4DNSA

Crystal structure of bermuda grass isoallergen bg60 provides insight into the various cross-allergenicity of the pollen group 4 allergens
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
486
structure length
486
Chain Sequence
DFLTCLTKDIPPRQLYAKSSPAYASVWSSTVRNIKFLSDKTVKPLYIITPTNASHIQAAVVCGRRHGMRIRVRSGGHDYEGLSYRSEKPEPFAVVDMNKMRAVSIDGKAATAWVDSGAQLGDLYYGIAKASPKLGFPAGVCTTIGVGGHFSGGGFGMLLRKYGTAADNVIDAKVVDAQGRLLDRKAMGEDHFWAIRGGGGESFGIVASWQVKLLPVPPKVTVFQVHKGIKEGAIDLVTKWQTVAPALPDDLMIRIMAMGQGAMFEALYLGTCKDLVLLMTARFPELGMNATHCKEMTWIESVPYIPMGPKGTVRDLLNRTSNIKAFGKYKSDYVLEPIPKSDWEKIFTWLVKPGAGVMIMDPYGGGIASVPESATPFPRRSGVLFNIQYVVYWFGEGAAALPTQWTRDIYDFMTPYVSKNPRQAYVNYRDLDLGVNQVVGNVSTYASGKVWGEKYFKGNFERLARTKGKIDPEDYFRNEQSIPPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Various cross-reactivity of the grass pollen group 4 allergens: crystallographic study of the Bermuda grass isoallergen Cyn d 4.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FAD-linked oxidoreductase BG60
total genus 154
structure length 486
sequence length 486
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4dnsA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4dnsA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4dnsA03
1T3QC 2VFVA 4PVHA 1FO4A 2W55A 3KJMA 4PVJA 3DQ0A 4BC7A 2Y3SA 1F0XA 2GQUA 1MBTA 1QLTA 3TSHA 5L6FA 2QKNA 5FXEA 1VDVA 1E8FA 1W1QA 3AMZA 3NRZB 3C0PA 1MBBA 2Q4WA 2GQTA 2MBRA 3D2HA 4PWBA 1DZNA 2VFRA 3B9JB 4O95A 4PVKA 4PZFA 1N60C 3TX1A 5HMRA 5FXDA 3POPA 4BCAA 1AHZA 5AWVA 5FXPA 1W1RA 2W3SA 2VAOA 1E8HA 1E0YA 3W8XA 3FWAA 5K8EA 1WYGA 1FFVC 1WVFA 3TSJA 4ML8A 3W8WA 1N5WC 3PQBA 1W1MA 4PYTA 3S1DA 4UD8A 1DIQA 4BC9A 1E8GA 2VFSA 2VFTA 3RJAA 5I1VA 2BVFA 4DNSA 1W1JA 2VFUA 2QPMA 5AE3A 1ZR6A 3W8ZA 2I0KA 3ETRB 4JAYA 3FW8A 5FXFA 2EXRA 5AE1A 1N62C 3S1EA 5HHZA 1VAOA 2E3TA 1FFUC 2W54A 3VTEA 2IPIA 3BW7A 3RJ8A 1AHVA 4XLOA 5AE2A 1JROA 1N61C 5HQXA 4PVEA 3NVZB 5ADZA 3JS8A 1W1SA 1DIIA 1N5XA 1HSKA 2BVHA 4JB1A 3NS1B 3S1CA 2Y08A 3PM9A 4MLAA 1W1LA 1N63C 2AXRA 3AN1A 4EC3A 2W3RA 1W1KA 2Y4GA 5D79A 3GSYA 5L6GA 4PWCA 4BBYA 1AHUA 1I19A 1V97A 3D2JA 2Y3RA 3SR6B 3FW9A 3D2DA 1WVEA 1QLUA 1UXYA 2WDWA 3AM9A 4OALA 4ZOHB 2BVGA 3EUB3 3HSUA 3FW7A 1ZXIC 3S1FA 1W1OA 3I99A 5I1WA 1FIQB 2Q85A
