4DOHE

Il20/il201/il20r2 ternary complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
204
structure length
204
Chain Sequence
b'KPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYARVRAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-20
publication title Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 37
structure length 204
sequence length 204
chains with identical sequence R
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohE01
5E99H 3C5ZB 4YDLC 1ES0B 2MCPL 5AG9A 1MJ8L 3LY6A 2DM3A 5FXCH 5BS0E 3SPVA 1RQ5A 1C12A 2RJMA 3TBYA 1KBGL 2C3HA 1CLYH 4X6FA 5KAQG 1I3GL 1A3RH 5FKAB 3U0WH 1FL3A 3QO1A 1YY8B 1KJ2A 3TO4D 3BN9D 4F33A 4YDKL 1R3JB 4S1RL 5DT1L 5T1MB 5C0EB 5K9KB 4FFZL 1UXSA 4HKXA 1S5HB 3FT4B 1DTUA 4MJID 3L3OB 3VI4F 4I0PD 3RWDA 4JR9H 3KPTA 3JV5A 5DS8B 5FDYA 4JQVA 4CNIA 4R2GB 5DRWA 1I1FB 1SYSA 1X4YA 2YR3A 2ZNXA 1EEUA 1L6ZA 1XCQA 4PJFE 4L4VA 4YIQB 1BIHA 1A4KB 4QTIH 4GKNA 1HYSD 1YEDA 3PG2A 4GRLC 3V0AC 5D2NA 5DMGC 3MNWA 2A6JA 4Q2ZA 3G9AB 2IH1B 4X6CB 2FR4B 3SKJL 1XF3A 4OFKA 3BP6A 4P5TB 4P0DA 1PSKL 5GRVK 2P5WD 3CX2A 2Y07L 4OZHB 3KPRE 2VWEC 4LHQB 3Q6GH 1IGIH 4XMPL 1UM6H 3MMEB 4QHUB 2HMIC 2VABA 3NCYP 2X9YA 5T1DH 5KG9B 1CVSC 2A73A 3G5YA 3OAZK 1JZ4A 5C0IB 1BM3L 5LGHL 3UJTL 1GGBL 3AVEA 4NFCA 4NO0A 3BPOC 4F7CA 2Z9TA 1MCEA 3RUGF 5C7XH 1UKSA 2UUDH 3GI9H 4PB9L 4BQ6A 2YXMA 1OWRM 3QFJB 1LVEA 3DNKA 5DZLA 1FG2A 5K9OB 4JVUA 5HGDB 3L3DB 2JK5B 4FQCL 3WFEL 1HHHA 1WBXA 3O3DB 4YHNA 2BERA 3KYMA 3MBEB 4AEEA 3C5ZC 3MRHA 4UTBH 3OAYK 4XC3L 1HQRA 5DQ9B 5L0QB 3MJ9L 2OQJB 5TDNB 4M4RA 3OF6A 1MJUH 5C0NC 4QRQB 5C8JA 1EHXA 3QPXL 2FX8L 5EB9A 2CGRL 1NFKA 3V0WH 1DANT 5L2KD 2ADGB 4L1DA 1ZLUK 3L3GB 5KW9H 3HZVB 4PGDA 1QBMH 5BMFH 1WEJH 3I3EA 4KK6D 1OTTC 1V7NL 1BLNA 3HZMA 4R2GC 5DJZB 4AY0A 4NZDA 1MFAH 3ARUA 4K94L 1EGJH 5DJXB 4QRRB 1PW3A 1BIIA 3GBNL 3QIWA 1FV1A 4YK4B 5DWUH 3TJEL 1AGDB 3GSOB 2XWBA 4WWKB 4PRPB 5C0AB 3L3HB 2FYYA 1IZJA 3PL6D 3T1WA 4LNVA 4E0RB 4P5TC 4NM4H 2VKWA 5GIRB 1JGUH 1CFNA 5DJDB 3TVMA 4L8SB 1NBYB 1O7SA 3TN0D 1LO3H 5I1GL 3D18B 1AIFB 1B2WH 4WDIA 5GZND 3I6KB 4S2SA 4DW2L 5IEKB 3S5LG 4YX2H 2LE9A 4HS6A 4WI2A 4PJCB 1IAIH 1BFTA 4PBWD 2J5LB 4C56D 2GTZB 5JIIA 4MNQE 3RWFB 1RJZB 3W9EB 1XIWB 1NMAH 1ONQA 2BK8A 2R4SL 2DDQH 2UWEB 4NO5A 3MV11 5D1ZA 5EUOF 5IB5A 4U6VL 2YD4A 1LK3L 4UV7H 5DJAA 1P1ZA 