLA 5IULC 1BOOA 2DWOA 3H1AA 2HA2A 1YQTA 2XDQB 4JEUA 2OV3A 1NYLA 4LSWA 3W4JA 2IH4A 1FMJA 1EX6A 2AG1A 3BMXA 3NAGA 3H1EA 3ENNA 3NOXA 4H7JA 5GZ6A 4NE7A 1HTTA 1EJ6A 1OKKD 2UYGA 1V8FA 2RJNA 4NZZA 1Y1PA 2HU5A 4B4VA 3UOGA 2XTNA 2WIGA 1PJ2A 3ISVA 4IUYA 1T1SA 2J3HA 1N2HA 2D62A 2QV7A 2GZRA 3GMDA 4R2KA 4ENPA 4FFLA 3GVPA 4MQ4A 5CU7A 1E3IA 4QOJA 1X2EA 3QE4A 3T1OA 1EB9A 1LRJA 3HJCA 3SHVA 1U3VA 1H6DA 3ICWA 4E5MA 2C4VA 3W8EA 1V95A 3KOZA 2VYVA 3PZRA 1FY2A 2VK2A 2BGWA 4GPEA 1DDOA 1XA4A 3ED1A 4LOLA 3ZWXA 2ZTLA 3OZIA 3VKGA 4RLSA 3R3JA 2RGDA 2OM2A 2PBZA 1RQ7A 3KSBC 3U0BA 4P1ZA 1DBQA 4PINA 1I10A 1GTJ1 3X1ZA 4UM5A 1A0OA 4IDNA 1JTVA 5LUAA 4NDAA 4CT4B 5G02A 4NI5A 1ZAKA 1UC5B 4CM1A 1AQLA 3G82C 4YCLA 4AZSA 3ZOKA 1RI5A 1BX1A 4IQ8A 5FOVA 4IV5A 3CIOA 1J42A 1FTGA 1WBJB 3ZGZA 1A7AA 3BIXA 1OD6A 2XB2A 4R84A 3IE2A 4JY7A 3RQSA 2E55A 3FWPA 1XU7A 1Y1SA 3I09A 5BRJA 1GCGA 3IMGA 3M6IA 3TXYA 5HMLA 2AN4A 1RQPA 4QHYA 1VIAA 1FS4A 1HKUA 2PSFA 5F51A 2JAQA 1L7MA 4G1MB 2GZMA 1DWOA 4DG5A 2B8WA 1JA0A 1KF0A 4WI1A 4QM7A 1QNLA 4GXRA 4ZC8A 4QQKA 3HU1A 5CW1A 4B4WA 4D9NA 4YY3B 3L2OB 3G5UA 5JFTA 2O5VA 4F11A 3HKDB 2P6NA 5JJLA 3N2LA 5EJ2A 2NTEA 3RRMA 3RAJA 4YRAA 4PYOA 1EIWA 4CIDA 1Z4KA 1GYRA 2XD9A 3PDJA 4GDMA 1FX1A 4I4CA 3T8YA 4QAQA 1Z6GA 3LPLA 5C4MA 2PZBA 3BE8A 4RTQA 1L4MA 4QA9A 3IOMA 1SD5A 3ZZ0A 5HHTA 1XJWA 1BX0A 2XMRA 4IH4A 1H2XA 4LRTB 3HUUA 5AJZA 4YDSA 4E5DA 4QGSA 2OVBA 3DBRB 3MBKA 5KDDA 4XFKA 5AVWA 2EJWA 2Q07A 4DQDA 5DF1A 1PJAA 4WA8A 5AOCA 2JIZD 4D7AA 5DSXA 4YALA 8LDHA 1SM4A 2YYSA 3COWA 4KDFA 1C50A 4NU5A 4CVNA 3PEYA 2WD9A 1WKBA 1XD9A 2PBLA 1Y6JA 2DPLA 3A1WA 2Q5CA 1XCGB 3F5QA 4D8WA 4YT4A 1OC2A 2YX1A 4Y9SA 4B4UA 3U7HB 1JHAA 2F3PA 3NONA 4X8OA 2D1QA 5CYOA 1AIPA 3VYWA 4DANA 1PR1A 1QDLB 1RAEA 1J0XO 1JJAA 2EEPA 1U9YA 3TAXA 4M8KA 4EHFA 5FOQA 1XPOA 