chains in the Genus database with same CATH superfamily
1T3QC 2VFVA 4PVHA 1FO4A 2W55A 3KJMA 4PVJA 3DQ0A 4BC7A 2UUVA 2Y3SA 1F0XA 2GQUA 1MBTA 1QLTA 3TSHA 5L6FA 3EJDB 2QKNA 5FXEA 3NVWB 3LAEA 1VDVA 2YVSA 1E8FA 1W1QA 3AMZA 3NRZB 3C0PA 1MBBA 2Q4WA 2GQTA 2MBRA 3HRDC 2UUUA 3D2HA 2O3GA 4PWBA 5G5GB 1DZNA 2VFRA 3B9JB 4O95A 4PVKA 3NVVB 4PZFA 1N60C 2R8DA 3TX1A 5HMRA 5FXDA 3POPA 4BCAA 1AHZA 5AWVA 5FXPA 1W1RA 2W3SA 2VAOA 1SB3B 1E8HA 1E0YA 2RK5A 3W8XA 3FWAA 5K8EA 1WYGA 1FFVC 2P4PA 1WVFA 3TSJA 2PLIA 4ML8A 3W8WA 1N5WC 2P13A 1W1MA 3PQBA 5G5HB 3LLBA 4PYTA 3S1DA 4UD8A 1DIQA 4BC9A 1E8GA 2VFSA 3DEDA 2OAIA 2VFTA 3RJAA 5I1VA 2BVFA 4DNSA 1W1JA 2VFUA 2QPMA 3NVYB 5AE3A 2PLSA 1ZR6A 3W8ZA 2I0KA 3ETRB 4JAYA 3FW8A 5FXFA 2EXRA 5AE1A 1N62C 3S1EA 5HHZA 1VAOA 2E3TA 1FFUC 2W54A 3VTEA 2IPIA 2NQWA 3BW7A 3RJ8A 1AHVA 4XLOA 5AE2A 1JRPA 1JROA 1N61C 5HQXA 4PVEA 3NVZB 5ADZA 3JS8A 1W1SA 1DIIA 1N5XA 1HSKA 2BVHA 4JB1A 3NS1B 3S1CA 3EJEB 2Y08A 3PM9A 4HG0A 1RM6B 4MLAA 1W1LA 1N63C 2AXRA 3AN1A 4EC3A 2P3HA 2W3RA 1W1KA 2Y4GA 5D79A 3GSYA 5L6GA 4PWCA 4BBYA 1AHUA 1I19A 1V97A 3D2JA 2Y3RA 3SR6B 3FW9A 3D2DA 1WVEA 1QLUA 1UXYA 2WDWA 3AM9A 4OALA 2R2ZA 4ZOHB 2BVGA 3EUB3 3HSUA 3FW7A 1ZXIC 3S1FA 1W1OA 3I99A 3EJBB 5I1WA 1FIQB 2Q85A
chains in the Genus database with same CATH topology
1T3QC 2VFVA 4PVHA 1FO4A 2W55A 3KJMA 4PVJA 3DQ0A 4BC7A 2UUVA 2Y3SA 1F0XA 2GQUA 1MBTA 1QLTA 3TSHA 5L6FA 2QKNA 5FXEA 3NVWB 3LAEA 1VDVA 2YVSA 1E8FA 1W1QA 3AMZA 3NRZB 3C0PA 1MBBA 2Q4WA 2GQTA 2MBRA 3HRDC 2UUUA 3D2HA 2O3GA 4PWBA 5G5GB 1DZNA 2VFRA 3B9JB 4O95A 4PVKA 3NVVB 4PZFA 1N60C 2R8DA 3TX1A 5HMRA 5FXDA 3POPA 4BCAA 1AHZA 5AWVA 5FXPA 1W1RA 2W3SA 2VAOA 1SB3B 1E8HA 1E0YA 2RK5A 3W8XA 3FWAA 5K8EA 1WYGA 