4DODA

The structure of cbescii cela gh9 module
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
454
structure length
454
Chain Sequence
b'ASGSFNYGEALQKAIMFYEFQMSGKLPNWVRNNWRGDSALKDGQDNGLDLTGGWFDAGDHVKFNLPMSYTGTMLSWAVYEYKDAFVKSGQLEHILNQIEWVNDYFVKCHPSKYVYYYQVGDGSKDHAWWGPAEVMQMERPSFKVTQSSPGSTVVAETAASLAAASIVLKDRNPTKAATYLQHAKELYEFAEVTKSDAGYTAANGYYNSWSGFYDELSWAAVWLYLATNDSTYLTKAESYVQNWPKISGSNTIDYKWAHCWDDVHNGAALLLAKITGKDIYKQIIESHLDYWTTGYNGERIKYTPKGLAWLDQWGSLRYATTTAFLAFVYSDWVGCPSTKKEIYRKFGESQIDYALGSAGRSFVVGFGTNPPKRPHHRTAHSSWADSQSIPSYHRHTLYGALVGGPGSDDSYTDDISNYVNNEVACDYNAGFVGALAKMYQLYGGNPIPDFKAIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-beta-glucanase
publication title Revealing nature's cellulase diversity: the digestion mechanism of Caldicellulosiruptor bescii CelA.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
total genus 187
structure length 454
sequence length 454
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4dodA00
3A3VA 4ZH5A 1V5CA 3S4CA 1TF4A 3S4AA 4EL8A 3QWTA 4Z4JA 2F6DA 1DOGA 4L0GA 3RRSA 3WKFA 3ANJA 3W7WA 5MEHA 3W7TA 3H7LA 2ZZRA 4CJ0A 3WKIA 1K72A 2EAEA 5GY3A 4AYQA 2P0VA 3E6UA 2DRRA 5M7IA 1G6IA 3RX5A 1L2AA 5KKBA 5CZLA 3WIWA 1IA6A 1ULVA 3ANIA 1LF6A 3VW5A 1G9GA 1V7WA 2B4FA 4AYRA 1H54A 4DODA 1KKTA 4WU0A 1XW2A 1AGMA 1FBOA 2JG0A 1UG9A 2RI9A 2VN7A 3GZKA 1WU6A 2OKXA 2CQTA 4L6XA 2DRQA 2DROA 1G87A 5M7YA 3WIQA 5DGQA 1NXCA 3H3KA 3RX8A 3P2CA 1IA7A 3RENA 1KREA 1F9OA 1KWFA 2NVPA 1GLMA 1HCUA 5GW7A 2VN4A 3ON6A 2D8LA 3T33A 3TF4A 3W7SA 1UT9A 3WKGA 1FO2A 1KSCA 3ACSA 4CJ1A 1L1YA 2FUZA 2JJBA 3S4BA 3WUXA 4Z4LA 3QPFA 3GT5A 4WVBA 4ZG8A 4TF4A 2WYNA 1GAIA 3CIHA 1AYXA 3QXQA 2EADA 4JJJA 3W5MA 1IS9A 1CLCA 1DL2A 3QDEA 3W7UA 2RI8A 3QFYA 3RX7A 1FBWA 1FAEA 2AHGA 4AYPA 2FV0A 3QFZA 2CQSA 3QG0A 1WZZA 2QNOA 1FP3A 2GZ6A 1VD5A 1G9JA 3WIRA 3WC3A 3EZ8A 1V7VA 1H14A 3D3IA 3WKHA 1KSDA 1KS8A 1V5DA 1FCEA 2YIKA 1JS4A 1LF9A 2Z07A 5CD2A 4XUVA 3VXDA 1X9DA 2XFGA 3RSYA 4KTRA 1WU4A 3GLYA 4FUSA 2EABA 4TXTA 4CE7A 2AFAA 3W5NA 1CEMA 5E2JA 4Q88A 3QSPA 1GA2A 2A8ZA 1RQ5A 1H12A 2JF4A 2D5JA 4DOEA 4WVCA 3QT9A 3E73A 4Q2BA 2AHFA 5CA3A 4J5TA 3QRYA 1FO3A 1KFGA 3QT3A 4WVAA 2RGKA 3X17A 1WU5A 3QXFA 1GAHA 4KTPA 5DGRA 1H13A 1KRFA 1F9DA 1XWTA 2DRSA 3ACTA 1NC5A 3H2WA 2GH4A 3EQAA 3ANKA 1V7XA 2FBAA 3K11A 3W7XA 2FV1A 2ZBLA 3S4DA 2EACA 3AFJA 4AYOA 1FMIA 3PMMA 1XWQA
chains in the Genus database with same CATH superfamily
