4DOHE

Il20/il201/il20r2 ternary complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
204
structure length
204
Chain Sequence
KPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYARVRAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Interleukin-20
total genus 37
structure length 204
sequence length 204
chains with identical sequence R
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohE01
2VXTL 2OTUA 1J0ZA 3L3IA 4WTZA 5D7KD 2R4RH 5I73B 4PBWD 2AK4A 3L3OB 1UGNA 4AMKH 1UM4H 4H20L 2APVA 3TVMC 2FIKB 4AIOA 4KJWD 4GRWB 4WV1A 5DJ0B 5GGVY 4M5YH 4AQ1B 1JYNA 1P7KA 3QDMB 1RVFH 2D9CA 4Q2ZA 1P84J 2EC9T 2ICEB 4YDKL 3IXTA 3VFUB 2X6MA 4HBQA 2OTWA 4KK6D 1M6OB 4BK5A 1AQDA 1ZV5A 5EU6D 4FG6C 4LCWB 1QA9A 3DVFA 1NFKA 1V7NL 4DOHB 4FXLA 3X13B 4ZO7A 1CD8A 1JPSH 3CFDB 1VA9A 1K85A 5C0CE 2PXYB 5EBWA 1QFHA 1XAUA 4DGVL 4DTGH 4BKLB 3DNKA 1I9IH 5BOPA 2EZ0C 3O6FA 1D3CA 1GC1L 4HK0A 4JQVC 3QPXL 2P1YA 1UJ3C 3NAAH 3FRPG 3ISWA 1A2YA 4ZG1A 1JF1A 1U8IA 1HH9A 4PV9A 2CQVA 5GS0D 4B41A 1EAPA 2AV1A 5C0CD 3LDBB 2AJSH 5T1MB 1F4AA 4M1CC 5DMKA 5GS2D 1QOKA 4DN4L 4N1EA 2H6PB 5DVMA 2X05A 4IHOA 3VXUA 5DJCA 4M9PA 5IVXA 1B9ZA 4MQ7B 5DURB 1MELA 4Z7VF 3MRLB 4JFXA 5IB1A 2R2EB 4F9PA 4I0PD 1FL3A 5CMAB 5DVKA 5B3JF 3TEUA 3MLPA 5I15L 3PGFH 4RGOL 2E7LC 2HYMA 4WFEE 1LWRA 3O0RL 4NKQB 5CJOH 1T3FB 2HVKB 1KF9B 4D9LH 3ZL4H 3VXTA 3ZE2E 4DZ8A 3DX8B 5DD3L 2EIDA 1EO8H 2RCSH 2XG5A 1KCUL 5CWSB 4OCWL 3L6FA 3S9DB 1RK0A 5DJDB 3GBNH 3CFBA 4P23A 2JIXB 3VMNA 3VE0A 2IG2H 4WFED 3K46A 3AS0A 1R5VB 3QPXH 3ZKMC 4JHAH 15C8L 3ULSA 3N85L 3ULVH 3PWLB 3C5JA 4KI5E 4D9QE 1JP5A 2VKXA 2PUQT 4YNYB 3U9PH 5JW4N 2OTWB 3B5HA 3QQ9C 2J6EA 4H88H 4OZGB 4XPBL 3LH2L 2IBBA 3B9VA 3HNVL 3O6KH 4I5BA 3W5MA 2DRUA 4JO4L 4UOW1 3X17A 5F96H 5SWZD 5IMLA 2XPGA 3S5LA 1YY9D 1IKNA 3MZTA 3AS1A 1KB9K 3FT2B 5F97E 1XR9A 1S5HA 5C07D 5ESQA 1JHLH 4HEPG 2XKSA 3RVUC 2AEIT 4P2OD 3TN0B 3I2CL 1FGNH 4X99A 4OZGE 4XNYH 3LPFA 4MNGA 1CICD 1DEEB 4XCEA 3EOAB 4XVUC 3IF1A 5FUOL 5IB5A 5IF0B 2QEJA 3QO1A 1G84A 3DSFH 4ODXA 3LPWA 3KXFE 4MA8H 1A4JB 4OLYH 5FUZH 4X9IA 4HJGA 4KJYA 4ZFGL 5B3JE 4NJ9L 5M95B 4KKCC 1K2DB 1JGEA 3EOYG 4QRQB 4YPGB 2CXGA 2F53D 4UB0H 5BS0D 1OAYL 2RFXB 4PJEA 5MEQB 1Z3GL 4NQCE 1RZIA 5DRNA 4UMGA 1S78D 1MF2L 2ZJSH 2VL4A 3RIAK 1U8HB 3V4VH 3DX6B 5JXEC 2HFGH 4NNPH 5H94A 1BOGA 3O3BB 2P4AB 2NY3B 4X6CE 5CBEB 2P8PB 1LO5A 5GGSA 2H9GB 2KDGA 3MFFB 2NY2C 4LLMB 1F2QA 3QXUA 4ZOEA 1Z9OA 2CLRB 1HQ4B 2QJDA 5FO7B 5C0BD 2EDRA 5F1KC 4PJ9A 1QR4A 4N8CH 3FOMA 1H8SA 2DTSA 1F11B 3EHBD 1FSKB 1YJDC 1RIUH 1MY5A 5IGXL 3I75A 3KPRB 2OJEB 1A3RL 5DWUL 2HMID 1KV3A 1KXTB 3S7GA 3HZMB 2H26A 1DLFH 1IGFL 1MFCH 2FDBP 3EIFA 5FO8A 1J8KA 4HS6B 5SWSE 4ETQB 4W81A 1T7YA 4YAQB 5TE4L 1JNHB 2EKSA 4B53A 3NTCL 1RUKL 2VLKA 4X9HA 1C08B 5L9DH 4IS6A 2VDKH 4R4BB 1AGEA 4R97C 3OB8A 3U7AA 3T0EB 3RWCA 1ZLUH 1BVKB 2VL5B 5GGRY 5T1KD 4AEHH 1KIUA 1SYVB 1WIPA 5JA9A 4XBEL 5DS8B 1MCCA 5C0AD 3P73A 4PLJD 3JTTB 1QTYT 2IALA 1PJ9A 3OAUL 1UB6B 2AJXL 3WDJA 3JZ7A 5D6DA 1XCTB 2YPLA 2IWGA 5T3ZL 1I1AB 3LKQA 2IH1B 3QDME 2H6PA 4JKPL 1QEWA 5BRZD 2ICWJ 2FATL 4G7VL 4HWNA 4RFEB 5CZVL 4U4BA 1LO3H 3VD3A 1MFBL 4GBXB 4MAYD 2P44B 1VCAA 1CGXA 4CUCA 3QFDA 2O93L 2Y7QB 1BPVA 3WV0A 5KANG 4PJGE 2CLVA 3NCCB 3ZHDA 4JN1L 3LKRA 2ARWA 4ZUUA 2EEAA 4GS7B 2FZ3B 3GMQB 1G7MA 5CP3H 2P8LB 3WNLA 3QWRD 1NSNL 1VEMA 5BRZE 2BVYA 1A3QA 1L0YA 3UTTE 2FX7L 5AZEL 5D70H 1F3JB 4HWZA 1DQTA 5ILTL 2OSLA 4N0RA 3EGSB 3NVQA 1BZ7B 3U4BH 4TOYL 5J12B 3CD4A 4HUVB 1FLRL 4GAGH 2JIXD 3P3YA 2HN7B 2D03L 1BREA 2FLRT 1KLUA 4P4RA 5F9JB 5FFLA 1NQBA 3L3HB 4Y7MA 4M93C 4ZTPH 4WY7L 2CGRL 5ACZA 4QKXB 3GBNL 3O8XC 4EUPH 3QHTC 1LDSA 1HQ4A 3UTTD 2YXMA 4RMUA 5L8KB 5ESVB 3L3IB 4RDQG 4ERSH 4P46A 5IW6B 5C08B 4LF3B 4X9GA 2IANE 5T1DL 1IEHA 3GMPB 4XNUL 4RIRA 4JKPH 3MZGB 2EDTA 3L3JA 4JZJC 1U8MB 1BD2D 2UVFA 3MLZH 5E2UH 1I9JL 3KPSA 1IAKA 2VAAB 3QXAA 3BW9A 4OKVA 4UQ3A 3BX7C 1MHPH 1EJOL 1U36A 5EA0L 2DTMH 3B8SA 1FN4B 4JN2B 1MHHB 4XP6L 5BVPL 3BQUC 5HPOA 4HFUH 4FXKB 3FTGB 4S1QH 1JCKA 5IB5B 5GS0C 4ZOAA 5DK2B 1NLBH 5CBAA 1PEZA 3EO9L 5FCSH 4TUJB 4NM8H 5ETUB 1F5WA 2H2PD 5IROA 1I3GL 1EO8L 3SJVD 4OFVA 3GUTA 4JFEA 4S1DC 3VRJB 1E4XL 2YMXL 3RPKA 2MSPA 4ZO8A 3LMJL 3MR9B 1GZPB 3QEGL 4OB5H 3HZKA 5D4QA 3ET9F 4NQSB 4U1KA 4R26L 3V6ZB 1NCDH 4BZYA 1Y6KR 2ERJB 4NRXA 2X4SB 3V6OC 3ZDYF 1PG7L 3MRNB 4P5KA 2BK8A 1QBBA 12E8L 3DGGB 3V6FB 3GSQA 3NCYP 3QQ3A 4U6XB 3C6LD 2FGWL 5FCUL 1CT8A 4PGBB 4UOW0 5E94A 4LGPB 4GFTB 1RUQH 2ADJA 3LIZH 2BSTA 1QLRA 3HCVB 5ALCL 1UCTA 1ORQB 5DHVA 2ATKB 2ZG3A 3NZHH 4I18A 4YBLC 1A1OB 1T3FA 4G9DB 3GSNL 1U95A 2VQTA 3W2DH 1TETH 1A7RH 3OKEB 3TNNA 1TQCC 3MJ6A 4WGWB 5GRJH 3QDJE 1MJUH 5TE6H 5E6ID 3TZVC 3RY4A 1M7XA 3BIKB 1MFCL 3MLWL 3FT3A 5D1XA 3V5HB 5T5FH 5GPRA 1NAMA 3GHBL 3MRCA 5FUZL 3TZVA 3W0WA 3DROB 4RMQA 3FN3A 2ORBH 4RAUA 1FE8H 1UACL 4WTWA 1S9VB 1X5GA 4MB4A 3MFGB 3QA3B 4OSUH 4LPCA 2XIDA 3QDJD 2XQBL 4POZC 1JGUH 3MRHA 2NCMA 2WV3A 2DWDB 4WWID 3IDNA 4ZQKB 4PJCB 4HPOL 5DJ2B 5C71A 5FYKD 4LFHD 5TF1H 2F19H 1DQLH 3P73B 4UNUA 4AL8H 5E1HB 1YEJH 5EOQL 3GMOB 3TBWA 3UJTL 3S35X 2KL6A 3DX7A 3ARTA 