4DOHE

Il20/il201/il20r2 ternary complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
204
structure length
204
Chain Sequence
KPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYARVRAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-20
publication title Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 37
structure length 204
sequence length 204
chains with identical sequence R
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohE01
1HHJA 4Y16B 1OAUH 2CLVA 5J1SC 2OZ4A 2WZPD 2WLYA 4DKEL 1DQQB 3PGFL 3L3OB 4XC1L 3GBLA 3BZFB 4WHTB 2BNUB 4Q0XH 5IM7A 5FIEA 1NEUA 3BO8A 3V5HB 3HE6C 4LVOC 1WZ1L 3B8YA 3C6LB 4XP6H 4RAUA 4KKBD 2R0WL 4YHIB 5I66B 1EBPA 1I1RA 4JO3H 1ZHLA 5FOBA 4ZTPL 1J8HB 3QRGH 4JY6A 3ULSB 2XA3A 3IT8D 5D1QA 1B0WA 2FL5B 5AWNL 1AGFB 2C5DC 4M1GH 1KELH 4XXCC 4EBQH 4KJPD 1CDUA 4TNWF 4LCIH 2HT3D 3IDGB 2JTDA 5IGXL 1LP9E 5GS3A 4WFGD 3KLSA 4M6MH 1JK8B 3BP7A 1OP3K 2YWZA 4M5ZH 5CBAA 1RZ7L 2VLJD 4JHAH 3CXHJ 2CKBB 1TDQA 1TQCB 4XH2A 1W0YT 2R2EB 4GLRH 5E94B 1WLHA 3QZWG 2PW1B 1NGQH 1NGWA 5C0AE 1IM3B 5L2KE 3GSOB 5TE4L 4KHXL 2KZ1B 2E7LC 4TTDC 5HYFA 1RIUL 3W0WD 3WFCH 1RURL 3SGJA 3KNBA 4G43A 1OGAB 4CW1B 3FO0H 2DQIL 4I0CC 1OWWA 4O2EA 4HIEB 3ALWA 4LL9A 4AMKH 1NGPH 4KQ4L 4NKDB 4DEPB 5KVGH 1HHIB 1EEQA 3C60A 5DJCA 4OM1L 1EO8L 1OAXL 4Y0GA 5JW4Q 2P7TA 2EYRA 4JB9H 5FUOH 4NGHH 5IESL 5C9JB 1Y18A 1T7YA 4PBVC 5DSCB 1IGTB 1PEWA 4A6YB 3DECA 2VE6A 1MCOH 1A7PH 1C5BL 1JGVH 4APQB 4XMKL 5CBEA 4UV7L 4L8CA 3FN0H 1EX0A 1B6UA 3MRHA 4LLMA 3TNNB 3QNXA 4H25B 3PGCA 3BN3B 3LEXA 3JWNC 2C3XA 2NNAB 43C9A 3MROB 3NIDF 2GFBA 4MXWL 4F33A 1DBJH 3PGDA 3FAWA 4WUUB 4I9WD 5EIVA 1RZGB 3C5JA 1KCUH 1CFNA 3DV6A 4ZFZA 3CMOH 3INUL 4ODVH 5I73C 5BO1L 1JZ5A 3BYYA 4I77L 4RGNE 1J5OH 1D5MB 1RK0A 4U49A 1HILB 3ZHDA 2AK1H 2DDQL 1PQZB 2Z8WC 1K3ZA 5EC1A 2B0SH 3E8UL 3M1BA 4PP1C 4X6CE 1FZJA 4PJEF 4R8WH 4GJTB 1CDIA 3PABB 4XNUH 4C83B 2EZ0C 2YPLB 3V7AE 3F7YA 3GMQA 3MSPA 3RTQD 5C6WH 5SWZE 5CZXD 4HZAA 5FYLE 1FFOB 2Z35B 3MRQA 3MLTB 3H42L 4YHNB 3CX2A 1BJMA 4GW4B 5KVFL 3BKMH 2ARJQ 4CDGC 5DK3A 4OB5L 4TVPL 5A43C 3Q1SH 5T3XD 1ZLSH 5DJZA 3WUZA 1BF2A 3IGAB 1KXQE 1PG7X 2P43B 2P5WE 2XIDA 3BEWB 5EU6E 4M48H 4MA7H 3RWGA 4GFTB 4DN3L 4S1RL 4WFHD 4P2RD 5F7DA 3I6LE 5HYIA 1NGYB 3DWTA 2F5BH 4OQTA 1CE1L 1R24B 3OAZK 4WEBL 4CVZB 3RPKA 1P7KA 1QBAA 5HGBB 5I2IA 4YBQC 4BKLB 4PJIB 3BE1L 1A7OH 1F11A 4X98A 5L0QB 1LE9A 3WFEH 4POYA 1DUZA 1S9VB 5A16B 3PIQB 2A77H 2EKSA 3TO2A 1TNMA 2PO6A 5I1LB 1IGFH 1NSNL 4HLZG 1CLOL 3DO7A 1SJHB 1BVLA 1K6QL 3O9WC 4JDVB 3EOAB 4CJ0A 3RBSA 2L7UA 4U1HB 4DZ8A 1I4FB 1PX4A 4JZOA 5IQ9B 3IKCB 2CDGB 4BJLA 1UCBH 2UY6A 3SE8H 1JNNH 3FQTA 3MRFB 1MJ7H 1WBXA 3CLFH 1W72A 3BZDA 1N0XL 5L9DL 2XTJE 1J18A 3LDBB 3O6LH 1V8HA 2UYLA 1WBZB 3I50L 1I7RB 3I6KA 4NZTL 1EJ6A 4ODHH 5J1AA 1LK3L 5EB9A 3SCMC 3K3QA 4AY0A 3UBXA 3G6JF 3GMLA 2QSQA 2D03L 4P3CL 3SDXE 3U2SA 1KTRL 1WIOA 2AJXL 3OBAA 5HI4D 4Y4FC 3S5LA 3WN5C 3MR9B 3MJ8B 2XN9D 4F7CB 2VQTA 5CILL 3S37H 3SDDC 1MFAL 4IRJD 3CDFA 5CEZL 4YGAB 5HYSB 2FR4A 4OZHA 5FGCB 4E9LA 3KG5A 3IB4A 5F97E 1MRDH 4MCYB 4QRRD 3TN0D 2UY7A 4Q9CA 4MLIA 1RUKL 4NWTH 2W9EH 4X7SL 3LD8B 1Y0LA 4OF0A 5JNYB 5T1MB 1L7IH 4BFBD 5D1XC 2JJWA 5FCUL 2YRZA 5EA0L 4XBEH 4LCCA 1KPVA 4OFYD 1IGMH 2GT9B 4LARH 3S9DB 5IMLB 4PRPD 3GMOB 5HPMA 4NOBA 2M2DA 1KJ3H 1T0MB 4IRSA 5EU5A 1MHCB 4Y2DB 1NBVL 4YHOH 3SOBH 4HUWB 1JL8A 4NQTA 1WBYB 5DVLA 4Y5YC 5DQDH 1FFRA 2AJVH 5FEBA 3FQUA 2XPGB 3QEHB 4F2MA 2DL9A 1NDGB 2VAJA 1U3HB 4R9HA 4YR6A 2W07A 1S7QB 3LH2H 5CZVH 3QO0B 1KB5L 5HVGB 1BM3H 1UKSA 3OJMB 1FE8L 3VFVB 4UIKL 1CFSA 4ISVA 1CDYA 4IIQC 4G6AC 4XCYB 4MB3A 3OXSB 5FO9A 2ICEB 1ES0A 2MQ0A 2VDQH 4ZFOA 1UQSB 4LPUA 3BO8B 5E4IA 5GGSA 3BYTA 2XG5A 4JG1H 1SHMA 4RAUB 1G7MA 3MREA 4HEME 5SWSE 1NLBL 2GJ6A 5FV1L 1ZHLB 4D2NA 1J0ZA 2GI7A 4RCAA 1WCQA 3QYCA 5ADPL 1CICD 4JY6B 4AJ0A 1FNGA 4KTDL 5DI8B 1NANH 4Z7OE 3HPJA 4XPGL 3DRQA 4OCMC 4WDIA 1DBAL 3FOLA 4DQOH 15C8H 5DHXB 1IARB 4Z77A 4GLRI 3GGWA 2GK2A 4X99A 5FYKL 1M05A 4WWKC 3U9PL 4CBPA 1O0VA 3TT3L 5KVMC 4WFEE 2VXTL 2BSRA 5GGUA 1TETL 4Z76B 5CBAB 2XZAL 43CAA 3BGAA 4XH2B 2VZ3A 1TJIH 5CD3A 1JJUA 3B6SA 1DUYB 2NZ9D 4LKCA 2ESVD 3WLWC 3FB5B 1FPTL 4K94L 1EGJH 1NGWB 2FJFA 4NQED 3U4EA 1ND0A 4QOKB 1XGUA 1GAFH 5IVXE 4CRPA 3IETA 5HDLA 1T03L 3DIFB 5FO7A 3H0TA 1YEKL 2XNAA 4O2EB 4U1NB 3BZ4A 4X8JB 3MOBH 1RU9L 1FORL 4LSDA 3C60B 3O4LA 4H8WL 3DGCR 4PFEA 5DJCB 5E4EB 5K33A 2X05A 2EO9A 3GSVB 2B5IC 3V4VH 4HAFA 1VFUA 3O3EA 2VNCA 2ZUVA 2I9TB 2JCCF 4HFWA 4KKLC 5LAXB 3B2UD 3LZFH 4HWBA 1KLFA 1S7SB 1EDQA 5LWYH 3GIZH 4WTZG 1Y18B 2EXYD 4I1NB 5JXEA 4NNXA 4RMSA 3SKJL 1I1AC 2MHAA 5ITFB 3R1GH 4E41E 4RMUA 1CK0H 1JV5B 3G6DL 4M7LT 4MD4B 1QG3A 3F12B 4U3HA 1FZKB 3MUZ1 3VWJA 1FNFA 5H37H 3ZDYF 3QNXB 3D85B 1FNAA 3PGCB 3EO9L 3G5VB 3OR7A 4PRAA 4Z0BL 4F33B 5KSBB 1U8NB 4WFFE 4Z95L 4PY7A 2IPKB 1UVQA 3C5JB 4DGIH 3CVIH 3S37X 1XIWC 3L3GA 3DV6B 2E5EA 3UXFA 3LOWA 4OJFH 4PPTA 5TF1H 3D2UD 4QGYA 4KY1L 2V2WA 3FTGB 1BWMA 1ZSDA 1NEZA 4R4BB 1IC1A 1MH5A 5C07D 3TYFB 1BECA 1EFXB 3O2VL 5DEGB 3HPLA 4OM0H 1L7TH 2DJSA 4ZPTA 2AJYL 3C6LD 2OR9L 4JQXC 2X9WA 1CE6B 