3EU8A 3S4AA 1SA5B 3PZ4B 3QWTA 5JPNB 3RRSA 1X1HA 3WKFA 3ANJA 2Q1FA 1TNBB 3SDQA 2ZZRA 1KZPB 1TN6B 5FOBB 1N7RA 3KQ4A 1G6IA 2BEDB 1N4PB 1HX9A 1HV6A 3E34B 1LF6A 3VW5A 2B4FA 4FJQA 1SA4B 4WU0A 1O6HA 4OZWA 4ONTA 1QBQB 4LNBB 1RWGA 1O1SB 2DROA 2IEJB 5DGQA 1F1SA 1NXCA 3RX8A 1KWFA 2PN5A 4D4BA 3SFXB 3T33A 3PZ3B 1J0NA 1F9GA 1RWHA 1L1YA 3DPYB 3WUXA 3HXDB 3QPFA 1HXGA 1RW9A 4WVBA 1NL4B 3KSLB 2WYNA 2H6GB 4GTOB 4JJJA 1DCEB 3QDEA 3W7UA 3QFYA 5ILHA 3HXEB 2AHGA 4MBGB 5IK9A 3QFZA 3VSNA 5GZKA 3QG0A 1G9JA 2V3PA 1JCQB 2WCOA 2BB6A 3EU5B 3D3IA 2YIKA 2H6IB 2Z07A 1JS4A 1LF9A 3VXDA 2WINB 4CE7A 1UMPA 4GTVB 3DSWB 1FPPB 2A8ZA 3OEDA 4LNGB 3QT9A 2WY8A 1J0MA 5FO9B 4J5TA 2XWBB 3A0OA 3M75A 3QXFA 4KTPA 1N7QA 5DGRA 1H13A 3PYBA 3E30B 1F9DA 1RWFA 3VSMA 3ACTA 1D8DB 1N4SB 3ANKA 1V7XA 3K11A 1QQFA 2ZBLA 3HXFB 5FO8B 2BRPA 1S63B 1N4RB 3A3VA 4V1SA 4DI5A 2SQCA 1DOGA 4YDOB 5IK6A 1QSJA 4KKJA 5MEHA 1HN0A 1LXMA 2EAEA 1LXKA 3WKIA 1LOHA 2NOJA 4AYQA 1H35A 2P0VA 3E6UA 2DRRA 5M7IA 2V8KA 3M7LA 3PZ1B 4D4DA 5KKBA 5AGDA 1N24A 1ULVA 2XQWA 4MMHA 5ILDA 5EATA 1V7WA 1O5MB 3E7JA 1LD7B 1H54A 1I8QA 1N1BA 1TN7B 2JG0A 3P5RA 1WU6A 3KLSA 4L6XA 2DRQA 1MZCB 3E80A 4OJZA 1G87A 1O6QA 3M7BA 3H3KA 4GTRB 1X1IA 5EASA 1C3DA 1H36A 5ILKA 1LTXB 1TNYB 3ON6A 2D8LA 3M77A 3M7CA 2FUZA 3S4BA 1OJMA 1JCSB 3M71A 4GTQB 5ILZA 3E37B 3P5PA 2F0YB 2GOXA 3S9VA 2QNOA 3DRAB 1FP3A 4RNQA 1VD5A 1HXAA 3WKHA 1V5DA 2V8IA 5CD2A 4XUVA 1QAZA 1H39A 1X9DA 2H6FB 3RSYA 1HXCA 4TXTA 2AFAA 4LNVA 3G4DA 3W5NA 1N20A 1H3CA 1GA2A 1RQ5A 1H12A 1W6JA 4DOEA 3DSSB 3SDRA 3EUVB 4FXGB 1HMWA 3M73A 2X03A 1HM3A 4GTMB 1WU5A 3SDUA 4GTPB 1HZFA 3PZ2B 1GXOA 1NC5A 2GH4A 4GL3A 1X1JA 3DSUB 3SDVA 2FBAA 3W7XA 2E22A 2A73B 4LIXA 3AFJA 4C1SA 1FMIA 3PMMA 1XWQA 3N0GA 4ZH5A 3S4CA 4ZH1A 4Z4JA 2F6DA 3Q7FB 4L0GA 1N7PA 3D5SA 4OZVA 4GAXA 4D94A 3W7WA 4F10A 1K72A 5GY3A 5ILYA 5C05A 5DHKA 5JPMB 3RX5A 5CZLA 3WIWA 1R76A 1IA6A 3ANIA 3RJ3A 4AYRA 4DODA 1KKTA 1XW2A 1AGMA 1FBOA 1EGUA 5ILIA 3NFVA 1UG9A 2RI9A 3GZKA 4MU9A 4EHMB 2B39A 5M7YA 3WIQA 3E33B 2XWJB 3P2CA 1IA7A 3RENA 2BB5A 5IL3A 1HCUA 5GW7A 2VN4A 1TNZB 3TF4A 1O6RA 1UT9A 3WKGA 4KKIA 1O1TB 1H3AA 1N95B 3GT5A 1GAIA 3QXQA 2EADA 3G6JB 3W5MA 2FUQA 1CLCA 3M72A 2RI8A 1FBWA 1FAEA 2H6HB 3M01A 3M76A 4BOKA 1KZOB 4FXKB 4F13A 1OJNA 1JCRB 4D4CA 3WC3A 1N94B 1V7VA 1D8EB 2PMVA 3KSQB 5JMFA 2BRWA 5DHIA 3M00A 2ONHA 2XFGA 4KTRA 1WU4A 3GLYA 4GTSB 3PYAA 3M7EA 4BOJA 2R2LB 4Q88A 4D4AA 3SAEA 2ZIRB 4ZRQA 4YDEB 4M76A 3DSXB 5CA3A 2BBCA 2V8JA 3QRYA 3QT3A 2RGKA 3X17A 1TN8B 1GAHA 1GHQA 2DRSA 5IL8A 3Q73B 1OJPA 3SQCA 3SFYB 2FV1A 3Q78B 5IM1A 1FT1B 1GXNA 5FO7B 4Z4LA 4OK2A 4EL8A 1N7NA 1V5CA 1N23A 1TF4A 1N4QB 3DSTB 1HMUA 4V1RA 3Q75B 1N1ZA 