1QZ1A 1CQYA 2IH1A 4XC3H 2H32H 1GC1C 2E6QA 4WUUA 3N1PC 1ITBB 3IJHB 3F8UB 4NOFA 3FQNA 1NFDE 4EDXB 5B39G 3ES6A 1S9YB 2F58L 1JF1B 1U8IB 4JFFD 3K4AA 1T1YA 1NC2B 1BD2A 2QQLL 1GGIH 3CZJA 3GUTB 3IFOB 4XVUD 3D3VD 2C3GA 4HZLA 3O3AB 2NZ9D 2VDNL 3WS6C 5IVXB 3VGGA 4WNQB 1F6AA 5IFHH 1F97A 2VZSA 2EYTB 1DVFA 5IROC 3VFWB 1LEIA 1UT9A 5EH1A 4BZ2L 4E41B 3OV6A 4H0GA 4R3SB 2HJLA 2I9LA 2BMKB 4CADB 4EUPB 4QHLA 1QQDB 3QUYA 2BVTA 5DQ9A 1L0QA 3TIDA 1JZ5A 2PXYC 2QSCL 4WO4A 2AJ3B 2VDRL 4U1GC 4KU1A 4MD5A 3QUMB 4N9OB 1H0DB 3V5KB 3W39B 1PZ5A 5HI4C 1GZQA 4ZTOH 4TRPL 4P5TB 2A0LD 2HWZH 4FZEH 2KQMA 4PIRF 3CFJB 3FHAA 4ZUTA 4XBEH 4XPFL 4BSVB 3CH1B 1QACA 1DBBH 2ESVA 1CLYL 3ZSTA 3CXHK 1MAML 4XHJD 3U36A 2ENYA 1UQSA 4OUUB 5LKNA 5K9QI 4YK4C 3PV6A 4OCNC 3D39E 3BW9B 2BNUA 4FMFA 3WXWL 3QBTB 1L9MA 1JYXA 3V7AG 3T04D 1YNKL 3VXOA 2GW5A 2PW2A 3MNVB 3IS1X 4ZNEA 3NABL 4YWGH 3BZEB 5BW7C 3D0LA 3MBED 1BWMA 2Q86B 3PE9A 3IDIB 4PP2A 2AXHA 4UV7H 1A02N 2ITCA 4OBRA 4GSDL 1M05A 2EZ0D 2Z9TA 3IDJB 3D9AL 2CR6A 4M03A 2CDFA 1ZLVH 3VG9C 2DLGA 1N6QH 3MRDA 4ZUVA 1DDHB 1RUPL 1BX2A 1KPRB 4Y4HB 3RGVD 1HHIB 5CGMA 2X7LA 2GY7B 3TYFB 5E8NA 4L4TB 4LEOB 3WNPA 1MEXL 3KXFB 1D5IH 4OZFA 3FO1B 3CC5B 3QUKB 4F33A 4R4ND 3K81A 3MXWL 1NAKL 1LNUB 4LVHB 4NFBA 4JQIH 5IKCA 4PJBB 1WIUA 3FOLA 4GLRI 1N3NB 4PJ5A 5I73C 3GSVA 1CFQB 1ZT7A 1HEZB 1MRFL 3O45B 1PQZB 2D7TH 4MAYA 4O02L 4R26H 1BHGA 4Y5YC 4UT9L 3ZTNL 3U4EB 2ZPKL 1HH6B 3GI9L 4PY7A 3S4SA 3L1OL 4Z77A 2G9HA 4JFQA 4JGUA 1AO7D 4H88L 4LLWB 4PJ9C 3L3KB 4XWGH 4OLVH 1J0IA 4IRJD 3X12A 3G5YA 1DBKH 1IC4H 4M7LT 5A43C 4K9EL 4XBGB 5D6DC 1K8DA 4ESKA 4B5EA 4O2FA 6CGTA 5TDNB 1G7MB 4P2YA 2WIIA 4Y5VB 5INDA 4AH2A 2BNQB 3PJSB 2I5YH 4MNQE 1ED3B 2EO1A 3RY6A 1ZS8A 4FQCL 1SVZA 4XP5L 1VFBA 1DP0A 5I1AB 2O5ZL 4GQPH 2VXQH 4WDIA 3UTPD 4KK5D 2NX5A 5E9DB 1FH5H 1K5NA 1ZHKB 1YEGH 3PNWB 4XVJH 4WGVB 1S5IL 1A1MA 4OD3H 5CKAA 1NEZB 3U1SH 1DCLA 5B8CA 3KYOA 4MNQD 4OD2B 1D9KA 3LQZB 3VXPA 4PLKD 4LHUD 4PG9A 1MCBA 3C60A 3ARGC 1ZWIB 3KPLB 2R8SL 5EU7E 4MX7B 4GKSA 1AD0B 4PJFB 5ANMA 4D3CL 2WWMD 3RI5F 4LSRH 1PKQE 1JNHA 2Z91B 4CU7A 3QH3A 4HPYL 3NIDE 2NYYC 3MGAA 3RX5A 4NT6A 2AKRB 4OT1H 5HGBA 1Z9LA 2CRYA 4BFEA 1S3KL 1LD9B 1YN7B 3HC0A 2BHZA 3G6JB 3VFPA 3IDXL 1I9RL 1QSZA 2H2PC 3QHZL 3ZKSD 1J8HA 2DD8H 4ODUB 4JFZH 3TYFA 2BDNL 2PO6A 1N59B 1DE4B 2ZWLT 5F9WB 1JPGB 3JTSB 4JGMA 4N0FB 4ODHL 4NO0A 3HPJB 3MA7B 1U8NB 3SDXF 4X4YA 4M8VA 4H1LB 5E8PB 2GIYA 4M5YL 3F5WB 3STBA 4OFIA 4U6YB 4TVPE 1T1ZA 2IADB 1U3HC 4BQCA 4L9DA 2WWMC 3JWOH 4HIIA 3B2UC 3U1SL 1Y6NR 2QSTA 2B5IB 3RBSA 2LTQB 4JDZA 1IM9B 4JFOA 1ACYL 1MEXH 5JW4R 1P2CA 3K2MC 5J8OA 1KENH 2NNAA 3MLUL 1K4CA 5IMKA 1QO3B 3HI5L 4M6ML 5ERWB 3O9WC 1FE8L 4DCQB 5E95B 1XGQB 5DRNB 3MRKB 3U2SB 2HT4C 4RFNB 1BM3L 4PJXF 1XR8A 3HUJF 3DXAA 3QQ3B 3T0VA 3CNKA 3QRGH 3IFPB 1NLDH 3PHQB 1I8MA 3WDHA 4U6HA 2FCBA 4XNQA 5KBNC 4QRPB 3FFDA 4K71C 1JGLH 3MRGA 2H3NA 3EZ8A 3VXRE 3CK0H 1ZVSB 2YD7A 4M5ZL 2GK2A 3BN9C 2CKBB 1DN0A 3CX5K 4CN1A 3QIBC 1ZT1B 2DJ4A 3DETD 5DQDH 3ULVD 5IW1A 1S5HB 5B3NA 2JKXA 1CWVA 4L8DB 1KELL 1R5VA 5HYFA 4QGTA 1A1NA 4MNGB 4W6XB 4JZNB 3HG1A 2AEQH 4LRNH 5KVEH 1QSED 1IGJA 1U8MA 4JO3H 1HK6A 4ZAKC 1OAKL 4GQ9H 4NWTH 5FYJL 2C4XA 1NANH 5DO2D 3ULVF 4IDLA 4YXKL 4YUEL 1BECA 4UTAH 3D18A 3SY0A 1BQHB 3O6LH 1OGAE 3HS0B 5DVNA 4V1DE 1MHHA 5E6ZA 4M1GH 4YX2L 4KVCL 3SKJH 3LPGA 5ESQB 1S9WB 2RBLA 5DT1L 5BZWA 4R8WL 5HXMA 5BVJA 1PG7X 4D9RE 1IC5L 3T2PA 4MQXC 2IPTL 4KUCD 1FZJB 5I1IL 1CDUA 5EN2B 1QUNA 1D9KD 1XIWA 1YY8A 4K3JL 1EPFA 5IB4A 5IOPA 3GMOA 5F7FA 3BVNB 3E3QC 3SGJC 4OZIA 1Q1JL 5C0IB 1UYWH 3HPJA 1J8HD 5MERA 5EC2B 2C4FT 4NFCA 1YEHH 2BNRB 3DYMA 5I2IB 3SDDC 4BKLA 5JR1L 1R3JA 4KGLA 3HLAA 5I1EH 5SX5H 5A2LH 4KKBC 3MROA 2RHEA 1JWMB 5F7NC 2BOCA 2GSIA 1MCPH 3I50H 3MOBL 3DTXB 2V2TB 3MJ9H 4JFDA 3SKOA 2X4PA 1IT9L 3U30B 4JFEE 3CDFA 1O7SA 1D5MB 2Q76A 2P24B 3OJVC 2G60H 2A0LC 5LBSH 1QLFA 4JZOA 1YEDB 4KTDH 1K5NB 4OZHE 4PGCA 1I8IA 3I9GH 4FOMA 3E6HA 1Q0XH 4GRLB 3BUYB 3EDJA 3D39A 2VLMD 4QWWD 4QRSA 4PJDB 1GHFL 4N8VA 4HJJH 2APTA 3FQUA 2CIIB 3HFML 5J9PA 2CKNA 1NL0H 1VADB 2FHCA 1RUPH 3TNNB 2Q7YA 1P7QD 1OAZH 3GJFK 3TA3A 4EN3A 2OTUB 5KVGH 1LK3L 3O4LB 1AGDA 2OLDA 2P8MB 3RNKB 1A6UH 4GXVL 1CXFA 3FFCD 1RY7B 3C08L 4H5SB 1X6NA 3LQMA 4JRYB 1MPAH 3Q3GA 3FMGL 4HJ0C 4OLXH 35C8L 3OB0K 3WE6A 1SQ2N 3P4OB 2AXGB 5HHXH 3SCMB 5GRUH 3DUSB 1QA9B 2ADGB 3G04B 4NN6C 4FQHA 2YA2A 3C2AL 2FATH 3MJ9A 4KRMB 2Q8AH 4GG6F 1CXEA 1N5AB 3C6LB 3TA3C 2GK0B 3O4OB 3BWUC 3QI9B 1FGVL 5GSVB 2BVPA 2CSPA 2R0ZH 2XQYG 4MJ6B 4YGVA 1HIMH 4JDTL 5E4EB 5I75B 2EDLA 2NXZD 3QJHA 3VRIA 1IGTA 3MLWH 1I7UB 5DC4B 4NZTL 3N50A 3ELAT 3IF1B 3F12B 4WEUD 3GO1L 3VFOB 3WL9A 4DKEL 4XVTL 3LV3A 1LK3H 3OXSA 3RWFB 3VRJA 4TSAH 1C8PA 4OLZL 1MREH 4LSSL 3DVGB 3W82A 3VD4A 1I1YA 4R3SA 5I9QB 3WKML 4HULB 3U2SA 1F2XK 3G9VA 3MGTA 3L6FB 4JAMA 4M7KL 1AKJA 3T0WA 3GMPA 3TIDB 3QCUH 2RFXA 3RWHA 3Q5TA 3QXDB 1ORSB 2R56H 1TTUA 3EAKA 4Q58C 4G8GE 1EIBA 1MUJB 5HHMD 4HUMB 4LASH 3TGXA 1WZMA 5INCA 2ITDB 3K8KA 5I18H 3KLDA 1QFWL 4LMQE 3IVKA 3QQ9D 1LO2L 3HE6A 3T0EE 4I3RH 4JO2H 1KJVB 4R4NC 4Y16D 1ZK9A 3F7PC 4LLQB 