4DO2A

Crystal structure of the rop protein mutant d30p/a31g at resolution 1.4 resolution.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
57
structure length
57
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELPGDEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title Structural plasticity of 4-alpha-helical bundles exemplified by the puzzle-like molecular assembly of the Rop protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 25
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4do2A00
1F4MA 2GHYA 1NKDA 2IJKA 1PD3A 3K79A 1F4NA 2IJHA 1B6QA 2IJJA 4DO2A 1RPRA 1GMGA 2IJIA 1GTOA 1ROPA 1RPOA
chains in the Genus database with same CATH superfamily
2F4VO 1B06A 1SC5B 2CDYA 2NLJC 5LA6B 1IXMA 2F95B 1XL6A 5EBMC 2LGWA 4DR4B 3W7XA 2DYSB 4UB8Z 5BZBA 1ZL8B 2VWJA 4YIOA 4FMTA 1XHXA 3F5TA 1L0LH 3RVZA 5IJ9A 5JWPA 3DGEA 5FPRA 2XT9A 4JV5B 1H2MA 3OMNB 3K5OA 4IT5A 4DK1A 3D8CA 1NTKH 2P06A 4IYHA 1M57C 4PDVA 5L3CA 5J2TA 1KC8W 3ZRXA 1EFRG 1OCRB 4YY3B 2EINC 2X7RB 1GTOA 1R3LC 4X1YB 1YSCA 2YEVA 3LDDA 1YI2V 4I9QA 3D36A 3H1LH 1V54B 3ASNB 2DQ0A 3STZC 1V9PA 1K3EA 1PPJH 1QNMA 4IIJB 1B3QA 3JATA 4TUYB 1ROPA 5KHHA 5LXTB 2YI9A 2WLLB 5JJEB 4PA4A 2ZR2A 4MTGA 4E4EA 1K5SA 1JPXA 1R3JC 2A7WA 5LP6A 1P84F 2PTMA 4JI7O 2P90A 4I55A 1XILA 3BFRA 1VQLV 1OV9A 2LP7A 4YHHB 1K9MW 2VS0A 4DV7B 1KP3A 2CGOA 5CBHA 3UO2A 5IJ0A 3APQA 3MAQA 4LWSA 3CC2V 4GZRB 4P9OA 2NR5A 1YJ9V 4UVCA 2BTQA 1SQXH 4WF9V 3TCUA 1G1XB 3AG2B 1CXZB 1MOFA 1XMOO 2YS8A 5B1BC 4JI6O 1HR0O 2R70A 4LFBB 2RMKB 2C2AA 2B1IA 3H1JH 5IJ9B 2VQFO 3JARB 4K8ZA 5LMUO 2RJZA 4JYYA 3IC9A 1OCZC 2Q6AA 1GN4A 4WCEV 4Z2WA 3ZMSA 3W7WA 5GONA 1BMFG 1GKFA 4GCZA 3VBBA 5CA1A 2P5OA 1F23A 4ZOLA 2YEVB 4LF9B 4CH6A 3OR7C 2XAHA 3IGAC 3FAVA 3CPWU 3SPJA 5E1AC 2Y4TA 4I9WA 2DOSA 2LW1A 3JATB 1AB3A 4LFAB 4MVQA 5LYJA 2GSMB 3TXSA 3D3QA 3EFFK 4O2BB 4IGGA 4DV0O 1G8MA 2E74B 4MVOA 5JQGB 4O4JA 1TUEB 4JI8O 4I55B 1OZ0A 3HKBA 3NR7A 2HHHB 4OPHA 3FX7A 1WP8A 4JI0B 5KA5A 4DR1O 3QTCA 4DRXA 3P3NA 4MVUA 3JD1A 1FXKB 3K57A 3B09A 3BA8A 3OUFA 3HKDA 2EIJB 3DXRA 2Y0IA 5KAIZ 3E22B 1QLEB 4OX9B 1S5LZ 4QPJA 2PI4A 4EKWA 3ZJZA 1XNQO 3UT5A 1TGOA 2LFSA 2PZSA 1IBKB 5B3SB 2ETNA 1KUQA 3CXHF 4DR6B 4AILC 3QO8A 3WG7C 1YTFB 5FLXN 3E35A 5EIBC 1F7YA 4H44B 3OM3B 2UXNA 3RYCB 3CJHA 1MZEA 5GONB 1EN4A 1XI1A 3A0HZ 1K92A 2RNBA 2ZR3A 4CZZA 2BSKA 4NXMB 2W6JG 3OE7G 2N74A 4TV8A 5B1AC 2W0FC 2EX3A 3FAVB 4JI2O 2HHHO 3ZIAG 3T1YB 2ZDIC 2P6JA 5FNVB 1LUWA 2GUZA 2XOKG 1VARA 4RUEA 4JI0O 3OGCC 2W0XA 3G6EV 1D5NA 2AZ2A 1NH2B 3AK3A 2HJDA 5LYJB 4D7SA 3D36C 4UCOA 1QLNA 3CHXA 3ZHUA 1P7BA 1YIJV 3ZRVA 2CH7B 1AR1B 2Q7HA 1OCOB 4NVPA 3K0DA 1EBOA 4PD4F 5CB4B 3HR0A 3CCMV 1JX9A 3J80N 1IBKO 2UUCB 4X66B 4O4HB 4LBEC 5LP6C 1EM1A 2B5UA 2EIMB 3L9DA 3WU2Z 1J95A 4DK0A 2A06H 2IM9A 2EULA 4DRXB 4UB6Z 2ODMA 2JEXA 3JAWA 4RQFA 1L8DA 4K3AA 3K79A 4MVSA 4B3SB 5JJJB 4MVZA 2MK3A 4DV1B 1KP2A 1Y76B 4IHJB 4DV3B 4J7JA 4FLVA 3CRMA 4Q20A 3W7TA 4BIUA 5JCOC 3B8MA 4LR3A 3SJBC 1FJGB 3GVMA 1ZWIC 3ABKB 3N2KA 4LFCB 4R7CA 2DYRC 2EILB 2H3OA 1Y67A 3ABLC 3PN1A 5EZYA 3K5LA 2ZNJA 3ZHVA 1E1RG 1N33O 3CJHB 2EZPA 3F5WC 1VQ6V 2P4KA 2X6BA 1H2GA 3DTUB 3JD0A 4CS2A 2QWOB 3RT3C 1F4NA 1MABG 5B66Z 1GM9A 3OT7A 2HEPA 2RN9A 3VQXA 2QSAA 2D3OW 4RQEA 2UXCB 3OTOO 3ABUA 1KECA 5EC2C 4JF3A 1A32A 3ASOC 2X6AA 4H0LB 1RSOA 4Z1VA 4IYIA 1WPBA 4JI4O 3ICXA 3CCQV 4FLXA 5KHKA 2UU9O 2ATKC 4UXNA 1NBMG 2L6LA 4DR2O 4GX2A 3RYFB 3SYCA 5KA6A 2CTPA 1SQGA 2UUBB 4LFCO 2PYLA 1GN6A 4I0XA 3T1CA 1S3JA 3JAWB 4JYCA 1FXHA 3BY6A 1RP3B 5F2VO 1W59A 3WB2A 2HFEC 3ZMVA 2GHYA 1SQPH 3SJAC 3EXAA 1KQSU 1VQKV 3JAKB 4JTDB 2Y69B 1SQBH 5JVDA 2D2CB 1FAFA 1AP5A 2Q73A 3A0RA 1XOUA 4ICGA 5J2UB 2PGGA 1BQ0A 2CTQA 3CCVV 3AG4B 4W4LA 1NZ6A 1YDXA 4L87A 1O9GA 2QKCA 1G6UA 1JFFB 4UV9A 2QM8A 3QO7A 4DR5B 4K0KO 5KLVH 3UO3A 1PP9H 3W7UA 2O57A 4YJ3A 3CC7V 3SR2C 1HWYA 3ZMTA 2Q0AA 1S5JA 4J80A 4NTWA 1SQQH 2YI8A 2UUBO 1ZL8A 3D3IA 3LSUA 4DV5B 2QEXV 5EBWC 4GKKB 3L75H 2IJIA 4J10A 2WWWA 5AG2A 4DYLA 2WLKA 5IWAB 2JJ1G 1OHHG 1BHAA 4JTAB 1PM9A 1Q6HA 3K9AA 2R9RB 4N21A 2F4VB 2OCCC 3CCUV 2HJFC 2H8PC 3KZIZ 1M57B 3A0BZ 5EC1C 4XDLA 3RFRA 4X1YA 2R72A 2E75B 4UV8A 5LOVB 3C3SA 3HKCB 2Q68A 3X2QB 3H9VA 3E8FA 5B1NA 2XAJA 4ASUG 2PY5A 2X0LA 4QIWF 2P67A 2QKSA 3IFXA 1K5QA 3CRCA 3L71H 5LXTA 2WLLA 2WA3A 2FMLA 2OIEA 2JDIG 1SETA 1FD9A 3GWKC 4MVRA 3KG2A 4BIOA 4DV6O 1I5XA 2QJ1A 1QVFU 4FZ0A 3JYCA 2QM4A 3Q4HA 4LF5O 1YCIA 1KB9F 1O9HA 4WFEA 5EYPB 2YXHA 1DF5A 2Q7EA 3K3WA 1YF2A 2FKXA 4NR1A 1BHBA 1DF4A 3E83A 1VF6C 5LHIA 2QR4A 2IH1C 1U97A 1R6KA 3LSSA 3ZHQA 2AHYA 2R9AA 4YJ3B 1ENVA 1E79G 1IVSA 1IURA 1GN2A 4JI7B 4HAMA 1R1BA 3JCZA 1W0KG 3NXSA 4JZ2A 3CX5F 5H5NA 1I0HA 4O2AA 3BABA 2DE0X 3KCXA 1HDJA 4AQYO 3JARA 2ZE5A 1MA1A 1ZX3A 2Q0OC 4JYAO 2MW2B 2K9PA 1BS3A 1H2NA 2ZXWB 4U3JB 1P49A 3FB7C 1XMOB 1WAZA 2WAMA 4Z1MG 4JI6B 1HR0B 4WFAV 4WBNA 5KHJA 5EBLC 1QQCA 4JTCB 1OJHA 3ZRWB 2CE4A 2VQFB 5IYDO 1I5YA 5C93A 5LMUB 3ZX6A 4GX5A 4F6EA 2DJVA 2BTOA 1HP8A 3OMAB 1NQTA 4DUYO 3E8BA 1RPOA 3E86A 4O2BA 3H1IH 4J11A 4X65B 3P32A 3S3WA 1KU9A 5LHHA 5JQGA 3K08A 4I4TB 1FYJA 3Q4HB 2HLDG 4B3MB 1SKVA 4P30A 1Q7YW 4PA9A 4KP4A 4BW9A 2ITCC 4FLZA 1VQ7V 1EZVH 1NTMH 1NJIW 2KB1A 4B08A 3ZEDA 1N36O 4P2ZA 1NR1A 1FXKA 1Y4MA 2PYJA 4F4LA 4FFKA 3FKSG 4DV0B 3E22A 4UVAA 3FYEB 