3W7TA 3HXCB 3H7LA 1RWCA 4CJ0A 5JMDA 2ZISB 4ZRPA 4OK4A 2I07B 1NI1B 4GTTB 4L9PB 1L2AA 3AFLA 3C72B 2BRVX 1N7OA 2V3NA 1G9GA 3M02A 2WDAA 5EAUA 1X81B 2VN7A 2OKXA 1W3YA 2CQTA 1LD8B 5IKAA 5ILJA 3OXUA 3HXBB 1KREA 1F9OA 3CU7A 1OJOA 2NVPA 1GLMA 2ONGA 3M74A 5IKHA 3W7SA 2WIIB 1FO2A 1KSCA 3ACSA 1FT2B 4CJ1A 1TNUB 2JJBA 1H37A 1C82A 3N0FA 2J5CA 2FUTA 3M78A 1HM2A 4ZG8A 4TF4A 3CIHA 1AYXA 3Q7AB 1IS9A 1DL2A 3K7XA 3RX7A 4AYPA 2FV0A 2CQSA 2G02A 1WZZA 2GZ6A 4YCRA 3WIRA 2E24A 3EZ8A 3G4FA 1H14A 1KSDA 1KS8A 4MMIA 1FCEA 3NNBA 1SQCA 4FNVA 4FUSA 2EABA 1W6KA 1TNOB 2WY7A 5IK0A 1CB8A 1CEMA 1O79A 5E2JA 3QSPA 1N21A 2JF4A 2D5JA 2G0DA 4WVCA 3E73A 3Q79B 1RWAA 1N9AB 4Q2BA 2AHFA 1GSZA 4E1YA 1FO3A 1KFGA 4WVAA 1S64B 3LZ9A 4QT9A 1N22A 1KRFA 3D5RA 1XWTA 4NEIA 1O1RB 3H2WA 3EQAA 1GXMA 3DSVB 1H3BA 3SDTA 3S4DA 2EACA 3E32B 4AYOA
chains in the Genus database with same CATH topology
3EU8A 3S4AA 1SA5B 3PZ4B 3QWTA 5JPNB 3RRSA 3WKFA 3ANJA 1TNBB 3SDQA 2ZZRA 1KZPB 1TN6B 5FOBB 3KQ4A 1G6IA 2BEDB 1N4PB 3E34B 1LF6A 3VW5A 2B4FA 1SA4B 4WU0A 1O6HA 4ONTA 1QBQB 4LNBB 1O1SB 2DROA 2IEJB 5DGQA 1NXCA 3RX8A 1KWFA 2PN5A 4D4BA 3SFXB 3T33A 3PZ3B 1L1YA 3DPYB 3WUXA 3HXDB 3QPFA 4WVBA 1NL4B 3KSLB 2WYNA 2H6GB 4GTOB 4JJJA 1DCEB 3QDEA 3W7UA 3QFYA 3HXEB 2AHGA 4MBGB 3QFZA 5GZKA 3QG0A 1G9JA 2V3PA 1JCQB 2BB6A 3EU5B 3D3IA 2YIKA 2H6IB 2Z07A 1JS4A 1LF9A 3VXDA 2WINB 4CE7A 1UMPA 4GTVB 3DSWB 1FPPB 2A8ZA 3OEDA 4LNGB 3QT9A 2WY8A 5FO9B 4J5TA 2XWBB 3M75A 3QXFA 4KTPA 5DGRA 3PYBA 1H13A 3E30B 1F9DA 3ACTA 1D8DB 1N4SB 3ANKA 1V7XA 3K11A 1QQFA 2ZBLA 3HXFB 5FO8B 1S63B 1N4RB 3A3VA 4V1SA 2SQCA 1DOGA 4YDOB 1QSJA 4KKJA 5MEHA 3WKIA 2EAEA 4AYQA 2NOJA 1H35A 2P0VA 3E6UA 2DRRA 5M7IA 2V8KA 3M7LA 3PZ1B 4D4DA 5KKBA 5AGDA 1ULVA 2XQWA 1V7WA 1O5MB 1LD7B 1H54A 1TN7B 2JG0A 3P5RA 1WU6A 3KLSA 4L6XA 2DRQA 1MZCB 1G87A 1O6QA 3M7BA 3H3KA 4GTRB 1C3DA 1H36A 1LTXB 1TNYB 3ON6A 2D8LA 3M77A 3M7CA 2FUZA 3S4BA 1JCSB 3M71A 4GTQB 3E37B 3P5PA 2F0YB 2GOXA 3S9VA 2QNOA 3DRAB 1FP3A 1VD5A 3WKHA 1V5DA 2V8IA 5CD2A 4XUVA 1X9DA 1H39A 2H6FB 3RSYA 4TXTA 2AFAA 4LNVA 3W5NA 1H3CA 1GA2A 1RQ5A 1H12A 1W6JA 4DOEA 3DSSB 3SDRA 3EUVB 4FXGB 3M73A 4GTMB 1WU5A 3SDUA 4GTPB 3PZ2B 1HZFA 1GXOA 1NC5A 2GH4A 4GL3A 3DSUB 3SDVA 2FBAA 3W7XA 2A73B 4LIXA 3AFJA 4C1SA 1FMIA 3PMMA 1XWQA 4ZH5A 3S4CA 4ZH1A 4Z4JA 2F6DA 3Q7FB 4L0GA 3D5SA 4D94A 3W7WA 1K72A 5GY3A 5JPMB 3RX5A 5CZLA 3WIWA 1R76A 1IA6A 3ANIA 3RJ3A 4AYRA 4DODA 1KKTA 1XW2A 1AGMA 1FBOA 1UG9A 2RI9A 3GZKA 4MU9A 4EHMB 2B39A 5M7YA 3WIQA 3E33B 2XWJB 3P2CA 1IA7A 3RENA 2BB5A 1HCUA 5GW7A 2VN4A 1TNZB 3TF4A 1O6RA 