1NRJB 4TPKA 3TVDA 1A69A 4KOAA 4JVOA 5KYUA 1I7QB 2Z6UA 1E3JA 1F5SA 2WDZA 3KKQA 4AICA 5I8WA 1GZ7A 3UC5A 3M6FA 1NQXA 2D7JA 2YASA 3CRVA 2JCSA 5J9FA 2WG2A 4DKXA 2Z5VA 2ZPAA 3NM6B 5LP1A 3E35A 2IYNA 3PT9A 3N8DA 4WADA 2SKCA 5L8VA 5JJ5A 2PZ8A 4EENA 1D2NA 1Z6YA 2LKDA 3TW4A 2WV7A 3FMIA 2IEAA 3QU5A 1IHPA 4Q9NA 1U5AA 3FRIA 5FL7D 3RUPA 2QYTA 3OQJA 4OREX 5JNTA 3W3AA 3UUFA 2ZB8A 2DX7A 3A58B 3ETEA 4YCDA 1JH9A 3I1JA 1QYXA 1WPXA 3OJFA 4ARZA 4LXIA 2DRIA 1HLPA 2VT3A 3A3OA 5PNTA 3WLSA 1DAHA 1V3VA 1DC3A 1BXZA 1ISSA 1HFEL 2JIDA 2O2ZA 3ONWA 4G86A 4H6WA 5TMEA 2A7XA 3TLGA 1U2RA 3U3KA 1ZLXA 1NMZA 3D6TB 1YIOA 1U1EA 1VB5A 2C2OA 2QRVB 2YVLA 4W8GA 4MB2A 4H3HB 1H9CA 1BROA 2FLWA 3LYLA 3LDAA 5KX5F 2HQRA 1VE3A 3DOFA 3E27A 3QEBZ 1VHWA 2NTJA 4A26A 1K63A 1T9CA 3V55A 5LDHA 1NSYA 3EQ8A 5T4HA 5ITZB 1CPYA 2D0DA 2Y77A 1S6YA 1I7NA 1KO4A 3BEDA 4JL6A 2WSSA 4R68A 2DKOA 4KR3A 3F71A 1JTEA 1V5GA 5JC1A 3CYFA 1MDBA 1FDWA 4A10A 1QFSA 4RIHA 4EHLA 1P1FA 1WS6A 2G67A 1RZUA 1MOQA 4ZN6A 3FOFC 1T5HX 4H35A 4B85A 2EGUA 1KQPA 3HA7A 1RCUA 1OV6A 3HA3A 4FR0A 3BT7A 4HV4A 2TRSB 1WR8A 4J1QA 4NX2A 4GMXA 1JLRA 1TFUA 1V43A 1Z0SA 1G19A 2BMVA 3ZWQA 4FONA 5JMPA 1W29A 1I9GA 3QEKA 3PCRB 5AHOA 3EK2A 4YHHB 3C8ZA 4N0QA 4U0JA 3ETCA 5JAQA 5H3LA 4FYMA 1NVTA 1ZNQO 2Q6OA 1PVDA 2BGKA 3H9BA 3I5UA 3KOXA 3PWSA 1ZIXA 4M1TA 1OXMA 2NW6A 4IBOA 2DT8A 1QJ4A 1REQB 4R5MA 2P90A 3RFFA 1P2FA 4DR6B 4MW0A 3RADC 3CSUA 4K86A 2CD7A 4OLBA 5KOJB 5EKTA 1N57A 3ONFA 4PLCA 1PJSA 4PO1A 5KTNA 2SKDA 1XEXA 2Q3HA 2WR8A 2EX0A 4XYLA 2CV0A 4WKOA 1TB4A 2R86A 1IOZA 3KU1A 2WJ6A 2FDRA 1O97D 1T2AA 3LRPA 1U2SA 2QAGA 4RK4A 3UF0A 2J09A 5I48A 5ALEA 1YQGA 3EAQA 5AHRA 2QVYX 4PG8A 5IJ9B 2G72A 1QIEA 3PSAA 4FMCF 4GT1A 2QTLA 3EGCA 1YQXA 1OVGA 3FWKA 3PSHA 5CT9A 3TOCA 2AWOA 1MRNA 2W2TA 3NHAA 2Y1CA 1JHOA 1VA5A 2CDAA 