1FFVC 2P4PA 1WVFA 3TSJA 2PLIA 4ML8A 3W8WA 1N5WC 2P13A 1W1MA 3PQBA 5G5HB 3LLBA 4PYTA 3S1DA 4UD8A 1DIQA 4BC9A 1E8GA 2VFSA 3DEDA 2OAIA 2VFTA 3RJAA 5I1VA 2BVFA 4DNSA 1W1JA 2VFUA 2QPMA 3NVYB 5AE3A 2PLSA 1ZR6A 3W8ZA 2I0KA 3ETRB 4JAYA 3FW8A 5FXFA 2EXRA 5AE1A 1N62C 3S1EA 5HHZA 1VAOA 2E3TA 1FFUC 2W54A 3VTEA 2IPIA 2NQWA 3BW7A 3RJ8A 1AHVA 4XLOA 5AE2A 1JRPA 1JROA 1N61C 5HQXA 4PVEA 3NVZB 5ADZA 3JS8A 1W1SA 1DIIA 1N5XA 1HSKA 2BVHA 4JB1A 3NS1B 3S1CA 2Y08A 3PM9A 4HG0A 1RM6B 4MLAA 1W1LA 1N63C 2AXRA 3AN1A 4EC3A 2P3HA 2W3RA 1W1KA 2Y4GA 5D79A 3GSYA 5L6GA 4PWCA 4BBYA 1AHUA 1I19A 1V97A 3D2JA 2Y3RA 3SR6B 3FW9A 3D2DA 1WVEA 1QLUA 1UXYA 2WDWA 3AM9A 4OALA 2R2ZA 4ZOHB 2BVGA 3EUB3 3HSUA 3FW7A 1ZXIC 3S1FA 1W1OA 3I99A 5I1WA 1FIQB 2Q85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3Q C;  2VFV A;  4PVH A;  1FO4 A;  2W55 A;  3KJM A;  4PVJ A;  3DQ0 A;  4BC7 A;  2Y3S A;  1F0X A;  2GQU A;  1MBT A;  1QLT A;  3TSH A;  5L6F A;  2QKN A;  5FXE A;  1VDV A;  1E8F A;  1W1Q A;  3AMZ A;  3NRZ B;  3C0P A;  1MBB A;  2Q4W A;  2GQT A;  2MBR A;  3D2H A;  4PWB A;  1DZN A;  2VFR A;  3B9J B;  4O95 A;  4PVK A;  4PZF A;  1N60 C;  3TX1 A;  5HMR A;  5FXD A;  3POP A;  4BCA A;  1AHZ A;  5AWV A;  5FXP A;  1W1R A;  2W3S A;  2VAO A;  1E8H A;  1E0Y A;  3W8X A;  3FWA A;  5K8E A;  1WYG A;  1FFV C;  1WVF A;  3TSJ A;  4ML8 A;  3W8W A;  1N5W C;  3PQB A;  1W1M A;  4PYT A;  3S1D A;  4UD8 A;  1DIQ A;  4BC9 A;  1E8G A;  2VFS A;  2VFT A;  3RJA A;  5I1V A;  2BVF A;  4DNS A;  1W1J A;  2VFU A;  2QPM A;  5AE3 A;  1ZR6 A;  3W8Z A;  2I0K A;  3ETR B;  4JAY A;  3FW8 A;  5FXF A;  2EXR A;  5AE1 A;  1N62 C;  3S1E A;  5HHZ A;  1VAO A;  2E3T A;  1FFU C;  2W54 A;  3VTE A;  2IPI A;  3BW7 A;  3RJ8 A;  1AHV A;  4XLO A;  5AE2 A;  1JRO A;  1N61 C;  5HQX A;  4PVE A;  3NVZ B;  5ADZ A;  3JS8 A;  1W1S A;  1DII A;  1N5X A;  1HSK A;  2BVH A;  4JB1 A;  3NS1 B;  3S1C A;  2Y08 A;  3PM9 A;  4MLA A;  1W1L A;  1N63 C;  2AXR A;  3AN1 A;  4EC3 A;  2W3R A;  1W1K A;  2Y4G A;  5D79 A;  3GSY A;  5L6G A;  4PWC A;  4BBY A;  1AHU A;  1I19 A;  1V97 A;  3D2J A;  2Y3R A;  3SR6 B;  3FW9 A;  3D2D A;  1WVE A;  1QLU A;  1UXY A;  2WDW A;  3AM9 A;  4OAL A;  4ZOH B;  2BVG A;  3EUB 3;  3HSU A;  3FW7 A;  1ZXI C;  3S1F A;  1W1O A;  3I99 A;  5I1W A;  1FIQ B;  2Q85 A; 