1UT9A 3WKGA 4KKIA 1O1TB 1H3AA 1N95B 3GT5A 1GAIA 3QXQA 2EADA 3G6JB 3W5MA 1CLCA 3M72A 2RI8A 1FBWA 1FAEA 2H6HB 3M76A 4BOKA 1KZOB 4FXKB 1JCRB 4D4CA 3WC3A 1N94B 1V7VA 1D8EB 2PMVA 3KSQB 2XFGA 4KTRA 1WU4A 3GLYA 4GTSB 3PYAA 3M7EA 4BOJA 2R2LB 4Q88A 4D4AA 3SAEA 2ZIRB 4ZRQA 4YDEB 4M76A 3DSXB 5CA3A 2BBCA 2V8JA 3QRYA 3QT3A 2RGKA 3X17A 1TN8B 1GAHA 1GHQA 2DRSA 3Q73B 3SQCA 3SFYB 2FV1A 3Q78B 1FT1B 1GXNA 5FO7B 4Z4LA 4EL8A 1V5CA 1TF4A 1N4QB 3DSTB 4V1RA 3Q75B 3W7TA 3HXCB 3H7LA 4CJ0A 2ZISB 4ZRPA 2I07B 1NI1B 4GTTB 4L9PB 1L2AA 3C72B 2V3NA 1G9GA 1X81B 2VN7A 2OKXA 2CQTA 1LD8B 3OXUA 3HXBB 1KREA 1F9OA 3CU7A 2NVPA 1GLMA 3M74A 3W7SA 2WIIB 1FO2A 1KSCA 3ACSA 1FT2B 4CJ1A 1TNUB 2JJBA 1H37A 3M78A 4ZG8A 4TF4A 3CIHA 1AYXA 3Q7AB 1IS9A 1DL2A 3K7XA 3RX7A 4AYPA 2FV0A 2CQSA 2G02A 1WZZA 2GZ6A 4YCRA 3WIRA 3EZ8A 1H14A 1KSDA 1KS8A 1FCEA 1SQCA 4FUSA 2EABA 1W6KA 1TNOB 2WY7A 1CEMA 1O79A 5E2JA 3QSPA 2JF4A 2D5JA 2G0DA 4WVCA 3E73A 3Q79B 1N9AB 4Q2BA 2AHFA 1GSZA 1FO3A 1KFGA 4WVAA 1S64B 4QT9A 1KRFA 3D5RA 1XWTA 1O1RB 3H2WA 3EQAA 1GXMA 3DSVB 1H3BA 3SDTA 3S4DA 2EACA 3E32B 4AYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3V A;  4ZH5 A;  1V5C A;  3S4C A;  1TF4 A;  3S4A A;  4EL8 A;  3QWT A;  4Z4J A;  2F6D A;  1DOG A;  4L0G A;  3RRS A;  3WKF A;  3ANJ A;  3W7W A;  5MEH A;  3W7T A;  3H7L A;  2ZZR A;  4CJ0 A;  3WKI A;  1K72 A;  2EAE A;  5GY3 A;  4AYQ A;  2P0V A;  3E6U A;  2DRR A;  5M7I A;  1G6I A;  3RX5 A;  1L2A A;  5KKB A;  5CZL A;  3WIW A;  1IA6 A;  1ULV A;  3ANI A;  1LF6 A;  3VW5 A;  1G9G A;  1V7W A;  2B4F A;  4AYR A;  1H54 A;  4DOD A;  1KKT A;  4WU0 A;  1XW2 A;  1AGM A;  1FBO A;  2JG0 A;  1UG9 A;  2RI9 A;  2VN7 A;  3GZK A;  1WU6 A;  2OKX A;  2CQT A;  4L6X A;  2DRQ A;  2DRO A;  1G87 A;  5M7Y A;  3WIQ A;  5DGQ A;  1NXC A;  3H3K A;  3RX8 A;  3P2C A;  1IA7 A;  3REN A;  1KRE A;  1F9O A;  1KWF A;  2NVP A;  1GLM A;  1HCU A;  5GW7 A;  2VN4 A;  3ON6 A;  2D8L A;  3T33 A;  3TF4 A;  3W7S A;  1UT9 A;  3WKG A;  1FO2 A;  1KSC A;  3ACS A;  4CJ1 A;  1L1Y A;  2FUZ A;  2JJB A;  3S4B A;  3WUX A;  4Z4L A;  3QPF A;  3GT5 A;  4WVB A;  4ZG8 A;  4TF4 A;  2WYN A;  1GAI A;  3CIH A;  1AYX A;  3QXQ A;  2EAD A;  4JJJ A;  3W5M A;  1IS9 A;  1CLC A;  1DL2 A;  3QDE A;  3W7U A;  2RI8 A;  3QFY A;  3RX7 A;  1FBW A;  1FAE A;  2AHG A;  4AYP A;  2FV0 A;  3QFZ A;  2CQS A;  3QG0 A;  1WZZ A;  2QNO A;  1FP3 A;  2GZ6 A;  1VD5 A;  1G9J A;  3WIR A;  3WC3 A;  3EZ8 A;  1V7V A;  1H14 A;  3D3I A;  3WKH A;  1KSD A;  1KS8 A;  1V5D A;  1FCE A;  2YIK A;  1JS4 A;  1LF9 A;  2Z07 A;  5CD2 