1XNRO 3CMEV 3EVKA 2KKWA 4JI8B 2AXTZ 2QM7A 1IX9A 2JJ2G 4O2AB 1MSWD 4GX0A 4PI2A 3ABMC 2NNUA 4DR1B 4PELA 3O9OA 2JS3A 3J81N 3WG7B 5L3DA 1WNSA 3SYOA 2JS5A 2DYSC 3LDCA 4F6RA 2YC0A 4ZKIA 1L0NH 4JAAA 3RYCA 1NTZH 3G6BA 3T4ZA 1XNQB 2WLNA 1BGYH 2DMXA 4X65O 4WBNB 3LSQA 1W0JG 4GUNA 5L3FA 1Q5OA 2E5LO 2P22C 4CH4A 4HBNA 4B3MO 2UXBO 5KX5B 2F1MA 3G67A 5B1AB 1SRYA 2B9ZA 5FNVA 1OCRC 3STLC 1UPGA 1SQFA 3CRRA 3ML0A 4KUMA 3DC5A 3H1KH 5KHGA 3JD2A 4RWUA 1V54C 2JGUA 2JK5C 5L3GA 3I56V 1VF7A 4FVMA 2CH7A 4Q6GA 1Q8IA 3M8AA 4MVMA 5IDJA 5CB4A 2AHZA 2YDEA 3K06A 4JI2B 3BAAA 2IJHA 3AK2A 3TETA 1VMGA 4O4HA 2JRIA 5DM6V 5LMNO 4I5SA 1IBMO 1GN3A 4X64O 4H33A 5IY5C 2XUMA 2ZE8A 4X8AA 2IJKA 3VQYA 3CWBH 4NXNO 1US6A 5C8YB 1SA0B 2LO1A 4X1KA 2UUAB 3SPHA 1VQMV 3HPLC 4FLUA 3FYIB 1VF5B 1Y76A 1LUVA 4IHJA 4P9PA 1L1FA 2IBZH 4A5UB 3RN4A 4NYKA 1XBLA 1M5IA 3C90A 4FJCC 1GM8A 3AG2C 4CH5A 1N34O 2FL4A 2QWRB 4F6RB 4L8JA 3H01A 2K1EA 1HNWO 1PV0A 1XUQA 4EFBA 3K5MA 4RUFA 4TWKA 3LDEA 2XASA 4JPRA 2WLIB 2EIKB 5CA3A 3K5NA 1HNZO 4MTOA 3SYPA 4B3TO 3TXQA 2Q4PA 3ETEA 2FTKA 4WFFA 2IU3A 1S76D 1BE3H 4XDJA 3CCEV 1PKXA 4J7ZA 1N33B 4WFGA 3B2EE 1EN6A 2UUAO 4PV1B 2H94A 1TUBB 1Q43A 4H37A 3CCLV 3WB1A 1XREA 2N04A 4TT3G 4U7NA 2NN4A 2WLMA 4LF7O 4U3FH 3RYFA 2ZCEA 2UXDO 3ZHRA 4PI0A 3OTOB 3ETQA 4ZI7A 5J9PC 2ZE6A 1AI5A 4X1KB 3K9SA 4O4LB 4PA6A 2PF4E 4JI4B 4RO2A 5KAFZ 1H2SB 2UU9B 1DLBA 1TA8A 4LF4O 1OCCC 4DR2B 4AI8A 3JAKA 3BVOA 2P7TC 2EIJC 1E1QG 1QLEC 2AW9A 3BPZA 3TGUH 5LL6Y 1AR4A 5K1XA 2M7WA 5L3BA 5J2UA 4XDKA 4FFBA 1V55C 2CK3G 5B3SC 1XMQO 1M1KW 3HKEA 1ZTEA 5H2FZ 1WPXA 2OYQA 2Y4UA 3AK1A 2JEUA 3RW0A 1TAEA 5IYZB 1JFFA 2HKOA 1XHZA 4EFEA 1DGSA 1WB8A 4BAYA 3T1HO 4DO2A 5FPOA 1SZXA 4UCVA 1I94O 4R8CA 4X9QA 3ZBHA 1WJZA 4IL6Z 1R73A 1QR8A 2F43G 5KHIA 1QBZA 3BCCH 4GKJO 1BSMA 2BCCH 4CBCA 2DWEC 4MS2A 1H2LA 4YJ2B 1Y6XA 4DR3O 3SDLA 2ZINA 1ZUQA 4X88A 1IXBA 1SF9A 1NKDA 4PHZA 1FS0G 4K0KB 5CN0A 3JCUZ 4DV4O 5ITZB 3CMAV 4U7OA 4DR7O 1X4TA 2CAZC 4FM2A 1VQ4V 4JI3O 2OCCB 4ZI7B 1YEWA 3T2MA 4J42A 5LOVA 5H6RA 3HKCA 1YITV 2YICA 2OTLV 1BZKA 2E3CA 1MZFA 1Y66A 1JVMA 4G28B 2Z5UA 3AEIA 2EIMC 2KG7A 1QR9A 4PJ0Z 2Q5ZA 3ZHTA 5EIBD 2WLHA 3L73H 4JAVA 3AG3B 1AR5A 4GYCB 1AJQA 1VIBA 3APOA 4MSWC 1QU7A 4YXWG 4DV2O 3J7AU 4FFBB 3ZS8C 3OR6C 3OUSA 5EYPA 4K8XA 4HZ3A 3HKEB 3OW2U 2QWPB 3C3TA 3ABKC 1VQ5V 4OXSA 4UCSA 1PL0A 3CE2A 1J5EB 1PD3A 1FPOA 1HNXO 4DV6B 4XBFA 2YIBD 3SYQA 4B3RO 3EHBB 4OGQB 4QE7A 1Y74B 2RDCA 3RWRD 4LF5B 2QWQB 3L74H 1AROP 3BEHA 1SS3A 3HB3B 2OTJV 4NTYA 1SZTA 3S3XA 4EEQA 5D5PA 4BR6A 4PDRA 3W7SA 2W6IG 4ABMA 4JAUA 2DW4A 1JJ2U 2BOCC 1N32B 2V4DA 4N23A 2ZNIA 4U3JA 4DW0A 3CRAA 4YIPA 1RPRA 1Q6IA 2EINB 2RCVA 1PL4A 2VRZA 4HNAB 3BA9A 3ZRWA 1M56C 4LF8B 4H13B 4AQYB 3UKMA 1IBLB 4MTFA 3KKYA 2LW7A 2WLJA 2KG7B 4JYAB 3JALB 4CC5A 4JGSA 2ZQMA 1AI7A 3A2FA 1VQOV 2HP8A 2ADQB 3THOA 1J5EO 3K04A 2Y48A 1FKAO 1FFXB 5CA0A 1MMMA 4R50A 4I4TA 3IAYA 2HVKC 3CCSV 4NKGB 3CS5A 3SJCC 2Y69C 4X20B 3JD3A 4OPAA 4W4KA 2YIDA 2HVJC 2WA4A 2ZT9B 3R66A 1JJOA 1GAXA 4DUYB 4X62B 3OEEG 1S72V 4JI1O 5KUMA 2OT5A 1N32O 4PA3A 2BOBC 1N0NA 3K58A 2A3QA 3IC7A 3VQWA 2FYUH 1KBHA 3K0GA 1BT8A 5B1BB 3QG5A 3QF7A 1WA8B 4D6TH 1N36B 3QO5A 4FM0A 4LF8O 1JR9A 2ZIMA 3FB6C 1U96A 5CMUA 3ABMB 1IBLO 1S0VA 2OWOA 1OCZB 2QWNB 2Z3YA 1XNRB 3RYIB 2EZOA 2Q7GA 1R6NA 1RM1C 3ZCCA 2YUAA 2QTOA 1Z5WA 4KHPO 1XDCA 4KL1A 1K4DC 3AG7A 1SQVH 3E89A 2XAFA 1NT2B 1TVKA 3MD0A 4LF6O 1N8RW 5KX5A 2VQEO 1MSDA 3SPIA 4O4IB 3RGBA 1FFTB 1K4CC 1T5EA 2DWDC 2ZDIA 4UUJC 4DUZO 2ZM6O 3MDSA 1K7DA 3N2GA 3KCYA 3CXCU 2YIBA 3X2QC 1THZA 4X62O 3UM7A 2CTRA 5CA0B 3ZN0A 3I55V 1COWG 3JSLA 2ZE7A 2E5LB 1VEWA 1GM7A 1JMKC 1AI4A 2UXBB 2EBOA 4UVBA 5JH7A 4QGPA 2YIAA 2AGAA 4LC1A 5DEDA 3AG1C 3OD4A 2OIGA 4PDMA 3RYHB 4JASA 1IDSA 5IY5B 5C8YA 1SA0A 2LQTA 4FK5C 1GH6A 2HG5C 1CPYA 2FB5A 2M6YA 2YXYA 1R3KC 4DR4O 3E8GA 1ORQC 4JI5B 1Z5VA 3FD9A 4JV5O 4WFBV 5LMNB 1IBMB 4X64B 1N4CA 3B40A 1H2KA 1KKDA 5JCOA 3UQ8A 1JOYA 4NXNB 1I7FA 4LH6A 4UCUA 4ZIBA 3VOUA 2AZ0A 4X1IA 4YY3O 4FM1A 3JASA 3SPGA 3WB0A 3SGIA 4BIZA 1QVGU 5CBGA 1Q3EA 1D5AA 1K8AW 2ADPA 2B1GA 2WLIA 3ZRSA 1HW7A 1TVKB 4CS3A 4EB6A 2ZXWC 1GO3F 4K35A 4LP8A 2LGQA 3U10A 1AJPA 1N34B 2JIZG 1CP9A 2QA4V 2KQXA 5J2TB 1X59A 1Z2GA 1S77D 1HNWB 4KFMA 3N2GB 3QVNA 4AHCA 2UXXA 3LUTB 1TUBA 3ASNC 1JCHA 2XHBA 2XAQA 4D7TA 4TQFA 2A9HA 4YHHO 1SESA 4DV7O 1PNMA 1YJNV 3H1HH 5JH7B 2R9IA 1HNZB 4JI5O 4PA7A 4B3TB 4BWAA 2GV9A 3JAMN 2QKAA 1LR1A 5IYBO 5DN6G 1AILA 2CTWA 4CS4A 5JJNB 5LP6B 1KYOF 3P3PA 1NU1H 5K1PA 1PNLA 4O4LA 3O65A 1IZ3A 1M4UA 4J7KA 3DC6A 1EZJA 1ZAUA 3JSNA 1RFYA 4LFBO 3SJQC 1W2BU 1XEQA 4LF7B 5IJ0B 1WB7A 2KSDA 1Q81W 1OCCB 4LWSB 1N0JA 5BXZA 3SPCA 4TV9A 2UXDB 3MHHC 3JD4A 5HFLA 1NS1A 2XAGA 2BTQB 4B7KA 2DYRB 2V1DA 4X1IB 4DW1A 3ABLB 1R6TA 3JASB 1M90W 1B6QA 1V55B 1M9NA 3A8TA 4FLTA 3I5DA 4LF4B 5IYZA 4LF9O 1KMIZ 4FZ1A 2YSUB 1ZSPA 4FPPA 1F4MA 1G4YB 1F51A 4EB6B 5B1OA 5IT9N 3M7MX 4R6ZA 4LFAO 5FL7G 3ETGA 3ZHSA 3FB5C 1JA8A 4PDLA 1XMQB 2GTAA 5CA1B 5GTIZ 4YJ2A 4ZOLB 1Q6UA 1VQ8V 4CH3A 3PJSK 2GBOA 3L70H 3G4SV 2PUSA 3T1HB 3ASOB 3CSXA 5ITZA 4JYBA 1K33A 3CD6V 1I94B 4GT1A 5IYCO 2BE3A 1D2DA 3TJTA 2V7QG 3QNEA 1NVPD 3OMIB 4MTXA 4GKJB 2OCHA 4HYOA 4E2LA 3ZN1A 4DR3B 4OX9O 2Q69A 1AVMA 4O4JB 3CP1A 5KUKA 2Q8VA 2WPDG 3UCSC 3L72H 4G2KA 5LGUA 3HKBB 3VQVA 