#chains in the Genus database with same CATH topology
 1T3Q C;  2VFV A;  4PVH A;  1FO4 A;  2W55 A;  3KJM A;  4PVJ A;  3DQ0 A;  4BC7 A;  2UUV A;  2Y3S A;  1F0X A;  2GQU A;  1MBT A;  1QLT A;  3TSH A;  5L6F A;  3EJD B;  2QKN A;  5FXE A;  3NVW B;  3LAE A;  1VDV A;  2YVS A;  1E8F A;  1W1Q A;  3AMZ A;  3NRZ B;  3C0P A;  1MBB A;  2Q4W A;  2GQT A;  2MBR A;  3HRD C;  2UUU A;  3D2H A;  2O3G A;  4PWB A;  5G5G B;  1DZN A;  2VFR A;  3B9J B;  4O95 A;  4PVK A;  3NVV B;  4PZF A;  1N60 C;  2R8D A;  3TX1 A;  5HMR A;  5FXD A;  3POP A;  4BCA A;  1AHZ A;  5AWV A;  5FXP A;  1W1R A;  2W3S A;  2VAO A;  1SB3 B;  1E8H A;  1E0Y A;  2RK5 A;  3W8X A;  3FWA A;  5K8E A;  1WYG A;  1FFV C;  2P4P A;  1WVF A;  3TSJ A;  2PLI A;  4ML8 A;  3W8W A;  1N5W C;  2P13 A;  1W1M A;  3PQB A;  5G5H B;  3LLB A;  4PYT A;  3S1D A;  4UD8 A;  1DIQ A;  4BC9 A;  1E8G A;  2VFS A;  3DED A;  2OAI A;  2VFT A;  3RJA A;  5I1V A;  2BVF A;  4DNS A;  1W1J A;  2VFU A;  2QPM A;  3NVY B;  5AE3 A;  2PLS A;  1ZR6 A;  3W8Z A;  2I0K A;  3ETR B;  4JAY A;  3FW8 A;  5FXF A;  2EXR A;  5AE1 A;  1N62 C;  3S1E A;  5HHZ A;  1VAO A;  2E3T A;  1FFU C;  2W54 A;  3VTE A;  2IPI A;  2NQW A;  3BW7 A;  3RJ8 A;  1AHV A;  4XLO A;  5AE2 A;  1JRP A;  1JRO A;  1N61 C;  5HQX A;  4PVE A;  3NVZ B;  5ADZ A;  3JS8 A;  1W1S A;  1DII A;  1N5X A;  1HSK A;  2BVH A;  4JB1 A;  3NS1 B;  3S1C A;  3EJE B;  2Y08 A;  3PM9 A;  4HG0 A;  1RM6 B;  4MLA A;  1W1L A;  1N63 C;  2AXR A;  3AN1 A;  4EC3 A;  2P3H A;  2W3R A;  1W1K A;  2Y4G A;  5D79 A;  3GSY A;  5L6G A;  4PWC A;  4BBY A;  1AHU A;  1I19 A;  1V97 A;  3D2J A;  2Y3R A;  3SR6 B;  3FW9 A;  3D2D A;  1WVE A;  1QLU A;  1UXY A;  2WDW A;  3AM9 A;  4OAL A;  2R2Z A;  4ZOH B;  2BVG A;  3EUB 3;  3HSU A;  3FW7 A;  1ZXI C;  3S1F A;  1W1O A;  3I99 A;  3EJB B;  5I1W A;  1FIQ B;  2Q85 A; 