5IEHA 4EQ2A 3LKNA 1KIRB 3VG0L 2DI8A 2VR4A 1G9NH 1O7VA 2LFGA 2R1YA 5HJ3B 2JIXA 4KDWA 1RMFL 3MLSL 1IC7L 5FM8A 3P9LA 1NCNA 4URTB 5KVDH 3ULSB 4KWUA 4PJCF 3VWJD 2HFEB 4OGXH 3WSQL 4XCEB 5L2JB 1Z5LB 5ID1B 4FQLH 4S2SA 5D93B 4PRPE 3WS3A 5KG9B 4LPXA 5T1LB 4MX7A 4OF0A 2YPLD 1Q9WB 1A6ZA 4LQFL 1KJMA 3LD8C 2ZG2A 4P0DA 3TBYB 3QEQB 3QHFL 4RNRB 4UB0L 3DECA 4OCWH 4IRZL 2CDGA 2EDQA 5GRYA 3JUZA 3WHXA 2P5WB 4UI2A 4APQC 3QAZC 4LLDB 4JFFA 4HKZA 4HDIA 1FVDB 1W72A 4PRPD 1JNNL 3UTOA 3GKWL 4P3WA 4OZHB 3RUGF 3D85B 2ZUSA 2GJ6D 4G8IA 4CNIA 4UTBH 5EOQH 3KGRA 4KHXH 1GSMA 1ORQA 5HGAB 2XWJB 4Z7QE 3BWAB 1M7DA 1W0WA 2D4FA 4U1LA 4ZUSA 5IFJB 5BRZA 2J8UE 1UB6A 1KTLB 3JWOC 3VW3L 2VUOA 1JBJA 2HJKA 3MOQA 4JKWA 4AMKL 1ZHNB 1QEWB 4PJGA 5GS3A 2IBZX 2J12B 2DLIA 3IGAA 4PJHE 1VDGA 3BO8B 2YD5A 3MSPA 2FJHB 1IGYB 4FNLH 1UH2A 2AP2A 5DURD 2N4IA 1AD9A 4IDJL 2OCFD 4U2ZA 3E6FA 5GJTL 5FM5M 3OZ9L 1XF5A 3ZKND 4S1QL 1PYWB 5E6IA 1XIWD 5TQ0H 1WIOA 1SBSH 3DMMA 4TTDD 1KTDB 3BKCH 2E8YA 5DUPH 2HVJA 3UYPA 3J7HA 7FABL 1MIMH 3OKKA 2C5DC 4UV4L 1SJEB 2NY6C 2P7TB 2DBLH 1PFCA 1ZHLA 3WLBA 3EYVA 4UUJA 3BP4B 5F71A 1CGVA 5C8JA 3RY6C 1FO0B 2Q20A 2F5AL 4UNTA 4CL7A 2WBJC 4L8SA 2AK4B 2XTJB 1KYOK 4G6KH 3SCMC 4YFLI 5CIPA 1JYWA 1IAIM 4PRBB 1NCDL 35C8H 3PABB 2DM4A 1BIIB 1LE9A 1P7KB 3SE8L 4Y4FA 3RNQB 4PJAB 5EC1B 1XCQB 3HR5B 5ECJE 1AO7B 1FORH 4X6DA 2ZCLH 4HXAH 1A6VL 3BH8B 3QIUD 1GOGA 2V2WA 4UQ2B 2C1OA 1TVHA 1V3KA 4PYGA 1OP5K 1CFNA 4OGAC 4ZDHA 1FNEB 3FHQA 4X6EA 1Z0NA 2HTKD 3N1FC 3B2VL 1BBDL 4IOSD 4RX4A 1R5WA 3X11A 4FTVA 1AKJD 1EHLH 5TQ0L 1JRHH 4Y2OA 1QBAA 4CJ1A 5HVWA 4LVNC 5B22A 4FXKA 4OD1L 4WCYL 1BJ1J 2YD4A 4I3SH 4L4TE 4U7SA 4X98B 3S88H 5EUOE 2IADA 1JYVA 1PKQB 1X5LA 3WN5C 3RDTC 4X4XA 4FQ1H 5CEXA 5EU6E 4F37K 1OAUL 1MWAH 2YD8A 3HAEG 2ATPB 4OCYL 1DQDL 2YUWA 2I26N 2EYTA 2FX9H 1A7BA 2R15A 1N0XH 2XOTA 5FOBA 2FBOJ 4X5XA 4F9LA 1JGUL 2ZSVA 3T77B 4KTYA 2BFVH 1JPTL 1Z6JT 4Y5YA 4CADA 4PJGF 4TQEL 3T0XA 2LQRA 2W65A 5HYSA 4KK5C 1DLHA 1RJLB 2MCPH 4WWKB 1KGCD 4G42A 4QGYA 4XCCL 1CD9B 3RUGB 3FRPA 4PRHD 3H9HB 1YEDA 1PD6A 3HNVH 3KJ6L 5J7CC 4NHUA 3REVB 1AY1H 1JUFB 1ZS8B 1I1CA 1TTGA 3BP6A 1UZ8B 4OGAD 3NABH 4PJ9D 5I19H 1CE1L 2EC8A 1L7TL 1EHNA 3CLEH 3OZ9H 2UZYB 2DQCL 4YHPB 1B0RA 5ACMA 2OJZH 3LCYA 2YN5A 4NCC2 4DVRL 5CIPB 3LD8B 1ZGLB 4BM7A 2V9QA 3QEHA 3MRQA 1DVFC 2DL9A 1G0YR 3QJFA 1C5DB 4JEGB 1KJMB 4Q74A 2BNQE 4PY8J 4P2CG 5EBMB 1CFQA 3UTSD 5HHNA 3ULUH 4NJAH 1S7UB 1SY6L 2VLKD 3RHWK 1LP9F 1T0NB 1T89C 4K94H 5GIRA 1FZOA 1J1OH 1W0YT 5EZIH 3F7VA 3O6FD 5HI5C 5DUBB 1CDYA 2Z31B 3HE7C 4KRPC 1CLZH 5BVJB 1KCRL 1NBVH 5HYJB 2DLFL 4PREB 3NCJL 3PQYE 3DV4A 2VZVA 5C86A 3K1DA 1RIHL 4AQOA 1U8PA 1IQWL 1YEFL 2XZQL 4Q6IB 4XXCA 1FP5A 3MRFB 1H3XA 4OQTH 1I9RH 4P2RA 5D6CB 3Q1SH 1A14L 3RJDA 2R4RL 1PX3A 2NW3B 2DQEH 3INUL 4OF6A 5FUCE 4RMTA 4Z7NF 4OZGF 3KR3H 5DR5L 1TZHA 3NA4A 4M00A 2AEPH 3HE7B 3NIGE 4QRRB 1LK2B 1LEGB 4GAYB 1JZ7A 1EERB 1T5WB 3BPNB 1INQB 5C0ND 3B43A 5BVPH 2BVEA 1Q9OA 1U8OB 4I3GA 4E0RA 3M17A 3HZKB 5FOBB 3EDKA 3FO2B 1RJYB 3TWCH 4AT6B 1FIGL 3H9SE 2YSSA 3OKYA 4Y5YB 5DA4A 4H8WH 4LLYB 1UVQA 1K3IA 2H2SC 2XTJC 5KVFL 3T4YA 4KVCH 3SKJL 4PG2A 1U8HA 1I75A 4APQD 2MHAA 3BN9D 3OGCB 3LHPL 5J11C 5TDOB 4I0PA 4U1MA 3NCEB 3HN3A 3O81A 4RDQF 1P4IH 5CBEA 5EOTA 4MA1C 5GGSB 4DGYL 2F5AH 5HHOB 2CMRL 3EFFB 4HCRA 1ZLUK 3MV9B 5INCB 4POUB 4PS4H 4XNQB 3MJGX 4Q9QL 1RZFH 4GXUM 3M45A 2VXVL 3S36L 1ZA3B 1N6VA 1CU4H 3ILQD 4YJZL 5CD3A 2X40A 3B6SA 2AI0L 3FT4B 1OPGH 3VRLE 4NPYA 1G7IA 1EFXD 1R24B 2YEZB 1DBML 4FQXC 4WTXA 4ZO9A 5I1JL 1BFSA 3C87A 3HG1B 3R0MA 4Y19D 1RU9L 1YMMA 3P30L 2YA1A 2C26A 3SCMA 1E27B 1LO0L 3C5SA 3BYYA 4HAFA 4BQ8A 3P9MA 2IPKB 1G1CA 4PGEB 4JR9L 4ONOA 4ENEC 2X4TA 3H3BC 3V5DB 5TPWL 2PW2B 3MNVA 4MB3A 4JN1H 5CEZH 2W9LA 43CAB 1MRCH 5I66B 1ONQB 3BKJH 3MV8A 1MY7A 1MNUL 3AREC 3D6GA 5DTFB 3O3DB 3PL6A 3FQWB 4JY6A 2PW1A 3FB8A 4LSPH 2PETA 1ZSDB 3T09A 1EXUB 3FQNB 4YZFF 4QHLB 5MI0B 3RFZC 1KN2H 2DM7A 1SYSB 5C6WH 2DBLL 4GRLC 3P0YL 1T1ZB 3KNBB 3BOVA 5C0JB 1EEUA 2ENSA 5MP6H 1URLA 1NGWB 4IIQC 4WY7H 3BSZH 3EDFA 3UZQA 1JWSA 3EHBC 4CMHC 4PRID 4XCFH 4G7YL 4ZXBA 2XN9E 3MUZ1 4PR5A 5BRZB 2NY1D 1Y18A 2XNAA 4P9HH 5T1MA 4BA8A 3OKOB 5HVHB 2VE6B 5MEOA 1U2CA 4WI4A 3G08B 3WFZA 1J87A 4JFDB 2HT4D 2P8LA 2GJZA 1WFNA 2JJTA 3WXWH 4JFED 1RAMA 4U7KA 2PN5A 4R7DB 2I9TB 2DQUL 1JZ6A 4EEEA 3QNXB 1UZ8A 3QDMD 1XEDA 4GKZB 4JZOB 3LAFA 4WEBL 4TNVK 2IFGA 4DQOL 1BQLL 4OM1H 2X4OB 2VLME 3LS5H 4G6MH 4QRSB 1FYHB 4J4PA 4OUOA 3D9AH 5JPNA 1VFBB 5I1AA 4OAWA 1JFQL 3LKNB 3O0RH 5KVFH 3B9KC 3QEHB 4YXLL 2NX5B 3DHMA 4D8PA 1OGAA 3QJFB 4POZD 2NXZB 4GT7A 1AHWA 4MJID 1FL6A 3GHBH 3MMEA 4I3SL 3TN0D 5FYLH 5EBMA 4C56B 4P48A 1RK0B 5E8NB 1X7QA 1A7QL 1F3RB 3O41B 2PF6A 3FQRA 4NJAL 1CICB 2BOBA 4LNRB 4P3CH 2J6EL 2YD1A 1BQSA 4CGTA 5EO0B 4LSQH 4OD2A 2Y07L 3IS0X 4QXUL 3HLAB 1JL8A 4BUGA 2XWTA 4X6BB 4MHHG 2C1PB 5A1AA 3QRFM 4OZ4B 3BESR 1CL7I 1ZWIA 3KPLA 4PP1C 5D7IE 3V5DA 4XNMA 1U8PB 5C09E 4NYLA 1YDPB 3QDGB 4EIZC 3QIWB 4NP4L 3V8CA 3BHBA 4Z77B 3O8XA 2FIRT 4M6AA 2D7PA 3OTTA 5AWNL 4CN6A 1BVLA 1JE6A 2F8XC 2LU7A 5EU4B 2VITB 1U93A 4Z5RA 2W1NA 4JE4B 