4DV4B 2ZKOA 1UFIA 3OGIB 4JZGA 3E2EA 4DR7B 1H8HG 1FXKC 3DSQA 4DR6O 3B4SA 5B5EZ 3K59A 4JI3B 2IU0A 5GTHZ 4TV9B 5LGNA 5LHGA 3CRQA 1GK9A 3R65A 3HKDB 3DXRB 3K03A 3IJ4A 4UCRA 3UT5B 1AJNA 3CC4V 2G38A 1P7GA 3LNMB 5KMGA 3OEHG 1YJWV 4NXMO 3BRCA 1K73W 5A2QN 2VWKA 2DQ3A 2DN9A 2F66C 5L3EA 1R3IC 5IE9A 3T1YO 1VF6A 3CYOA 1JQ0A 3F7VC 1YXBA 2RQ6A 2F93B 1ZLZA 3OAAG 4DV2B 3TK1A 1Y74A 5DECA 1P4RA 2PI5A 2Z0AA 5E79Z 5CBFA 4FLWA 4FLYA 2EIKC 5BMVA 2BSKB 5D5QA 3FB8C 1DTOA 4BW5A 2GTSA 4TV8B 3ABTA 2LJ2A 1YZBA 3M99B 4I7ZB 1H38A 2ILMA 4X66O 1MG1A 2UUCO 2GUZB 1HNXB 1URFA 1NI8A 2EJ7A 2IH3C 4GX1A 4B3RB 4J9YB 1XL4A 1B04A 1Q86W 3P30A 4LNUA 1M93A 1OCOC 4HNAA 1AI6A 4B3SO 5BR8B 4C7UA 1KD1W 3ZMUA 4DV1O 1M56B 4J9ZB 1BQZA 4DV3O 1CEZA 4MW8A 3GB7C 4MT8A 3OTFA 2F23A 3RVYA 3JALA 4B7EA 3U0ZA 1FJGO 4WFHA 1YVWA 1NR7A 3ZMZA 2JGDA 2IJJA 2XTAA 1DK1A 1QCEA 1FFXA 2ARHA 1Q90D 2HR3A 1GRJA 2A0LA 2QTSA 2JVDA 2XNDG 1Q82W 1XQ8A 2ZIOA 2X6CA 4X20A 5KMGB 1WP7A 2IW5A 3B77A 2EILC 2WSSG 3BHPA 3N2KB 1YHQV 2A79B 2Y0PA 1PNKA 2P4VA 5EZYB 4CC6A 2UXCO 1KKCA 4I50A 4UFZA 3LNNA 4ZHQA 3G71V 3FFQA 2Q9LA 3CB2A 1MNGA 2N05A 2QGNA 4TOIA 4QE9A 5BMVB 1WA8A 5BR8O 4MW3A 1LNQA 1UJWB 1VQ9V 4UCTA 4TQDA 3CCJV 3U11A 1AP6A 4QJFB 4G27B 4JI1B 5LA6A 3SYAA 1VQPV 2YXLA 1S5HC 3CCRV 1VP7A 3RYIA 5HFMA 3OFNG 4KXRA 1SERA 1I08A 1QHTA 1RM1B 3G80A 1H8EG 1RSOB 3T4DA 4LNUB 5H9CA 4TSFG 5H6QA 3CEIA 3RBZA 4O4IA 3ETDA 4LH7A 1WLEA 5TISZ 1K97A 1VQNV 2JGDB 4I0XB 4NB5A 4KHPB 4GLXA 2EJRA 4QPKA 4FIPC 5LGTA 1BL8A 1YTFD 2ZD9A 5EK0A 4LF6B 3GWOA 4IIJA 2VQEB 4TUYA 2LFRA 1BCCH 4DR5O 3AG3C 3E8HA 5LBQA 3RYHA 3B8NA 1EN5A 4DXWA 2GDSA 5JVDB 3AG1B 4DUZB 2ZM6B 2L35A 4X89A 2E76B 4RAIA 4QNHB 2QDOA 2ITDC 1FXVA 1K34A 3MHSC 3AG4C 1NVPB 4J41A 3F7YC 4I50B 5BY1A 4ZHQB 4DV5O 2CGNA 2CUGA 4GKKO 1WN7A 3N27A 1GMGA 5GW7A 5IWAO 4ZBMA 4LCUC 3WFVA 2Q67A 5A9GA 1NH2D 4NTXA 2QE7G
chains in the Genus database with same CATH topology
2NLJC 5J9PC 1IXMA 1XL6A 3A0RA 1AI5A 5EBMC 4KFMA 1S77D 3W7XA 2DYSB 2UXXA 5BZBA 3CCVV 3AG4B 3LUTB 4PA6A 3ASNC 4FMTA 1JCHA 4L87A 4RO2A 2XAQA 3RVZA 3DGEA 2A9HA 1DLBA 3OMNB 4UV9A 1SESA 2QM8A 3QO7A 1OCCC 1PNMA 1YJNV 2R9IA 2P7TC 3W7UA 4PA7A 2EIJC 3CC7V 1E1QG 1M57C 1QLEC 4PDVA 5IYBO 5DN6G 1HWYA 5L3CA 3ZMTA 1KC8W 3ZRXA 1EFRG 1OCRB 2M7WA 2EINC 2X7RB 5L3BA 1GTOA 4XDKA 1R3LC 1V55C 1YSCA 1PNLA 2YEVA 3LDDA 2CK3G 5B3SC 1YI2V 1M1KW 3D3IA 1WPXA 1EZJA 2QEXV 5EBWC 3D36A 2JEUA 3RW0A 1V54B 3ASNB 3SJQC 2IJIA 2HKOA 2DQ0A 3STZC 1W2BU 2WWWA 2WLKA 1K3EA 2JJ1G 1OHHG 4BAYA 1BHAA 4DO2A 3K9AA 4JTAB 1Q81W 1OCCB 2R9RB 1ROPA 3SPCA 2WLLB 3MHHC 4N21A 4PA4A 4R8CA 3JD4A 2OCCC 5HFLA 3CCUV 2HJFC 2ZR2A 2H8PC 4MTGA 2XAGA 1K5SA 1R73A 1QR8A 1JPXA 1M57B 1R3JC 5EC1C 2F43G 4XDLA 2DYRB 1QBZA 4CBCA 2DWEC 4MS2A 2V1DA 4UV8A 3ABLB 2P90A 1M90W 1B6QA 1V55B 2Q68A 1VQLV 1M9NA 3X2QB 4X88A 1NKDA 2LP7A 1K9MW 3E8FA 1FS0G 5B1NA 2XAJA 1KP3A 5CBHA 4ASUG 5CN0A 2X0LA 4QIWF 2P67A 2YSUB 2QKSA 3CMAV 3IFXA 4U7OA 1K5QA 4FPPA 1F4MA 3CC2V 1G4YB 2WLLA 1F51A 4P9OA 5B1OA 2JDIG 1VQ4V 1SETA 1YJ9V 4MVRA 2OCCB 4UVCA 4R6ZA 3KG2A 4WF9V 5FL7G 1I5XA 3ETGA 1QVFU 3FB5C 3TCUA 3AG2B 3JYCA 4PDLA 1MOFA 3T2MA 5B1BC 1YITV 5H6RA 1VQ8V 2OTLV 4WFEA 3PJSK 1DF5A 3K3WA 2C2AA 3G4SV 2B1IA 1Y66A 1JVMA 4G28B 2Z5UA 3AEIA 2EIMC 3ASOB 1QR9A 1BHBA 4JYBA 1DF4A 1K33A 3CD6V 3E83A 5LHIA 4GT1A 1OCZC 2Q6AA 2IH1C 5IYCO 2WLHA 1R6KA 4WCEV 3LSSA 4JAVA 2V7QG 3QNEA 2AHYA 1NVPD 3AG3B 1ENVA 3OMIB 1AJQA 1E79G 4MSWC 4MTXA 3ZMSA 3W7WA 4HYOA 4YXWG 4E2LA 1BMFG 4HAMA 3ZN1A 1GKFA 4GCZA 3JCZA 3VBBA 1W0KG 3NXSA 1F23A 2Q69A 2YEVB 3CP1A 3OR6C 3OUSA 2WPDG 5KUKA 4HZ3A 4G2KA 3OR7C 3OW2U 2XAHA 5LGUA 3IGAC 3ABKC 3E2EA 3CPWU 1VQ5V 4OXSA 1H8HG 3SPJA 5E1AC 1FXKC 1PL0A 4I9WA 2IU0A 1PD3A 5LGNA 5LHGA 1GK9A 3R65A 4MVQA 4XBFA 2GSMB 2ZXWB 3SYQA 3EHBB 3EFFK 4QE7A 3FB7C 3K03A 2WAMA 4Z1MG 1G8MA 4MVOA 4WFAV 1AROP 3BEHA 5EBLC 3HB3B 2OTJV 4JTCB 1SZTA 3ZRWB 1AJNA 1TUEB 3CC4V 4PDRA 3W7SA 1OZ0A 3LNMB 5IYDO 3OEHG 1YJWV 2W6IG 1I5YA 5C93A 1K73W 4GX5A 4JAUA 2DQ3A 5KA5A 2DW4A 5L3EA 1JJ2U 1R3IC 2BOCC 4MVUA 3JD1A 1FXKB 4N23A 3CYOA 1JQ0A 3F7VC 3OMAB 1NQTA 3E8BA 1RPOA 3OUFA 3OAAG 2EIJB 3E86A 3TK1A 1QLEB 2PI4A 4QPJA 1P4RA 1RPRA 3P32A 2PI5A 5LHHA 4EKWA 3K08A 2EINB 3ZJZA 3ZRWA 5CBFA 2EIKC 2HLDG 2LFSA 1M56C 4P30A 1Q7YW 3FB8C 1DTOA 4PA9A 4BW5A 4KP4A 5B3SB 2ITCC 3UKMA 1VQ7V 4MTFA 3ABTA 1NJIW 2KB1A 2WLJA 3M99B 3QO8A 3WG7C 1YTFB 4P2ZA 1NR1A 1H38A 1MG1A 3E35A 4JGSA 1FXKA 2ZQMA 2IH3C 4GX1A 1AI7A 1Y4MA 4J9YB 1XL4A 1VQOV 4F4LA 3OM3B 1Q86W 2UXNA 3K04A 2Y48A 3FKSG 4UVAA 3FYEB 3CMEV 3P30A 4R50A 1K92A 1OCOC 1AI6A 2ZR3A 2HVKC 2QM7A 3CCSV 4CZZA 2W6JG 3OE7G 1KD1W 2JJ2G 3ZMUA 1M56B 4J9ZB 4GX0A 2Y69C 5B1AC 1MSWD 2W0FC 3JD3A 3ABMC 2NNUA 1CEZA 4MW8A 3GB7C 4MT8A 4PELA 3ZIAG 3RVYA 2ZDIC 2P6JA 4WFHA 2HVJC 3WG7B 2XOKG 5L3DA 4RUEA 3SYOA 1NR7A 3OGCC 3ZMZA 2DYSC 2IJJA 3LDCA 3OEEG 1S72V 3G6EV 4ZKIA 1QCEA 5KUMA 2OT5A 4PA3A 2BOBC 1NH2B 3T4ZA 2HR3A 3IC7A 1QLNA 2A0LA 2WLNA 1YIJV 1P7BA 3K0GA 3ZRVA 1AR1B 3LSQA 1W0JG 1OCOB 2XNDG 5L3FA 5B1BB 3K0DA 1EBOA 1Q82W 2X6CA 3CCMV 3QO5A 1JX9A 2IW5A 3B77A 3FB6C 5B1AB 1SRYA 2EILC 5CMUA 2WSSG 4LBEC 3ABMB 1OCRC 3STLC 2B5UA 2EIMB 1S0VA 1YHQV 2A79B 1J95A 3ML0A 1PNKA 4KUMA 2JEXA 1OCZB 2Z3YA 4RQFA 3JD2A 2EZOA 3K79A 1R6NA 1RM1C 3ZCCA 1V54C 4MVSA 3G71V 2JK5C 2QTOA 