#chains in the Genus database with same CATH homology
 1T3Q C;  2VFV A;  4PVH A;  1FO4 A;  2W55 A;  3KJM A;  4PVJ A;  3DQ0 A;  4BC7 A;  2UUV A;  2Y3S A;  1F0X A;  2GQU A;  1MBT A;  1QLT A;  3TSH A;  5L6F A;  2QKN A;  5FXE A;  3NVW B;  3LAE A;  1VDV A;  2YVS A;  1E8F A;  1W1Q A;  3AMZ A;  3NRZ B;  3C0P A;  1MBB A;  2Q4W A;  2GQT A;  2MBR A;  3HRD C;  2UUU A;  3D2H A;  2O3G A;  4PWB A;  5G5G B;  1DZN A;  2VFR A;  3B9J B;  4O95 A;  4PVK A;  3NVV B;  4PZF A;  1N60 C;  2R8D A;  3TX1 A;  5HMR A;  5FXD A;  3POP A;  4BCA A;  1AHZ A;  5AWV A;  5FXP A;  1W1R A;  2W3S A;  2VAO A;  1SB3 B;  1E8H A;  1E0Y A;  2RK5 A;  3W8X A;  3FWA A;  5K8E A;  1WYG A;  1FFV C;  2P4P A;  1WVF A;  3TSJ A;  2PLI A;  4ML8 A;  3W8W A;  1N5W C;  2P13 A;  1W1M A;  3PQB A;  5G5H B;  3LLB A;  4PYT A;  3S1D A;  4UD8 A;  1DIQ A;  4BC9 A;  1E8G A;  2VFS A;  3DED A;  2OAI A;  2VFT A;  3RJA A;  5I1V A;  2BVF A;  4DNS A;  1W1J A;  2VFU A;  2QPM A;  3NVY B;  5AE3 A;  2PLS A;  1ZR6 A;  3W8Z A;  2I0K A;  3ETR B;  4JAY A;  3FW8 A;  5FXF A;  2EXR A;  5AE1 A;  1N62 C;  3S1E A;  5HHZ A;  1VAO A;  2E3T A;  1FFU C;  2W54 A;  3VTE A;  2IPI A;  2NQW A;  3BW7 A;  3RJ8 A;  1AHV A;  4XLO A;  5AE2 A;  1JRP A;  1JRO A;  1N61 C;  5HQX A;  4PVE A;  3NVZ B;  5ADZ A;  3JS8 A;  1W1S A;  1DII A;  1N5X A;  1HSK A;  2BVH A;  4JB1 A;  3NS1 B;  3S1C A;  2Y08 A;  3PM9 A;  4HG0 A;  1RM6 B;  4MLA A;  1W1L A;  1N63 C;  2AXR A;  3AN1 A;  4EC3 A;  2P3H A;  2W3R A;  1W1K A;  2Y4G A;  5D79 A;  3GSY A;  5L6G A;  4PWC A;  4BBY A;  1AHU A;  1I19 A;  1V97 A;  3D2J A;  2Y3R A;  3SR6 B;  3FW9 A;  3D2D A;  1WVE A;  1QLU A;  1UXY A;  2WDW A;  3AM9 A;  4OAL A;  2R2Z A;  4ZOH B;  2BVG A;  3EUB 3;  3HSU A;  3FW7 A;  1ZXI C;  3S1F A;  1W1O A;  3I99 A;  5I1W A;  1FIQ B;  2Q85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...