A;  4XUV A;  3VXD A;  1X9D A;  2XFG A;  3RSY A;  4KTR A;  1WU4 A;  3GLY A;  4FUS A;  2EAB A;  4TXT A;  4CE7 A;  2AFA A;  3W5N A;  1CEM A;  5E2J A;  4Q88 A;  3QSP A;  1GA2 A;  2A8Z A;  1RQ5 A;  1H12 A;  2JF4 A;  2D5J A;  4DOE A;  4WVC A;  3QT9 A;  3E73 A;  4Q2B A;  2AHF A;  5CA3 A;  4J5T A;  3QRY A;  1FO3 A;  1KFG A;  3QT3 A;  4WVA A;  2RGK A;  3X17 A;  1WU5 A;  3QXF A;  1GAH A;  4KTP A;  5DGR A;  1H13 A;  1KRF A;  1F9D A;  1XWT A;  2DRS A;  3ACT A;  1NC5 A;  3H2W A;  2GH4 A;  3EQA A;  3ANK A;  1V7X A;  2FBA A;  3K11 A;  3W7X A;  2FV1 A;  2ZBL A;  3S4D A;  2EAC A;  3AFJ A;  4AYO A;  1FMI A;  3PMM A;  1XWQ A; 
#chains in the Genus database with same CATH topology
 3EU8 A;  3S4A A;  1SA5 B;  3PZ4 B;  3QWT A;  5JPN B;  3RRS A;  1X1H A;  3WKF A;  3ANJ A;  2Q1F A;  1TNB B;  3SDQ A;  2ZZR A;  1KZP B;  1TN6 B;  5FOB B;  1N7R A;  3KQ4 A;  1G6I A;  2BED B;  1N4P B;  1HX9 A;  1HV6 A;  3E34 B;  1LF6 A;  3VW5 A;  2B4F A;  4FJQ A;  1SA4 B;  4WU0 A;  1O6H A;  4OZW A;  4ONT A;  1QBQ B;  4LNB B;  1RWG A;  1O1S B;  2DRO A;  2IEJ B;  5DGQ A;  1F1S A;  1NXC A;  3RX8 A;  1KWF A;  2PN5 A;  4D4B A;  3SFX B;  3T33 A;  3PZ3 B;  1J0N A;  1F9G A;  1RWH A;  1L1Y A;  3DPY B;  3WUX A;  3HXD B;  3QPF A;  1HXG A;  1RW9 A;  4WVB A;  1NL4 B;  3KSL B;  2WYN A;  2H6G B;  4GTO B;  4JJJ A;  1DCE B;  3QDE A;  3W7U A;  3QFY A;  5ILH A;  3HXE B;  2AHG A;  4MBG B;  5IK9 A;  3QFZ A;  3VSN A;  5GZK A;  3QG0 A;  1G9J A;  2V3P A;  1JCQ B;  2WCO A;  2BB6 A;  3EU5 B;  3D3I A;  2YIK A;  2H6I B;  2Z07 A;  1JS4 A;  1LF9 A;  3VXD A;  2WIN B;  4CE7 A;  1UMP A;  4GTV B;  3DSW B;  1FPP B;  2A8Z A;  3OED A;  4LNG B;  3QT9 A;  2WY8 A;  1J0M A;  5FO9 B;  4J5T A;  2XWB B;  3A0O A;  3M75 A;  3QXF A;  4KTP A;  1N7Q A;  5DGR A;  1H13 A;  3PYB A;  3E30 B;  1F9D A;  1RWF A;  3VSM A;  3ACT A;  1D8D B;  1N4S B;  3ANK A;  1V7X A;  3K11 A;  1QQF A;  2ZBL A;  3HXF B;  5FO8 B;  2BRP A;  1S63 B;  1N4R B;  3A3V A;  4V1S A;  4DI5 A;  2SQC A;  1DOG A;  4YDO B;  5IK6 A;  1QSJ A;  4KKJ A;  5MEH A;  1HN0 A;  1LXM A;  2EAE A;  1LXK A;  3WKI A;  1LOH A;  2NOJ A;  4AYQ A;  1H35 A;  2P0V A;  3E6U A;  2DRR A;  5M7I A;  2V8K A;  3M7L A;  3PZ1 B;  4D4D A;  5KKB A;  5AGD A;  1N24 A;  1ULV A;  2XQW A;  4MMH A;  5ILD A;  5EAT A;  1V7W A;  1O5M B;  3E7J A;  1LD7 B;  1H54 A;  1I8Q A;  1N1B A;  1TN7 B;  2JG0 A;  3P5R A;  1WU6 A;  3KLS A;  4L6X A;  2DRQ A;  1MZC B;  3E80 A;  4OJZ A;  1G87 A;  1O6Q A;  3M7B A;  3H3K A;  4GTR B;  1X1I A;  5EAS A;  1C3D A;  1H36 A;  5ILK