3PQ6A 3CUEF 1EVZA 4GGPA 1TUEA 4KH0A 5KNCH 4AD8A 4BLSA 4ZTZB 1NQ5A 1ZHOA 4M6WB 1XMOB 1XDUA 2FPSA 2HA0A 1B42A 1RAFA 4D0NA 4B0OA 3MJFA 3JR3A 4UE2A 1DJPA 2Y4NA 3LPAA 1XL0A 1L5ZA 3AKDA 3IQZA 5JIBA 5CVEA 4P2BA 4B2LA 4G4IA 4O4IF 3EUFA 4HAYA 5EZSA 3BMQB 3K8QA 4IG9A 2WFAA 3FWYA 4FNGA 2XEXA 3CMCO 4RMIA 3X1MA 1D6NA 1HT3A 4MAMA 4P2GA 1KMNA 1TJYA 5U4QA 2O8NA 3R8FA 4RK7A 1Z2OX 1SURA 3N70A 5ALYA 3J81k 2HRZA 3TSOA 4B5LA 3L8DA 3ZEIA 3C6YA 3OP4A 2AOWA 4ND8B 1ULHA 4BGDA 4FZRA 2PK3A 2NYVA 4FFMA 3KQLA 4DR5B 2DUNA 3J81A 3H2IA 1OGJA 4KOEC 4DYDA 5C8YA 3Q3VA 2FVXA 1UM8A 1XMJA 3DOOA 3ANNA 4G09A 2DJ5A 1Z37A 2OXRA 1V8BA 4DQKA 3HPRA 4F72A 1KFJB 3H75A 4F8EA 3V8PA 1EI9A 4QULA 4YRPA 3R7WA 4KQHA 4BNDA 3QYPA 2F7SA 1DBSA 3BIJA 5KEIA 2PUBA 1DBIA 1RR6A 3KDSE 3SC4A 2IU3A 5K2MA 3TWOA 1GQOA 1X1CA 1W44A 3NEJA 4A0FA 1M34E 4FIZA 4EA9A 1UM9B 3RREA 4MEAA 1JPNA 5EKDA 3WSTA 1G4HA 2XV1A 4FQ7A 3QPCA 3SNHA 1ONPA 2PFGA 2IZZA 4UBMA 4DDVA 1GPDG 1Q0TA 1TQ6A 4ZVRA 1EBBA 1D03A 4EB6B 1IHXA 2C3OA 1GUDA 4L9SA 4PTYA 5JJKA 4MMXB 2IEIA 4COOA 1K08A 2C59A 3B85A 4IFEA 2ERYA 3PUWA 3BWXA 3OCVA 3WHPA 3ZQUA 1HSZA 2FEMA 4W1QA 1KIMA 1W5BA 2IXBA 2XAUA 4PGHA 1ZH0A 4HB2A 1HQKA 4A2CA 4DMFA 4YAIA 5EHZA 4NJMA 2CDNA 2JAPA 5ALJA 5K3FB 3UT5A 5IFLA 2Q3DA 4AMBA 1OFIA 3AUYA 2C61A 4QRDA 4Q4JA 1UKZA 4REMA 4I9UA 3KJFA 4IM7A 4TMXA 3GP8A 1ZUWA 3I9LA 4K2HA 2ZJAA 5JPCA 3IVAA 1VHQA 1BXRA 3PC8C 3D0RA 3L8ZA 3JQGA 3H05A 2YIJA 2WWWA 3WNCA 2PEZA 1TECE 3LG2A 1BVUA 3D7KA 3ICCA 3VC3A 1G20A 2FSHA 1MABB 2W70A 3I28A 2QD5A 1NR1A 4GSYA 3OOWA 4I5GA 4U9HS 3VSCA 1T9DA 3MJEA 2HC9A 1RAAA 2QQFA 1IQ0A 1XVLA 4MHTA 2JAHA 4KKVA 2C2GA 4K9DA 4Q3DA 1XA0A 2Q62A 2WIJA 4IEEA 2R00C 1QPZA 1CUFA 1Z4QA 1FDIA 1HFWA 1MRZA 3PTZA 3QE2A 3WLQA 3O91A 2Y2UA 2B78A 5AT1A 5HQ3B 2AG0A 5KOJA 4I08A 5DBFA 1V2HE 2JGKA 