4DNSA

Crystal structure of bermuda grass isoallergen bg60 provides insight into the various cross-allergenicity of the pollen group 4 allergens
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
486
structure length
486
Chain Sequence
b'DFLTCLTKDIPPRQLYAKSSPAYASVWSSTVRNIKFLSDKTVKPLYIITPTNASHIQAAVVCGRRHGMRIRVRSGGHDYEGLSYRSEKPEPFAVVDMNKMRAVSIDGKAATAWVDSGAQLGDLYYGIAKASPKLGFPAGVCTTIGVGGHFSGGGFGMLLRKYGTAADNVIDAKVVDAQGRLLDRKAMGEDHFWAIRGGGGESFGIVASWQVKLLPVPPKVTVFQVHKGIKEGAIDLVTKWQTVAPALPDDLMIRIMAMGQGAMFEALYLGTCKDLVLLMTARFPELGMNATHCKEMTWIESVPYIPMGPKGTVRDLLNRTSNIKAFGKYKSDYVLEPIPKSDWEKIFTWLVKPGAGVMIMDPYGGGIASVPESATPFPRRSGVLFNIQYVVYWFGEGAAALPTQWTRDIYDFMTPYVSKNPRQAYVNYRDLDLGVNQVVGNVSTYASGKVWGEKYFKGNFERLARTKGKIDPEDYFRNEQSIPPLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAD-linked oxidoreductase BG60
publication title Various cross-reactivity of the grass pollen group 4 allergens: crystallographic study of the Bermuda grass isoallergen Cyn d 4.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 154
structure length 486
sequence length 486
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4dnsA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4dnsA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4dnsA03
4OALA 1F0XA 1MBBA 3AN1A 4ZOHB 1JROA 3W8WA 3VTEA 3EUB3 1DIQA 2WDWA 3W8XA 4PVHA 2GQTA 3FWAA 1FFUC 3D2DA 1E0YA 1N60C 1VDVA 3FW7A 2EXRA 1N63C 4BBYA 1W1MA 2Q85A 2Y3RA 1VAOA 3RJAA 5FXFA 5ADZA 2VFRA 2VFVA 5HHZA 3AM9A 2MBRA 3B9JB 4XLOA 3KJMA 3NVZB 1FFVC 4UD8A 2I0KA 3AMZA 1QLUA 2BVGA 1W1JA 1W1LA 1UXYA 1E8FA 2Q4WA 3JS8A 5HQXA 4EC3A 1FO4A 1N62C 4JB1A 4PYTA 3TX1A 5D79A 5K8EA 2QPMA 2GQUA 1MBTA 1N5WC 3S1FA 1AHUA 3I99A 3SR6B 3NRZB 1HSKA 1W1SA 1E8GA 2IPIA 3S1DA 2W3SA 2VFSA 1WYGA 4BC7A 3FW8A 3D2HA 2Y3SA 1AHVA 3FW9A 3C0PA 4O95A 1ZR6A 1FIQB 2BVHA 2E3TA 1WVEA 5AWVA 3TSHA 1AHZA 3D2JA 2W54A 2W3RA 3GSYA 4MLAA 1V97A 1WVFA 3ETRB 4ML8A 1DZNA 5FXDA 5I1WA 5AE1A 2Y4GA 1DIIA 5HMRA 1ZXIC 3PQBA 3POPA 4PVKA 3BW7A 1QLTA 4BC9A 4BCAA 2VFTA 1T3QC 2W55A 4DNSA 3RJ8A 3DQ0A 1N61C 4PVJA 5AE3A 5L6GA 3S1CA 1W1KA 2AXRA 4PWCA 1E8HA 2QKNA 1W1QA 2VAOA 3S1EA 3HSUA 5FXEA 5AE2A 5FXPA 5L6FA 1W1RA 2BVFA 4PVEA 4PWBA 2Y08A 1W1OA 4PZFA 5I1VA 1N5XA 1I19A 3PM9A 3NS1B 2VFUA 4JAYA 3W8ZA 3TSJA