1FYHB 1RPQA 4HUKB 5BZDA 1U8JB 4HS6A 1JVKA 4NC2B 3X3GH 2HFFB 3F7QA 2YHGA 2IBGA 4XPAH 5FO8A 1QSFD 2D0FA 3QXDB 2BX5A 2X4NB 4YHZL 3K0WA 2OS7A 5BRZD 5EZJA 2GITB 2UZIL 4U1MA 1ZLVK 4F15B 4YE4H 2WIIA 5FDWB 3T2QA 3VI3E 4OAWB 4ZFGL 3VXMD 3ULVL 3OKMA 1FVCA 5FGBC 2EO1A 5GJSL 1G6RB 3NZHL 3V5KA 1II4E 3KPRA 3UJIL 3ZYJA 5JQHC 3H7BA 3RGHA 4LGRB 4XGZA 1NC2D 3TCLB 1E4JA 1YQ2A 2BNQA 4XI5D 3FB8B 5FYJD 4NC1C 2J7LA 1JHKL 5I16A 2DQHH 4DZBA 3LAFA 3EOTL 2Y07L 2VN4A 3KJ6H 4NNYA 4OSUL 2VABA 3LHPH 5T3XE 2Q7YA 1OGAD 4JO4H 4K23L 3TYGH 1DUZB 5EZLA 2EKSB 4LKXB 2E7BA 3PHOA 5BS0B 4G9FB 3B5HA 1BVLB 5CKAA 1IGIL 1PFCA 2W60A 4KKBC 3U0PB 2KDGA 3O81A 3G5YB 1FL5B 4DZ8B 1WEJL 1ZT1A 2VDOL 3DRTB 2VH5H 3VXPA 2QQNH 4LVNB 3WIIH 1F97A 1KJ2A 4UIMA 1KIRB 4D9QD 1K4CB 3DPBA 1GJIA 4OCRL 4R97B 3A67H 4KJPC 5TDPB 3B2VL 3VD5A 2HT3C 4X5XB 3KLDA 3OTTA 3GBNH 4GAYB 3K1DA 1N26A 5J1AB 5KANG 2HVJB 1MFEL 4OBSA 5IB3B 3U2SB 5IIEA 1QO3B 2OL3B 4XCCH 3T4AB 2XRAL 5E9DA 1IM9D 4WUUD 1I7ZB 1MPAH 3QQ3B 3WL9B 4ZQKA 1MIEL 1A6VL 2Q3ZA 1JGDA 3I6GB 3LEYL 3U0WH 4OZHB 1XH3B 3V6OE 5F93C 4EUPB 2F5AL 4OGYH 3OMZA 4Z9KB 5DJ6B 1RZKL 1Y0LB 4HEPG 2YBRA 4PJ9C 3F7VB 4LRNH 4PJAE 1ORQA 5KTEH 1FZMA 4LAQH 4Q74A 1I85C 2NYYD 1A14H 2YPLD 3D6GA 5SV4A 4D8PA 2B1HH 3WKMH 1NFDF 2DMCA 3MRGA 4XWGH 1TJHH 2YRLA 3G9VA 2XXMB 3HZMA 1F3DJ 4JPIB 5KSUA 3NA4A 5HPMB 3H3PL 4LCYB 2DQJL 4FQQB 5EU5B 2IFFH 4L29B 3Q6FB 1DBKH 2F74A 2N7BA 1GVIA 4F9LC 5LG1A 1T21A 2C4FT 3UTSE 4FABL 3D0LA 1G84A 5K9OA 3GB7A 3WIHA 3VFSA 3FONB 5HGHA 2VDPL 3WXVH 3ARGA 5FYLL 2V7NA 1LD9B 3HCVB 1HEZA 3KYKH 1M71B 3T0AA 3DSFL 2DQEH 3BKJH 4M8QA 3LS4H 4PGDA 2HJKA 5AYUL 1JP5A 3U4BH 1CGSL 1ZWIB 1JNHB 5FB8A 2BVEA 2BOBB 4MQ7A 4PRBA 2R69H 2BERA 4YDIH 3VXSA 1HCVA 4ELKA 2YN5A 4PJEA 4FNLH 1H3GA 4QTIH 4CVXB 1A7NL 1AGBA 4NRZA 3KJ4C 1A6AA 1G7MB 5ILTL 1AIFA 4PJ8C 2AV1A 2ZWLT 2YSSA 4X83A 1I1FB 1HHKB 3ARBB 4XCNB 4TNWK 3BMVA 2E27L 4PUBH 3V7MA 3IFNL 4ZUUB 2OK0H 5CZXC 4Y19D 3AROA 4Y1AA 4WW2F 1U8MA 4KZEH 4JFPA 3DLQR 1JF6A 4IDJL 2X4OA 3DJ9A 3PP3K 1CG9B 4WDIB 1RUQL 2YS4A 2O93L 1M6OA 1UZ6E 1JF1A 3O2WL 1X5ZA 2LVCA 2C3VA 4EVNB 2EIDA 4JZNB 3P2TA 4N68A 5TE7H 4L4TB 2KH2B 4L3CB 4X99B 5BOZG 1FHGA 5D7IF 5ADOL 2ADJA 2BSRB 5GGUB 4UT6L 2Q20A 4NO5B 5JHLL 4HCRA 1T1ZB 1IMHC 5T3XH 3LN9A 3WD5H 3DVNB 2MOVA 5C0IA 5JTWA 1DE4A 4JFHD 3BT2L 3H0TB 2XNAB 3QIWB 4XMPH 4XP1L 2PTVA 1QSVA 3WJLC 1A6ZA 3O4LB 5EOCH 2FD6H 3UJJH 1T5WA 3O3EB 4HG4K 3O6MH 3U0TA 1B4JL 4HFWB 1FZOA 1F45A 3N9GH 3VH8G 4ZDHA 4U2ZA 1AQKH 4E42B 4NNXB 4OCWH 5HVHB 1A7RH 2VXQL 1OAZL 3MA7A 2MHAB 1QZ1A 1HZHL 2B4CC 2X44D 1S7VB 1WC7B 3HNSL 1NCBL 5C0EB 5E6YA 1U8PA 4Y2DD 4I3RL 3PQYA 4TQEH 3V95A 4U1LB 3G6JA 4UU9B 4FFWD 5E6IA 4XNXH 3AS3A 1WK0A 4OUOA 4IJ3B 4MDIB 3OR7B 4MNHB 4PRAB 1UB6A 1U3HD 4OLZH 4EKXA 5HI4C 5F7NC 3VI4F 2A6IA 3VXTB 1UVQB 1ZANH 3QCUL 3QCTL 1JGUH 4XP9L 3QA3B 4JQIH 1TENA 4PGCB 5DC0A 4PG9A 2ZSWA 1JZ2A 2V17L 4JRWA 3LKPB 5DQ9A 5IFHL 4J6RH 1VKXA 5IT2H 1ZSDB 1NEZB 5DURB 4QCIB 4EDXA 3NIFE 1LHZA 1TZGL 3MUHL 3TN0C 5C0FA 2EDDA 2E8YA 3IDMA 1LO5B 3HPLB 4L4JA 4D9RD 1Q9LA 2ZCKL 4I2XB 4J3XA 2IGFH 4MA1B 3DX7A 2M1KA 3BIKA 2XQBH 2DQFA 5CIPA 4NJ9L 4PR5B 3MRRA 1A6UH 2HKFH 3FQWB 1EZVY 4JREB 3IDIA 4GQ9L 1NGZB 5EOQL 5B3NA 4GMTL 3SDYH 3DTXA 1RULL 3BGFB 1T20B 2C3HA 4X4ME 1LO4H 3L6FA 5C0BB 3KPRB 5IW1A 3KYOA 5B4MD 3H7BB 3V7AG 1PLGH 4MMZC 3FN9A 4LLYB 5T1DH 1CFQA 2BVOB 2XOTA 2BNQB 3GSNA 1T2XA 5CWSB 1F5WA 4LQ1A 1R3KA 2LAGB 3VMOA 4JVWA 3AAZA 3FJTA 4DZBB 3OB0H 4HJGA 4FQ1H 4HXAH 4QOKD 1T0NA 3ESUF 4WU7B 5D5ME 5K59E 4NNYB 2VABB 3EDKA 4FZEH 4OT1H 3QT2A 1KFAH 2GUOA 5F8RC 3DARA 3DURB 5I1EL 4W4OC 5D7JB 4JPWH 3K81A 3P30L 5EBGA 5FKAA 5EZLB 2NZIA 3Q5TA 2DQCL 1NBZA 3C60D 1E4KA 1F2XK 1O5DT 5T5FL 1K4DA 3ISWA 4NHUB 2NY5L 2BMKB 1FLRL 3MCLL 2I5YH 2R9HD 3BPOB 3F6LA 4PJHF 4HJJH 1D5ZA 2BNRB 2LABA 3QULA 1BAFH 4S1QL 1CICC 4UUJB 3QFJE 4Y5VC 1K8DB 1BLNA 4OFVA 2YZ8A 1FGNH 5TFSL 1N3NA 4NO3B 5ICYA 2HLFD 2R2BA 4KUZH 4ZPVB 4DAGH 2Q76B 4IRZL 1KTLA 3D85D 4HUVA 3KLHC 4EN3A 5A3ID 1ZHNB 4LF3A 3MRBB 4NO0A 5ERWB 3FRUB 5GRUL 3IS1X 5E9DB 1SJEB 3D39A 4HF5H 2JB5H 1J0YA 1ZKAA 3QUXB 4IHOB 2NZ9C 5DO2D 4KAQH 4ZQKB 3MNZA 3BQUB 3EYUL 2QKIA 1BF8A 2YZ1A 3TWCH 3AS1A 5KSAB 4MJIB 2Q86B 4KROD 4KK6D 5DJDA 4Y4KA 3HAEB 3TO4A 2YBRB 1YNLH 4YK4B 1RHHB 4Z7WB 2OTPA 1OWRM 4WW1A 5H37G 3AXLA 2YOCA 4G8EB 5CJ8A 2VDKL 3W39A 3B2UC 3GO1L 3BUTA 1HOCA 1FC2D 2N4IA 2PN5A 4OGXH 3W5NA 2R1YA 2EXYC 2NMSA 5D6CA 1LWRA 5I74B 1CFTA 3QZWA 1KLGA 5EDXA 2HFGH 5IQ7H 4TUKH 1H9VA 3KR3L 5DWUH 3OGCA 3ARFC 4GSDL 5LVEA 3MCG1 2APWA 1UYWL 1KIQA 1AE6L 3RWHB 1QLFA 1VACB 2EDOA 2JE8A 5FECB 4N5ED 3GSRA 3C8KB 4MQSB 4S0TD 1JIBA 4JN1L 4JZJB 2V7NB 4LNRB 4PJGE 4QY8B 5B22A 3EOYG 1IKFH 5JZ7D 2D3VA 4W4NA 5DT1L 2AAVA 3WNLA 2BRRH 4MQ7B 2VDMH 1NAMB 2XA8L 4PJEB 2AQ3A 1ITBB 3NACH 3VGDA 4NRYB 3BRFA 1D6VH 1QPXA 1A6AB 3H9SE 3C6LC 2AV1B 4N0UA 4U1KA 4KVCH 2H32A 2YSSB 3S96B 3RP1A 5CD5D 3E3QC 3VFRA 4Y1AB 5M95B 4TUOA 2WUCL 3P11L 3BKCL 5D6DA 2ATKA 5DK0A 5F9AC 3U36A 2Z0BA 4R26H 2XFXA 4Z7UF 1E4XL 1MQKH 3IDXL 3UJTL 4CN6A 4UBDD 2E9WA 2ADJB 4M00A 3P4OA 1INQB 4PRIA 2EDKA 3QO1A 4XP4H 3LKOA 