5L3GA 1K4DC 3I56V 4MVZA 2MK3A 3E89A 1KP2A 2XAFA 4QE9A 4MVMA 5IDJA 2AHZA 3K06A 3MD0A 4Q20A 3W7TA 1N8RW 4MW3A 4BIUA 2IJHA 1LNQA 3B8MA 3TETA 3SPIA 1ZWIC 1UJWB 5DM6V 1VQ9V 4I5SA 3ABKB 4H33A 3CCJV 4R7CA 1FFTB 2DYRC 2EILB 1K4CC 2DWDC 2ZDIA 4QJFB 5IY5C 4G27B 2IJKA 4UUJC 4X8AA 3SYAA 1VQPV 3ABLC 1S5HC 3CCRV 1K7DA 3CXCU 3X2QC 1THZA 5HFMA 1E1RG 3UM7A 3SPHA 1VQMV 3HPLC 3OFNG 1SERA 3FYIB 3ZN0A 3I55V 2EZPA 1RM1B 1COWG 3F5WC 1VQ6V 1H8EG 3T4DA 5H9CA 4TSFG 1GM7A 2X6BA 1H2GA 4P9PA 1AI4A 1L1FA 2EBOA 4UVBA 3DTUB 3JD0A 5H6QA 3RBZA 4LC1A 3AG1C 1F4NA 4PDMA 1MABG 3ETDA 1GM9A 1WLEA 4FJCC 4JASA 1GM8A 3AG2C 1K97A 5IY5B 2D3OW 4RQEA 1VQNV 4FK5C 3ABUA 2HG5C 1CPYA 1KECA 5EC2C 3H01A 2K1EA 1R3KC 4JF3A 3ASOC 2EJRA 2X6AA 4QPKA 4RUFA 4FIPC 4TWKA 5LGTA 1BL8A 3LDEA 2XASA 1YTFD 2ZD9A 5EK0A 3E8GA 4JPRA 1ORQC 3GWOA 3CCQV 2WLIB 4WFBV 2ATKC 2EIKB 4UXNA 2LFRA 1NBMG 3AG3C 3E8HA 5CA3A 5LBQA 4GX2A 1KKDA 3SYCA 3B8NA 4DXWA 1JOYA 4MTOA 5KA6A 3SYPA 3AG1B 3ETEA 4X89A 4RAIA 2FTKA 4WFFA 2IU3A 4QNHB 1S76D 2ITDC 3VOUA 4XDJA 1FXVA 3CCEV 3T1CA 1PKXA 1K34A 1S3JA 3AG4C 3MHSC 4WFGA 3SPGA 1NVPB 3F7YC 4JYCA 2H94A 4BIZA 1QVGU 5CBGA 1FXHA 3BY6A 1K8AW 4H37A 2HFEC 2B1GA 3ZMVA 3CCLV 2WLIA 2GHYA 3ZRSA 1KQSU 1VQKV 4TT3G 4U7NA 1GMGA 5GW7A 4JTDB 2WLMA 4ZBMA 2ZXWC 1GO3F 4LP8A 1AJPA 2Y69B 4LCUC 3WFVA 2JIZG 2Q67A 1NH2D 1CP9A 2QA4V 2QE7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4M A;  2GHY A;  1NKD A;  2IJK A;  1PD3 A;  3K79 A;  1F4N A;  2IJH A;  1B6Q A;  2IJJ A;  4DO2 A;  1RPR A;  1GMG A;  2IJI A;  1GTO A;  1ROP A;  1RPO A; 
#chains in the Genus database with same CATH topology
 2F4V O;  1B06 A;  1SC5 B;  2CDY A;  2NLJ C;  5LA6 B;  1IXM A;  2F95 B;  1XL6 A;  5EBM C;  2LGW A;  4DR4 B;  3W7X A;  2DYS B;  4UB8 Z;  5BZB A;  1ZL8 B;  2VWJ A;  4YIO A;  4FMT A;  1XHX A;  3F5T A;  1L0L H;  3RVZ A;  5IJ9 A;  5JWP A;  3DGE A;  5FPR A;  2XT9 A;  4JV5 B;  1H2M A;  3OMN B;  3K5O A;  4IT5 A;  4DK1 A;  3D8C A;  1NTK H;  2P06 A;  4IYH A;  1M57 C;  4PDV A;  5L3C A;  5J2T A;  1KC8 W;  3ZRX A;  1EFR G;  1OCR B;  4YY3 B;  2EIN C;  2X7R B;  1GTO A;  1R3L C;  4X1Y B;  1YSC A;  2YEV A;  3LDD A;  1YI2 V;  4I9Q A;  3D36 A;  3H1L H;  1V54 B;  3ASN B;  2DQ0 A;  3STZ C;  1V9P A;  1K3E A;  1PPJ H;  1QNM A;  4IIJ B;  1B3Q A;  3JAT A;  4TUY B;  1ROP A;  5KHH A;  5LXT B;  2YI9 A;  2WLL B;  5JJE B;  4PA4 A;  2ZR2 A;  4MTG A;  4E4E A;  1K5S A;  1JPX A;  1R3J C;  2A7W A;  5LP6 A;  1P84 F;  2PTM A;  4JI7 O;  2P90 A;  4I55 A;  1XIL A;  3BFR A;  1VQL V;  1OV9 A;  2LP7 A;  4YHH B;  1K9M W;  2VS0 A;  4DV7 B;  1KP3 A;  2CGO A;  5CBH A;  3UO2 A;  5IJ0 A;  3APQ A;  3MAQ A;  4LWS A;  3CC2 V;  4GZR B;  4P9O A;  2NR5 A;  1YJ9 V;  4UVC A;  2BTQ A;  1SQX H;  4WF9 V;  3TCU A;  1G1X B;  3AG2 B;  1CXZ B;  1MOF A;  1XMO O;  2YS8 A;  5B1B C;  4JI6 O;  1HR0 O;  2R70 A;  4LFB B;  2RMK B;  2C2A A;  2B1I A;  3H1J H;  5IJ9 B;  2VQF O;  3JAR B;  4K8Z A;  5LMU O;  2RJZ A;  4JYY A;  3IC9 A;  1OCZ C;  2Q6A A;  1GN4 A;  4WCE V;  4Z2W A;  3ZMS A;  3W7W A;  5GON A;  1BMF G;  1GKF A;  4GCZ A;  3VBB A;  5CA1 A;  2P5O A;  1F23 A;  4ZOL A;  2YEV B;  4LF9 B;  4CH6 A;  3OR7 C;  2XAH A;  3IGA C;  3FAV A;  3CPW U;  3SPJ A;  5E1A C;  2Y4T A;  4I9W A;  2DOS A;  2LW1 A;  3JAT B;  1AB3 A;  4LFA B;  4MVQ A;  5LYJ A;  2GSM B;  3TXS A;  3D3Q A;  3EFF K;  4O2B B;  4IGG A;  4DV0 O;  1G8M A;  2E74 B;  4MVO A;  5JQG B;  4O4J A;  1TUE B;  4JI8 O;  4I55 B;  1OZ0 A;  3HKB A;  3NR7 A;  2HHH B;  4OPH A;  3FX7 A;  1WP8 A;  4JI0 B;  5KA5 A;  4DR1 O;  3QTC A;  4DRX A;  3P3N A;  4MVU A;  3JD1 A;  1FXK B;  3K57 A;  3B09 A;  3BA8 A;  3OUF A;  3HKD A;  2EIJ B;  3DXR A;  2Y0I A;  5KAI Z;  3E22 B;  1QLE B;  4OX9 B;  1S5L Z;  4QPJ A;  2PI4 A;  4EKW A;  3ZJZ A;  1XNQ O;  3UT5 A;  1TGO A;  2LFS A;  2PZS A;  1IBK B;  5B3S B;  2ETN A;  1KUQ A;  3CXH F;  4DR6 B;  4AIL C;  3QO8 A;  3WG7 C;  1YTF B;  5FLX N;  3E35 A;  5EIB C;  1F7Y A;  4H44 B;  3OM3 B;  2UXN A;  3RYC B;  3CJH A;  1MZE A;  5GON B;  1EN4 A;  1XI1 A;  3A0H Z;  1K92 A;  2RNB A;  2ZR3 A;  4CZZ A;  2BSK A;  4NXM B;  2W6J G;  3OE7 G;  2N74 A;  4TV8 A;  5B1A C;  2W0F C;  2EX3 A;  3FAV B;  4JI2 O;  2HHH O;  3ZIA G;  3T1Y B;  2ZDI C;  2P6J A;  5FNV B;  1LUW A;  2GUZ A;  2XOK G;  1VAR A;  4RUE A;  4JI0 O;  3OGC C;  2W0X A;  3G6E V;  1D5N A;  2AZ2 A;  1NH2 B;  3AK3 A;  2HJD A;  5LYJ B;  4D7S A;  3D36 C;  4UCO A;  1QLN A;  3CHX A;  3ZHU A;  1P7B A;  1YIJ V;  3ZRV A;  2CH7 B;  1AR1 B;  2Q7H A;  1OCO B;  4NVP A;  3K0D A;  1EBO A;  4PD4 F;  5CB4 B;  3HR0 A;  3CCM V;  1JX9 A;  3J80 N;  1IBK O;  2UUC B;  4X66 B;  4O4H B;  4LBE C;  5LP6 C;  1EM1 A;  2B5U A;  2EIM B;  3L9D A;  3WU2 Z;  1J95 A;  4DK0 A;  2A06 H;  2IM9 A;  2EUL A;  4DRX B;  4UB6 Z;  2ODM A;  2JEX A;  3JAW A;  4RQF A;  1L8D A;  4K3A A;  3K79 A;  4MVS A;  4B3S B;  5JJJ B;  4MVZ A;  2MK3 A;  4DV1 B;  1KP2 A;  1Y76 B;  4IHJ B;  4DV3 B;  4J7J A;  4FLV A;  3CRM A;  4Q20 A;  3W7T A;  4BIU A;  5JCO C;  3B8M A;  4LR3 A;  3SJB C;  1FJG B;  3GVM A;  1ZWI C;  3ABK B;  3N2K A;  4LFC B;  4R7C A;  2DYR C;  2EIL B;  2H3O A;  1Y67 A;  3ABL C;  3PN1 A;  5EZY A;  3K5L A;  2ZNJ A;  3ZHV A;  1E1R G;  1N33 O;  3CJH B;  2EZP A;  3F5W C;  1VQ6 V;  2P4K A;  