chains in the Genus database with same CATH superfamily
4OALA 1RM6B 1F0XA 1MBBA 3AN1A 4ZOHB 1JROA 3W8WA 3VTEA 3EUB3 1DIQA 2WDWA 3W8XA 4PVHA 2NQWA 2GQTA 3FWAA 1FFUC 3D2DA 1E0YA 1N60C 1VDVA 3FW7A 2EXRA 1N63C 3EJDB 4BBYA 1W1MA 2Q85A 2Y3RA 1VAOA 3LLBA 5G5GB 3RJAA 5FXFA 5ADZA 2VFRA 2VFVA 3LAEA 5HHZA 3AM9A 2MBRA 2RK5A 3B9JB 4XLOA 3KJMA 3NVVB 3NVZB 1FFVC 4UD8A 2I0KA 3AMZA 1QLUA 2BVGA 1W1JA 2UUVA 1W1LA 1UXYA 1E8FA 2Q4WA 3JS8A 5HQXA 2PLIA 4EC3A 1FO4A 1N62C 4JB1A 4PYTA 3EJBB 5D79A 3TX1A 5K8EA 2QPMA 2GQUA 1MBTA 1N5WC 3S1FA 2UUUA 1AHUA 3NVWB 3I99A 3SR6B 3NRZB 1HSKA 3HRDC 1W1SA 1E8GA 2IPIA 3S1DA 2W3SA 2VFSA 1WYGA 4BC7A 1SB3B 3FW8A 2OAIA 3D2HA 2P3HA 2Y3SA 1AHVA 3FW9A 3C0PA 4O95A 1JRPA 2O3GA 1ZR6A 1FIQB 2BVHA 2E3TA 1WVEA 5AWVA 3TSHA 1AHZA 3D2JA 3EJEB 2W54A 2W3RA 3GSYA 4MLAA 1V97A 1WVFA 3ETRB 4ML8A 1DZNA 5FXDA 2P13A 2R2ZA 5I1WA 5AE1A 2P4PA 2Y4GA 1DIIA 5HMRA 1ZXIC 3PQBA 3NVYB 3POPA 4PVKA 3BW7A 1QLTA 4BC9A 4BCAA 2R8DA 2VFTA 1T3QC 2W55A 4DNSA 3RJ8A 3DQ0A 1N61C 4PVJA 5AE3A 5L6GA 3S1CA 1W1KA 2AXRA 4PWCA 1E8HA 2QKNA 1W1QA 2VAOA 3S1EA 2PLSA 3HSUA 5G5HB 5FXEA 5AE2A 5FXPA 2YVSA 5L6FA 1W1RA 2BVFA 4PVEA 4PWBA 4HG0A 2Y08A 1W1OA 4PZFA 5I1VA 1N5XA 1I19A 3PM9A 3NS1B 2VFUA 4JAYA 3DEDA 3W8ZA 3TSJA
chains in the Genus database with same CATH topology
4OALA 1RM6B 1F0XA 1MBBA 3AN1A 4ZOHB 1JROA 3W8WA 3VTEA 3EUB3 1DIQA 2WDWA 3W8XA 4PVHA 2NQWA 2GQTA 3FWAA 1FFUC 3D2DA 1E0YA 1N60C 1VDVA 3FW7A 2EXRA 1N63C 4BBYA 1W1MA 2Q85A 2Y3RA 1VAOA 3LLBA 5G5GB 3RJAA 5FXFA 5ADZA 2VFRA 2VFVA 3LAEA 5HHZA 3AM9A 2MBRA 2RK5A 3B9JB 4XLOA 3KJMA 3NVVB 3NVZB 1FFVC 4UD8A 2I0KA 3AMZA 1QLUA 2BVGA 1W1JA 2UUVA 1W1LA 1UXYA 1E8FA 2Q4WA 3JS8A 5HQXA 2PLIA 4EC3A 1FO4A 1N62C 