A;  1LTX B;  1TNY B;  3ON6 A;  2D8L A;  3M77 A;  3M7C A;  2FUZ A;  3S4B A;  1OJM A;  1JCS B;  3M71 A;  4GTQ B;  5ILZ A;  3E37 B;  3P5P A;  2F0Y B;  2GOX A;  3S9V A;  2QNO A;  3DRA B;  1FP3 A;  4RNQ A;  1VD5 A;  1HXA A;  3WKH A;  1V5D A;  2V8I A;  5CD2 A;  4XUV A;  1QAZ A;  1H39 A;  1X9D A;  2H6F B;  3RSY A;  1HXC A;  4TXT A;  2AFA A;  4LNV A;  3G4D A;  3W5N A;  1N20 A;  1H3C A;  1GA2 A;  1RQ5 A;  1H12 A;  1W6J A;  4DOE A;  3DSS B;  3SDR A;  3EUV B;  4FXG B;  1HMW A;  3M73 A;  2X03 A;  1HM3 A;  4GTM B;  1WU5 A;  3SDU A;  4GTP B;  1HZF A;  3PZ2 B;  1GXO A;  1NC5 A;  2GH4 A;  4GL3 A;  1X1J A;  3DSU B;  3SDV A;  2FBA A;  3W7X A;  2E22 A;  2A73 B;  4LIX A;  3AFJ A;  4C1S A;  1FMI A;  3PMM A;  1XWQ A;  3N0G A;  4ZH5 A;  3S4C A;  4ZH1 A;  4Z4J A;  2F6D A;  3Q7F B;  4L0G A;  1N7P A;  3D5S A;  4OZV A;  4GAX A;  4D94 A;  3W7W A;  4F10 A;  1K72 A;  5GY3 A;  5ILY A;  5C05 A;  5DHK A;  5JPM B;  3RX5 A;  5CZL A;  3WIW A;  1R76 A;  1IA6 A;  3ANI A;  3RJ3 A;  4AYR A;  4DOD A;  1KKT A;  1XW2 A;  1AGM A;  1FBO A;  1EGU A;  5ILI A;  3NFV A;  1UG9 A;  2RI9 A;  3GZK A;  4MU9 A;  4EHM B;  2B39 A;  5M7Y A;  3WIQ A;  3E33 B;  2XWJ B;  3P2C A;  1IA7 A;  3REN A;  2BB5 A;  5IL3 A;  1HCU A;  5GW7 A;  2VN4 A;  1TNZ B;  3TF4 A;  1O6R A;  1UT9 A;  3WKG A;  4KKI A;  1O1T B;  1H3A A;  1N95 B;  3GT5 A;  1GAI A;  3QXQ A;  2EAD A;  3G6J B;  3W5M A;  2FUQ A;  1CLC A;  3M72 A;  2RI8 A;  1FBW A;  1FAE A;  2H6H B;  3M01 A;  3M76 A;  4BOK A;  1KZO B;  4FXK B;  4F13 A;  1OJN A;  1JCR B;  4D4C A;  3WC3 A;  1N94 B;  1V7V A;  1D8E B;  2PMV A;  3KSQ B;  5JMF A;  2BRW A;  5DHI A;  3M00 A;  2ONH A;  2XFG A;  4KTR A;  1WU4 A;  3GLY A;  4GTS B;  3PYA A;  3M7E A;  4BOJ A;  2R2L B;  4Q88 A;  4D4A A;  3SAE A;  2ZIR B;  4ZRQ A;  4YDE B;  4M76 A;  3DSX B;  5CA3 A;  2BBC A;  2V8J A;  3QRY A;  3QT3 A;  2RGK A;  3X17 A;  1TN8 B;  1GAH A;  1GHQ A;  2DRS A;  5IL8 A;  3Q73 B;  1OJP A;  3SQC A;  3SFY B;  2FV1 A;  3Q78 B;  5IM1 A;  1FT1 B;  1GXN A;  5FO7 B;  4Z4L A;  4OK2 A;  4EL8 A;  1N7N A;  1V5C A;  1N23 A;  1TF4 A;  1N4Q B;  3DST B;  1HMU A;  4V1R A;  3Q75 B;  1N1Z A;  3W7T A;  3HXC B;  3H7L A;  1RWC A;  4CJ0 A;  5JMD A;  2ZIS B;  4ZRP A;  4OK4 A;  2I07 B;  1NI1 B;  4GTT B;  4L9P B;  1L2A A;  3AFL A;  3C72 B;  2BRV X;  1N7O A;  2V3N A;  1G9G A;  3M02 A;  2WDA A;  5EAU A;  1X81 B;  2VN7 A;  2OKX A;  1W3Y A;  2CQT A;  1LD8 B;  5IKA A;  5ILJ A;  3OXU A;  3HXB B;  1KRE A;  1F9O A;  3CU7 A;  1OJO A;  2NVP A;  1GLM A;  2ONG A;  3M74 A;  5IKH A;  