2X6B A;  1H2G A;  3DTU B;  3JD0 A;  4CS2 A;  2QWO B;  3RT3 C;  1F4N A;  1MAB G;  5B66 Z;  1GM9 A;  3OT7 A;  2HEP A;  2RN9 A;  3VQX A;  2QSA A;  2D3O W;  4RQE A;  2UXC B;  3OTO O;  3ABU A;  1KEC A;  5EC2 C;  4JF3 A;  1A32 A;  3ASO C;  2X6A A;  4H0L B;  1RSO A;  4Z1V A;  4IYI A;  1WPB A;  4JI4 O;  3ICX A;  3CCQ V;  4FLX A;  5KHK A;  2UU9 O;  2ATK C;  4UXN A;  1NBM G;  2L6L A;  4DR2 O;  4GX2 A;  3RYF B;  3SYC A;  5KA6 A;  2CTP A;  1SQG A;  2UUB B;  4LFC O;  2PYL A;  1GN6 A;  4I0X A;  3T1C A;  1S3J A;  3JAW B;  4JYC A;  1FXH A;  3BY6 A;  1RP3 B;  5F2V O;  1W59 A;  3WB2 A;  2HFE C;  3ZMV A;  2GHY A;  1SQP H;  3SJA C;  3EXA A;  1KQS U;  1VQK V;  3JAK B;  4JTD B;  2Y69 B;  1SQB H;  5JVD A;  2D2C B;  1FAF A;  1AP5 A;  2Q73 A;  3A0R A;  1XOU A;  4ICG A;  5J2U B;  2PGG A;  1BQ0 A;  2CTQ A;  3CCV V;  3AG4 B;  4W4L A;  1NZ6 A;  1YDX A;  4L87 A;  1O9G A;  2QKC A;  1G6U A;  1JFF B;  4UV9 A;  2QM8 A;  3QO7 A;  4DR5 B;  4K0K O;  5KLV H;  3UO3 A;  1PP9 H;  3W7U A;  2O57 A;  4YJ3 A;  3CC7 V;  3SR2 C;  1HWY A;  3ZMT A;  2Q0A A;  1S5J A;  4J80 A;  4NTW A;  1SQQ H;  2YI8 A;  2UUB O;  1ZL8 A;  3D3I A;  3LSU A;  4DV5 B;  2QEX V;  5EBW C;  4GKK B;  3L75 H;  2IJI A;  4J10 A;  2WWW A;  5AG2 A;  4DYL A;  2WLK A;  5IWA B;  2JJ1 G;  1OHH G;  1BHA A;  4JTA B;  1PM9 A;  1Q6H A;  3K9A A;  2R9R B;  4N21 A;  2F4V B;  2OCC C;  3CCU V;  2HJF C;  2H8P C;  3KZI Z;  1M57 B;  3A0B Z;  5EC1 C;  4XDL A;  3RFR A;  4X1Y A;  2R72 A;  2E75 B;  4UV8 A;  5LOV B;  3C3S A;  3HKC B;  2Q68 A;  3X2Q B;  3H9V A;  3E8F A;  5B1N A;  2XAJ A;  4ASU G;  2PY5 A;  2X0L A;  4QIW F;  2P67 A;  2QKS A;  3IFX A;  1K5Q A;  3CRC A;  3L71 H;  5LXT A;  2WLL A;  2WA3 A;  2FML A;  2OIE A;  2JDI G;  1SET A;  1FD9 A;  3GWK C;  4MVR A;  3KG2 A;  4BIO A;  4DV6 O;  1I5X A;  2QJ1 A;  1QVF U;  4FZ0 A;  3JYC A;  2QM4 A;  3Q4H A;  4LF5 O;  1YCI A;  1KB9 F;  1O9H A;  4WFE A;  5EYP B;  2YXH A;  1DF5 A;  2Q7E A;  3K3W A;  1YF2 A;  2FKX A;  4NR1 A;  1BHB A;  1DF4 A;  3E83 A;  1VF6 C;  5LHI A;  2QR4 A;  2IH1 C;  1U97 A;  1R6K A;  3LSS A;  3ZHQ A;  2AHY A;  2R9A A;  4YJ3 B;  1ENV A;  1E79 G;  1IVS A;  1IUR A;  1GN2 A;  4JI7 B;  4HAM A;  1R1B A;  3JCZ A;  1W0K G;  3NXS A;  4JZ2 A;  3CX5 F;  5H5N A;  1I0H A;  4O2A A;  3BAB A;  2DE0 X;  3KCX A;  1HDJ A;  4AQY O;  3JAR A;  2ZE5 A;  1MA1 A;  1ZX3 A;  2Q0O C;  4JYA O;  2MW2 B;  2K9P A;  1BS3 A;  1H2N A;  2ZXW B;  4U3J B;  1P49 A;  3FB7 C;  1XMO B;  1WAZ A;  2WAM A;  4Z1M G;  4JI6 B;  1HR0 B;  4WFA V;  4WBN A;  5KHJ A;  5EBL C;  1QQC A;  4JTC B;  1OJH A;  3ZRW B;  2CE4 A;  2VQF B;  5IYD O;  1I5Y A;  5C93 A;  5LMU B;  3ZX6 A;  4GX5 A;  4F6E A;  2DJV A;  2BTO A;  1HP8 A;  3OMA B;  1NQT A;  4DUY O;  3E8B A;  1RPO A;  3E86 A;  4O2B A;  3H1I H;  4J11 A;  4X65 B;  3P32 A;  3S3W A;  1KU9 A;  5LHH A;  5JQG A;  3K08 A;  4I4T B;  1FYJ A;  3Q4H B;  2HLD G;  4B3M B;  1SKV A;  4P30 A;  1Q7Y W;  4PA9 A;  4KP4 A;  4BW9 A;  2ITC C;  4FLZ A;  1VQ7 V;  1EZV H;  1NTM H;  1NJI W;  2KB1 A;  4B08 A;  3ZED A;  1N36 O;  4P2Z A;  1NR1 A;  1FXK A;  1Y4M A;  2PYJ A;  4F4L A;  4FFK A;  3FKS G;  4DV0 B;  3E22 A;  4UVA A;  3FYE B;  1XNR O;  3CME V;  3EVK A;  2KKW A;  4JI8 B;  2AXT Z;  2QM7 A;  1IX9 A;  2JJ2 G;  4O2A B;  1MSW D;  4GX0 A;  4PI2 A;  3ABM C;  2NNU A;  4DR1 B;  4PEL A;  3O9O A;  2JS3 A;  3J81 N;  3WG7 B;  5L3D A;  1WNS A;  3SYO A;  2JS5 A;  2DYS C;  3LDC A;  4F6R A;  2YC0 A;  4ZKI A;  1L0N H;  4JAA A;  3RYC A;  1NTZ H;  3G6B A;  3T4Z A;  1XNQ B;  2WLN A;  1BGY H;  2DMX A;  4X65 O;  4WBN B;  3LSQ A;  1W0J G;  4GUN A;  5L3F A;  1Q5O A;  2E5L O;  2P22 C;  4CH4 A;  4HBN A;  4B3M O;  2UXB O;  5KX5 B;  2F1M A;  3G67 A;  5B1A B;  1SRY A;  2B9Z A;  5FNV A;  1OCR C;  3STL C;  1UPG A;  1SQF A;  3CRR A;  3ML0 A;  4KUM A;  3DC5 A;  3H1K H;  5KHG A;  3JD2 A;  4RWU A;  1V54 C;  2JGU A;  2JK5 C;  5L3G A;  3I56 V;  1VF7 A;  4FVM A;  2CH7 A;  4Q6G A;  1Q8I A;  3M8A A;  4MVM A;  5IDJ A;  5CB4 A;  2AHZ A;  2YDE A;  3K06 A;  4JI2 B;  3BAA A;  2IJH A;  3AK2 A;  3TET A;  1VMG A;  4O4H A;  2JRI A;  5DM6 V;  5LMN O;  4I5S A;  1IBM O;  1GN3 A;  4X64 O;  4H33 A;  5IY5 C;  2XUM A;  2ZE8 A;  4X8A A;  2IJK A;  3VQY A;  3CWB H;  4NXN O;  1US6 A;  5C8Y B;  1SA0 B;  2LO1 A;  4X1K A;  2UUA B;  3SPH A;  1VQM V;  3HPL C;  4FLU A;  3FYI B;  1VF5 B;  1Y76 A;  1LUV A;  4IHJ A;  4P9P A;  1L1F A;  2IBZ H;  4A5U B;  3RN4 A;  4NYK A;  1XBL A;  1M5I A;  3C90 A;  4FJC C;  1GM8 A;  3AG2 C;  4CH5 A;  1N34 O;  2FL4 A;  2QWR B;  4F6R B;  4L8J A;  3H01 A;  2K1E A;  1HNW O;  1PV0 A;  1XUQ A;  4EFB A;  3K5M A;  4RUF A;  4TWK A;  3LDE A;  2XAS A;  4JPR A;  2WLI B;  2EIK B;  5CA3 A;  3K5N A;  1HNZ O;  4MTO A;  3SYP A;  4B3T O;  3TXQ A;  2Q4P A;  3ETE A;  2FTK A;  4WFF A;  2IU3 A;  1S76 D;  1BE3 H;  4XDJ A;  3CCE V;  1PKX A;  4J7Z A;  1N33 B;  4WFG A;  3B2E E;  1EN6 A;  2UUA O;  4PV1 B;  2H94 A;  1TUB B;  1Q43 A;  4H37 A;  3CCL V;  3WB1 A;  1XRE A;  2N04 A;  4TT3 G;  4U7N A;  2NN4 A;  2WLM A;  4LF7 O;  4U3F H;  3RYF A;  2ZCE A;  2UXD O;  3ZHR A;  4PI0 A;  3OTO B;  3ETQ A;  4ZI7 A;  5J9P C;  2ZE6 A;  1AI5 A;  4X1K B;  3K9S A;  4O4L B;  4PA6 A;  2PF4 E;  4JI4 B;  4RO2 A;  5KAF Z;  1H2S B;  