4L29A 3B83A 3BT2L 3QYCA 3GZKA 3NOIA 2W92A 4L8CA 2CO7B 3VXSE 2Y5TB 4NN6B 4NQVB 3SKNB 5A40E 3OPZL 1TJGL 4UAOC 5J56B 1C5CH 2V9RA 4C57C 4HV8A 4OI9A 4YDIL 3T0BA 5KAQF 4XXDB 4JFEB 4NWTL 3OAZH 1YUHB 3THMH 3JV6A 3VGAB 3MFFA 2PTTB 2X41A 1U95B 2ATPA 1SEBA 4X4ZA 4V1DA 4D9QD 4IMKC 5C0BB 2J7LA 4WI5A 2L4OA 4IOIA 1QFPA 1WSST 5EZJA 1MI5B 4F7PA 2R0KL 4EI5D 3AGVA 4Z7UB 1BLNA 2R0WL 5D2LB 5JO5B 3WKMH 1OM3L 3U48A 5IM7A 1X5XA 1YMMD 3FO9A 5IR1A 5KS9F 2P7TA 4NKOA 3RVWC 4JQXC 3SJVE 1BOGB 4OI7A 4AM0A 1LGVA 1T66C 1OW0A 5C3LD 4A6YL 3OWEA 5LWYH 4Y5VC 4LSUL 3HMWH 3T0ED 5T3ZD 4MA3B 5D71H 4LRIC 2J5LC 5CJQL 2AEWA 1WZ1H 1Q72L 4HUWB 2XYCA 4JO2L 5E1AB 2GUOB 4HIXH 4YGVB 4F7EA 4Y4FB 3OPZH 1T4KB 2GITA 4NFDA 3EYSL 3QIWD 3WE6B 4XPHH 1M4KA 3RVXD 4FQQA 5E5MA 3MA7A 3LS5L 3V79C 1FFQA 4U1JA 5E8DH 3DGCR 3O2DH 2Z91A 3OXRA 2C1PA 1AE6H 1CFNB 4ZAKB 4XNXH 1V7MH 5GGVH 5HVFB 2VLRE 1V3MA 4XVJL 4OTXH 2W9EL 2X5PA 2QV2A 3EOTH 3VCLB 2XQYK 3O3AA 5DEGA 4GBXD 1WEJH 3U82B 4EXKA 3QDGA 4RFEA 2XZZA 4XMPH 3O8XB 1HHKB 1U92B 1OL0A 1WBZA 5ICYA 4UINL 1G7QB 4KQ4L 4UT6L 2AGJL 4OLZH 1Q8MA 4L29B 1UA6H 4X7CC 4MA1B 1AXTL 1KCUH 1VGEH 3O9WD 3O4OC 3OKLA 1CLOL 3TPUA 2WINA 1NCCL 4PS4L 1TNMA 4MD5B 3RJQB 4K3EH 3GI8H 5DJXB 3WIFA 1H3WM 4GXUN 5D5MA 1EMTH 3IT8D 3QUZA 1DBJL 3MRMB 1MVFA 1HHGB 4J6RL 4ETYA 4HKJB 1T5WA 2OK0H 4P57B 3MV7E 3ZE0E 3MV8E 3MACL 1CIUA 2UZIH 4H8WC 1ZANH 4BZ1L 4BH7B 2YPVL 3MRLA 1WICA 2Q8AL 1J1XH 4OZFH 2BC4A 5CD5D 4YEFA 4Y1AE 5JQ6H 2R9HC 2X4NA 2NX5D 1ROWA 4NO2A 1NMCC 2ITDA 5DD0L 4P99A 3FRUB 1NFDA 4C56D 3H2WA 4GSDH 5L88H 1JZ2A 1I8IB 1CGWA 2KZWA 3H6JA 3WLWC 1HNGA 2ARJA 4ACPA 1A7PL 4U6VL 1NJ9A 5D7SH 5I1CL 5JOFA 1IKNC 1HCFX 4WW2F 2BSED 4J23A 3QUYD 3EO0A 2IPTH 2R0KH 1V8HA 4LCYB 4HS8L 5DD1H 2VNCA 5HHOE 4Y8DC 1X5JA 5IHZB 2OP4L 5C70A 1MWAA 3QIUC 4F7EB 4HWUA 4LNVA 4Z7VE 2MTPA 1P4LB 1QVOA 4ZSOA 2GT9A 3B9KD 4TQEH 5L2KB 1T0NA 1XGPA 5J4MA 2WNGA 1F02I 3CFCL 4AY0A 5I2IA 1F4WH 4Y0GA 5KSBE 2VIRA 1HEZA 3CVHA 2YKLH 4PTTB 3E8UH 3U83A 1NBYA 3BMWA 2ITCB 3KPPB 4FA8A 3IJYB 4JREB 2IGFL 1IT9H 5KS9E 3PUCA 1DDHA 2IAMA 5EU7C 3QUXD 5I19L 4JLRA 1TITA 5KS9A 3A6BL 4M7JL 4NQDA 3PL6B 3BVNA 5E70A 3HC4H 2WQ8A 3GSUB 4DQOH 4YEEA 3GB7A 5DEFB 4XZUA 1FH5L 3S6CA 3ZE0F 2DMKA 3BH9B 5CZKA 5E5UB 3BRDA 5GISH 5JHDD 4XMPL 2E6JA 2E8ZA 1CTOA 1G7HA 4JPVH 1OB1B 3C6SA 2RCSL 1HZHL 3MYZA 3KPQB 5LGJB 4LLMA 2ZSWB 1F4HA 3QO0A 5CHNA 5E00B 2R0WH 1H3PH 4GUPB 3RL2A 3OXSB 3RWFA 1X5AA 1DUZB 4DTGL 3VXRB 1INEL 3S37L 2DLHA 4HK3J 2A83B 5C08D 2DLFH 1G9NC 4K2UL 1I8KA 2D7QA 3RTQA 5JHDE 5GGTL 4HXBH 4PRIA 3WEXB 2BZDA 3O6FC 5EUOA 5F72S 3VFRB 5T1DH 3CVHH 3ZMRA 3VH8B 4J3WA 2X1PA 3BN3B 4TSCL 1DSFL 4Y1AA 4K71B 4KROC 1HYSD 3OAYK 4QWWC 2WLZA 5CD3B 3ZSSA 4JFPA 4J3SA 5JOPD 2HKFH 1NEZA 4JFZL 1NMAH 5FO9A 4FTVB 1LILA 3K1KC 1KFAL 2NY5H 2HT3D 2QQQA 3KAAA 4X99B 5FK9A 4PLJC 2A6JB 5DDHB 5F1OB 3IETA 2R4SL 4FFWC 4H5SA 4RMWA 4WFHE 4NO5B 5D1XB 4IBLT 3L5WB 2K1MA 4GKSB 5L0QB 3UO1L 2W9EH 5DYOB 1OAXH 3S3JA 4F58L 4OIBA 1DUYB 1WF5A 4R7NA 4A2LA 8FABA 3UTSE 5CLTA 3ROLB 3VFMB 3PF2A 3DBXB 2EH7H 3I6LD 5L6YL 4Q97A 5IEKB 2P48B 5DUBA 4PJ7A 1G1YA 2B8OT 1A3LH 1EAPB 5IW3A 3IDNB 4HSQA 5HYJA 3O2WL 4LPVA 2PR4H 1RUAL 5T1LD 5KANI 2IMNA 3R06A 5ABDE 3P0VL 3WUZA 3FB6B 5I1HL 4KK6C 4N0UA 1XGRB 1E0OB 4FZEL 3L7FA 1DEDA 4JQXA 5C0DB 2P46B 4LLDA 4O9HH 4K8RD 3SE4A 1NC4B 3VGBA 3I6LE 1TJIH 2NW3A 3K4ZA 5LWYL 1CI5A 3IKCA 5E2WH 4KJWC 4U7MA 4J6RH 2N1KA 2WBKA 1I3RA 3DX9B 4CU6A 4XPTL 1HILB 3P30H 3GSRA 1CZ8H 2B2XH 5DJZB 1U91B 3OHXB 3T2NL 5EU6B 1D5BA 1KTKE 1N5YL 4XC1H 3K3QA 3W81A 3CU1A 1EHXA 5BV7C 1Y6MR 5CEYB 4H1LG 5GHWH 2ICWB 4PJGB 2H26B 2QQNL 2W9DH 3R1GH 3QCVH 1JPFB 3D69A 3VXUB 1BBDH 2IBGA 3WNNA 5I8CB 5HHNB 1CD1A 1OT2A 4LRIA 5DJAB 2B1HH 3HHRB 1XT5A 5F89B 5IWLC 3OR7A 5EBLA 4D0CA 1BJMA 2X4UB 5KG9A 3BI9X 3ZL4L 2ZNXA 5F7YC 2VISA 2DJSA 1CGTA 3GDBA 5DEZA 1XFPA 1IC1A 3IFLH 2V5YA 5F6IB 5JIHA 1FC1A 5IVOA 4LLQA 5IEHB 3DOSA 1EGJL 2IQAA 2R0LH 4HUXB 2ID5A 4QOKD 4K2UH 5GGTH 1U9KA 1Y0LA 2F19L 5BMFL 4HUWA 3DUHA 5GRZA 5HHVL 3ILPB 4LAJH 1IAII 2GITB 1S9XA 2XY2A 4L9LC 5E8EB 1JMXA 1WFOA 4PB9L 1CDJA 2DS4A 2Y06H 1LNUA 3VXOB 1CICC 3K2UL 3S96B 5E7FA 3PL6D 1U58B 3IU3B 4ZAKA 1AHWC 2IPKA 3M8OL 3QUML 3IDIA 2X89D 4UQ3B 9CGTA 5JPMB 2QQLH 1FRGL 1RQ5A 5T3XE 5IT2H 1TVHB 5LAXB 5I1GH 4OGYL 5D2NB 2IPUG 2GTWB 2CDFB 2XKUA 3AM8C 1A7NL 5D96B 3U7YL 3ZDZF 1VHPA 4PJXB 3G6JE 4D0BA 4ZD3H 5IVZA 3QUYC 2CUMA 3QIBA 5DF0A 1RUML 1ZSDA 3N9GH 4L3CB 3KS0J 3B9EA 2DICA 1EAJA 5HHQA 2H1PH 5DJ8B 1J1PL 2BCKB 1MAJA 4L4VD 1IBGH 2Z8RA 3A0OA 4WUKL 1UB5B 1SY6H 3MRPB 4LHUG 1OTSC 1FNSH 3ARED 5DJZA 1UCBL 4K94L 4LLYA 4JCMA 4MNHA 5CD5C 1T2QL 1WGOA 5ISZD 1KJ3L 3M07A 3O9WA 3TJHD 3TO4D 5DXWA 4PJ8D 5T3XH 1CFSB 3HI6L 3SO3C 4OFYA 5D2LA 5JO5A 3GEWB 1CGSH 2BJML 3W11C 4OJFH 5TDOA 3D0VA 4HUUA 1U8QB 2YHGA 2V5SA 2EYRA 3ARFB 5C0AB 2HJFA 4GRLA 4PJAA 4WFFE 4Z8FL 4OQTL 3B9KA 4OQ1A 5CZXC 3KVQA 5I1JH 2X4NB 5J06A 2F54D 1CBVH 5FYJE 5CJXC 2VZ3A 2E6PA 4UQ2A 3QH3B 2Q7YB 4PTUB 1FGVH 2ARJB 2JB5L 2ADFH 1WTGT 3RWIB 1QD0A 3RZWA 5FYKU 2GJJA 2YN3A 5TFSH 2XA8L 3QWOA 3WFBH 5C0FA 3EYUH 4DEPC 5FUOH 2EIZA 5D72L 