1NPUA 4YDVA 2HT4D 4NRXB 2CJUH 1MNUH 3EOBA 1IAIM 2YRPA 5DUPL 1TQCC 1JWMA 1YEJH 3X11B 3N0PB 1MVUA 2JJTC 1KIUA 2JELL 3ARXA 4NQCE 1PKQB 1S5IH 2VZUA 1D9KA 2PR4H 1AI1H 5D71L 4TSAH 3VD7A 1DE4B 2X2YA 3JZ7A 2EDTA 2BOCB 4X7CC 1FC1A 2D7MA 4N9GA 5IMKA 4JY4B 2R8SL 5JLZB 2CKBH 1YNTB 4PJDA 6CGTA 2JJSC 5FYJH 2VLRA 4FQPA 3WJJA 4DEPC 4L8DA 3FFCE 3WS6A 5ISZB 2QHRH 4R3SA 1FZOB 4FQ2L 1NMCB 1WIPA 1FO0B 4GAGL 4UAOB 4HMEA 4BFIA 2DWDA 1YYMH 4LPYA 3FL7A 3OJDA 4IMLA 3UZEA 1A4JA 2JIXB 2E9JA 1DN2A 2P48B 5KW9H 5DF0A 1WJ3A 2NW3A 4JGMA 2ARWA 4IRSD 3RX5A 3CPLB 4K7FB 5B3JE 3PQYB 2J12B 4OF8A 3DX8A 5E6IB 4NKOA 5T1KB 2ZZUT 5I1CH 1LP9F 4JCLA 1F4HA 3D9AL 2R15A 4KVNH 2R4RL 2A6IB 4A6YH 2YPVH 1AD0A 1XR9A 4H1LB 1U8OB 3DGGB 3VD9A 2R0LH 5HGAB 5D2NE 2E6JA 3NCBB 4JJ5A 1D6EA 4PLKD 4YPGA 3FFDA 3D5OF 2AJ3B 3D1MC 4IOIA 1BEYL 5DQ9B 2IH3A 4JDZA 3P0VH 3V8CA 4YO0A 1Q1JL 5I1KL 4PS4L 4AEHH 2FYYA 2GTZA 2IF7A 1EHAA 1SMAA 1MCIA 4X4XB 3LS5L 3Q2CA 2V9RA 4RNRA 3RDTB 3DX6A 1I8LC 3HI6H 2WM0A 3IAGC 4OGAD 3V52H 3H8NA 2NYYC 4JRXA 4GBXB 1NFDA 5I19L 4G42A 1I9JH 3CGTA 1DANU 2W65A 1A6TB 1CR9H 3K1KC 3JV4A 3WLBA 1YPZF 2BSTB 4GKSA 3MRRB 4OD3L 1DZBA 4Q58C 5EORL 1RQ5A 2XT1B 4NOFA 5CINH 3V0AC 4O4YH 1UFUA 4NZJA 3ZTJG 4AM0A 3ZDXE 5JOPE 4I48A 1EXUB 2R2HA 5B38B 4NQUA 3IAQA 3ZKNC 2XWBB 1JPFA 5E8OA 3RGVA 4YXHH 2N56A 3MFFA 4I18B 4U6YB 2IANE 3L6FB 3NMEA 4WUKL 3GKZA 5CUSL 5I1GL 3ZTNH 3QDGA 4N0RA 2HTKC 4YDLB 5IB2B 3SKOA 4WTWA 1I9IH 5E1HB 4KPHL 2VERN 2ICWA 2R1WA 4U6HB 2BC4A 4X80H 5EU7E 4M7KL 1H3PH 1XGPA 3BXNA 3WUWG 3AAZB 1BQLH 4ORGA 4JFEB 3C8DA 4ETYA 1JPSL 3SE3A 4QHMA 5C09E 3QEUA 1GC1H 2HWZH 3C08L 4FQJH 5L0QC 2F54E 3QIWD 3T65B 1LK2A 5C2BL 3O4LD 2CGRH 4PB0L 1X5XA 4Z7VB 3IS0X 4X6CF 1MJUL 1RUAL 3QULB 1KULA 4WW2A 3ILQC 2AV7A 1A7QH 4FP8H 1IC7L 2IPUG 1A3LL 3PWJA 5DJ2A 5I1IH 4AIOA 2B2XH 1NKOA 1RIVH 1S7UB 3MLWL 1AGEA 2R2BB 3VWJD 3TBSB 3LDBC 5C3TA 3DHMA 3AUVA 4LFHG 4LLQA 1KN4H 4P99A 2HAZA 1QSEB 4RFOH 5C7XH 2NR6C 3OXRB 4R4ND 4B41A 3RAJH 1Z2KA 2OQJA 3CFCH 2RGSA 5DURD 3ETBF 4NKMB 5FHAH 3GKWH 4CU6A 4F3FA 4DKFH 3KPLB 4O2FA 1NGXB 3LD8C 4XT1C 2JCCB 5GHWH 1BJ1J 1CF8H 1FCGA 1JPTL 4MD5A 4E0RB 4P2QE 2P49B 2D31A 4JO2L 3UDWC 1C1EL 2XV6B 1M4KA 4K3GA 4J3WA 1OTTD 2ADIB 3RIFF 1S7WB 3QZWB 1RUMH 2Z9TA 4KKCD 2RR3A 3H3BC 1P84K 2VWEC 3S6CA 2EDHA 1VGKA 5J4MA 1CLYH 1IFHL 1KIQB 5D70L 4Y2DC 2ZPKH 2FNBA 3THML 1UWEL 3KPRD 4FFWC 3DX9A 5CHNA 5L8KB 2C7UB 1C8PA 2DMKA 4LCWA 3SDXF 1UGNA 1U3HC 4G8GE 2BNQD 3OZ9L 4P4KB 5B8CB 3VGAB 1A3QA 3S7GA 4TOYL 3GJEB 4PJBE 1EAPB 4N0YL 1MHHB 5I15L 3MGTA 1XGYL 3UYRH 2AGJH 4WTZA 1GIGL 1P9MA 2FJGA 3S4SA 4NM8L 4NQDA 5C6TH 1FJ1A 5MERA 3U7WH 3SGKA 4OLWH 3RPIB 3T0EB 4CADA 4L8SA 4M6OL 1GOGA 1V3KA 4V1DE 2DIBA 5JPMA 1RFDH 4QRPA 3GHBL 3KPMA 4WHDA 2BDNH 1X6LA 3ECBA 2A9NH 5GSRA 2AQ1A 2Z92B 4N0UB 4U1KB 1YN7A 1QBBA 3FMGH 2BNRD 3GMPB 3K2UH 4HWUA 1I3GL 5DTFA 5IFAL 3U6RB 3Q6GL 3AREA 3CC5B 5MENB 4JRYB 4XAWL 4HWEH 2A6KA 3E6FB 4KRNA 1PG7L 4NUGH 2QR0A 2A2QT 4YFLI 2MSPA 4DJMA 3RL2B 4MNQA 3QUML 3LPFA 2X7LA 4U7SA 3SY0A 4YWGH 5F9JB 3VJ6A 4HQQH 1E6OL 5ALCL 3OGOE 3QH3B 5B4MC 2P4AB 2R1XA 3EOBB 3QUKB 4NZUH 5E9DD 2P8LB 3SDCB 4Q6YA 3QDMA 1OAUL 2Z4QA 2Z93A 4U05A 3ILPA 1D9KB 3BQUD 2ZUQB 5DYOA 5DS8A 1U6AH 4NDMA 1KPRB 4Q9QH 3L7FA 2APVA 4L3EE 3B4NA 2A0LD 4N9GB 5IMKB 4Q0XL 5KSAD 1ADQA 4JEGB 4OIIH 3MV8E 2QHLA 1NMAL 4M61A 3ZSSA 1S9WA 2G9HB 2ZUSA 5C8JB 1LEIA 1HWGB 2VXUH 1N8ZA 3C60C 5E4EC 1GGIH 1Q38A 2QJDA 3UEZA 4JO3L 3SN6N 2R9HC 1YJDC 3OAZH 5JW5B 5ENWA 4BFIB 2DWDB 3F7RA 4XXDA 4A2MA 1RK1A 1KELL 4EBQL 3BH9B 1F00I 1CT8B 2XZQL 4MA3A 4Z7OF 2AP2A 5ITBH 2LTQB 4QO1A 4AK1A 3EGSB 2HLFC 4M6ML 4NKOB 3CCHA 4K3DH 5I0DA 4PJ7A 4JHAL 4NC1E 2VC2H 1Q0XH 3DV4A 4BH7B 3SKMB 3BKYH 1NGQL 3ARGD 5F88B 1BD2E 1SVZA 3KPOB 4J4PA 5DO2C 4W68A 4XVUD 3WFCL 4IOIB 3J8F7 5D8JH 5IVXF 3VGEA 4YO0B 1PX3A 4AMKL 5DVKA 1AFVL 1NGPL 4R0LA 2E3VA 3S35H 5KVGL 2FYYB 5EOCJ 1BVZA 3VXSD 3OKYA 3RJDA 1JYWA 2XWJA 2H26B 4RNRB 1F4XH 4GO6B 4JB9L 5FUOL 2NTFA 4NGHL 1F3JB 1JRHI 5EFIB 2HH0H 2DM3A 3RX7A 4G42B 2W65B 4HGWA 3HE7A 5E99L 1LEGA 3X14A 2DQDH 3QI9A 5CJQH 4Y1AD 4M7ZB 3QNYB 1MCOL 1A7PL 3EO0B 4AM0B 1JGVL 3VXRA 3MNVB 4I48B 1JI1A 1U2HA 2HVKA 4PREB 3RGVB 3WNOA 2Y7QA 4FXKA 1CDBA 3MRPA 1MRCL 1MY5A 5FUCE 3SDAB 3RWIB 5FHBH 3SKOB 1BX2B 2VITB 4EJ1C 3HMWH 1CLZH 4WHYG 1DBJL 1QRNA 4N5EC 3BD3A 3HG1B 3QQ9D 4NPYB 1U58A 2Z31B 2GJ6E 4NBXB 5HHQA 5J13B 1B4RA 4MDJB 4RAVA 4HPYH 4ORGB 1GZQA 3D3VB 5DQJA 4R7DB 3C6SB 4XRCB 5K9QI 1PKOA 1I75A 4KTEL 5INDB 5JZ7C 5DC9B 3RWFB 2H2PD 2AXJA 4M3KB 3BZEA 3PUCA 4M4PA 2B0SL 3RUGA 4OQTH 3S3PA 3OR6A 4R8WL 1OVZA 2Q87A 4BH8B 1P7QA 3GMRA 1HDMB 2P5EA 4XNUL 2J8UB 4NKIH 4U7MA 5ISZD 1T6WA 3HZKB 1TZHA 5J3HD 4WW2B 3L3HA 1YQVH 3DVGA 4FQXA 5CD5C 1G7IA 3GMMA 2IH1A 2WWMC 5LCVH 3WFDH 1IGYA 5TQ2H 4LSVH 2P42B 1GRWA 1EHNA 1HSBA 1ZLSL 5HYQB 2CXGA 4Z7UA 2AKRA 3P77B 5E24E 3VI3F 1LE5A 4R97C 1B9ZA 1AGEB 5D7IB 3PQYD 1AO7E 4M48L 1CXIA 1PYWA 4MA7L 3LEVH 4YHKH 1F90H 4MSWA 5E6ID 5SX4I 5T1KD 1MY7A 2PYFA 4YH6A 1R0AL 3JTTB 2OX5A 1CFBA 1XFPA 2A6DA 2UV3A 4LEOB 2C1PA 2HT4C 1FAKT 4F7MB 3BWUC 4I0PA 1W72H 1FL6B 3GK8H 4KK9D 3CFDA 