4JB1A 4PYTA 3TX1A 5D79A 5K8EA 2QPMA 2GQUA 1MBTA 1N5WC 3S1FA 2UUUA 1AHUA 3NVWB 3I99A 3SR6B 3NRZB 1HSKA 3HRDC 1W1SA 1E8GA 2IPIA 3S1DA 2W3SA 2VFSA 1WYGA 4BC7A 1SB3B 3FW8A 2OAIA 3D2HA 2P3HA 2Y3SA 1AHVA 3FW9A 3C0PA 4O95A 1JRPA 2O3GA 1ZR6A 1FIQB 2BVHA 2E3TA 1WVEA 5AWVA 3TSHA 1AHZA 3D2JA 2W54A 2W3RA 3GSYA 4MLAA 1V97A 1WVFA 3ETRB 4ML8A 1DZNA 5FXDA 2P13A 2R2ZA 5I1WA 5AE1A 2P4PA 2Y4GA 1DIIA 5HMRA 1ZXIC 3PQBA 3NVYB 3POPA 4PVKA 3BW7A 1QLTA 4BC9A 4BCAA 2R8DA 2VFTA 1T3QC 2W55A 4DNSA 3RJ8A 3DQ0A 1N61C 4PVJA 5AE3A 5L6GA 3S1CA 1W1KA 2AXRA 4PWCA 1E8HA 2QKNA 1W1QA 2VAOA 3S1EA 2PLSA 3HSUA 5G5HB 5FXEA 5AE2A 5FXPA 2YVSA 5L6FA 1W1RA 2BVFA 4PVEA 4PWBA 4HG0A 2Y08A 1W1OA 4PZFA 5I1VA 1N5XA 1I19A 3PM9A 3NS1B 2VFUA 4JAYA 3DEDA 3W8ZA 3TSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAL A;  1F0X A;  1MBB A;  3AN1 A;  4ZOH B;  1JRO A;  3W8W A;  3VTE A;  3EUB 3;  1DIQ A;  2WDW A;  3W8X A;  4PVH A;  2GQT A;  3FWA A;  1FFU C;  3D2D A;  1E0Y A;  1N60 C;  1VDV A;  3FW7 A;  2EXR A;  1N63 C;  4BBY A;  1W1M A;  2Q85 A;  2Y3R A;  1VAO A;  3RJA A;  5FXF A;  5ADZ A;  2VFR A;  2VFV A;  5HHZ A;  3AM9 A;  2MBR A;  3B9J B;  4XLO A;  3KJM A;  3NVZ B;  1FFV C;  4UD8 A;  2I0K A;  3AMZ A;  1QLU A;  2BVG A;  1W1J A;  1W1L A;  1UXY A;  1E8F A;  2Q4W A;  3JS8 A;  5HQX A;  4EC3 A;  1FO4 A;  1N62 C;  4JB1 A;  4PYT A;  3TX1 A;  5D79 A;  5K8E A;  2QPM A;  2GQU A;  1MBT A;  1N5W C;  3S1F A;  1AHU A;  3I99 A;  3SR6 B;  3NRZ B;  1HSK A;  1W1S A;  1E8G A;  2IPI A;  3S1D A;  2W3S A;  2VFS A;  1WYG A;  4BC7 A;  3FW8 A;  3D2H A;  2Y3S A;  1AHV A;  3FW9 A;  3C0P A;  4O95 A;  1ZR6 A;  1FIQ B;  2BVH A;  2E3T A;  1WVE A;  5AWV A;  3TSH A;  1AHZ A;  3D2J A;  2W54 A;  2W3R A;  3GSY A;  4MLA A;  1V97 A;  1WVF A;  3ETR B;  4ML8 A;  1DZN A;  5FXD A;  5I1W A;  5AE1 A;  2Y4G A;  1DII A;  5HMR A;  1ZXI C;  3PQB A;  3POP A;  4PVK A;  3BW7 A;  1QLT A;  4BC9 A;  4BCA A;  2VFT A;  1T3Q C;  2W55 A;  4DNS A;  3RJ8 A;  3DQ0 A;  1N61 C;  4PVJ A;  