5E9JA 1R4AA 1A77A 1IM8A 3KZXA 1IPEA 1JTFA 4A92A 3TM4A 4J9UE 2QN9A 4EUFA 2JL1A 5E1OA 4HH1A 1SUEA 4J7AA 5H70A 2CN1A 3U61B 1EZ4A 1R9JA 1DTEA 3TYXA 3O8QB 3WNBA 4AL4A 4CKBA 3T7DA 1SQFA 4FI3C 3HP4A 1PR0A 5GIOE 2F9MA 1WPGA 4PO9A 3ULKA 3VOBA 4ESEA 4F12A 1NN0A 2RGWA 3H4IA 2P77A 1V26A 3DD5A 1X1TA 2VN8A 4UBNA 2XIQA 5DNCA 4UEWA 5AJTA 1G16A 3LQ4A 4DVGA 1FIUA 1ENZA 4MPJA 2X6TA 2I9KA 1A2BA 1R6DA 3DMPA 3MOSA 5DHFA 4CMIB 3D3WB 1QONA 4WLFA 2VK8A 1QHYA 4Q3AA 5EHNA 3ROZA 1RRMA 3DMHA 1CZOA 1EKXA 1SVIA 1GA4A 2X0KA 3G6KA 3NC0C 2CLHB 3DDWA 3QFRA 1B15A 2FE4A 4LX8A 2WP8J 4BJ6A 5A7GA 4HWSA 4W5QA 3G2OA 4YK7A 1E59A 5FPPA 4AVYA 4OM8A 2GD2A 4KQ1A 4NBLA 2VP0A 1VDMA 4LPKA 2C2KA 1X92A 4TYPA 2DY0A 4LNUB 4JBNA 5BWBA 1VBMA 2FCAA 1SCUA 1Y7TA 2PL5A 4ZD6A 9LDBA 4HNGA 5TVGA 2ONYA 3SQNA 3JVIA 1YF3A 4LN1A 3SEZA 4RZIA 4K1LA 3FLBA 3LHKA 4AKIA 3QKIA 4MWSA 3TR6A 1BXRB 3AHJA 3KSZO 4NTZA 3IDAA 4EG0A 5K8TA 4TL7A 4B31A 2VSOA 2JIQA 1USVA 3TBHA 1CR2A 2J59A 3LPDA 4WVFA 4XWTA 3F8WA 1L4FA 1RI1A 1D0VA 4ER5A 2FEOA 2IYUA 1CJVC 3PIDA 3E8MA 1U28A 3OQIB 3IILA 4F7DA 2WNHA 5FX2A 3BZBA 1S3GA 1KKUA 1OU4A 2FKAA 4YJGA 5HILA 1U7UA 3AVWA 4GU5A 1SOAA 3A6LA 3HFRA 2I33A 4YP1A 4X8HA 1U9JA 4ZT2A 1LLQA 2O2XA 4WX2B 5K0NA 4PAGA 1NUUA 2OHOA 3IDQA 3N8GA 4IQ4A 3FUCA 2WK1A 4E5VA 3FTFA 2HXGA 2OSVA 2YOFA 4OAQA 4JJ7A 4OHMA 4L76A 4Z0TA 3HUEA 3IBYA 3PA8A 4ECAA 3QU4A 3RGGA 3ZUGA 5KTYA 2EF1A 1DPGA 3L4BA 3NOQA 4C0HA 1H1TA 3BFPA 3V2IA 1ZGCA 1DVRA 1UPCA 4NOKA 6AT1A 1JXMA 3HO6A 1S2DA 3L7IA 4HUQB 3SJZA 1XXHE 5JISA 4QPJC 3TAUA 1EFRD 1FUIA 1WTCA 1XDSA 2O4UX 2Q9CA 2R68A 1Y33E 4TOIA 4DA0A 2QYSA 2R5NA 1D4ZA 1NX9A 5EXDA 2PH3A 3MPUA 1E1LA 4NCKA 4RK0A 1NW8A 1XLWA 2B92A 2GNOA 2YDYA 3IMCA 2L19A 5LR6A 3EZ6A 1BEEA 1TM4E 2B2NA 1IY2A 2PKWA 3WNDA 4F2PA 5LP6A 3LRTA 3WBBA 3P2JA 2GD1O 1C3OA 