1R5WA 3HRPA 1U8LA 3OG4B 4WCYL 1A7OL 5DR5H 3PL6A 3ULUC 3KHOA 3RWDB 4Y5XA 3U30B 1CQYA 3WFEL 5GS0C 4L9LB 3FQXA 2IBZY 2OL3H 4O9HL 4YGVA 4UTAL 1AR2A 2VLMD 1AXTH 2EYTB 4O2FB 1SJXA 2WINA 4G8IB 4M62H 4GBXD 2FEEI 4X8XA 4AEIH 3E0GA 1JNNL 3HS0A 3LKNA 3BVNA 5C9KA 2OR7A 1RAMA 3CX5K 1F6LL 1MJ7L 2EDEA 3RVUD 1MCBA 1VGKB 5JMRA 1ZK9A 4OLUL 2Z91A 4OKDA 3FCTB 2QADB 3F65A 3HZVB 4HUMB 1FG2B 4ODHL 3QJFA 3AS0A 4BZ2L 5H35A 1OTSC 2HJLA 5CHNB 5E6ZA 1NUDA 4FZ8L 4ODWB 3OKDB 3IDNB 1N64L 1U93A 1T22B 5L2KA 4AEFA 2FATL 5F9DC 3A6BH 4U1IA 4PLKC 1FJ1B 1OAYH 5MERB 4IBLT 4JLRA 4Q6IB 1MRDL 5EPMA 4L8SB 5CMAB 2W9EL 1RUPH 3WNMA 3S35X 3Q5YA 5JPMB 5FKPA 1L7IL 2A73B 4ZNCD 4KDWA 4XVJH 5GSRB 2FX8H 1FSKB 5KZCB 3QUYB 1ZA6B 4PJAF 3VFPB 4GRWB 3MRIA 1YN7B 1V7MH 4OGAC 1TPXB 1Q9KA 1SYVA 2HRPH 1KEML 3ARBC 1IGML 1T5XA 1NBYA 4LARL 3V0WH 3KPSE 3IJYA 3R4DA 1M7DA 4EI6A 1A1MA 5CCKH 3H9HB 4FQCH 3TBYA 2NY3B 3D48R 4YHOL 2CDEB 1CFVH 5DQDL 2AJVL 4MNQB 3SY0B 2X7LB 5JOFB 1WQVT 3OKEB 4PGEA 1PY4A 4C56A 5CLWA 1WCBB 4WO4A 3HR6A 3S88H 4EN3D 1UA6L 3LH2L 5CZVL 5FGSA 4NO0D 3HUJE 4NC0B 3T2PA 4ENEC 4OD1H 4F7TB 3GUTB 3D39D 4FOMA 3UZVB 1CDJA 3BSZL 3BESR 3D25A 2YD9A 2BCKB 2WSKA 3SPVA 3BP4B 3WFBL 3MJ6A 1EEZA 4ZTOH 4LBEB 3G04A 3IJHB 1ZLVH 5JO5A 1WSST 4KXZH 1CTNA 2QTEA 3L7FB 5H94A 1OPGH 5IK3A 3PHQA 5B39B 2GSGA 5F6IB 4M61B 3QIWC 1XGTA 1S9WB 5EU3B 3TO4D 5FYKU 3T0BA 4DTGH 4QGTA 3DYOA 1QOKA 1VFAA 4PJHB 5ESVB 1FVDB 1FFPB 1P2CA 2FSEA 2D4DA 4DOHB 3TIDB 4RWHA 1Q94A 3TNMA 2HN7A 2UWEA 4GAJH 1PZ5B 1T2QL 4WJ5B 2DBLH 5HVHC 3IF1A 4AYFA 1DL7L 4UINH 4MA3B 5D7LE 3EHBD 4RX4D 2EYSA 2VR5A 4AL8L 1UZ6F 1FN4B 1V3LA 2G75B 5EWIH 2P5WA 2BSSB 3TBWB 1HKLL 4MLSA 3MRCB 1MIMH 4HWBH 1Y6NR 3GSWB 1FLTX 4PLJD 3BIBX 4LVHC 2J1KA 5EIIA 4N8VA 1P6AB 4LPTA 32C2B 4PJCA 5HYJE 5F7WC 1IBGH 4XPTH 2BFVH 1EGJL 3BWAB 3DBXA 4H88H 2HJFB 4N5UA 4TULH 4DVBB 2QBWA 4NNPH 4TSCH 4EOWH 4JFDB 3T0ED 2K1MA 5DVOA 3G5XA 5LKNA 3MOBL 2P46B 3P73A 1BFTA 4EZMA 4NFDA 2YUVA 2VZ1A 4FMFA 5IF0A 2FEDD 1S3KH 2EDNA 4AQ1B 5DJXB 4CVWA 5LWYL 2ZNXA 4HUXB 5MEQA 4MA1C 2VIRA 3WE6A 1OTTC 5C0DA 3R1GL 3G6AB 1CK0L 3NABL 3WNNA 3IYLW 4KKCC 4PJXE 4JREC 4KKAD 2VLLA 4I13B 1E4WH 5IWLA 4FXKB 3BRDA 1S9YA 4PV8A 3BGFC 2GAZB 1ED3A 1KCVH 3KYNA 2K7PA 1MLCA 3C09B 3QEQE 3SDXA 4PRID 1EK3A 4RMVA 1CD0A 1OSZA 1V5JA 3B9DA 3OAUH 3CSYB 1OL0A 3SE4A 1RSFA 1U58B 4U33A 5KJRL 1QNZH 3EYQC 4DGIL 1E28A 2FX7L 1YNKH 3VW3H 3BRGC 1T3FA 3ROOB 2RAMA 2IEPA 4HZLB 1D9KD 4NHCL 5DQJB 1ACYH 3RWCB 3MV9B 5IBTH 4YDJB 2CO7B 5CGYD 1A22B 1QFUL 4ETQB 3BZEB 4YBLB 5D7JC 4OM0L 1L7TL 3NIFF 4X5WA 1P7QB 3GMRB 3KLAB 2VLRD 2P5EB 2FBJH 3LV3A 3REVA 4DVRL 5C3LD 1FYTB 4MHHG 3D0VB 1MFCH 4YXKH 2CPCA 1HE7A 4UNTA 1TZHB 4XPAL 1FRGL 3BPOC 4RDQG 3BAEH 2DD8H 4FQXB 3VFTB 1I8MB 2J8HA 2IH1B 2YA1A 4DN4H 3V4UH 1T83C 3PWPB 3DUUA 1HSBB 1VEMA 4C59B 1NLDH 1LE5B 2NQCA 5C0RH 4OLYH 2V9QA 4NO2A 5CP7A 1FFNA 2BVPA 2JK5A 1AR1D 4MSWB 4OI9A 4U6VH 3QG7H 3L5XH 4KDVA 4LIQH 2C1PB 4GW1B 1KJ2H 4TYUA 1MCFA 2DQHL 3DUSA 3CFDB 1R5WB 4OZGA 1U8LB 3QUXC 5KAQG 3KJ6L 4F37K 1Q72H 4NN6B 3PP3H 3BQUC 2FBOJ 3LHPL 1N2RA 1TVBB 1MAKA 2A1WH 3WFHB 3AU1B 5D5MF 5K59F 1BFOB 2ZKHL 5LBSL 3VXQA 1G0YR 4JO4L 4I4WB 2CIKB 3TYGL 4JVPA 4NWUL 5KSAC 2FB4H 2VRAA 1L0QA 5EUOA 3CXHK 3RIFK 2X40A 1JFQH 3BDYH 2Q3AA 3ARUA 3NCEB 1JPGB 4P49A 5EIQA 3N1MC 5SWSA 1J8HE 1G1CA 3GNMH 4JFFA 1Q0YH 3BMWA 4JRXD 1WICA 2A9MH 4L5FL 1DLHA 2VH5L 5KVDH 3F62A 2QQNL 3WIIL 5I1HL 1VFBB 3JXAA 2QSCH 5L88L 1I3RB 4P57A 1IJ9A 5I74C 3A67L 4YHMH 3MGAA 2XTLA 4P9MH 4OIBA 2Z91B 5EU4A 2ZNWA 3EYOA 2Y06H 3ARYA 3GBNL 1HI6A 3DXAA 3RGVD 4B7LA 1BIIA 2FIRT 4GH7B 4CNIB 1LP9B 4HUUA 1OD9A 1GHFH 4UQ2B 4HGMA 4K7PH 4XCCL 1EHLL 3MOAH 5FAAA 4KHTH 3V6ZB 3EYVA 5IJVA 4Q7DA 1D5XA 2AXFB 4JZJC 4OFPA 2OJZH 3VH8B 1R3HA 1ZOXA 5C0AB 1ZLWH 3U0WL 1DQMH 5IVXA 4U1IB 5DVMA 3VGHA 1CXFA 4K3HA 4XVUC 1QD0A 3TF7C 2R0ZH 4OGYL 5EPMB 3TBTB 5ID1A 4ZUSA 3WIHH 2EH8H 4IMKA 5KTEL 4RWYL 1ZVSB 3O8XA 2AJZA 4LAQL 4ERSL 3RY4A 4RZCA 3U46B 1BQSA 3MRIB 3K4AA 2B1HL 3WKML 1OAQH 3LN4B 1YPZB 2DRUA 4XWGL 5FCSH 5IHZA 1TJHL 5DRWA 3K8MA 1NBYB 4MAUH 3KXFA 3IJYB 1M7DB 2V5YA 1JHLL 1NAMH 2XACC 1JN6B 4P5TA 5DHVB 3QEGH 2IFFL 2RB8A 3O45A 1DBKL 3VRIB 3MRMA 5C08B 4HH9B 2A6JA 2EDBA 4OFKA 3ZL4L 2HLAB 1OTUD 5KS9B 1KB9K 2F19H 4WO4B 4JKMA 4NQVB 4MQXD 2VQ1A 4J1UA 4S0SD 3WXVL 2X70B 3KDMB 1YUHA 4I0KA 4MAYA 4KXZI 2AEIT 3QQ9C 3KYKL 1XGQA 1KCRH 2DQEL 3BKJL 3LS4L 4HIIB 3DYMA 3RU8H 4NIKB 4PJGF 3U4BL 4EXPX 4PY8I 4MD0B 2WV3A 5JO5B 4RGNB 1OY3B 3V6FA 1AD9B 2R69L 4YDIL 3SO3C 3KPQA 3PHQB 4HCRH 4F7EA 3ARTA 2H2PC 4LGSB 3TVMA 1XGTB 2EH7H 4FNLL 4P59H 4JFXA 2H41A 4X6CB 3NH7H 3T1FA 4PTTA 5JW4N 2FSEB 4OD2A 1P6FA 2AEQH 3I75B 3MRKA 2OK0L 1NMCC 3VGGA 5SWZB 3L5WA 3PDGA 1F8TH 1T04B 1CS6A 3D39E 5J3HC 4KZEL 4UAOC 2MKWA 1UM6H 1P4BH 1FCCA 4TPRL 2KUTA 2EYSB 1RZIA 3BH8B 2D9QB 1YN6B 5TE7L 4TVSa 2V5MA 2P5WB 3HLAA 3P4NA 5DD6B 3NBNA 3UBXG 5EU6B 3RI5F 2LAAA 5E6IC 3ZE1E 3S5LG 3VFUA 3BW9A 2IALA 4IOFD 5EIIB 5AG8A 1N59A 5DEFB 3WHE0 4LCWD 1VEOA 3MXWL 4L8BA 4PRHB 1FL3A 4PJIE 3G08A 3Q48A 3PNWB 2PNDA 3GSUB 4L4VB 3LCYA 3ME0A 4QRSA 1AXIB 4XBGA 2XKNA 1AQDA 1IAMA 