3MMEB 4MXVE 4C56A 3UTZA 4KJPC 3WO4C 3SE9H 3FFCB 4LPYA 1KCLA 5HDOA 4PG9B 1J1PH 3FQRB 2NY0B 2LAGB 3C5ZC 5FA3A 4JRYD 1G7PA 3H0TB 2JK5B 5IJVA 2V5TA 4CJ0A 1MCWM 1MI5D 1H3PL 2ILLA 3EZJB 4TULL 3ARGA 4X80L 4HGMA 2C4FU 1K8IB 2BY0A 3W9EB 5GIRB 1LD9A 1YN7A 2PW1B 2CR3A 3FB8B 3WFCL 2VLKB 2GSGA 3S97C 1FPTL 2MWCA 4M43H 2R2BB 5C2UB 4PREA 2DQTH 4U3HA 4LP5A 4MYWB 2ZKHH 2X9WA 5ISZB 1FLTX 1GXEA 4U1SB 4RFNC 4MXWH 1MHCA 4Z0BL 3K2UH 5DHVB 1Q9KB 3RUGA 5ALCH 1JWSB 2D0HA 3H42L 1T03L 3ZZ1A 5TE7H 1WFTA 1LO3L 4HWEL 4R90H 4KV5E 3B9DA 1T83A 4NUGH 1FVEA 4JRWA 5MEOB 3WXVL 2B5IC 1KTRL 3V0VB 5D1ZB 1FZKB 4JAMB 1R5IB 5HJ3A 3BAEH 3HE7D 4R7DA 2NXYB 4HKXB 4BSVA 4PRAA 2DDQL 4WHTB 4JG1L 5I1KL 3BKYL 2J8UA 4F7PB 5LGHH 1F13A 2X9YA 4FFYL 3LRGA 3S35H 3GJFB 1I3GH 2L0DA 3SGEH 1P9MA 3MCG1 1RFDH 4QHUA 2OM5A 5EUOB 2CGRH 1IM3A 1ZLSL 3UC0L 1AR1C 4QHMA 4JM2F 1FVCA 5FKAB 1E6OH 5DVOA 4K3EL 1FPTH 4LLVB 3UPRB 1ES0A 2GEEA 4G43A 3MV9A 3GIVA 1PBYA 5IW1B 4GKNB 1T1WB 1C12B 2J88H 3PGCB 4G5ZH 4GMTH 4NP4H 3RWJB 5KSAA 4Z0BH 1HDMB 3ARGD 2R69L 3KLHD 1CDIA 1A5FH 3PV6B 3QQ4B 3LN5B 2HRLA 1TPXC 1F42A 1N2RA 2C7UA 3UPAA 1MLCB 3U9UA 5J6GA 3VGEA 4YHOL 4F7TA 1YDPA 3A6CH 5FV1L 1I1AC 3VWKB 3NPSB 3D0LB 1FG2B 1SEBB 4WEMB 3RDTD 4DZ8B 1NEZG 1X5ZA 3HB3C 5D1ZC 3WBDA 2A1WL 2MKLC 4R0LA 3RAJL 3V4PH 1HXYB 1BIHA 5HHQB 4TN9A 4NCC1 4WJ5A 3MV11 5JMOC 2F53E 5DUPL 5BS0E 2NXZC 2H1PL 2OMNA 3ZDZE 4I0CC 3UAJC 3IU4H 2KKQA 4C55A 3EGSA 1D7FA 2HVJB 4DVBA 3RIFK 4PJXE 4HUVA 1OM3H 2XKNA 3GIZL 3HE7A 3GKZA 1P9MC 4XAWH 3TCLA 3BUYA 3EFFA 1NUGA 5JHLL 1LQSR 3BGFB 4G6AD 4LEXH 4Z0XB 4HPYH 4GG6E 5EU3B 3RGVA 3S5LB 5J9PB 2UWEE 1NDGB 1CGYA 1S3KH 2MCPL 1AGFA 3MV7D 1G6RH 3EOBB 2AJVH 1OGAD 5DK0B 3VXMA 2F58H 2P8MA 3L7EB 2YXFA 4Y16A 5C0BE 1HWHB 1EV2E 4Z76A 1NCAH 5FYKH 1N64H 3D2UD 3PWLA 3MOAH 4X7TA 1JPFA 2VXUL 4U1MB 1T5XB 1BOYA 4OFYD 2VH5L 2NY0C 2NY7H 3RKDD 1R3LB 1XGYL 3PJSA 1PY4A 4JRYA 1TZIB 3PWUB 1RD6A 5DZLA 2O5YH 5MENE 2D31B 2GYSA 5ANMB 2I9TA 1CIDA 1HOCB 4ODHH 3FRUA 1WJ3A 4ENED 1VFAB 3P4OA 5KN5A 5TFSL 4BQBA 1EEYA 3ARQA 1X9QA 3EYUL 3M1BB 1GAFL 3UTZB 1VACB 1HHHB 3C6LC 3TA3B 1LO4L 1W0VB 5F1IA 2V6HA 1C08A 4DW2L 4AEEA 4DN3H 5B39A 3KXFA 2MFNA 4OZFB 4W70A 1LHZA 4NM8L 4HFWB 1G7PB 4D8PB 1WTLA 5K9JL 5IHZA 3TPUB 1S7WB 2QL1A 3SDCD 2ED8A 4R7NB 4Z18A 3AS3A 3I6KA 4XAWL 1A6UL 4GXVH 5CJBA 3C09B 2Y6SD 2YRZA 5C0AE 5IFAH 1NCBL 3KYAA 4UZGA 3O11B 4XCFL 3DIFB 4U0RB 2E9JA 3KLAB 1FL5A 5HGHA 2APXA 5CJ8A 1S9VA 2F8VA 1YPZF 3FL7A 1OAQL 1WCBA 4ODTH 2DIAA 3TBTB 5FYJU 1RZJH 4KK9D 2XZAL 5HDLA 2QTEA 5C9JB 3OKMB 1DLHB 5D2NA 3H3KA 2FGWH 5FCUH 4ZS7L 3I75B 1AKJB 1A6TA 3GHEH 3KPRA 1F6LL 5ITFA 4P9ML 1FNFA 4EDWH 2OZ4H 4QLRA 5ENWB 3WFDH 4LIQE 4PJ8C 4LDOB 4BH8B 3Q6FA 2ATKA 2CXKA 2JB5H 5J0BA 4LPWA 5KSVA 3WNKA 3L95B 4JREC 1V5JA 2OJZL 3IVKB 1AC6A 3MRPA 3QDGE 4XI5D 3KYNB 4OM0H 1AGFB 4LQFH 3MV9E 4WHYG 5D1QA 4AENA 5GGUA 2BRRL 4L4TD 4KROD 4U1HB 4KK8C 1NCBH 2BNRE 4V2BA 3SJVA 2DI7A 2Y6SC 2IG2L 3BDBA 4Q9QH 3UPRA 1TIUA 1MJ7H 3IFPA 1RHHB 4HPOH 2XRAL 3L3JB 3IXTB 4TVSa 4QRPA 3FO9B 3QI9C 3MV9D 2VQUA 3PWJB 4BJLA 4P5MA 3C5JB 4X9BA 1VB9A 1DSFH 4P9HC 1YN6A 3ZE1E 3FQTA 4RAVA 1QSFE 3CFJA 3MOAL 1MCPL 3MOBH 1FFNA 2J3SA 2W59A 4EI6A 1IQDA 4XMLH 3JVGA 3HTLX 5DK3A 4RA0C 2SEBA 3B5GA 3CSYA 4P23C 4YDIH 3CVHB 2ERJC 2Z31C 3HRZA 4RRPA 1JN6B 1WISA 3MO1A 4XHQA 2VDNH 1UWXK 4RGNB 5LGJA 3PWPA 1I7RA 2WIMA 3GRWH 2H32A 4X7EC 1F6AB 2OL3L 1WBYB 4G8GD 2APWA 5EU4A 2P5EB 5C9JA 1ZLWH 1BF2A 1WWWX 5IW6A 5DD3H 3QT2A 1QQDA 4HS3A 2HP4A 2R2BA 4TNWF 4FS0A 2A2QT 4YC2B 4UT7H 4FP8H 3VFTA 3WJLC 1E4JA 1CL7H 4I48A 5FM5O 3GSXB 1J88A 4UIKH 2X70B 5CSZB 4AG4L 1TJIL 4N8VB 4JM2C 4MWFB 1Q9OB 2FH6A 2A74A 1D5ZA 1QLRB 2VDOH 3G5ZA 3WIFB 5JLZA 3BRGC 2NY1B 1TZGH 1PQZA 4MAYB 3GMLA 4WFGD 1A9EB 4Y16B 5E2VL 1ZHNA 3OHXA 5CILH 5CZVH 2X4PB 4PJHA 4YIQA 3QISA 2IFFH 2DQUH 2EE2A 2EDJA 4JFDD 4PV8B 2VH5H 1TZIA 3PWUA 4YDLC 3F7QA 3PXHA 5JORA 3P77A 5GS1C 1JHTA 4PJIB 3NZ8A 5JNYB 3PIQB 4CN4A 5SWQB 4X4ME 2AJZB 4F57L 1DQQB 3KPNB 1QRKA 5DUMH 5C0CA 2G75B 3TFKD 3DROA 5E4EC 3ARZA 2FO1A 2F74B 4WUUE 5FO9B 2W38A 4XPAH 2DLEA 4TOYH 4OCMC 2HKHH 1X3DA 3ECBA 4M6MH 3H9SB 2B7DT 4FFWD 5F9AC 1ETZA 1JHKL 3MLXL 1M7IB 3ALPA 3ARDC 5C09B 5CBAB 3VXQA 3SPVA 2M1KA 5LCVH 5FA3B 3UJJH 3QG6B 4WTZG 3WKNA 1S8DA 2BXYA 3BZDA 4BELD 4K3GA 3HG1D 3TO2B 1J10A 4A6YA 1NUFA 3P9MB 4OF3A 4CVXA 1SEQL 4O5LH 5CS7A 4NZUH 4KKNA 1C7TA 1MLCA 4J3TA 3PWPB 4GW5B 2C3VB 1KXVC 2C1OB 1LDPL 3QSKB 4N90E 1RZKH 4RMVA 4NNXA 5DMIL 4JFQB 3SQBA 2OMBA 1FV1B 1H3GA 4X6FA 5FGBC 3FQWA 1CE6B 1C7SA 1ZE3C 4KQ3H 1QYGL 5F7EL 4CU8A 4ALAH 4P2OC 4Y19E 4PJXA 3U0PB 3OKLB 4MNQB 5GHWL 1XH3A 1INDH 1NDMA 2IQ9H 1EHLL 2CJUH 3WMSA 2BSTB 1GHFH 1X4YA 1MFDL 2E7BA 3QEUA 1WEJL 1FIEA 5DLMH 4NO3A 3DXAB 4K3DL 2P8PA 3LEXA 5MEPB 2N7AA 4OM0L 1I8MB 1SJHA 4K23H 4I13B 3BISA 4EKXA 2NY0D 3RKDC 1YNTA 2YPKA 2EDOA 3T77A 1DQML 1OT1A 1UCBH 5IB2A 1T7ZA 4ZUTB 1XGUA 1NBVL 3DETC 1MFEH 3BP5B 4L1DA 4YO0A 4IEFB 2BFVL 3CFCH 5DA0B 5DMJB 5F88A 3SDAD 3CZFB 4V1DD 5I8OL 1ADQA 2F9BT 1REIA 3JWDC 1B0GA 3C09C 5HYQB 4FQHB 3GBMH 2R39A 2VIRB 4P2QE 2ZNWA 3KPTA 3NFPA 3QIUB 1MRDH 4EBQH 