3WGIA 4F4JA 5IVIA 4JR1A 2C9BA 3VPAA 3I23A 4JJGA 4JLDA 2P4SA 4FGKA 2FSVC 1NN5A 3KOUA 4M21A 4QLOA 1R9GA 2R5WA 3AKCA 4MS3A 4JBHA 3UJDA 5I9IA 4ILEA 1LDEA 2IUEA 1V7QA 4YDHB 2RH9B 1ZVVA 4FX5A 1S2MA 2Z5GA 3C16C 3I9V1 2JFUA 4I14A 4IGAA 3CE6A 3GLIB 1UWCA 2R48A 3PZBA 1HA3A 2N47A 2GYUA 1GZDA 2Q5OA 3HDGA 4GG1A 5LCXA 3UZUA 1F1BA 3V42A 3UAGA 4MUHA 2J9FB 1H2FA 3WFJA 3U7GA 1X7GA 4IJWA 3HDHA 1KAEA 2HHCA 2KQUA 4GXQA 4DZRA 3T3OA 1QGAA 4ABTA 4GBJA 3OFJA 3PEUA 2XDYA 3FFAA 4LEIA 4Y2VA 3TQTA 3AR6A 2OHIA 1VKNA 1GZSA 2JAOA 1MKYA 1G6Q1 4GQBA 5I3ZA 3N8KA 13PKA 3UKOA 4EK9A 5FA6A 2PJUA 3GFVA 1ZJYA 3L05A 5CLQA 3U3XA 4DMRA 4XJXA 4WK4B 4CF7A 1TNDA 3UHOA 4Z4CA 4ID3A 1HG0A 5LZ2A 1PQWA 3HUTA 4TT8A 1WRBA 4O4IB 3EXHB 3GO4A 4BNFA 4EJ2A 5I5EA 1E9BA 2G1JA 1IJEA 3ITDA 4KPFC 3IBFA 1P4JA 1Z7BA 3CN9A 3VZCA 1N9GB 2PQMA 5E8JA 4WOPA 1FX0B 1XTVA 2X0JA 4OPMA 3SSMA 1EZZA 5AVSA 4DJEC 4BPRA 4JI1B 3VJKA 1J8QA 4AY6A 3CF4G 5SZIA 4TKLA 1CUIA 1VLMA 2VJLA 1PZGA 3O4VA 4EX7A 3OU2A 1UJ6A 1WM1A 1YDFA 3MAJA 4H1VA 1XMPA 2V7WA 1XDZA 2HWYA 3KTOA 4ZRMA 4DILA 8AT1A 3UC9A 2I7DA 3G79A 4DIEA 1UKYA 2WM9B 2NU6B 5C7IO 5JQWA 3ETHA 1EMDA 1PZXA 1AUPA 4XSGA 3GA0A 5AOAA 3QELA 2W0SA 3B6JA 4DNFA 2ZANA 1VPLA 3BXXA 2YZKA 4IEIA 2Q99A 3QXSA 3WE7A 3DPIA 4UUQA 1IEXA 4N3CA 3DDCA 1G2OA 3R9XB 4FSXA 2MT9A 3LP6A 1NDQA 4G65A 3Q7RA 2V4MA 4RD2A 2CF6A 3HKBA 4Y9DA 4L2IB 1ZMRA 5LOVF 1ISPA 1VRCA 2MDTA 1I7LA 4LW8A 4A23A 5JSQA 3C3EA 4GD3Q 2H48A 4MGHA 5CH8A 2FQXA 3SU8A 4C3UA 2IBTA 5C5CA 4LBZA 2CNOA 5AKGA 2QNBA 1PX2A 1E60A 4LV6A 1EDOA 1FRNA 2FP4A 3MFYA 4MGIR 2OAGA 5CLLA 3S70A 2M1ZA 3T7EA 1KC3A 4N0MA 3U80A 1RXEA 4FT2A 1WLYA 3CJRA 2DSNA 3IIKA 3S2FA 1X1QA 3GF4A 4J0EA 2QMZA 5G4KB 1EJ2A 4PPGA 4C0XA 1CDDA 5EMKA 2X9GA 3JASA 5LXTB 4JBXA 2DTXA 1NBWB 1H05A 3GEGA 2FMTA 4UE3S 4R8SA 2CHFA 2ZZMA