1TMCB 2X09A 4NZDA 2AS5M 2CUHA 1PG7W 3OPZL 1QR1A 5GRJH 2R39A 5FM5O 3EW3B 1MRFH 5EOCL 2FD6L 5IVZA 3UJJL 4ZD3H 2WP3T 4DGYL 4ODXA 4QHNA 1EEYA 4QRPD 2AXGA 3T0WA 3O6ML 5EUKB 5ALBH 2SEBA 5L7XL 3TJEH 1U2CA 3W81A 1VB9A 5GISH 3QUYD 3N9GL 3L1OH 3N85H 3WXWH 3RDTC 1AQKL 4Z7NE 3GSQA 4G9DB 4GBXC 2BK8A 3WE6B 3H6JA 2X4RB 3QHTC 5C0DB 3BDBA 3EZJB 1MJJA 5TDOA 5IB5B 1MWAL 3B3IA 5GGRA 2X4UB 3RVUC 1C08A 1WWWX 4KDTC 3GHEH 2FGWH 2XTJB 3UO1L 4MMXC 2OSLA 2VLLB 5HHNA 4WI4A 4HK3N 5B3JF 1S7XA 1QUNA 4XNXL 2NCMA 4MNQD 1ED3B 4LLUA 1MFDH 3VA2C 3KYNB 1WFOA 4GKOA 3SDXB 3CSBA 5HJ3A 4ZAKB 4P3DA 1OSZB 5CIPH 4YDLC 2YUZA 4K7PX 2B4CL 1YECH 5FF6A 2CRYA 2Q6WA 2CLZA 1E28B 1NC4A 1ZANL 3WHE1 4ZSOA 3BP6A 3M8OH 2GJZA 1QLRA 4R7NB 1J05A 4P4RB 5CJXA 1JGUL 4X6BA 1UACH 5I30H 2AERT 5ICXA 2ADFH 4RA3A 1FNSH 5ACLA 3LKRA 3RZCA 2ZUXA 3V6OA 4YLQT 1H5BA 4QF1A 5IT2L 3HTLX 4ZUVA 3X17A 4OZFG 1QFWH 3X12A 2ZOLA 5FA3B 2FZ3A 4LHUG 4V2CB 4HKZB 5GGQL 2YMXH 4PJAA 1GPOL 4KQ3L 4BUHA 3LV3B 1E4KC 2I24N 4GRMB 2IGFL 5GRVL 4X4YB 4I5BA 1H0DA 3GI8H 1W0VA 1A6UL 3QNZB 4GOSA 3RFZC 1WZMA 3EFFA 3BGMA 3X3FH 3SDYL 1KOAA 4M93B 3O3DA 1CZ8H 2K3TA 3ZDXF 1HSAA 1LO4L 2YC1A 5IHUH 1FFNB 2WQRA 1J1PH 1KEGH 4HLJA 4UQ3B 3QUZB 4H26A 4HWZB 1PLGL 3UTSA 4PJDE 4HPOH 1MREH 3ZT6A 5T1DL 1N6QH 1OW0A 3RWJB 12E8H 5E8NB 4EN3C 3K74B 4PP2A 5T1LA 5EC2A 2CIIA 2P45B 4YDKH 1REIA 2OTUB 3HZYB 4FQ1L 1HNFA 4GS7B 4HXAL 4LDOB 4OUUB 2IPUK 2H2SD 1J0HA 2ILLA 4OT1L 1KFAL 5IW6A 4RDQF 5F3BB 5TPWH 1UB5A 4JANA 4X0KB 2IPTL 4JPWL 5GZOD 4CN4A 3V5DB 5JMOC 4RRPG 2QQLH 2RJMA 1IEHA 4ODUB 3NFPA 2FO1A 5TDNB 5D7KE 2F53A 4XWOD 4G7YL 3IDUA 4J3TA 2NY0D 4WTXA 3S34H 3BHBA 3EJZD 2I5YL 4WV1A 4HJJL 3L3JA 4R96A 1JZ4A 4RIRA 1P4IL 1BAFL 4MQTB 2VL5A 3HE7D 4WNQB 1XF3B 1WITA 3QI9D 2HYMA 1DANT 1XT5A 5I1DB 4C55A 1TVHB 4LP5A 2AI0L 3L3KA 2RHEA 1AY1H 3EHBC 1MCCA 5EU4B 3VXOA 2FH8A 4KUZL 4DAGL 4Y88A 5KAQF 1BIIB 1HHGA 1FDLH 5EO9A 4AG4L 4N1HB 1ZGLP 4JQVC 2NLJA 2DICA 4PV9B 1R3JA 1QVOA 5SWQA 1QRND 4M1CC 4HF5L 1SM3L 2JB5L 3EYVB 1ZT7B 4YAQA 2FX9L 1B2WH 4KC3B 4F80A 4P4KC 4KAQL 5B8CC 3VGAC 3NCYS 4O51A 1RJYB 1X9QA 4I3SH 3TIEA 4HBCH 3JV5A 4JG0H 1UZ8B 3MV9D 2VDRH 1ORSB 3T0EC 2OI9B 1YNLL 4LRIA 1FH5L 1P7QD 2FEDC 3QDGE 5DMYA 2P5ED 2H45A 3O4OB 3P9LB 4FA8A 4OGXL 1DVFA 5IHZB 2V7HB 4FQXD 5I8CB 1BIHA 4MWFA 5D1ZA 4E41B 5DWUL 3OL2A 4XC3H 1IZKA 3W0WB 3AY4C 3HNVH 5D6DC 4M1DL 2VZSA 4YFDB 5GGSY 5IBUG 4OV5A 4GKNA 2H32H 2QSVA 1MCJA 3C5SB 5KSVA 2X4SA 5F7UA 4UB0L 5ICZA 5I76A 5JDJA 4FMKA 2VQ1B 5KSBE 1VADB 3IXTB 1YUHB 4MAYB 1UT9A 2VUYA 4P2OA 3EO1A 1RJZB 1KC5H 4I0PD 4KMTH 2MTPA 1BJ8A 3KPTA 3MOQA 3SDCC 4EDWH 4PJBF 3VG9B 3AM8C 3CSPA 1D9KC 3CFIC 2ZUQC 2NW2B 5LGJA 3U4AA 2VDML 3TT1H 5IROC 3DMMB 5CGYC 4PJ5A 4F7EB 5TQ0H 4E5XB 2DTSA 1SQ2N 4MJ6A 3NACL 1MAJA 4G6JL 2YD4A 3L7EB 3E2HB 4JPKH 1ZT4A 3T0DA 3WJJC 3IAPA 1AH1A 4PIRF 4S2SA 5D93B 2UZYB 3HRZB 3C2SA 3FT2A 3CXDL 3KYMB 4AIZA 1A3RH 1WT5A 3ARDB 5ESAB 2NY4D 3WUWB 4K07A 3T8XA 5JUEL 1C5DB 2G2RB 3PF2A 3VRJA 4NYLA 1U95A 4ODSH 1MQKL 5HHOA 3HLAB 2LTQC 1OARH 3EYSL 4TVPE 5E1AA 1IGJB 3NA9L 1DSFH 2ZCHH 1AR1C 2NX5A 4XP4L 2NXYD 2A83B 2OR8A 2CJUL 2WIMA 4HSQA 4H20L 4MXVE 2BVQA 1P53A 5A2LH 1N5AA 3JSSA 3RTQB 3PWLA 3ZKXC 2VQUA 3VCLA 1S5IL 5DLML 2PR4L 1AI1L 4TSAL 5C0AD 4AH2A 5L2KD 1M7XA 3F7PC 3VXNB 4XC1H 4XBGB 2C26A 5D5MA 2CO6B 2DBJA 2XKNB 4GKZA 1KG0B 3ES6A 3VXUA 5GZND 1A1NA 1A0QH 5J57B 4EEEA 2CKBL 3NFNA 1J9CT 4G9FE 4PY8J 5FYJL 1WZ1H 3RVVD 3IDJB 4QHNB 2AXGB 4N1EA 3ZYZA 3QUMA 5CGMA 1NFIB 2OXHA 2QHRL 3HR5B 4P2RB 2WBWB 3CK0H 5E5UB 4QXGH 4ZTPH 3WHXB 5HHPA 1MEXL 5AWNH 2G60H 3O2DH 3QSKB 1I8KA 5CJBA 4U3CA 4LSTL 1EUUA 1MJJB 2YKLH 2DOCA 5MP6H 5KW9L 2V9TA 3ZKMD 4M7ZC 4N0FA 4NQDE 5J9PA 4KU1A 2CK0H 2EXWC 5HHNB 1C7TA 1A8JH 2CDFB 2F58L 4O00A 4ZXBB 3RGVC 3ALXA 6FABH 1RZ7H 4WY7H 3D18A 4ONHB 1WWAX 4LLUB 1BGXH 2ZUUA 3DNKA 5A2KH 3NPSC 4WO4D 5FDYA 4KVNL 4U6XA 1H3XA 3SDAC 4WU5B 4A6YL 2YPVL 5J12B 3FRPG 3MRNB 2R0LL 2K9UA 5DD0L 5TE4H 3KVQA 4U1SA 3FO2A 2VJXA 3MBEB 4KHXH 3LQAC 4NM4H 5J13C 4G80B 4YHPA 1ZXQA 1U92B 1PBYA 5AUMA 3P0VL 4P23A 4RGND 4QF1B 3SE3C 3HE6A 3CVHB 5CEZE 4KQ4H 3TPKA 2EEBA 4AEHL 3X12B 2FZ3B 5ABDE 1EO8H 3MLVH 3P9MB 3LQAH 3HI6L 4V2BA 3V52L 1WISA 4S1DD 5IESH 5DHYB 5EBWB 1I9JL 5BZWA 2E8ZA 1H0DB 4HWNA 5IMMB 3JWOC 2QQKL 5SWZD 3RJQB 3B5TA 4LVEA 4YHLL 1KLUA 1MCSA 4WW2C 5FYLD 3UROR 3QDME 4IRJB 4O4YL 1E6JL 3BGMB 1JRHL 3MCKA 4XMKH 2R4SH 3MRJB 1XCQA 4OF5A 5E2UL 2V5TA 5HY9B 2HP4A 5F7YC 2IQAB 1SVCP 3F8UB 2P5WD 4H26B 3FT4B 3ZTNL 1NDMA 3JWOH 4X6FB 2RQ8A 2FCBA 5EU6D 1HCFX 5L2JB 1KCLA 3T4YA 1IEAA 1OTUC 4MXWH 1XCTA 3MLXH 4U4BA 3I6LD 4KGJA 1IC5H 4MQXC 4ONGH 3N06B 4X80L 1H3PL 4DKDC 4PTUB 3SKNA 3INUH 4J7RA 5I8EA 5BO1H 2YD8A 3U83A 4GW5B 2DI7A 3RZWA 3LRSA 5AAMA 3CSGA 4G6KH 2VZTA 4TSBL 1PAMA 5IW6B 1HXYA 1MHEA 3R0NA 4FQJL 3DROA 1PSKH 3U30C 5HDBE 3P0YH 5C0CE 4L9LC 1S5HA 2ERJC 3OKKA 4PJ7E 1I3VA 3H9SA 4WV1B 1I8IA 5GRXG 3L3JB 4QRTA 2CH8A 5JPNA 1A7QL 3F5WB 4P5KA 5DJAB 4BZ1L 5KVFH 4Q2ZA 4OB5H 4GXVL 3CFKA 2BZDA 4NUJA 1IAIH 2UUDK 5T33H 5I1IL 2B2XL 4L4TE 3MYJB 3VXOB 2XTJD 2CSPA 2Z8SA 4XCEA 1MCDA 2QADC 5I9QB 1HHGB 2W59A 3IXAB 