4QTHA 3TO4C 3ARYA 1YQVL 4NSKA 4XX1E 4AZ8A 4ZQKA 2XFXA 3LN9A 5CINH 3IJYA 3CCHA 4K94C 1IFHL 2JJWA 4XX1G 5EORL 2UYLA 3KJ4C 5I71C 2PYEE 3OL2A 1KIQB 4Q6IC 3HC4L 2HJLB 5CJ5A 1DE4A 1N59A 1S9XB 4LP4A 4K7FB 2AV7B 2NLJB 3GMRA 1EVTC 4U49A 1A7RL 3D3VA 4IDJH 3TO2A 2VR5A 4UTAL 4MD4B 2AQ3A 4HV8B 4UU9B 3MUY1 1A2YB 4YDVB 2VKWA 1T2JA 4YHIA 1LK2A 1KTLA 1RZ7H 4O51B 1RFDL 5FHAL 1TJHH 3TJEH 1EX0A 3BPLC 4NHCL 3UXFA 2IBZY 4NKDA 2DI9A 3SEPA 1OF2A 2NY2D 2XQBH 5JW4M 3BO8A 4J1UA 3MBXL 2GSGB 4HXBL 3T2QA 4P5TC 1U3HD 1JMZA 1M1SA 4I48B 5FYLE 3IYLW 4Q6IA 4DFIA 4WW1A 1F4YH 4RISH 2Y5TA 2AXFB 4NQEB 5DHYB 3GI8L 1XF5B 3R06B 3NIFF 2OR9L 4NRZA 4ORZC 2J88L 4G5ZL 1VENA 2P24A 4U1GB 2C9AA 4HLZH 2X4SA 5I1EL 3JXAA 4Y4HC 1VEOA 5JLZB 1U8KB 1BZ7A 4K07A 1M7DB 4HG4K 3SKMA 3OKKB 4MXWL 4LQ1A 2HMIC 4JPIB 1KIPA 4G9FB 4QRUA 4XP1H 4FTVE 1RZ8B 1F8TL 1QRNB 4IJ3C 5CP3A 1OLZA 2WQRA 1GGIL 4HG4J 4DKFL 2J8UF 1B4RA 1R3HB 2VLKE 4QCIB 2VUYA 1IC7H 4NDMA 2O5XH 1TVBA 1TCRA 4LCCC 4LEOA 5SWSA 2DTML 5GSRA 5DDHA 3QI9D 5TJWK 3U6RB 4EI5B 4OZHF 1M71A 4KUZH 5CEZD 3QZWB 3LQZA 3VXPB 2CRIA 3HAEH 4Z7UF 1ZKAA 3U46A 4JG1H 1EUTA 3O6LL 1IILE 4I2XE 1YMMB 2B39A 4ODBD 8FABB 4LBEA 4M1GL 3U4AA 4KK8D 4LCCA 5E08H 1V7NH 4IRJC 3UTTB 3O45A 3LHPH 4NNYB 3WN5B 4MLSA 1QSFB 3MXWH 3N06B 2VDRH 5JDSA 4P23D 1GGUA 1KBGH 3QNZA 1VGKA 4EOWL 1MJ8L 5FK9B 5GGQH 3FTGA 2FEEL 5IB4B 5IOPB 1CLOH 1N4XH 3TO4A 2NQCA 4PJ5D 1V05A 1YYLL 3FO1A 4JY6B 4GH7B 1T6WA 2VDML 2MQCA 1LE9B 1YYMH 4U1JB 1IQDB 3C60D 4M7ZB 3RX8A 2V17H 1DBKL 1MAMH 3FOLB 5ADOL 2LVCA 2SEBB 4FQ2L 4AK1A 5CCKH 1KG0B 1U8LB 1LP9A 3C5SB 4X6DB 4XP1L 1U3HA 2FECI 4X4YB 1D5XB 4NQCA 3H42H 4NKIH 3G5VB 4HJGB 1F4XL 2AXGA 3MLRH 5HTSA 4N8CL 5BO1L 1GZPA 4M9OA 4NIKB 3TNMA 5ACLA 1GGCH 2YD6A 5JQ6L 3DXAD 4AJ0A 2FECL 1UM6L 3WSQH 1IM9A 4JFOB 5HHME 5LAXA 1Q0XL 3ESVF 4OCRH 5ENWA 2GTWA 2YBRB 4DN3L 4X6CA 2HAZA 1JF6A 4BSJA 2E9WA 1MJJA 5LGHL 3MRKA 2UWEF 5C07A 3ARBB 3S4SG 1CR9H 5A2FA 4P2OA 2Z0BA 2Z8SA 1MCOH 5GRVK 3HZVB 4MDIA 2FEEI 4KXZI 3PHQA 1AGBA 2GHWB 5EZLA 1EGJH 1U91A 3EYFB 2OZ4A 1MCKA 4WU7A 3W39A 5GS1A 1HYSC 3RZCD 5A2KH 4S11A 1UXWB 3N85H 2V2XA 4X6DF 1CDCA 2AVGA 3RPIA 4PRPB 1I4FB 1KJ2A 4Q9BA 4PV8A 3LRSA 1G6RL 1HN1A 2GJ6B 2DQTL 4LAQL 4Y5XA 3HC3H 3TZVB 1A5FL 4LCCB 3DV6B 2YD3A 3SDXA 1F8TH 2OQJA 5D8JH 4OV6F 4MD0A 5C0NC 5D7JD 5JXAH 3VG0H 4X7SL 2BXZA 1OP3H 2X1WL 4HH8A 3MLTB 3IFNL 3BMVA 4K3HA 3DUUB 1OD9A 2P45B 3BE1H 1X5FA 1KPUB 1JFQH 2A1WH 1PW3A 2XN9D 4ZUUB 1I7TA 5JW5A 1B2WH 3CLFH 1ZGLA 1CQKA 3BAEL 4ZSOB 3QFJB 2HLAA 3DO7B 1QHPA 3BJ91 3IRPX 5D6CA 2BOBB 5D1XD 3H7LA 1CR9L 4OZHA 1KEGL 3I6KB 1HSAA 3DYPA 3PWVB 2FJFB 4G8IB 5FHAH 4CNIB 5EB9A 2FD6H 1S7UA 4NQDE 1NPUA 1IJ9A 4A6YB 4IMKA 1MHEA 4NKDB 5HGHB 1EGJA 4F33B 1HH9B 3C8KA 4JFHD 1R3JB 3NFNA 4MSWB 2Z31A 2AS5M 4BSWB 3MODL 4RBPH 3ZYIA 1YEKL 1TPXB 4IOFD 1JGLL 1JGVL 3X3FL 1U8JA 4OT1L 1JWMA 3MUGB 1PEWA 4Z6AT 1YECH 5T5NG 2P5WA 4DVBB 3JWNC 1ORSA 4FQ2H 4J4PC 4I8DA 4NHUB 4OLVL 1QRND 3HUJB 2Q76B 1B6DA 4QXTB 1TQBC 1NKOA 2B2XL 1GVIA 3FB5B 2QHRL 3TBVB 3MCKA 4KY1L 1NMAL 1BQHA 3DI2B 4XPHL 2R1XA 3MRBA 3FO0L 5HYJE 4Z7UE 2WUCH 1UM5L 1YEEH 3MUJA 4OM1L 1YEIH 2APBA 1H15A 3DSNA 3RL1A 1F3DH 3QULA 3EOTL 6FABL 1L6XA 1ZEAH 3QWOB 4XP4H 5GQBA 4Z76B 3DVIA 5JUEH 5FOJA 1CFBA 3FT4A 3P9LB 3CXDH 4DKAA 4HIEA 1JNJA 1S7QB 2V7NB 1KUMA 3VFSB 4PUBH 4DFHA 5GS0H 4ZXBC 4X4MA 1HKLL 4ZXBD 3STZB 1F90H 5EO9B 5DYOA 4P5TD 4YO0B 2FH8A 3KDMA 4FQQB 3JVGC 1A0QL 4U33A 4K3JH 3LZFH 2W0FA 3MRRB 4NC1E 1A6ZB 4Y1AB 3ROLA 3TT1H 1I9IL 3BDYH 5HPMB 5IFAL 3K74B 2NMSA 4R2GB 5DRWA 2A77L 2FGZA 3BSZL 1YECL 5FV2A 3DUSA 3G04A 2IJ0C 3PL6C 5EBWB 5JHLH 2L7UA 1J18A 4RRPG 1N26A 5H37H 2VB5A 3C8HA 3RIAF 4XB8A 3ZTNH 1G7QA 1KT2B 2VC2L 2ZUVA 4I9WE 5DFVD 5ITFB 3GIVB 5J11B 5EPMB 3MYJB 3WLWD 4P5KB 1SM3H 4WI7A 2ADIA 3WJLA 1IAMA 4QHKJ 2BX5A 3LIZL 2JJTC 1T20A 4XVSH 4ZUWB 2AEQL 4YXHH 3FO0H 5LBSL 3SCMD 1CFTA 3QO1B 3QDAA 3QJHB 3FO2A 5D1QC 5JOPE 1S7VA 3K7UA 3IFNH 3LRHA 4FQXA 3UX9B 2WAHA 1H5BA 3B3IA 3CXDL 4M93B 4KJYB 3MXVL 3DURA 1YEGL 4HKXA 1S7TB 4WCYH 4DZBA 5JDJA 3D69B 4DGIL 1LVEA 4QTIL 5K59F 3I3BA 4PGCB 5E56A 4Z95L 3OX8B 4KKBD 5D7IA 3VU2A 5BQ7B 2Z92B 2UV3A 2OP4H 1K4DB 4YHNA 1K4CB 3ULUF 4QRTB 1RZFL 4XGZB 1J12A 1RK1B 2MKWA 3OG4B 1IM3B 2RB8A 3WD5L 1ZT4B 1MJ8H 5E9DA 3DX8A 2ZCHL 2EIBA 4LLUA 4JHWL 3BPCA 3QRGL 4RGMB 2XTJE 3AREB 4KJQC 4F2MA 4TTDC 4G43B 1YMHB 4NQUA 1X5KA 3IXAB 5DJDA 5HHVH 3BEWA 3EJJX 2BHUA 1ZHBB 1YYML 2KPNA 1KC5H 4LARL 4QCIA 3RWEA 1NBQA 3VD9A 4XCCH 1RULL 1CD1B 3VXUD 3RGVC 1FYTD 3ES6B 3MBEA 1X4ZA 4JY4A 4OZGA 2Y4SA 4M02A 4XNYL 3ARDD 2WZPD 2ADFL 3Q5YA 1QFUL 2JJSA 4J3VA 3QFJD 4MMZC 5K93A 2DWDA 1RJCA 3BGMA 4GG6B 5AAWA 4K3DH 4M61A 4PD4J 3QUXB 2Y23A 3PDDA 3SQOH 1ZVHA 3BQUB 4K23L 2R23A 4L3EA 4I0PC 3PWVA 1HHHA 3V6BR 2WK2A 4NJ9H 5C09A 4R8WH 1KCVH 5DD5L 3HR6A 4HKZB 5MHSD 4JPWL 2FL5A 4ZO6A 5C0GB 2N7BA 3H9YA 1S9YA 4MLIA 1AXTH 1Q9LB 2GJ6E 3UC0H 3HG1E 2XWTB 1XCTA 2YPLB 3HMXH 2ZPKH 3GI9H 1VFMA 3SDCB 2RJMA 5D7LD 1JPTH 5IMMB 5FDWA 1NH6A 3HNTH 4PJEB 1BVZA 5FECA 1CLYH 5MHSE 1AI1H 2W65B 3EOBA 3GM0A 4MXQD 3SO3B 1RJLA 1SMAA 4XMKL 4RGMC 3T0DA 1EFXB 