3W7S A;  2WII B;  1FO2 A;  1KSC A;  3ACS A;  1FT2 B;  4CJ1 A;  1TNU B;  2JJB A;  1H37 A;  1C82 A;  3N0F A;  2J5C A;  2FUT A;  3M78 A;  1HM2 A;  4ZG8 A;  4TF4 A;  3CIH A;  1AYX A;  3Q7A B;  1IS9 A;  1DL2 A;  3K7X A;  3RX7 A;  4AYP A;  2FV0 A;  2CQS A;  2G02 A;  1WZZ A;  2GZ6 A;  4YCR A;  3WIR A;  2E24 A;  3EZ8 A;  3G4F A;  1H14 A;  1KSD A;  1KS8 A;  4MMI A;  1FCE A;  3NNB A;  1SQC A;  4FNV A;  4FUS A;  2EAB A;  1W6K A;  1TNO B;  2WY7 A;  5IK0 A;  1CB8 A;  1CEM A;  1O79 A;  5E2J A;  3QSP A;  1N21 A;  2JF4 A;  2D5J A;  2G0D A;  4WVC A;  3E73 A;  3Q79 B;  1RWA A;  1N9A B;  4Q2B A;  2AHF A;  1GSZ A;  4E1Y A;  1FO3 A;  1KFG A;  4WVA A;  1S64 B;  3LZ9 A;  4QT9 A;  1N22 A;  1KRF A;  3D5R A;  1XWT A;  4NEI A;  1O1R B;  3H2W A;  3EQA A;  1GXM A;  3DSV B;  1H3B A;  3SDT A;  3S4D A;  2EAC A;  3E32 B;  4AYO A; 
#chains in the Genus database with same CATH homology
 3EU8 A;  3S4A A;  1SA5 B;  3PZ4 B;  3QWT A;  5JPN B;  3RRS A;  3WKF A;  3ANJ A;  1TNB B;  3SDQ A;  2ZZR A;  1KZP B;  1TN6 B;  5FOB B;  3KQ4 A;  1G6I A;  2BED B;  1N4P B;  3E34 B;  1LF6 A;  3VW5 A;  2B4F A;  1SA4 B;  4WU0 A;  1O6H A;  4ONT A;  1QBQ B;  4LNB B;  1O1S B;  2DRO A;  2IEJ B;  5DGQ A;  1NXC A;  3RX8 A;  1KWF A;  2PN5 A;  4D4B A;  3SFX B;  3T33 A;  3PZ3 B;  1L1Y A;  3DPY B;  3WUX A;  3HXD B;  3QPF A;  4WVB A;  1NL4 B;  3KSL B;  2WYN A;  2H6G B;  4GTO B;  4JJJ A;  1DCE B;  3QDE A;  3W7U A;  3QFY A;  3HXE B;  2AHG A;  4MBG B;  3QFZ A;  5GZK A;  3QG0 A;  1G9J A;  2V3P A;  1JCQ B;  2BB6 A;  3EU5 B;  3D3I A;  2YIK A;  2H6I B;  2Z07 A;  1JS4 A;  1LF9 A;  3VXD A;  2WIN B;  4CE7 A;  1UMP A;  4GTV B;  3DSW B;  1FPP B;  2A8Z A;  3OED A;  4LNG B;  3QT9 A;  2WY8 A;  5FO9 B;  4J5T A;  2XWB B;  3M75 A;  3QXF A;  4KTP A;  5DGR A;  3PYB A;  1H13 A;  3E30 B;  1F9D A;  3ACT A;  1D8D B;  1N4S B;  3ANK A;  1V7X A;  3K11 A;  1QQF A;  2ZBL A;  3HXF B;  5FO8 B;  1S63 B;  1N4R B;  3A3V A;  4V1S A;  2SQC A;  1DOG A;  4YDO B;  1QSJ A;  4KKJ A;  5MEH A;  3WKI A;  2EAE A;  4AYQ A;  2NOJ A;  1H35 A;  2P0V A;  3E6U A;  2DRR A;  5M7I A;  2V8K A;  3M7L A;  3PZ1 B;  4D4D A;  5KKB A;  5AGD A;  1ULV A;  2XQW A;  1V7W A;  1O5M B;  1LD7 B;  1H54 A;  1TN7 B;  2JG0 A;  3P5R A;  1WU6 A;  3KLS A;  4L6X A;  2DRQ A;  1MZC B;  1G87 A;  1O6Q A;  3M7B A;  3H3K A;  4GTR B;  1C3D A;  1H36 A;  1LTX B;  1TNY B;  3ON6 A;  2D8L A;  3M77 A;  3M7C A;  2FUZ A;  3S4B A;  1JCS B;  3M71 A;  4GTQ B;  3E37 B;  3P5P A;  2F0Y B;  2GOX A;  3S9V A;  2QNO A;  3DRA B;  1FP3 A;  1VD5 A;  