3LSOA 3QB7C 5BJTA 1CE1H 3V0VB 5FYKE 2BXYA 2DTMH 4XNMA 4K7PY 2XWTB 4WEBH 4M03A 4YAQB 5H8DA 5F89B 4RFOL 2NY1B 1BQUA 4M3JA 4M02A 2GQHA 5IVOA 3LPGA 4MCZA 3LN5A 3RAJL 1DFBL 4PJFA 1RVFH 3VXRE 4ZOBA 3CFCL 4HC1A 4Q6IC 5FHAL 3BP5A 4TRPH 4L8SC 3EIFA 1CLOH 3VFWA 1IL1A 4LP4A 3FFCA 1FSKC 5J11B 3JWDC 4HS3B 3QUYC 4UOW0 2CLRB 1TPXC 2ESVB 1IC4H 2VMFA 1RUML 3MJ7B 1OF2B 3EDJA 5E8EA 1CLYL 4G6MH 2FEEL 1EBAA 3KGRA 3D69B 1LK3H 2NY3C 3JWDH 3SE9H 4GKNB 5JORB 4HG4J 3RUGE 5I76B 3IFOA 4JKWA 1YEDB 3HMXL 1QQDB 5C6PB 3MGOB 5MEOB 4ZO7A 5D2NA 4LPCA 3UYRL 2AGJL 3MXVL 4OFDA 5F71A 1B88A 4F58L 3CFBB 1KCSH 4OLWL 4QYOB 5JXAL 1VFMA 2P8PA 3VRLE 4PRDA 2BJMH 2MJWA 3QWOA 2YK1H 1IT9L 2J4WL 2BDNL 4RAHA 2A9NL 5F6IC 5FCUH 1T80A 5C0ND 5EA0H 2Y5TA 5GS2D 5HVFB 5SWSD 4S2SB 1UM5L 1CGUA 2XZZA 5A1AA 4LMQI 3FT2B 4RMWA 3DUHA 5EO1A 3PV6A 5FA4B 4F7PA 1UJTA 4MJ5B 3BEVB 1ADQH 3FB7A 3RI5K 3IJSA 1NBVH 3SCMA 5CSGA 4S1SH 3CZFA 3D2UB 5C0BE 4NBYB 2BVTA 3GSXA 3S8WA 5IG7A 4YWGL 2IANA 3VFMB 2FWOA 5C07B 3WN5A 4HQQL 2X1WL 3ULVE 4LLDB 4MYWB 4XTRD 1CQKA 3GIVA 4WFED 3PWVB 1PVHA 1UJ3A 1JGLL 3HHRB 3SDDA 1HIMH 3AMKA 2GTWB 4UT9H 3ZDZE 3UTZA 1FE8H 1LNUB 1NJ9A 2BVQB 4NZUL 4P46A 5EBLB 3HUJF 3FQRA 4BZYA 3PWLB 3VCLB 2RFXA 3C2AH 4JN2B 1QSFB 1AGCB 3W9EB 3LQZA 5BRZB 1U6AL 5E8PB 4CN1A 5D5MB 4Q9QL 5C09A 2PXYB 4XCFH 2H2SC 2NY6D 1A1NB 3VXMB 3ZHLA 4OIIL 1T1XB 5D1XA 5MI0B 2F54A 5GZOC 4KFZC 4GG8B 1A4KA 4OF3A 2P8MA 4JY5H 3V9FA 4XWOC 3O8XD 3OKLA 1GGIL 1NLBH 3OG6B 4X9IA 3UPCA 3RL1B 2VISA 1NC2B 3EJZC 2YD3A 3JTSB 4YJZL 1SEBA 1C12A 5HHPB 5IEHA 1MFNA 4AT6A 2H9GA 1KIPB 3QFJB 3CUPA 9CGTA 3HC4L 3HB3D 4P0DA 2XXCB 4Y5YA 3KWWA 4F9PC 4E41D 2MWCA 4P5TD 4N0FB 2DM4A 5ITBL 3V4PH 3MNWA 2A74A 4O5LH 4KGLA 5IFJA 1C16B 2ED7A 2Y25A 1OOAA 3U9PH 4P2YA 1YJDL 1H15B 3TT3H 1D7FA 2VXTH 4K3DL 1TETH 3OKOA 3D18B 4JPVH 1MJ8L 2XZAH 2VC2L 1Q0XL 4DFIA 1I1YB 2OCFD 5IR1A 3C09C 3GJFA 3CFEB 3BKYL 5I8KL 4OF6A 4MAYD 4HDIA 3W9DB 4WFFD 4U1SB 1J1OL 4WI3A 5F7EH 3R8QA 4XZUA 1T03H 3O41A 4X5LA 1DBML 4HH8A 4MJIE 2KL6A 4P23B 4R2GB 3S97C 1HHHA 1G7QA 4HFUH 4P48A 1FORH 1FNEA 4Z7WE 3DMMD 2WUBH 1WV7T 3TVMD 4ZOAA 1K2DA 4YBLC 5D9SA 4FTVA 3MV01 3STZB 4C56E 5BXFB 2HH0L 1U8KB 5BZWB 1QLEL 4P2QA 3I85A 1FVEA 1IM9B 2DQDL 1SYSA 2W9DH 4B0MM 4FQXC 1WUNT 4QHUB 3IVKB 3MCKB 1A21A 3ARDD 3R06A 1TTGA 4X7EC 4PJXF 3TGXA 4G5ZH 5DDHA 4BSVB 1NDMB 1CIDA 4C4KO 3T4YB 5DJ8B 3EYFB 4Z0BH 3HMWL 3QXAA 1CLZL 2MKLC 1XCTB 3QG6A 4M4RA 4G8GA 4Z7QE 1JYVA 4I3GA 3CZJA 4PJBA 4PJGB 3FB6B 5I8EB 4I0PC 4ZUTB 3LRSB 1CVRA 1G6RL 2UWEE 1A9EA 3BDXA 3REWA 4NN6C 3HC0A 2AK4A 1TCRA 2J6EH 1XF4A 1ZS8B 3CIQA 1IILE 2X4QA 4OQTL 4V1DA 1S5HB 2AJYH 5F7LB 3V8OA 2OR9H 5CEXA 4XNZB 3QFDA 4UMGA 3PJSA 4XPHL 3H9SB 1I1AA 1I8IB 2ITCB 4KJYA 1IAII 4NQSA 3O3BA 2GKIA 4QXWA 1SMOA 2V2TA 4PJCE 3CDCA 5ETUB 4LFHD 2RIKA 4DGVH 2EIZA 5IP4A 2ZUTA 3TFKD 5TQ2L 2W1NA 4LSVL 4POZC 3CFKB 4ZFGH 4PG2C 4BQ8A 2NY4C 5GJSH 3ZE2E 3AB0B 5IV2A 1B0GA 2EEAA 2PYEA 1Y6KR 3GJFK 3LEVL 1AKJA 4ZXBD 4ZUWA 3B5GA 3QDJA 3GEWB 3MO1B 1XIWA 1TCMA 1FAIL 1IRAY 1A9BA 1G7HA 1I9RH 5F6HI 4CJ1A 1W72L 4NQCB 3MBED 4OSUH 2EIBA 4Y19B 5DR5L 1FNHA 1J10A 5EZIL 1MUJA 1MAML 3RZCD 3DI3B 3LN5B 2JJUA 2DKMA 4L3EA 3ARRA 5GZNC 2OL3L 2XKUA 3BP5B 2DF3A 1U8IA 2DQTH 3MV8A 3QQNA 3VFWB 3QIBB 1QBML 1TTUA 3RVVC 2BHUA 1IL1B 4KRPB 1C5CH 5D2LA 3FFCB 3UTPE 3GMNA 1W2KT 2JB6B 3ULUL 3VE0A 5IEKA 2DMBA 1CXHA 1UXSB 5GS0L 1BP3B 1EHXA 1MCLA 1Q9OA 4AQOA 4ZFFA 2VYRE 4OCRH 5INCB 5E8EB 4HV8B 5BMFH 2FDBP 1HXMB 5EO0A 1FP5A 1Z9MA 1MFEH 4HKJA 4CMMB 3O6KL 1VHPA 3UTSD 1Z9SA 3LPWA 3IFOB 1JMZA 2CMRL 4ZS7H 2XRAH 1CU4H 4WO4C 5BW7A 5AZ2H 5DMIL 4LSQL 2I60H 5T1LD 1G7PA 1X5IA 1A6VH 2L7JA 5DHVH 5D2NB 1BD2A 3EDFA 1MQ8A 1ZHKA 3A6BL 5BQ7A 1NBQA 1I1CA 4OZIA 2RCSL 3UTTE 4M9OA 1BBDL 2CRMA 4AIXA 4PRDB 1T89C 4RGNC 1BOYA 1RZKH 1GGBH 3C5ZA 4JAMB 1K5NA 3ORJA 5ID0A 5TF0A 4TUJA 5F1IB 2X9XA 2FX8L 1DR9A 2Y5TB 5MHSE 4S1DC 1OQOA 5E2VH 2FHBA 4KRLB 3SBWA 4K55A 1HKFA 1KJVA 1HHJB 1PGRB 5DK2A 2G5BA 3MRDA 4OZGE 2CLVB 1DCLA 4FQCL 2EC9U 1ACZA 1J88A 2XKSA 1EIBA 3EJYD 2F8XC 2VLJA 4FABH 3OJ2C 1YEGH 5IM7B 1NCDH 5FFLA 4OZFA 2ZOKA 1UJ3B 3KPNA 5EUOE 2DLTA 5FYLH 4LHUA 4O02H 5JA9A 4OD1L 3QXVA 4JFEE 3TPUA 1N0LA 3DSFH 4JFFE 2I9LA 2FO4A 2NY1D 3TBVA 5FOBB 4ZTOL 3STLA 2WWKO 5D1QB 4S10A 1XF2A 5C09B 5FM4A 4HT1H 4PJ9A 2ITDA 4H0GA 1OPGL 4NZRL 3B9KA 3CDGA 1I85A 3TV3L 2F54B 3N50A 4Z7VE 4BELD 3DXAE 1H8OA 3CH1A 4DTGL 4W6YB 1A7NH 5ILTH 3J7HA 3OWEA 1QR4A 3LRGA 3ARSA 2LU4A 3NCCB 3BP7B 3CMGA 3Q0HA 5MEPA 1JWUA 2E27H 3SQBA 4M7LH 1OB1A 1C12B 2R2CA 4IDJH 4AT6B 4Z8FL 5KANI 1RUQH 1V3MA 4UINL 3WEXA 2PCPA 5FOJA 4HS8H 5JW4M 5F96L 4DUXA 1RY7B 3KNBB 4G43B 5EWIL 2XTJC 1S9XA 4K8RD 4OCSH 1AO7A 1MIML 1SJVA 5IWLC 3WNPA 1WFUA 4RRPA 2EIEA 4X6DE 4PD4K 4OLXH 4LASH 1IEBA 1YEFH 1QSEE 3GJFB 1MFBH 3ZE1F 1IBGL 4ZAKC 2P7TB 2EYRB 2BFVL 5T3ZE 4TULL 3S4SG 4KV5E 5F7KC 4NNPL 4TSCL 4PJIF 1X7QA 2IJ0C 3KXFE 1G7JA 5LGKA 4H5SA 1BMGA 2VE6B 1HHHB 1G7QB 4XP1H 3IU3A 1TJGH 2UZXB 4O2CA 5CBEB 4L8CB 3NIGE 4PJ8A 4PJ5D 5IB4A 3MRHB 1U8HA 1K2DB 4LLMB 2EDYA 1EEUA 5D9SB 5HTSA 7CGTA 4GUPA 4HXBH 3LEXB 2V2XA 3W82A 3GDBA 43C9B 