4C83B 2C3WA 3DTXA 2O5YL 4KY1H 5IM7B 5J89A 4HBCH 3VFUA 4XZUB 2D31A 4QRTA 1D5ZB 1SJXA 3G5ZB 3WXVH 5F7MC 2D4DA 4PJIF 4PJEF 4NRYA 2UY6A 2CJUL 1G0XA 4P2OB 2EDBA 3VRLF 5GRVL 4XP9L 4KXZH 2QADD 4JZJA 5L7XL 1MVUB 5DLML 5EZLB 4HF5H 1A7OH 3T1WA 4L3AA 2X1OA 1ZHBA 5C92A 5IBUB 4M4RA 4L8DA 3RL2B 4HUUB 1RUKH 2J6EH 2V7HA 4KKLC 3U36B 2GUOA 1L7IH 3T3PE 2A83A 4LSQL 4IMLA 2V2XB 1XGUB 3GGWB 4UT6H 2R8SH 4H0IA 5J6HB 4H25B 5D5ME 1OSZA 4PLKC 1EUUA 5KJRL 5D7KE 1VERA 3BDYL 4PRBA 4L4VE 4DKDC 3WJJA 1T83C 3OGCA 4HMEA 1P69B 1FJ1A 3LS4L 4UT9H 5I1DA 4NC0B 1JZ3A 3OAUH 4L9LB 2Q3ZA 3T3MF 5TDPB 1GPOH 3BRFA 3JV0A 2P5EE 1CE6A 3MYJA 4HQQL 2YKLL 4AG4H 1U3YA 1IAIL 1YY9C 5IMLB 1G6RB 1S78C 1YJDL 1PGRB 3GHEL 3V7AE 1TZGL 2PCPA 5IESH 3MACH 1P84K 1W2KT 1YNKH 1OTTD 2QHRH 3PP3H 2Z8VC 4XP5H 4CVXB 3JV5A 4ISVA 5DC9B 2J8HA 1YA5A 1EZVY 4YBHA 3RQ3A 4N9GB 2LV4A 1EBAA 4LU5L 3Q6FB 3G5VA 5TF0A 4WWKC 3ZYZA 1XZ0A 1IGCH 1U8OA 5ILTH 3IDMA 2ZOLB 5E99H 5D1ZA 4ZMAT 2GSIB 5K9JH 5L0QC 5GS0L 2FBJH 1HZHH 2NY1C 1IL1B 2FO4B 3SKUD 4MJIB 4LL9A 3BZFB 1A4KA 2ICWA 1NAKH 1MQKL 2VDQH 3DMMB 4Q9RH 4Y4KB 4EOWH 4RZCB 3UJIL 2NW2B 3RVTC 4Y19B 4ZFFB 3WUWG 3ZKXC 3IKCB 3HNTL 1U8KA 4UTBL 5CJXA 1ADQL 1MIEL 3CMGA 5KVMC 4WFHD 4KHXL 2NZIA 3V2AR 4DUWA 2F53A 5DD6A 3CX2A 5BS0A 4NZUL 3OBAA 2BSSA 4YAQA 1FFPB 4KV5F 4PR5B 1UWGL 4FTVD 1IZJA 5I18L 3G6AB 3STLB 3GJFH 1QRNA 2AQ2A 1NCAL 4OAWB 3RL1B 2VXUH 3RTQD 3MBEB 4ODUA 1X6LA 3ULUE 1JTPA 4G8EB 4JANB 2XG4A 4OLWL 3CGTA 4H0HB 1F45A 3AY4C 3C5ZA 5DJAA 3LQAH 1P7QB 2W9DL 3R1GL 4NSKB 3MRCB 2BERA 4O00A 3KPSD 4O51A 3FONA 4L8SC 3FZUD 4YHKL 5HHPA 3SGEI 1OOAA 2UYLB 2WSKA 1DLFL 4DUVA 2OBGA 3CDYA 3UCRA 1NJ9B 3SHSA 4NZTH 5JW4Q 2EKSB 4FFZH 3W0WD 2V5MA 3BGFC 4DGIH 2F74A 3T0AA 3VXSD 1GOHA 5JXEA 4IS6B 4FQPA 4NZJA 3VFGH 5C0GA 2O61B 1NCUA 4JGJA 5J1TC 5HI3D 3IRZA 1KBGL 4DGVH 1HINH 3RWDA 4MQXD 2FX9L 2E7MA 3VJ6B 2NY3D 2VL5A 5H8DA 4JG0H 5E7BA 2R0LL 2D0FA 5CAYB 1P5VA 1SYSA 4OB5L 3LN5A 3EUUA 5DRZA 4PJCE 3MBXH 1OARL 4PLNC 3KNBA 3QG7H 5ADPH 3H8NA 3LKOB 4RWHA 4O58H 1ADQH 1MIEH 3U0WL 3W0WE 1IRAY 3D85A 3O6FB 1I7RB 4HC1A 1KB9J 1XZ0B 3BXNB 3ARRA 5EBGA 4TSBL 5CUSH 5CJQH 2H32B 5IBLC 1JZ8A 2CLRA 4U1KB 3V6ZA 2AJVL 1B4JH 4N8VG 3KPRD 4DOHE 2AXJA 2DQJL 3EJZC 5JA8B 2Y36H 2HA1A 5BO1H 4U6XA 5C7XH 4KI5D 3DXAE 5ID0A 4C54A 4WV1B 3PHOA 4JHZA 2Q1EA 5IQ7H 5GRJL 4OTXL 2RAMA 1T7VA 2ZOKB 1RIUL 5IG7B 4C59B 1P4BH 4WI6A 5DJ8A 1NL0L 3QR2A 5IR1B 5BXFB 3MRGB 3AM8A 1S7RB 4ZFZA 4WW2B 1RK1A 2QKIB 3SBWC 5JHDA 1AGBB 4OKVB 4ODVL 4BYHA 5LQBL 2AJYH 1MCOL 4QOKB 5GZND 1S7QA 1TJHL 4KZDH 4NQXA 1SJHB 3R8BB 3TM6A 2CH8A 1M7IA 2A38A 4G6AC 1FN4A 5C8JB 1OARH 1I1AD 3CSPA 1MCEA 2YWZA 1XGPB 2PR4L 5ADPL 2YPKB 3P0VH 4LF3A 4CDGC 1D6VL 25C8H 4L9LA 3HMXL 4WIQA 3N1QC 4WHYH 3OF6D 5CSGA 4HD9A 3KPPA 4OIAA 4MA7H 2Y1VA 3FONB 5JDSB 3PABA 3LH2H 3PG2A 1VGKB 1MCRA 4P4KA 5CCKL 3P2TA 5A16A 3UAJD 2P43B 1JRHI 4KI1A 4XPTH 1BVLB 1FV1A 4LHJB 1AXSA 1DBAH 1ZAGA 3S8WA 1CK0H 2VITA 3NGBC 3K80A 3TA3D 3QUMH 1ITCA 5AYUH 1U41A 1GGTA 1S7WA 2NY6B 3GSNA 2JJVA 3D5OF 1WCQA 1T1YB 5IWLA 4MJ5B 3FFCA 4JJ5A 3VWJA 1JNLL 4N5UA 5D7JC 4QYOA 3QPQC 1NUDA 4WI8A 1BEYL 1INQA 4PJFE 3UROR 3BXNA 1T7XA 4G6JH 1P4IL 3D25B 1VADA 2DQGL 4E41E 1X4XA 4JO1L 2Q6WA 3SDCA 3NFNB 4JQVA 4LVOB 4MSWA 3ORJA 2J8OA 3OG6B 4JFYB 1UEMA 5FYJD 1L6ZA 5KJRH 1RSFA 3MUGA 4QRPD 4JFXB 3OKEA 3W9DA 3CFBB 1D5MA 4POYA 4LCIH 4KFZC 3DLQR 3CDCA 4YGAB 1MCIA 4J1UB 1PVHA 1BFOA 3BIKA 4YBLB 1H9VA 1QLEH 3Q3GB 1IGML 4NC2B 4P2QB 3F65A 3KPOA 5HYSB 5IIEB 2WIIB 5I1LB 1BAFH 2Z8WC 2X4UA 4JFPB 1A22B 1AIFA 1A14H 1ED3A 1QFWI 4Z7OE 4JRXB 4RFOL 1WQVT 2YK1L 5DR5H 4HIHB 1WK0A 2VSDA 3QDJA 5DRXB 4NN5B 5TH2B 3NGBB 4HH9A 2EDHA 1FAKT 2R1WA 1MCNA 1G9NL 4G9DA 1U42A 1YNLL 4EQ3A 5IVXF 2X4QB 1MHPL 2R4SH 4WHCA 3MV7A 1S9KC 3QNYA 4K7FA 4Y5XB 4ELKA 5I15H 3Q5OA 2EDFA 3CFDA 3D3VB 3ZKNC 5GGVL 2FJFA 2O26U 5C0JA 3OR6A 1AGCA 5KSUA 1B0GB 2DDQH 2EYSA 1NGWA 4FFVC 2MMXA 4PLOB 2A6KB 1RZ7L 2NY6D 2I25N 4PP2B 4FFYH 3GMNA 1D5IL 5C2BH 3SGJA 3F12A 4LVOC 1Y18B 2XNAB 3CCHB 1TENA 4HIJB 2CKBL 4NQSA 1RUAH 4X6EB 5FAAA 3RVXC 3NA9H 4LVHC 1MWAL 3MX0A 1WBYA 4YQXL 1C16B 1K2DA 3K0WA 2VRAA 4OCYH 2WBJD 3DVNB 4KDVA 1DQJB 1MCLA 3QCTH 3DO7A 4JHWH 3RX7A 2A77H 1BJ8A 2ZJSL 2W0KA 3TN0A 3OB0H 1QG3A 4M62H 2PCPB 1CXIA 2OL3A 3RRQA 1KJ2H 3O3UN 3QUXC 1KEMH 5DQ9B 4ZSOE 2EDXA 2BCKA 4Z8FH 2XACC 4H1LA 5E8PA 1ZMYA 1HH6A 5EORH 3RP1A 2DQJH 3HE6B 4XTRC 3O4LE 2FR4B 1II4E 1ZLVK 3KHOA 2BY1A 2WANA 1I8LA 3UEZA 2DMBA 2CK0H 2BP3A 1X5IA 3I9GL 4PP1D 2NNAB 5SWZA 3RWHB 2J5LB 1VFUA 3ZTJH 4DVRH 1UQSB 3F62A 5L2KE 1BLNB 4XRCB 1FAIH 3O4LD 1MUJA 2D03H 4OZ4A 3IFLL 4JPWH 1L4IA 3UPCA 4Q0XL 1MCWW 3SN6N 3VFNB 3VFGL 3IJSA 2AQ1A 4Y4HD 1JJUA 4U6HB 3ARBA 1IVLA 4HH9B 2Q86A 1OSPH 4AEHL 1SHMA 2CKBA 4TYUA 3UTQB 1WITA 2ZCHH 3QCUL 4GS7C 15C8H 1N8ZB 2QLVB 4G8FB 5FGCB 4WUUB 3S36X 3KYMB 3ULVL 2XPGB 5HDQH 3AUVA 2NTFA 5B21A 4IRJA 3FN0H 4I2XA 4EIGB 4X8JB 5HPMA 5BV7B 1LDPH 3LDBC 1BFVL 1HNFA 2I27N 3NH7H 4GAJH 3UTTA 4CW1B 1WWCA 3DIFA 4NWUH 4OCSH 4QEGA 1IFHH 1D5XA 3EJYC 5BZDA 5I8KH 3G6JA 3ZT7A 3NCBB 3QIWA 3VXSA 2VXSL 3ARSA 4LPUA 1EEYB 2JELL 2JTDA 5C0BA 