2UU9 B;  1DLB A;  1TA8 A;  4LF4 O;  1OCC C;  4DR2 B;  4AI8 A;  3JAK A;  3BVO A;  2P7T C;  2EIJ C;  1E1Q G;  1QLE C;  2AW9 A;  3BPZ A;  3TGU H;  5LL6 Y;  1AR4 A;  5K1X A;  2M7W A;  5L3B A;  5J2U A;  4XDK A;  4FFB A;  1V55 C;  2CK3 G;  5B3S C;  1XMQ O;  1M1K W;  3HKE A;  1ZTE A;  5H2F Z;  1WPX A;  2OYQ A;  2Y4U A;  3AK1 A;  2JEU A;  3RW0 A;  1TAE A;  5IYZ B;  1JFF A;  2HKO A;  1XHZ A;  4EFE A;  1DGS A;  1WB8 A;  4BAY A;  3T1H O;  4DO2 A;  5FPO A;  1SZX A;  4UCV A;  1I94 O;  4R8C A;  4X9Q A;  3ZBH A;  1WJZ A;  4IL6 Z;  1R73 A;  1QR8 A;  2F43 G;  5KHI A;  1QBZ A;  3BCC H;  4GKJ O;  1BSM A;  2BCC H;  4CBC A;  2DWE C;  4MS2 A;  1H2L A;  4YJ2 B;  1Y6X A;  4DR3 O;  3SDL A;  2ZIN A;  1ZUQ A;  4X88 A;  1IXB A;  1SF9 A;  1NKD A;  4PHZ A;  1FS0 G;  4K0K B;  5CN0 A;  3JCU Z;  4DV4 O;  5ITZ B;  3CMA V;  4U7O A;  4DR7 O;  1X4T A;  2CAZ C;  4FM2 A;  1VQ4 V;  4JI3 O;  2OCC B;  4ZI7 B;  1YEW A;  3T2M A;  4J42 A;  5LOV A;  5H6R A;  3HKC A;  1YIT V;  2YIC A;  2OTL V;  1BZK A;  2E3C A;  1MZF A;  1Y66 A;  1JVM A;  4G28 B;  2Z5U A;  3AEI A;  2EIM C;  2KG7 A;  1QR9 A;  4PJ0 Z;  2Q5Z A;  3ZHT A;  5EIB D;  2WLH A;  3L73 H;  4JAV A;  3AG3 B;  1AR5 A;  4GYC B;  1AJQ A;  1VIB A;  3APO A;  4MSW C;  1QU7 A;  4YXW G;  4DV2 O;  3J7A U;  4FFB B;  3ZS8 C;  3OR6 C;  3OUS A;  5EYP A;  4K8X A;  4HZ3 A;  3HKE B;  3OW2 U;  2QWP B;  3C3T A;  3ABK C;  1VQ5 V;  4OXS A;  4UCS A;  1PL0 A;  3CE2 A;  1J5E B;  1PD3 A;  1FPO A;  1HNX O;  4DV6 B;  4XBF A;  2YIB D;  3SYQ A;  4B3R O;  3EHB B;  4OGQ B;  4QE7 A;  1Y74 B;  2RDC A;  3RWR D;  4LF5 B;  2QWQ B;  3L74 H;  1ARO P;  3BEH A;  1SS3 A;  3HB3 B;  2OTJ V;  4NTY A;  1SZT A;  3S3X A;  4EEQ A;  5D5P A;  4BR6 A;  4PDR A;  3W7S A;  2W6I G;  4ABM A;  4JAU A;  2DW4 A;  1JJ2 U;  2BOC C;  1N32 B;  2V4D A;  4N23 A;  2ZNI A;  4U3J A;  4DW0 A;  3CRA A;  4YIP A;  1RPR A;  1Q6I A;  2EIN B;  2RCV A;  1PL4 A;  2VRZ A;  4HNA B;  3BA9 A;  3ZRW A;  1M56 C;  4LF8 B;  4H13 B;  4AQY B;  3UKM A;  1IBL B;  4MTF A;  3KKY A;  2LW7 A;  2WLJ A;  2KG7 B;  4JYA B;  3JAL B;  4CC5 A;  4JGS A;  2ZQM A;  1AI7 A;  3A2F A;  1VQO V;  2HP8 A;  2ADQ B;  3THO A;  1J5E O;  3K04 A;  2Y48 A;  1FKA O;  1FFX B;  5CA0 A;  1MMM A;  4R50 A;  4I4T A;  3IAY A;  2HVK C;  3CCS V;  4NKG B;  3CS5 A;  3SJC C;  2Y69 C;  4X20 B;  3JD3 A;  4OPA A;  4W4K A;  2YID A;  2HVJ C;  2WA4 A;  2ZT9 B;  3R66 A;  1JJO A;  1GAX A;  4DUY B;  4X62 B;  3OEE G;  1S72 V;  4JI1 O;  5KUM A;  2OT5 A;  1N32 O;  4PA3 A;  2BOB C;  1N0N A;  3K58 A;  2A3Q A;  3IC7 A;  3VQW A;  2FYU H;  1KBH A;  3K0G A;  1BT8 A;  5B1B B;  3QG5 A;  3QF7 A;  1WA8 B;  4D6T H;  1N36 B;  3QO5 A;  4FM0 A;  4LF8 O;  1JR9 A;  2ZIM A;  3FB6 C;  1U96 A;  5CMU A;  3ABM B;  1IBL O;  1S0V A;  2OWO A;  1OCZ B;  2QWN B;  2Z3Y A;  1XNR B;  3RYI B;  2EZO A;  2Q7G A;  1R6N A;  1RM1 C;  3ZCC A;  2YUA A;  2QTO A;  1Z5W A;  4KHP O;  1XDC A;  4KL1 A;  1K4D C;  3AG7 A;  1SQV H;  3E89 A;  2XAF A;  1NT2 B;  1TVK A;  3MD0 A;  4LF6 O;  1N8R W;  5KX5 A;  2VQE O;  1MSD A;  3SPI A;  4O4I B;  3RGB A;  1FFT B;  1K4C C;  1T5E A;  2DWD C;  2ZDI A;  4UUJ C;  4DUZ O;  2ZM6 O;  3MDS A;  1K7D A;  3N2G A;  3KCY A;  3CXC U;  2YIB A;  3X2Q C;  1THZ A;  4X62 O;  3UM7 A;  2CTR A;  5CA0 B;  3ZN0 A;  3I55 V;  1COW G;  3JSL A;  2ZE7 A;  2E5L B;  1VEW A;  1GM7 A;  1JMK C;  1AI4 A;  2UXB B;  2EBO A;  4UVB A;  5JH7 A;  4QGP A;  2YIA A;  2AGA A;  4LC1 A;  5DED A;  3AG1 C;  3OD4 A;  2OIG A;  4PDM A;  3RYH B;  4JAS A;  1IDS A;  5IY5 B;  5C8Y A;  1SA0 A;  2LQT A;  4FK5 C;  1GH6 A;  2HG5 C;  1CPY A;  2FB5 A;  2M6Y A;  2YXY A;  1R3K C;  4DR4 O;  3E8G A;  1ORQ C;  4JI5 B;  1Z5V A;  3FD9 A;  4JV5 O;  4WFB V;  5LMN B;  1IBM B;  4X64 B;  1N4C A;  3B40 A;  1H2K A;  1KKD A;  5JCO A;  3UQ8 A;  1JOY A;  4NXN B;  1I7F A;  4LH6 A;  4UCU A;  4ZIB A;  3VOU A;  2AZ0 A;  4X1I A;  4YY3 O;  4FM1 A;  3JAS A;  3SPG A;  3WB0 A;  3SGI A;  4BIZ A;  1QVG U;  5CBG A;  1Q3E A;  1D5A A;  1K8A W;  2ADP A;  2B1G A;  2WLI A;  3ZRS A;  1HW7 A;  1TVK B;  4CS3 A;  4EB6 A;  2ZXW C;  1GO3 F;  4K35 A;  4LP8 A;  2LGQ A;  3U10 A;  1AJP A;  1N34 B;  2JIZ G;  1CP9 A;  2QA4 V;  2KQX A;  5J2T B;  1X59 A;  1Z2G A;  1S77 D;  1HNW B;  4KFM A;  3N2G B;  3QVN A;  4AHC A;  2UXX A;  3LUT B;  1TUB A;  3ASN C;  1JCH A;  2XHB A;  2XAQ A;  4D7T A;  4TQF A;  2A9H A;  4YHH O;  1SES A;  4DV7 O;  1PNM A;  1YJN V;  3H1H H;  5JH7 B;  2R9I A;  1HNZ B;  4JI5 O;  4PA7 A;  4B3T B;  4BWA A;  2GV9 A;  3JAM N;  2QKA A;  1LR1 A;  5IYB O;  5DN6 G;  1AIL A;  2CTW A;  4CS4 A;  5JJN B;  5LP6 B;  1KYO F;  3P3P A;  1NU1 H;  5K1P A;  1PNL A;  4O4L A;  3O65 A;  1IZ3 A;  1M4U A;  4J7K A;  3DC6 A;  1EZJ A;  1ZAU A;  3JSN A;  1RFY A;  4LFB O;  3SJQ C;  1W2B U;  1XEQ A;  4LF7 B;  5IJ0 B;  1WB7 A;  2KSD A;  1Q81 W;  1OCC B;  4LWS B;  1N0J A;  5BXZ A;  3SPC A;  4TV9 A;  2UXD B;  3MHH C;  3JD4 A;  5HFL A;  1NS1 A;  2XAG A;  2BTQ B;  4B7K A;  2DYR B;  2V1D A;  4X1I B;  4DW1 A;  3ABL B;  1R6T A;  3JAS B;  1M90 W;  1B6Q A;  1V55 B;  1M9N A;  3A8T A;  4FLT A;  3I5D A;  4LF4 B;  5IYZ A;  4LF9 O;  1KMI Z;  4FZ1 A;  2YSU B;  1ZSP A;  4FPP A;  1F4M A;  1G4Y B;  1F51 A;  4EB6 B;  5B1O A;  5IT9 N;  3M7M X;  4R6Z A;  4LFA