5AE3 A;  5L6G A;  3S1C A;  1W1K A;  2AXR A;  4PWC A;  1E8H A;  2QKN A;  1W1Q A;  2VAO A;  3S1E A;  3HSU A;  5FXE A;  5AE2 A;  5FXP A;  5L6F A;  1W1R A;  2BVF A;  4PVE A;  4PWB A;  2Y08 A;  1W1O A;  4PZF A;  5I1V A;  1N5X A;  1I19 A;  3PM9 A;  3NS1 B;  2VFU A;  4JAY A;  3W8Z A;  3TSJ A; 
#chains in the Genus database with same CATH topology
 4OAL A;  1RM6 B;  1F0X A;  1MBB A;  3AN1 A;  4ZOH B;  1JRO A;  3W8W A;  3VTE A;  3EUB 3;  1DIQ A;  2WDW A;  3W8X A;  4PVH A;  2NQW A;  2GQT A;  3FWA A;  1FFU C;  3D2D A;  1E0Y A;  1N60 C;  1VDV A;  3FW7 A;  2EXR A;  1N63 C;  3EJD B;  4BBY A;  1W1M A;  2Q85 A;  2Y3R A;  1VAO A;  3LLB A;  5G5G B;  3RJA A;  5FXF A;  5ADZ A;  2VFR A;  2VFV A;  3LAE A;  5HHZ A;  3AM9 A;  2MBR A;  2RK5 A;  3B9J B;  4XLO A;  3KJM A;  3NVV B;  3NVZ B;  1FFV C;  4UD8 A;  2I0K A;  3AMZ A;  1QLU A;  2BVG A;  1W1J A;  2UUV A;  1W1L A;  1UXY A;  1E8F A;  2Q4W A;  3JS8 A;  5HQX A;  2PLI A;  4EC3 A;  1FO4 A;  1N62 C;  4JB1 A;  4PYT A;  3EJB B;  5D79 A;  3TX1 A;  5K8E A;  2QPM A;  2GQU A;  1MBT A;  1N5W C;  3S1F A;  2UUU A;  1AHU A;  3NVW B;  3I99 A;  3SR6 B;  3NRZ B;  1HSK A;  3HRD C;  1W1S A;  1E8G A;  2IPI A;  3S1D A;  2W3S A;  2VFS A;  1WYG A;  4BC7 A;  1SB3 B;  3FW8 A;  2OAI A;  3D2H A;  2P3H A;  2Y3S A;  1AHV A;  3FW9 A;  3C0P A;  4O95 A;  1JRP A;  2O3G A;  1ZR6 A;  1FIQ B;  2BVH A;  2E3T A;  1WVE A;  5AWV A;  3TSH A;  1AHZ A;  3D2J A;  3EJE B;  2W54 A;  2W3R A;  3GSY A;  4MLA A;  1V97 A;  1WVF A;  3ETR B;  4ML8 A;  1DZN A;  5FXD A;  2P13 A;  2R2Z A;  5I1W A;  5AE1 A;  2P4P A;  2Y4G A;  1DII A;  5HMR A;  1ZXI C;  3PQB A;  3NVY B;  3POP A;  4PVK A;  3BW7 A;  1QLT A;  4BC9 A;  4BCA A;  2R8D A;  2VFT A;  1T3Q C;  2W55 A;  4DNS A;  3RJ8 A;  3DQ0 A;  1N61 C;  4PVJ A;  5AE3 A;  5L6G A;  3S1C A;  1W1K A;  2AXR A;  4PWC A;  1E8H A;  2QKN A;  1W1Q A;  2VAO A;  3S1E A;  2PLS A;  3HSU A;  5G5H B;  5FXE A;  5AE2 A;  5FXP A;  2YVS A;  5L6F A;  1W1R A;  2BVF A;  4PVE A;  4PWB A;  4HG0 A;  2Y08 A;  1W1O A;  4PZF A;  5I1V A;  1N5X A;  1I19 A;  3PM9 A;  3NS1 B;  2VFU A;  4JAY A;  3DED A;  3W8Z A;  3TSJ A; 