3WKH A;  1V5D A;  2V8I A;  5CD2 A;  4XUV A;  1X9D A;  1H39 A;  2H6F B;  3RSY A;  4TXT A;  2AFA A;  4LNV A;  3W5N A;  1H3C A;  1GA2 A;  1RQ5 A;  1H12 A;  1W6J A;  4DOE A;  3DSS B;  3SDR A;  3EUV B;  4FXG B;  3M73 A;  4GTM B;  1WU5 A;  3SDU A;  4GTP B;  3PZ2 B;  1HZF A;  1GXO A;  1NC5 A;  2GH4 A;  4GL3 A;  3DSU B;  3SDV A;  2FBA A;  3W7X A;  2A73 B;  4LIX A;  3AFJ A;  4C1S A;  1FMI A;  3PMM A;  1XWQ A;  4ZH5 A;  3S4C A;  4ZH1 A;  4Z4J A;  2F6D A;  3Q7F B;  4L0G A;  3D5S A;  4D94 A;  3W7W A;  1K72 A;  5GY3 A;  5JPM B;  3RX5 A;  5CZL A;  3WIW A;  1R76 A;  1IA6 A;  3ANI A;  3RJ3 A;  4AYR A;  4DOD A;  1KKT A;  1XW2 A;  1AGM A;  1FBO A;  1UG9 A;  2RI9 A;  3GZK A;  4MU9 A;  4EHM B;  2B39 A;  5M7Y A;  3WIQ A;  3E33 B;  2XWJ B;  3P2C A;  1IA7 A;  3REN A;  2BB5 A;  1HCU A;  5GW7 A;  2VN4 A;  1TNZ B;  3TF4 A;  1O6R A;  1UT9 A;  3WKG A;  4KKI A;  1O1T B;  1H3A A;  1N95 B;  3GT5 A;  1GAI A;  3QXQ A;  2EAD A;  3G6J B;  3W5M A;  1CLC A;  3M72 A;  2RI8 A;  1FBW A;  1FAE A;  2H6H B;  3M76 A;  4BOK A;  1KZO B;  4FXK B;  1JCR B;  4D4C A;  3WC3 A;  1N94 B;  1V7V A;  1D8E B;  2PMV A;  3KSQ B;  2XFG A;  4KTR A;  1WU4 A;  3GLY A;  4GTS B;  3PYA A;  3M7E A;  4BOJ A;  2R2L B;  4Q88 A;  4D4A A;  3SAE A;  2ZIR B;  4ZRQ A;  4YDE B;  4M76 A;  3DSX B;  5CA3 A;  2BBC A;  2V8J A;  3QRY A;  3QT3 A;  2RGK A;  3X17 A;  1TN8 B;  1GAH A;  1GHQ A;  2DRS A;  3Q73 B;  3SQC A;  3SFY B;  2FV1 A;  3Q78 B;  1FT1 B;  1GXN A;  5FO7 B;  4Z4L A;  4EL8 A;  1V5C A;  1TF4 A;  1N4Q B;  3DST B;  4V1R A;  3Q75 B;  3W7T A;  3HXC B;  3H7L A;  4CJ0 A;  2ZIS B;  4ZRP A;  2I07 B;  1NI1 B;  4GTT B;  4L9P B;  1L2A A;  3C72 B;  2V3N A;  1G9G A;  1X81 B;  2VN7 A;  2OKX A;  2CQT A;  1LD8 B;  3OXU A;  3HXB B;  1KRE A;  1F9O A;  3CU7 A;  2NVP A;  1GLM A;  3M74 A;  3W7S A;  2WII B;  1FO2 A;  1KSC A;  3ACS A;  1FT2 B;  4CJ1 A;  1TNU B;  2JJB A;  1H37 A;  3M78 A;  4ZG8 A;  4TF4 A;  3CIH A;  1AYX A;  3Q7A B;  1IS9 A;  1DL2 A;  3K7X A;  3RX7 A;  4AYP A;  2FV0 A;  2CQS A;  2G02 A;  1WZZ A;  2GZ6 A;  4YCR A;  3WIR A;  3EZ8 A;  1H14 A;  1KSD A;  1KS8 A;  1FCE A;  1SQC A;  4FUS A;  2EAB A;  1W6K A;  1TNO B;  2WY7 A;  1CEM A;  1O79 A;  5E2J A;  3QSP A;  2JF4 A;  2D5J A;  2G0D A;  4WVC A;  3E73 A;  3Q79 B;  1N9A B;  4Q2B A;  2AHF A;  1GSZ A;  1FO3 A;  1KFG A;  4WVA A;  1S64 B;  4QT9 A;  1KRF A;  3D5R A;  1XWT A;  1O1R B;  3H2W A;  3EQA A;  1GXM A;  3DSV B;  1H3B A;  3SDT A;  3S4D A;  2EAC A;  3E32 B;  4AYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...