O;  5FL7 G;  3ETG A;  3ZHS A;  3FB5 C;  1JA8 A;  4PDL A;  1XMQ B;  2GTA A;  5CA1 B;  5GTI Z;  4YJ2 A;  4ZOL B;  1Q6U A;  1VQ8 V;  4CH3 A;  3PJS K;  2GBO A;  3L70 H;  3G4S V;  2PUS A;  3T1H B;  3ASO B;  3CSX A;  5ITZ A;  4JYB A;  1K33 A;  3CD6 V;  1I94 B;  4GT1 A;  5IYC O;  2BE3 A;  1D2D A;  3TJT A;  2V7Q G;  3QNE A;  1NVP D;  3OMI B;  4MTX A;  4GKJ B;  2OCH A;  4HYO A;  4E2L A;  3ZN1 A;  4DR3 B;  4OX9 O;  2Q69 A;  1AVM A;  4O4J B;  3CP1 A;  5KUK A;  2Q8V A;  2WPD G;  3UCS C;  3L72 H;  4G2K A;  5LGU A;  3HKB B;  3VQV A;  4DV4 B;  2ZKO A;  1UFI A;  3OGI B;  4JZG A;  3E2E A;  4DR7 B;  1H8H G;  1FXK C;  3DSQ A;  4DR6 O;  3B4S A;  5B5E Z;  3K59 A;  4JI3 B;  2IU0 A;  5GTH Z;  4TV9 B;  5LGN A;  5LHG A;  3CRQ A;  1GK9 A;  3R65 A;  3HKD B;  3DXR B;  3K03 A;  3IJ4 A;  4UCR A;  3UT5 B;  1AJN A;  3CC4 V;  2G38 A;  1P7G A;  3LNM B;  5KMG A;  3OEH G;  1YJW V;  4NXM O;  3BRC A;  1K73 W;  5A2Q N;  2VWK A;  2DQ3 A;  2DN9 A;  2F66 C;  5L3E A;  1R3I C;  5IE9 A;  3T1Y O;  1VF6 A;  3CYO A;  1JQ0 A;  3F7V C;  1YXB A;  2RQ6 A;  2F93 B;  1ZLZ A;  3OAA G;  4DV2 B;  3TK1 A;  1Y74 A;  5DEC A;  1P4R A;  2PI5 A;  2Z0A A;  5E79 Z;  5CBF A;  4FLW A;  4FLY A;  2EIK C;  5BMV A;  2BSK B;  5D5Q A;  3FB8 C;  1DTO A;  4BW5 A;  2GTS A;  4TV8 B;  3ABT A;  2LJ2 A;  1YZB A;  3M99 B;  4I7Z B;  1H38 A;  2ILM A;  4X66 O;  1MG1 A;  2UUC O;  2GUZ B;  1HNX B;  1URF A;  1NI8 A;  2EJ7 A;  2IH3 C;  4GX1 A;  4B3R B;  4J9Y B;  1XL4 A;  1B04 A;  1Q86 W;  3P30 A;  4LNU A;  1M93 A;  1OCO C;  4HNA A;  1AI6 A;  4B3S O;  5BR8 B;  4C7U A;  1KD1 W;  3ZMU A;  4DV1 O;  1M56 B;  4J9Z B;  1BQZ A;  4DV3 O;  1CEZ A;  4MW8 A;  3GB7 C;  4MT8 A;  3OTF A;  2F23 A;  3RVY A;  3JAL A;  4B7E A;  3U0Z A;  1FJG O;  4WFH A;  1YVW A;  1NR7 A;  3ZMZ A;  2JGD A;  2IJJ A;  2XTA A;  1DK1 A;  1QCE A;  1FFX A;  2ARH A;  1Q90 D;  2HR3 A;  1GRJ A;  2A0L A;  2QTS A;  2JVD A;  2XND G;  1Q82 W;  1XQ8 A;  2ZIO A;  2X6C A;  4X20 A;  5KMG B;  1WP7 A;  2IW5 A;  3B77 A;  2EIL C;  2WSS G;  3BHP A;  3N2K B;  1YHQ V;  2A79 B;  2Y0P A;  1PNK A;  2P4V A;  5EZY B;  4CC6 A;  2UXC O;  1KKC A;  4I50 A;  4UFZ A;  3LNN A;  4ZHQ A;  3G71 V;  3FFQ A;  2Q9L A;  3CB2 A;  1MNG A;  2N05 A;  2QGN A;  4TOI A;  4QE9 A;  5BMV B;  1WA8 A;  5BR8 O;  4MW3 A;  1LNQ A;  1UJW B;  1VQ9 V;  4UCT A;  4TQD A;  3CCJ V;  3U11 A;  1AP6 A;  4QJF B;  4G27 B;  4JI1 B;  5LA6 A;  3SYA A;  1VQP V;  2YXL A;  1S5H C;  3CCR V;  1VP7 A;  3RYI A;  5HFM A;  3OFN G;  4KXR A;  1SER A;  1I08 A;  1QHT A;  1RM1 B;  3G80 A;  1H8E G;  1RSO B;  3T4D A;  4LNU B;  5H9C A;  4TSF G;  5H6Q A;  3CEI A;  3RBZ A;  4O4I A;  3ETD A;  4LH7 A;  1WLE A;  5TIS Z;  1K97 A;  1VQN V;  2JGD B;  4I0X B;  4NB5 A;  4KHP B;  4GLX A;  2EJR A;  4QPK A;  4FIP C;  5LGT A;  1BL8 A;  1YTF D;  2ZD9 A;  5EK0 A;  4LF6 B;  3GWO A;  4IIJ A;  2VQE B;  4TUY A;  2LFR A;  1BCC H;  4DR5 O;  3AG3 C;  3E8H A;  5LBQ A;  3RYH A;  3B8N A;  1EN5 A;  4DXW A;  2GDS A;  5JVD B;  3AG1 B;  4DUZ B;  2ZM6 B;  2L35 A;  4X89 A;  2E76 B;  4RAI A;  4QNH B;  2QDO A;  2ITD C;  1FXV A;  1K34 A;  3MHS C;  3AG4 C;  1NVP B;  4J41 A;  3F7Y C;  4I50 B;  5BY1 A;  4ZHQ B;  4DV5 O;  2CGN A;  2CUG A;  4GKK O;  1WN7 A;  3N27 A;  1GMG A;  5GW7 A;  5IWA O;  4ZBM A;  4LCU C;  3WFV A;  2Q67 A;  5A9G A;  1NH2 D;  4NTX A;  2QE7 G; 
#chains in the Genus database with same CATH homology
 2NLJ C;  5J9P C;  1IXM A;  1XL6 A;  3A0R A;  1AI5 A;  5EBM C;  4KFM A;  1S77 D;  3W7X A;  2DYS B;  2UXX A;  5BZB A;  3CCV V;  3AG4 B;  3LUT B;  4PA6 A;  3ASN C;  4FMT A;  1JCH A;  4L87 A;  4RO2 A;  2XAQ A;  3RVZ A;  3DGE A;  2A9H A;  1DLB A;  3OMN B;  4UV9 A;  1SES A;  2QM8 A;  3QO7 A;  1OCC C;  1PNM A;  1YJN V;  2R9I A;  2P7T C;  3W7U A;  4PA7 A;  2EIJ C;  3CC7 V;  1E1Q G;  1M57 C;  1QLE C;  4PDV A;  5IYB O;  5DN6 G;  1HWY A;  5L3C A;  3ZMT A;  1KC8 W;  3ZRX A;  1EFR G;  1OCR B;  2M7W A;  2EIN C;  2X7R B;  5L3B A;  1GTO A;  4XDK A;  1R3L C;  1V55 C;  1YSC A;  1PNL A;  2YEV A;  3LDD A;  2CK3 G;  5B3S C;  1YI2 V;  1M1K W;  3D3I A;  1WPX A;  1EZJ A;  2QEX V;  5EBW C;  3D36 A;  2JEU A;  3RW0 A;  1V54 B;  3ASN B;  3SJQ C;  2IJI A;  2HKO A;  2DQ0 A;  3STZ C;  1W2B U;  2WWW A;  2WLK A;  1K3E A;  2JJ1 G;  1OHH G;  4BAY A;  1BHA A;  4DO2 A;  3K9A A;  4JTA B;  1Q81 W;  1OCC B;  2R9R B;  1ROP A;  3SPC A;  2WLL B;  3MHH C;  4N21 A;  4PA4 A;  4R8C A;  3JD4 A;  2OCC C;  5HFL A;  3CCU V;  2HJF C;  2ZR2 A;  2H8P C;  4MTG A;  2XAG A;  1K5S A;  1R73 A;  1QR8 A;  1JPX A;  1M57 B;  1R3J C;  5EC1 C;  2F43 G;  4XDL A;  2DYR B;  1QBZ A;  4CBC A;  2DWE C;  4MS2 A;  2V1D A;  4UV8 A;  3ABL B;  2P90 A;  1M90 W;  1B6Q A;  1V55 B;  2Q68 A;  1VQL V;  1M9N A;  3X2Q B;  4X88 A;  1NKD A;  2LP7 A;  1K9M W;  3E8F A;  1FS0 G;  5B1N A;  2XAJ A;  1KP3 A;  5CBH A;  4ASU G;  5CN0 A;  2X0L A;  4QIW F;  2P67 A;  2YSU B;  2QKS A;  3CMA V;  3IFX A;  4U7O A;  1K5Q A;  4FPP A;  1F4M A;  3CC2 V;  1G4Y B;  2WLL A;  1F51 A;  4P9O A;  5B1O A;  2JDI G;  1VQ4 V;  1SET A;  1YJ9 V;  4MVR A;  2OCC B;  4UVC A;  4R6Z A;  3KG2 A;  4WF9 V;  5FL7 G;  1I5X A;  3ETG A;  1QVF U;  3FB5 C;  3TCU A;  3AG2 B;  3JYC A;  4PDL A;  1MOF A;  3T2M A;  5B1B C;  1YIT V;  5H6R A;  1VQ8 