#chains in the Genus database with same CATH homology
 4OAL A;  1RM6 B;  1F0X A;  1MBB A;  3AN1 A;  4ZOH B;  1JRO A;  3W8W A;  3VTE A;  3EUB 3;  1DIQ A;  2WDW A;  3W8X A;  4PVH A;  2NQW A;  2GQT A;  3FWA A;  1FFU C;  3D2D A;  1E0Y A;  1N60 C;  1VDV A;  3FW7 A;  2EXR A;  1N63 C;  4BBY A;  1W1M A;  2Q85 A;  2Y3R A;  1VAO A;  3LLB A;  5G5G B;  3RJA A;  5FXF A;  5ADZ A;  2VFR A;  2VFV A;  3LAE A;  5HHZ A;  3AM9 A;  2MBR A;  2RK5 A;  3B9J B;  4XLO A;  3KJM A;  3NVV B;  3NVZ B;  1FFV C;  4UD8 A;  2I0K A;  3AMZ A;  1QLU A;  2BVG A;  1W1J A;  2UUV A;  1W1L A;  1UXY A;  1E8F A;  2Q4W A;  3JS8 A;  5HQX A;  2PLI A;  4EC3 A;  1FO4 A;  1N62 C;  4JB1 A;  4PYT A;  3TX1 A;  5D79 A;  5K8E A;  2QPM A;  2GQU A;  1MBT A;  1N5W C;  3S1F A;  2UUU A;  1AHU A;  3NVW B;  3I99 A;  3SR6 B;  3NRZ B;  1HSK A;  3HRD C;  1W1S A;  1E8G A;  2IPI A;  3S1D A;  2W3S A;  2VFS A;  1WYG A;  4BC7 A;  1SB3 B;  3FW8 A;  2OAI A;  3D2H A;  2P3H A;  2Y3S A;  1AHV A;  3FW9 A;  3C0P A;  4O95 A;  1JRP A;  2O3G A;  1ZR6 A;  1FIQ B;  2BVH A;  2E3T A;  1WVE A;  5AWV A;  3TSH A;  1AHZ A;  3D2J A;  2W54 A;  2W3R A;  3GSY A;  4MLA A;  1V97 A;  1WVF A;  3ETR B;  4ML8 A;  1DZN A;  5FXD A;  2P13 A;  2R2Z A;  5I1W A;  5AE1 A;  2P4P A;  2Y4G A;  1DII A;  5HMR A;  1ZXI C;  3PQB A;  3NVY B;  3POP A;  4PVK A;  3BW7 A;  1QLT A;  4BC9 A;  4BCA A;  2R8D A;  2VFT A;  1T3Q C;  2W55 A;  4DNS A;  3RJ8 A;  3DQ0 A;  1N61 C;  4PVJ A;  5AE3 A;  5L6G A;  3S1C A;  1W1K A;  2AXR A;  4PWC A;  1E8H A;  2QKN A;  1W1Q A;  2VAO A;  3S1E A;  2PLS A;  3HSU A;  5G5H B;  5FXE A;  5AE2 A;  5FXP A;  2YVS A;  5L6F A;  1W1R A;  2BVF A;  4PVE A;  4PWB A;  4HG0 A;  2Y08 A;  1W1O A;  4PZF A;  5I1V A;  1N5X A;  1I19 A;  3PM9 A;  3NS1 B;  2VFU A;  4JAY A;  3DED A;  3W8Z A;  3TSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...