1WFNA 4P2QB 1T7VA 4MS8D 2GFBB 1L0XA 3PGDB 2VXQH 1OAZH 4EUPG 5HGDA 1QSZA 3BUYA 4Z7NF 1HZHH 1G7LA 5IKCA 1CFNB 1AP2A 4ZFZB 3R06B 4PB9H 5FUZL 1E4WL 3BI9X 5E2TH 4M93C 5KG9A 2V5SA 5E2WH 1RK0B 1YYLL 1ZHBA 4KROB 2DLGA 1KCVL 2P1YA 4NT6A 3QUZC 5EC1B 3M1BB 3OAUL 4R90H 1FZJB 1OCWL 1G9NC 4G8GB 1QNZL 5BV7B 3F7YB 3GMQB 3ZMRA 4ZMAT 1YNKL 3VW3L 4P2CG 1UC6A 1CGWA 1ODAA 1P84J 4GS7C 4DWHA 3MRQB 1JBJA 5IFHH 1A9EB 1FGVH 5IBTL 5TJWK 2PXYD 3VXUD 1MWAA 2VXVH 5DJZB 1G9NH 2XY2A 2X4QB 3TZVA 5I1AA 3TCXA 2FBJL 3RWGB 3PJSB 4XAKE 2CR3A 5HHME 5F7DB 3HC3H 1BFVH 4NQSB 1KPUA 3STBA 2DD8L 1TITA 5MENE 2MNUA 4JRYE 3V4UL 1JHTA 3KPSA 5IMOA 3I02A 3QFJD 1QA9A 3V2AR 1CBVL 1P7KB 1NLDL 4JGJA 5I2IB 1Q8MA 1DEEA 4DK6A 1F11B 4OLYL 3ROLA 5C0RL 5KVEL 4X98B 4Z5RA 5GS2H 1LE9B 1AKJB 5I18L 4WI8A 5GGTA 4U6VL 4ZUWB 3TO2B 1MHPH 4UZGA 4HX1A 3QG7L 3L5XL 2PO6B 4XTRC 2XN9A 3MUJA 3NAAH 4PJDF 2H8PA 1YMHA 3DO7B 2YEZA 3HUJA 3GI9L 2W91A 4JZOB 2OP4H 1Q72L 1XZ0A 1CL7H 1SBSH 3FQTB 3TN0A 4AEEA 1WBXB 1WZKA 5JR1H 5ESQA 3KHQA 5HI5D 4P23D 4R2GD 1W72B 2O61A 1KJMA 1RZ8A 3HE6D 5JW3H 2FB4L 2DQCH 3MV8B 2UYLB 3I6KB 1A6PA 3BDYL 2HKHH 2OI9C 4ELMA 5AG9A 2EE3A 3MCLH 3UBXB 3GMLB 3O8XC 3GMNB 3C9NA 3QR2A 1MI5E 2E6PA 2O5YH 3SJVE 4J12A 1IAOA 5TH2A 3S5LB 4S1QH 2R56H 2W0LA 3O4OC 4HKBA 5KVDL 4PRPA 3RWEA 3MV7E 4ZSOE 2GYSA 3HB3C 4YHML 4CKVX 5D7LA 1DQLH 2FR4B 2Y06L 3PDOA 2ZCLL 3N1FC 1QYGH 1JUFA 1KENL 1GHFL 5GRUH 4JDTH 3MOAL 3O3AA 4KHTL 4XVTH 5HYJA 3FO1A 4TTDD 1G7PB 2OJZL 2L0DA 4MAYC 3EYUH 2Q8AH 1BD2B 2AW2A 4LCCB 1DQML 1ZHKB 3MUGA 1KPVB 3MODL 4NQXA 1NUNB 1QFWM 2R0ZL 3DETD 5F6HJ 3VG9C 4URTB 4ZYKA 3BISA 3FO9A 1NAKH 1YMME 3UTOA 4D3CH 1NL0H 1OQXA 4IRSB 1NMBL 3WIHL 2IMMA 3C5ZB 5F21B 3DMMC 4TUJB 2VAAA 2AABL 2UVEA 3FQUB 3IFLH 5T5NG 3UAJD 4F2MB 1VCAA 1CICA 3GO1H 1F58H 3E2HC 4L3AA 4YR6B 3SHSA 5JIPA 3H9SD 1OAQL 3LVEA 4MAUL 3FRPA 5D93C 5J6HA 1CFSB 3KR3H 1NAML 2G5BB 4ISVB 5DK2B 3S36L 3ZTJH 4FXGA 4GSDH 3MRDB 5J1TC 3QEGL 4R6UA 3OX8A 4QXUH 3ARDC 3MLYL 4PJXA 3BIAX 2WMPA 4MNGE 4LSPH 5FO9B 1AGDA 1ES0B 4ZFOB 2F19L 3QHFH 3ET9F 4OZFB 2ZOKB 2F53E 3QEQA 4RGMC 5GGSB 4FFYL 4LSSH 5F3HA 4OKVA 1NANI 4NQEA 4D0CA 3MREB 1QEWA 3SKUD 1S8DA 2GJ6B 1KCRL 3D3VE 3TBVB 3C8HA 2D7TL 3RTQC 4NQCD 3STLB 4N90E 2M8XA 4LLVA 3VG0H 4G7VH 1FNGB 3ALPA 3HPJB 5D96B 4G8FA 3DRQB 2APBA 4MX7A 4Q9RL 2ARJA 3FOLB 3B9KB 8FABA 4JM2F 5F1KC 4DUVA 4Z77B 3UPRA 1ONQA 2EH7L 2J8UE 3GGWB 1KACB 4MA8H 1M05B 5C70A 3QIBD 2DB8A 35C8H 4U31A 4KRPD 3FFCD 2AEQL 43CAB 2H1PH 1F8TL 1ZGLM 4ZNEA 1ZEAL 3ARFA 5CD3B 3VMPA 2WUCH 4XMLH 3B6SB 4LKCB 1UM6L 4UTBH 3P11H 2FJFB 3U4EB 1CI5A 1ND0B 1MCPH 3E6HA 1XGUB 1LO3H 1UKQA 4HIXL 1IGCH 2H3NA 3IETB 4ACPA 1E4XH 4YQXL 3FQNA 3IDXH 3P0GB 5DD3L 5FO7B 5HI3D 3QPXL 1ZMYA 3BZ4B 4H0IA 5DEZA 1BPVA 1FO0L 4POUB 1F4WH 4NCDA 4ZXBC 4WWID 1K8IA 2DKSA 4KI5E 2VUOA 2HG5A 5DUPH 5DUMH 1I7UA 3UC0L 4Y16A 4YBQD 5J12C 4MXVF 4XVSL 3AGVA 5D71H 3M17A 2JJVA 1WF5A 1HH9A 3L3OA 3MBEC 3NVQA 1RMFH 3BZFA 2DKUA 5HHVL 2WLZA 4YX2H 1ZLWK 1I3UA 4H5SB 5GRJL 2E7CA 3RZCC 2VR4A 1WAAA 2I27N 2EDXA 3V5HA 4J2XA 3LKSA 4EXKA 5IB4B 3VWJB 2MFNA 1U8HB 1NCAL 5ALBL 4YHIA 3TJEL 5I66A 3FHQA 4FQ2H 4OZ4A 5JHDE 4LVHB 3L1OL 3T3PE 1TZIA 3WXWL 2W9LA 1J8HA 3HI5H 4KZDL 2FL5A 1FV1A 1AGFA 3VGBA 4PY7B 3CVHH 1N5YL 4CDHA 1DLFL 1G7LB 2W0FA 2BVYA 3HAEG 3L3GB 3IDGA 3GHEL 4IRJC 2FGWL 4MZ3A 5CGTA 5JOPD 1JK8A 2V2WB 1X6NA 1MCKA 5KG9B 5DFVD 4RMQA 1BVKA 1HH6A 2CR6A 2L4OA 4PJ5E 1YEHH 2IAND 1MCHA 1MH5B 4NT6B 3D9AH 4RGOH 2R2EA 2R4RH 1LDPL 2JJTA 5E94A 1YECL 5E8DL 4ZPTB 4P46D 3FOMA 5BZDB 1IM3A 1G9MC 4HS6B 3GSOA 3M8OL 3EUUA 1ZAGA 5E95B 1UACL 1H3UA 3I3BA 3VGFA 5FO8B 2ADFL 4HUNB 1OGAA 4LSRH 4CW1A 5EZJB 1BEYH 5D1QD 5C2UB 1J8KA 3L3IA 4HIEA 4U1MB 5C09D 1A6WL 2JJSA 2WIIB 5I1KH 2BY2A 4NKDA 1HHIA 1NQBA 3OKMB 5GPRA 4RA0C 1FVCB 2F54D 1G9MH 5HHOE 3TZVB 4GRWE 3V5KB 5I1AB 5I75B 5IBUB 3FZUD 2NX5E 2VXSL 5C9JA 2F8VA 4K2UH 4XGZB 5DSCA 2CK2A 1KPUB 5E7FA 3GI8L 4WV1C 4BM7A 4OD3H 5EORH 5DXWA 2B1AH 5I16B 3I02B 4APQA 1IZJA 5H2BA 1NCCL 1CZ8L 2ZUYA 3TNNA 2J88L 1FFQA 3VXUE 5IHUL 4WUKH 1J1PL 2EE9A 3EAKA 4JCMA 5CUSH 2Q7YB 5I1GH 1EA9C 2Y36H 5BVPH 2NNAA 2YWYA 1X4XA 3MROA 4KPHH 1N6QL 5I9QC 3N1QC 4N8VG 4WUUA 3PHOB 1CL7I 2YEZB 1RZGA 2IAMA 1GH7A 3QBTB 2W60B 4RMTA 2J8OA 4KMQA 2NY1C 3SO5A 4OCYL 1ZT1B 3CLEH 1D5MA 3VXPB 1KJ2B 4NBZB 4UIMB 5ESQB 3VD3A 1PQZA 2O61B 1KJMB 2C9AA 1URLA 1DEDA 5C2BH 1I8LA 5HDBF 3PABA 4JKLA 3H9ZA 2ORBH 4DOHE 1MJUH 3MJ9A 2Q8BH 5IIEB 2LU7A 4PJ7F 2X5PA 2Z35A 5T3ZL 4P2QD 1DQDL 5J11C 1QFPA 5LQBL 4YHNA 5F9OL 5F7MC 4GW4A 4XPFH 1A3LH 3IGAA 1JGDB 1AY1L 3BEWA 3EDDA 2ED9A 4ESKA 5DZOA 1FDLL 1JPST 1JUFB 3QIUA 4K8RC 1ZGLA 3Q3GA 3ARWA 2UVFA 2J3SA 3O3AB 3WLWD 1ORQB 1FZMB 4MGXA 5HYJB 5HXMA 4CVZA 4G8GD 3FO1B 5DD1L 5HGBA 5LXGL 2O5ZL 4BKLA 4D8PB 4PJIA 3MRGB 4JFDE 4K8RH 4OCNC 5KSUB 3HZMB 4IS6A 2MCPH 4ZYKB 3FO9B 2VDRL 2VDLH 4LU5L 5CEYA 3PIQA 3V79C 5I1LA 5I71B 4MB4A 1T2JA 5K9KA 2F74B 4V1DD 3NTCH 4JDVA 3EOAA 4JKKA 4U1HA 1T21B 1U3JA 2ZUWA 3D0LB 5TE6H 5IQ9A 3IKCA 2CDGA 5K9OB 1C1EH 3GB7B 3VFSB 5HGHB 1Z9LA 3ARGB 3MRFA 4MS8C 4ALAL 1UEMA 4FQHA 1F3DH 3ZYOA 1HEZB 3MACL 4M8QB 4PGDB 