V;  2OTL V;  4WFE A;  3PJS K;  1DF5 A;  3K3W A;  2C2A A;  3G4S V;  2B1I A;  1Y66 A;  1JVM A;  4G28 B;  2Z5U A;  3AEI A;  2EIM C;  3ASO B;  1QR9 A;  1BHB A;  4JYB A;  1DF4 A;  1K33 A;  3CD6 V;  3E83 A;  5LHI A;  4GT1 A;  1OCZ C;  2Q6A A;  2IH1 C;  5IYC O;  2WLH A;  1R6K A;  4WCE V;  3LSS A;  4JAV A;  2V7Q G;  3QNE A;  2AHY A;  1NVP D;  3AG3 B;  1ENV A;  3OMI B;  1AJQ A;  1E79 G;  4MSW C;  4MTX A;  3ZMS A;  3W7W A;  4HYO A;  4YXW G;  4E2L A;  1BMF G;  4HAM A;  3ZN1 A;  1GKF A;  4GCZ A;  3JCZ A;  3VBB A;  1W0K G;  3NXS A;  1F23 A;  2Q69 A;  2YEV B;  3CP1 A;  3OR6 C;  3OUS A;  2WPD G;  5KUK A;  4HZ3 A;  4G2K A;  3OR7 C;  3OW2 U;  2XAH A;  5LGU A;  3IGA C;  3ABK C;  3E2E A;  3CPW U;  1VQ5 V;  4OXS A;  1H8H G;  3SPJ A;  5E1A C;  1FXK C;  1PL0 A;  4I9W A;  2IU0 A;  1PD3 A;  5LGN A;  5LHG A;  1GK9 A;  3R65 A;  4MVQ A;  4XBF A;  2GSM B;  2ZXW B;  3SYQ A;  3EHB B;  3EFF K;  4QE7 A;  3FB7 C;  3K03 A;  2WAM A;  4Z1M G;  1G8M A;  4MVO A;  4WFA V;  1ARO P;  3BEH A;  5EBL C;  3HB3 B;  2OTJ V;  4JTC B;  1SZT A;  3ZRW B;  1AJN A;  1TUE B;  3CC4 V;  4PDR A;  3W7S A;  1OZ0 A;  3LNM B;  5IYD O;  3OEH G;  1YJW V;  2W6I G;  1I5Y A;  5C93 A;  1K73 W;  4GX5 A;  4JAU A;  2DQ3 A;  5KA5 A;  2DW4 A;  5L3E A;  1JJ2 U;  1R3I C;  2BOC C;  4MVU A;  3JD1 A;  1FXK B;  4N23 A;  3CYO A;  1JQ0 A;  3F7V C;  3OMA B;  1NQT A;  3E8B A;  1RPO A;  3OUF A;  3OAA G;  2EIJ B;  3E86 A;  3TK1 A;  1QLE B;  2PI4 A;  4QPJ A;  1P4R A;  1RPR A;  3P32 A;  2PI5 A;  5LHH A;  4EKW A;  3K08 A;  2EIN B;  3ZJZ A;  3ZRW A;  5CBF A;  2EIK C;  2HLD G;  2LFS A;  1M56 C;  4P30 A;  1Q7Y W;  3FB8 C;  1DTO A;  4PA9 A;  4BW5 A;  4KP4 A;  5B3S B;  2ITC C;  3UKM A;  1VQ7 V;  4MTF A;  3ABT A;  1NJI W;  2KB1 A;  2WLJ A;  3M99 B;  3QO8 A;  3WG7 C;  1YTF B;  4P2Z A;  1NR1 A;  1H38 A;  1MG1 A;  3E35 A;  4JGS A;  1FXK A;  2ZQM A;  2IH3 C;  4GX1 A;  1AI7 A;  1Y4M A;  4J9Y B;  1XL4 A;  1VQO V;  4F4L A;  3OM3 B;  1Q86 W;  2UXN A;  3K04 A;  2Y48 A;  3FKS G;  4UVA A;  3FYE B;  3CME V;  3P30 A;  4R50 A;  1K92 A;  1OCO C;  1AI6 A;  2ZR3 A;  2HVK C;  2QM7 A;  3CCS V;  4CZZ A;  2W6J G;  3OE7 G;  1KD1 W;  2JJ2 G;  3ZMU A;  1M56 B;  4J9Z B;  4GX0 A;  2Y69 C;  5B1A C;  1MSW D;  2W0F C;  3JD3 A;  3ABM C;  2NNU A;  1CEZ A;  4MW8 A;  3GB7 C;  4MT8 A;  4PEL A;  3ZIA G;  3RVY A;  2ZDI C;  2P6J A;  4WFH A;  2HVJ C;  3WG7 B;  2XOK G;  5L3D A;  4RUE A;  3SYO A;  1NR7 A;  3OGC C;  3ZMZ A;  2DYS C;  2IJJ A;  3LDC A;  3OEE G;  1S72 V;  3G6E V;  4ZKI A;  1QCE A;  5KUM A;  2OT5 A;  4PA3 A;  2BOB C;  1NH2 B;  3T4Z A;  2HR3 A;  3IC7 A;  1QLN A;  2A0L A;  2WLN A;  1YIJ V;  1P7B A;  3K0G A;  3ZRV A;  1AR1 B;  3LSQ A;  1W0J G;  1OCO B;  2XND G;  5L3F A;  5B1B B;  3K0D A;  1EBO A;  1Q82 W;  2X6C A;  3CCM V;  3QO5 A;  1JX9 A;  2IW5 A;  3B77 A;  3FB6 C;  5B1A B;  1SRY A;  2EIL C;  5CMU A;  2WSS G;  4LBE C;  3ABM B;  1OCR C;  3STL C;  2B5U A;  2EIM B;  1S0V A;  1YHQ V;  2A79 B;  1J95 A;  3ML0 A;  1PNK A;  4KUM A;  2JEX A;  1OCZ B;  2Z3Y A;  4RQF A;  3JD2 A;  2EZO A;  3K79 A;  1R6N A;  1RM1 C;  3ZCC A;  1V54 C;  4MVS A;  3G71 V;  2JK5 C;  2QTO A;  5L3G A;  1K4D C;  3I56 V;  4MVZ A;  2MK3 A;  3E89 A;  1KP2 A;  2XAF A;  4QE9 A;  4MVM A;  5IDJ A;  2AHZ A;  3K06 A;  3MD0 A;  4Q20 A;  3W7T A;  1N8R W;  4MW3 A;  4BIU A;  2IJH A;  1LNQ A;  3B8M A;  3TET A;  3SPI A;  1ZWI C;  1UJW B;  5DM6 V;  1VQ9 V;  4I5S A;  3ABK B;  4H33 A;  3CCJ V;  4R7C A;  1FFT B;  2DYR C;  2EIL B;  1K4C C;  2DWD C;  2ZDI A;  4QJF B;  5IY5 C;  4G27 B;  2IJK A;  4UUJ C;  4X8A A;  3SYA A;  1VQP V;  3ABL C;  1S5H C;  3CCR V;  1K7D A;  3CXC U;  3X2Q C;  1THZ A;  5HFM A;  1E1R G;  3UM7 A;  3SPH A;  1VQM V;  3HPL C;  3OFN G;  1SER A;  3FYI B;  3ZN0 A;  3I55 V;  2EZP A;  1RM1 B;  1COW G;  3F5W C;  1VQ6 V;  1H8E G;  3T4D A;  5H9C A;  4TSF G;  1GM7 A;  2X6B A;  1H2G A;  4P9P A;  1AI4 A;  1L1F A;  2EBO A;  4UVB A;  3DTU B;  3JD0 A;  5H6Q A;  3RBZ A;  4LC1 A;  3AG1 C;  1F4N A;  4PDM A;  1MAB G;  3ETD A;  1GM9 A;  1WLE A;  4FJC C;  4JAS A;  1GM8 A;  3AG2 C;  1K97 A;  5IY5 B;  2D3O W;  4RQE A;  1VQN V;  4FK5 C;  3ABU A;  2HG5 C;  1CPY A;  1KEC A;  5EC2 C;  3H01 A;  2K1E A;  1R3K C;  4JF3 A;  3ASO C;  2EJR A;  2X6A A;  4QPK A;  4RUF A;  4FIP C;  4TWK A;  5LGT A;  1BL8 A;  3LDE A;  2XAS A;  1YTF D;  2ZD9 A;  5EK0 A;  3E8G A;  4JPR A;  1ORQ C;  3GWO A;  3CCQ V;  2WLI B;  4WFB V;  2ATK C;  2EIK B;  4UXN A;  2LFR A;  1NBM G;  3AG3 C;  3E8H A;  5CA3 A;  5LBQ A;  4GX2 A;  1KKD A;  3SYC A;  3B8N A;  4DXW A;  1JOY A;  4MTO A;  5KA6 A;  3SYP A;  3AG1 B;  3ETE A;  4X89 A;  4RAI A;  2FTK A;  4WFF A;  2IU3 A;  4QNH B;  1S76 D;  2ITD C;  3VOU A;  4XDJ A;  1FXV A;  3CCE V;  3T1C A;  1PKX A;  1K34 A;  1S3J A;  3AG4 C;  3MHS C;  4WFG A;  3SPG A;  1NVP B;  3F7Y C;  4JYC A;  2H94 A;  4BIZ A;  1QVG U;  5CBG A;  1FXH A;  3BY6 A;  1K8A W;  4H37 A;  2HFE C;  2B1G A;  3ZMV A;  3CCL V;  2WLI A;  2GHY A;  3ZRS A;  1KQS U;  1VQK V;  4TT3 G;  4U7N A;  1GMG A;  5GW7 A;  4JTD B;  2WLM A;  4ZBM A;  2ZXW C;  1GO3 F;  4LP8 A;  1AJP A;  2Y69 B;  4LCU C;  3WFV A;  2JIZ G;  2Q67 A;  1NH2 D;  1CP9 A;  2QA4 V;  2QE7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...