1OWRM 1UKQA 1HSBA 4NUGL 3DV4B 4E41A 4JFDE 4LOUD 4E42A 1BVKA 4UV7L 3THML 4YFLF 4HEME 1TMCB 1S5IH 2R23B 2X89A 4L3EB 2ZUXA 1FZJA 5ISZA 2X1QA 4KC3B 5C9KA 2EXYD 2N56A 1KTDA 5K9KB 4FABL 3TC9A 1TZHB 5IJVB 3VGHA 4GAFB 1KB5L 3RKPA 2IAMC 2AW2A 2AK4E 4WI3A 5J3HD 5KSAD 1K8IA 2DOCA 4JFFE 1INEH 2X9XA 5GGRB 4QT5A 1WV7T 3S37H 4KDTA 1NLDL 3MRMA 3DBXA 1YPZE 2P47B 3PNWA 4OJFL 3K8MA 2DYPB 4LSVH 5AD0A 2VDMH 4LLWA 3SE3C 3GMQA 4XPGH 2HLFC 1AD9B 1IGMH 3G5YB 1AIFB 5CEYA 3MNWB 2Z4QA 1OPGL 2MNUA 5F88B 5FGRA 3UTSA 1MCDA 1I9JH 4Y5VA 5INDB 1ZT4A 1QSVA 2K9UA 3IDGA 3DV6A 3QIUA 3GSQB 1BBJA 4TVPH 3VA6A 1OW0C 2UUDK 2WW8A 5D2LE 3VG9B 4I1NB 2NY3C 3GSOA 4Z7WA 1FFPA 4GQ9L 4FXGB 5FYJH 5E03A 1OD7A 4JY5L 1J5OL 4PJ7F 2XXMB 3QUXA 2F5BH 5CP7A 4JR9H 1KCSH 4YBQD 4Y4HA 2GQHA 2WP3O 1UXWA 1DL7L 3ZE2F 1N8ZA 4G8FA 3BZ4B 1T1WA 3UDWA 3RWGB 3JSSA 3UYRH 3QUKA 2XICA 5HHOD 4M8QB 2V7HB 4LHUA 3CZFA 3VFVA 4HCRH 2Q3AA 4GAGL 5CGYD 1XCQA 3HR5A 1UA6L 5D5MB 3S98A 5T3XD 3NTCH 4OLUL 4MZ2A 2JJUA 1NKRA 1BGXL 4QHUB 3VI4E 4Q7DA 3VFMA 2VDKL 4ZNCD 1UYWL 3D39D 4H26B 3VGAC 1I8LC 3DMMD 3WFCH 1G7JB 4JN2A 5I66A 2P5ED 4ZS6C 5F9OH 1YC8A 1YN6B 3SDXE 2AV7A 2NLJA 4M3JA 5KSAB 4KHTH 1E6JL 1UWGH 5H37G 1P1ZA 1E28A 1FFOB 1I3VA 4FQIH 1CLCA 3KJ6H 4J8RB 1L9NA 4OV5A 2CPCA 2BVPB 4LIQH 4M6NH 3LN4A 5KTEL 5SX4H 4NO0B 4R4FL 5FYKL 4CKVX 3EYSH 4YFEA 3CXHJ 4JO3L 4L8CB 4FRWA 4BFIB 1WZLA 2EDWA 4RX4D 1IAOA 1P53A 3CPLA 1GGCL 2O5ZH 4KMQA 1LE5B 1U58A 3IU3A 3D2UA 5F1NB 5H2BA 3QCVL 5HYEA 3EFDH 4YHKH 5FF6B 4BFBD 2CO6B 4FQXB 4KRPD 3JV6B 5T5FL 5DMYA 3T1FA 1T80A 5I76B 3NCFB 5F21B 4UINH 5DZNA 4NO2B 2QHLA 4QY8B 3VFWA 3HUJA 4JM2A 3STZA 5SV3A 1AO7E 4NQED 1AQKL 4D0BB 4D0CB 4PPTA 3VDAA 2J1KA 3RA7L 2KUTA 1JZ4A 4EUPA 4MCYA 4IJ3B 2QKIA 5JHDB 1T22B 1CG9A 2WLYA 3AROA 3KPNA 3MODH 3VXME 3GSOB 4Z7WB 3HC0B 3BFOA 4D2NA 4GKNA 2GI7A 3O4LA 1CGSL 1SEQH 4O5LL 5F6IC 3B5TA 3N1MC 1J8HB 3E8UL 1MWAB 1ERNA 2KQNA 3HKFA 4JCLA 3U30C 3VI4F 4PJHB 4YIQB 1SYVA 4P2RD 5E2VH 3JTSA 3VXMB 3NFSL 3VXQB 2VWEC 2XZAH 4YDJB 1MH5A 1Q72H 4ZOBA 4YHOH 4P4KC 2MJWA 3TZVD 2EEBA 4RMSA 1TNNA 3FQXB 3L5WA 1U6AH 1NBYB 5JIKA 4OZIF 43C9B 1VFAA 2Q8BL 5D1QD 5EOCJ 1YPZB 1IKFL 4P2RE 1KLGB 4LCWA 1A6AA 3HS0A 4M6OL 1O5DT 4XAKD 5K9OB 3I85A 4PJ7B 3HMXA 5B39B 1OTUC 4PGDB 5L7XH 3ARDB 3EO9H 3U7WL 2V2TA 4PJBE 3BGMB 4ZFGH 4GG6A 4MQ7A 5D7JA 5EZOL 3GRWA 5E2JA 1XF2B 3FB6A 4OLUH 3MLUH 4U05A 1XGRA 3DRTB 4JQIL 3SBWA 3VFRA 4DGYH 5T5NF 3ZTJG 2YRLA 4X80H 4U1SA 3CSBA 4YHZH 4Z0XA 3BYTA 3GNML 3NMEA 2F53B 2W91A 4ZPTB 2BNRA 5HGAA 5BS0B 4C4KO 1N0XL 4KTEL 3FCTA 4PV9B 1RURL 1UXSB 3EYOB 1TVDA 2FX8L 2ADJB 5CLWA 5IKCB 2AABH 3TT3H 4MA7L 1MFAH 2UY7A 3AMLA 1ZT7B 3UJTH 1N0LA 3IXAA 4OFPA 2BOCB 3W9DB 3HA0A 1RULH 2B4CH 1NC2D 2FSEA 1V3JA 3O6MH 1N64L 2LTQC 1UH3A 5D71L 1RU9H 5EUOF 1Q0YH 1G7IB 4XVSL 3NH7L 3MJ9L 5ESAB 2HJFB 5JZ7D 4W6YB 2VXQL 5F7KC 5C7XL 4LRNL 5KVEL 4XGZA 3FT3B 4X6DE 3NZHL 4MCYB 1CS6A 2J4WL 1PDKA 3BPOB 5ITBL 3ARBD 4MD0B 4YR6A 4JM4H 4NZDA 2X4TB 2EH8H 2H8PB 3ESUF 5IEKA 5BXFA 3AREA 4F2MB 2FNBA 3DRQB 5DUML 1LO4H 3SGDI 3HAEA 3WHE1 4YC2C 3H9SD 4UIMB 1A7PH 4U6VH 4I77L 1K3ZA 5EULV 1HXMB 2YS4A 1WAAE 4D9LL 4YX2H 4NQXB 3VXRD 4PRPA 5DGRA 3TH3T 1AQKH 4QOKE 5FA4B 2Z31D 2ZCKL 3QI9A 2YRPA 4PRAB 2OXHA 4TVPD 3AMKA 1RV6X 1CDGA 3CFKA 5HVGB 1F4YL 4RISL 3OKDB 2PYEB 5AZ2L 3PWNB 5IBTL 2CLZB 1DZBA 3CAFA 5C6TL 1HHJA 1KB5B 4U2YA 1C16A 1RZGA 3OAZK 1AI1L 1TLKA 2EC9U 3WL9B 4ZDHB 3F7YB 1DBJH 3CVIH 1FHGA 1OCWL 1BFTA 2AKRA 3VD7A 1LEKB 4W4OA 1LO2H 1NBZA 1H3UA 1CCZA 3C6LA 3I3EA 2LE9A 2DM3A 2B1AH 3PHOB 3C2SA 3INUH 5FKPB 4NZRL 3AB0C 1TFHA 2LU4A 3ARWA 4OI8A 2XN9B 3WHE0 1HI6B 3BP7A 4AEFA 4F3FA 5FB8B 4RAHA 4D9RD 2DMCA 5GRXG 2YD2A 3MC0A 3O8XD 2VISB 5GJTH 2JF1A 4ODXB 4PG2C 2YZ1A 2IQ9L 1I1RA 4L3EE 1FVEB 2X44D 3C8KB 3MV01 3FB7B 5IFHL 5AZEH 1W72L 1XF3A 4P46C 5GISL 1AGDB 5L88L 5HD8D 5J1AB 4HUXA 4QRUB 1ZA6A 5LXGH 1U8JB 2EDKA 2EECA 1QSEE 1YC7A 3HFMH 1JV5B 2BRRH 4ZYKA 2HTLC 3CFEB 2FSEB 4N8PA 1AHWB 2R2HA 2NXYC 3HZYA 3SO5A 4QRPE 2F8OA 2X4RA 1DQMH 5EBLB 1NMBH 2VN4A 3PXJA 1FNHA 4CVZB 4XCNB 3PIQA 3MCKB 4TUKL 4ZTOL 4F15C 2FX8H 1UKTA 2YUXA 1DQQA 4RZCA 3SKMB 1MFNA 2R56L 1PKOA 3HMWL 5DQDL 3OSKA 1KULA 3T8XB 1T1XA 3WO3B 2VC2H 5M7QA 1P6FA 3U9PL 4HIHA 1A1MB 3PQYA 4Q6YA 3BHBB 5KN5B 2CIKB 5F3HA 1DBMH 2R1WB 3P11L 2VZOA 5KZCD 4R0LC 4R9HA 5IJKC 5JTWA 4OIIL 4LCUA 1X7QB 5SWSB 3UP1A 3QNYB 4JVUA 4HDIB 1NMCB 4PRNA 4XC1L 5DI8A 1QYGH 3HI1A 1JHTB 5I16B 4CW1A 4ALAL 4ZS6D 4HWBL 4L4TA 2IALB 1AC0A 3TJHC 3QUZD 4X7TB 1CFVH 1EK3A 1NGZA 3CUPA 7CGTA 4KUCF 3WS3B 1A3RH 3NPZB 5DWUH 4M6OH 3VXNA 3WJJC 3C5ZB 4Y16C 4U1LB 3SQOL 3KLAA 3PDOA 2BY2A 3KWWB 4K9EC 4P46D 3TBYA 4R2GD 1GRWA 2NYYD 1WWBX 2VOTA 4LSPL 2ZUQB 2A9NH 1NGPL 3GSNB 4B7LA 2NY2B 4G6JL 4MJIE 5F6HI 4IHOB 2OTPA 1NCTA 4CBPA 2G9HB 4J7RA 4KZEH 2APFA 3QEGH 4G80B 3WIHH 2IPUK 5IJKA 1FZMA 4KROB 5I1LA 1E4KC 4X4XB 5AZ2H 2BVOA 2GKIA 3ZKXB 4UIKL 2X70A 5CSZA 1MFEL 2XRAH 4ERSL 2IH3B 3L9RB 4LPTA 1NFDF 1J0YA 2IANA 4GO6B 3V4VL 1A9EA 5D9SB 2H3NB 3IDXH 4ZFOB 5CEZE 4NQCB 3HC3L 3F58H 1XF3B 4HX1B 5B4MC 1CBVL 3PP4H 2BNRD 4CVUA 4WU7B 1LE5A 1IL1A 4HC1H 5GS2H