2HJKB 1WT5C 2EEDA 4N8CH 5D70H 3HNVL 1I7RA 4K3EH 4QNPE 2D0HA 25C8H 5FB8B 3LMJL 4O58H 3THMH 2HMID 1UWEH 4UOJA 4PRBB 1AKJD 1KT2A 3VXSB 4ELKB 3A6CL 5ACMA 2O5XH 4WHYH 4CU7A 3MJ8A 2PO6D 3RUGF 4F7CA 1ZTXH 1AGBB 4NRZB 1AIFB 1XIWD 1S8DB 5GS1A 4NN5B 1XGYH 4KMTL 5B38G 1GIGH 5T5NF 3SQOH 3MLZL 4LLVB 1U8MB 1ZV5A 4JFPB 4MCYA 2X4OB 1HINH 1FG9C 3QXTA 3WKNA 4M6OH 1M6OB 4YHYB 5F7FA 1JF1B 2ARJB 2PXYC 4L3ED 3RKDD 3W2DL 2C3VB 4LK4A 3VRLF 5JNYA 5T1MA 3UPRB 1ONQB 5MI0C 3MV8D 3LKQA 1FYTE 3GRWH 4JPKL 1VSCA 1GGCH 4GG6E 1ZLUK 5A40E 2GT9A 1I3GH 2EE2A 3Q6GH 3HMXA 1A3RL 1G9EA 5DFTA 2DLEA 1OLZA 5IMLA 3GMOA 4XI5C 1T0MA 1MHCA 1D5IH 4Y4HA 5C0IB 2X41A 4M6NH 2DI8A 4ODSL 5HBBA 4PJFE 3SO3B 1OARL 2Y72A 3QEHA 2XPGA 3RVXD 1NDGA 1DSFL 1RIHL 4JFQA 5FYJU 1S7QA 1A6ZB 1K8IB 5BCAA 3GM8A 2DAVA 3ULVF 1T5WB 3VFVA 2ZJSH 3U0TB 4Y7MA 2MCG1 3ZDZF 4ZDHB 4M9PA 3M07A 4XCYA 3M17B 3OXSA 1BD2D 3NFSH 1HH9B 2ICEA 3MA7B 2UUDH 1A0QL 1T1YA 1UQSA 2BRQA 5HI5C 1NMAH 4P23C 4R2GC 3TC9A 1U8PB 3LKSB 3RVWD 3C5ZD 2JF1A 3G6JB 4U7KA 1YY9D 4OZ4B 3UX9B 3CK0L 1TZIB 1JI2A 2XYCA 3K4ZA 4ZO6A 4QXGL 5I17A 1UB6B 5DI8A 4J3SA 1FV1B 1IAKA 3RNKA 2G60L 3O2DL 5J7CC 1DDHA 2XZQH 2YKLL 5MP6L 2W0FB 2C4XA 5EZOL 5GJTH 2CK0L 4PG9B 2ZSWB 5I1JH 6FABL 1VKXB 4Z76A 4WY7L 1BVKB 1HH6B 3I2CL 4EDXB 2X9YA 3TEUA 1BGXL 5C0FB 3IDMB 5CKGA 1Q9LB 1DUYA 4JR9H 4LHUD 3FB5A 3FOMB 4QOKA 3QWRA 2GJ6D 3DX7B 2M26A 4NM4L 3RY5A 1FIGH 3BIKB 2DQFB 5CIPB 3DIFA 5E0QA 5AZEH 2B8OT 1HQRA 2BXZA 1IQWL 4XBPA 4U1NA 3L3IB 1G0XA 3IDIB 3DETC 4X8JA 1AFVH 4PJ9D 4WI6A 3B9KD 3GSVA 3DTXB 3OKNA 3MLVL 2I9TA 4Z7WF 5CJOH 3LQAL 5LAXA 5IW1B 5HVWA 3KYOB 1S7SA 4D0BA 3VDCA 1YPZE 2IFGA 1KN2H 3UAJC 1GC1C 3MLPA 4XNZC 1CFQB 3CU1A 4FXLA 2E7MA 5E99H 3GSNB 5ITFA 1R3KB 1JV5A 3VFNA 1TVDA 4MD4A 1J86A 3F12A 2R4SL 4HJGB 1FZKA 2VDNL 3T0VA 1T0NB 2XICA 5H2BB 1X5KA 5C08E 1BBJA 3D85A 3QXWA 1A7BA 2GUOB 1MRCH 1A5FH 5DJ0A 5KS9E 2YUXA 3AB0C 2PW2A 3JWOL 2WBKA 1AO7D 3G5VA 4U0RB 1ZVYA 5FKAB 1WFTA 4MXQD 2D9CA 1NBZB 3MLXL 1S9KC 3OHXA 4WI5A 4JFOA 1IC5L 1U8NA 5KSBA 1K4DB 4ONGL 2IAMB 2IPKA 4OQ1A 3U1SH 4WEMB 2EC8A 1WTGT 4Z7QF 1D5ZB 1VPOL 1YY8A 2OLDA 4OCXL 4J3VA 5JXED 5IJKC 2GSIA 4M43H 4G6KL 3FTGA 4KTEH 3NZ8A 3UP1A 4JM2A 1BLNB 4R4BA 1CGVA 2UWEF 1PSKL 3TYFA 1EFXA 5DEGA 3P0YL 1N3NB 1LILA 4NJAH 5ICYB 3G5ZA 4PJ8D 1KB9J 1T6VN 3WS3A 1CE6A 1RZJC 2Y9RT 1KTLB 1U8JA 4LHQB 3QIBC 4ZODA 4HUVB 2HFFA 4EN3B 4KRPC 4KKNA 3ABZA 4LF3B 4NO0B 5SV3A 4HBQA 3QXDA 2X4NA 1W8OA 2GITA 5CSZA 1BZQK 3D39B 5FDWA 4PJCF 4K3JH 2VLKE 1SY6H 4HC1H 4OAWA 3MNZB 1IAIL 5T33L 1GL4B 1RV6X 1RZJH 2QKIB 4K71B 1XF5A 1G6RA 4Z6AT 3BPLB 4EIZC 4XNYH 4LQFL 3ZE2F 2YR3A 3QIUB 5HI3C 1R0AH 1ZGLB 3Q3GB 4LNVA 5DJDB 4Y4KB 3TCLA 3TO4B 3FB8A 4XHJD 4PRHE 2DJ4A 4FTVE 4JHZA 2DTML 4WW1B 3AXLB 1UKTA 1V3JA 2KBGA 4L4VE 2HFTA 4WENB 1MELA 1F6FB 3W39B 4D9LL 4WCYH 1HOCB 2R1YB 5D2NC 5D6CB 1CFTB 1KLGB 1WTLA 4IS6B 1NCWL 1RVFL 1CD8A 5CEYB 3OGCB 2P47B 4LKXA 1UWGL 4O9HH 4TRPL 4UTAH 5BS0A 3MBXL 4G9FA 5K9KB 3LB6D 3TZVD 1F4YL 1QLFB 3U0PA 3G5YA 1FL5A 5F8QC 2FLRT 3DRTA 4OLVH 3GSRB 5L6YH 5AD0A 4FQHB 1IC4L 4K9EC 1KIRA 1K4CA 4OLUH 3KPSD 5TDPA 4G6ML 1JNJA 4P9HC 3U7AA 4X5XA 4GAYA 1PZUB 3JWDL 3SE9L 4BZ2H 2HVJA 2AK4E 4Y8DC 5IB3A 5DFVC 4NCC1 1QO3A 2OL3A 3U82B 1KT2B 3OQ3B 3ZO0A 4K9EH 3T4AA 4FZ8H 5GRYA 1ZA3A 1M7IA 5JDSA 3DI2B 1I7ZA 1UJ3C 3DHJA 4TNVF 1EPFA 4CL7A 1N64H 4JHWH 3QQ3A 4P9HH 3WL9A 2ED8A 5GS1B 4P46C 2H32B 2OZ4H 3I6GA 2FATH 3WIFA 3F58H 5EU7C 1XH3A 1CYGA 3VFRB 4EUPA 1KCSL 4LSUL 4TUOB 5E70A 5D1QC 5DJ6A 2IQ9H 2BJML 4UI2A 3T09A 2ATKB 1LO2H 5EBMA 3O3UN 2YK1L 5DK0B 3F7VA 3U36B 2XFXB 2PYEE 3LKQB 2OTWA 3P4OB 4PRIB 3QDJE 1JZ3A 3FZUC 2EDFA 3QO1B 4RMRA 5DZNA 3LKOB 1M1SA 4YDVB 1KEMH 2GW5A 4JPIA 1JWMB 4W81A 1MVUB 4LCYA 1ADQL 4FQQA 5F70A 1X44A 1NFKA 5GIRA 4L29A 4Y4HB 5AAWA 3Q6FA 4S1SL 5D7LD 4G3YH 4OZGF 3O6FA 5JOEA 4MZ2A 4KK8D 2DIJA 2YD5A 1A64A 4WRLA 3SGJC 4JFQB 1UA6H 4PJDB 3FONA 4YNYA 1HIML 2VLRB 4UT9L 3JUYA 4L8DB 4XP6L 1LD9A 3HCVA 5D2LE 5EUOF 4YFEA 1M71A 4R3SB 5HYJD 3BSZH 3CH8A 3ESVF 4UT7H 1OSPH 3C2AL 1I9EA 2OM5A 3WFBH 3QRGL 5GGRY 1KB5A 5F1NA 1ZWIA 1JNHA 4XCFL 3OJDB 4OBRA 2BOBA 4IMLB 4M1GL 1A4JB 1T1YB 1SBBA 1QHPA 2NW3B 5C86A 4LCIL 2NY2B 4BQ6A 3GJFH 5C0CA 4JY5L 4CVXA 1TQBC 3DX8B 4Z7VF 1MF2H 1I1FA 1HHKA 4M5ZL 3ARBA 4XCNA 3MC0A 2ZG1A 4ZUUA 5I17B 1QHOA 5A3IC 4ZO9A 3QHZH 1EZVX 1IAKB 4QRQA 3RNKB 3ZKXB 1AD0B 1JWSA 1T2QH 1XR9B 1CG9A 4A2LA 1DDHB 3QAZB 2AJSH 1QKZH 3GBMH 1DL7H 5SX5K 3ZHKA 4HJ0D 2MMXA 4JJ5B 1D6EB 4AL8H 4EVNA 3CD4A 3V4PL 1CGTA 4YPGB 3FFDB 4JZNA 4O5LL 4L4TA 4OZIE 4L3CA 4JM4H 5D72H 3FO0L 3KLHD 1U8QA 4PYGA 4RBPK 4X7TA 2IH3B 1HKLH 4JDZB 4J3OC 3PXHA 2EC9T 4NO5A 1UXWA 4JPVL 1DTUA 1T1ZA 4KROC 3HNTH 2GTZB 4KK6C 3PWUA 3QEQD 4KWUA 4X6DF 3DX6B 2VSCA 2MQ3A 3DVNA 2CUMA 4JRXB 1HNGA 5DJYA 2HT2D 1NFDB 5F7EL 5BV7C 4KRMB 4BQCA 1BWWA 3JV4B 3WLBB 1HQRB 4GKSB 4HHAA 5EH1A 4XBPB 4KV5F 3QIWA 4HFUL 4DFHA 2IC2A 2R2HB 5ACZA 3FN0L 1W0WA 2WUBL 4WFGE 1GGUA 1JPFB 1ZVHA 3OKNB 5E8OB 3MFFB 3T3ME 1AJ7H 2VLJE 3NIGF 3UYPA 5BV7H 3T2NH 3NPSB 3QDGB 2D7QA 4D0BB 4HK0A 4E42A 1PJ9A 4U1GB 3KS0H 2ICWB 2R1WB 5E7BA 2BC4B 3NABH 3ARFD