4G5ZH 4JFFE 1KJVA 1WBZA 4G6AC 5D7SH 2CMRL 2R2EB 5E7FA 1I1RA 4WUKH 3T0EB 1EDQA 4M43H 4X6DA 3VFTA 4AK1A 3MBEC 1LK2B 1UWXK 3SE3C 4Q0XH 5E5MB 5T33L 4PGCA 1Z2KA 4RGND 5L0QC 3LQAL 4X0KA 4JY6B 5FIEA 2Q8AH 1CGVA 4TNWK 2PCPB 2VQTA 1IGFH 4WU5B 1R5IB 1MCLA 4M9OA 4AIZA 1VPOH 4ZD3L 3VWJA 2BSSA 4OLYL 3CH8A 1CDGA 3HG1B 3JWOC 1E6JH 1JRHI 4JQIH 5L2JA 2EYTA 3BIAX 2H1PH 4AENA 4WEUD 2LFGA 5AD0B 1XGYL 4EUPA 5GGRA 4YGVB 4PRBA 3QQ9D 5ALBL 1NKOA 1U6AL 3T0XA 2YPLE 4YK4C 2Z35A 4BH7A 1J10A 5CILL 4MQSB 5GRUL 3RA7L 1N3NA 4Y4HB 4L8SC 4PRIA 1U3HD 5EA0H 2YEZB 4P57A 5EO9A 1ZTXH 2XN9A 3TBTB 1TZGH 2CLVB 3OHXB 4KI5F 4WO4C 5C86A 4NBZB 1AGBB 5I8KH 5TFSH 4YDVA 1WWBX 2J5LC 5F96L 2ZCHH 5D7JD 4QRPB 2R1YB 3VG0L 3IDIB 5I1HL 1XIWC 1DDHA 1Q9WA 2RIKA 1G6RA 2UZIL 1CD1B 2QQQA 1JF1B 1RZFH 4X6CF 1I8IA 5KANG 5DHVB 5HI4D 4J4PD 3CMOL 1T83C 3M1BA 3NA4A 4OZHF 1RIUH 5DK0A 4EZMA 4ODSL 1XF5A 3OGCB 3SE9L 4NZTL 1DSFL 1PYWB 3WIFA 3D25A 5C2BH 3BUYA 3TZVA 1KEGL 1M1SA 3WFBL 4EUPH 2PTVA 1BVKB 4ZS7L 4LVNB 3MXVH 3VFUB 4Y88A 2ITDA 1T7VA 1U58A 3PDOA 4OCWH 3O3UN 4KQ3H 2FX7L 4OLXH 4P4RA 5T1KB 4GAGH 3BZ4A 2H6PA 3MLZL 2B7DT 4MCZA 5H8DA 4MNHA 2BHUA 5BW7C 5I8CA 1SY6L 1FFOA 1LO5A 3EOAB 3PJSA 5E03A 2D03L 2VLRD 5CKAA 2DQEL 1LO0L 4YLQT 4PJ8A 2I07B 1Q9LB 1ZAGA 4YHLH 4D0CA 5IM7B 2CK0L 1T03H 4JLRA 4XC1L 3GMMA 1A3LH 4Q6YA 3VXNB 1UXWA 5FK9A 5FA3B 5TQ0L 1VFAB 4UV4H 1BHGA 1I7UA 2CDEB 4Y4HC 4F2MB 3MYJA 3CSYA 3TT3H 2ADIA 1FFPA 1TFHA 4JRXD 1QLEL 3AXLB 5D7LB 1MI5A 2GSIB 4W6WB 3JV0A 5D2LE 4JG1L 2DL9A 3PGCB 2ESVA 5HHVH 4JO3H 1DQTA 1I1YA 1F4XL 2WW8A 1TNNA 3E6HA 5KVFH 1QRKA 4ELME 4XBPA 1KXQE 4RBPK 2GKIA 1GZPA 3TLRA 3EYSH 4OD2B 1S5IL 4RX4A 3GKWH 4I8DA 1CDYA 4LLWA 4U31A 1G7HA 4DCQB 3B8YA 3DV6B 1OL0A 4U0RB 4PUBH 2V17L 4K3JL 1NANI 1CICD 1QLRB 3GRWH 4PJCF 1KC5L 3LN5B 2AABH 3ARBA 1JGEA 2VE6B 1IEBB 1U42A 4MHHG 4LVNC 2FHFA 2BHZA 2UWEF 4KDWA 4XHQA 2QKIA 4F7PB 4U3XA 1GH7A 5ITFA 4N0FA 4YFDB 4XP1L 1ZVSB 4M00A 3K81A 4OFDA 3WEXA 5ISZD 3OPZL 3QA3B 3QUML 1RUKL 1WCBB 1OAZH 3CU7A 3TC9A 4G9DA 5JXED 4WFHD 4LVHB 4XPBL 4NFBA 4ONHB 3AS2A 2ZKHH 5INDA 1IEHA 1WICA 4MAUH 1JI2A 1IEAB 2G75A 5DUML 1FGNH 1RJLA 4Y1AE 3SOBL 5I30L 2QQLL 4LHUD 1RZ7H 4UNVA 2H8PA 3N1FC 2VXVL 5IUSA 1NFIA 3ELAT 1X5LA 5I1DA 2CXGA 2AJSL 1KTDA 4IDJL 4HEPG 3CFIC 4M7KL 3KJ6H 2ZPKH 1AP2B 1PZ5B 2BX5A 4KKCC 1F13A 2HJKB 4XNZC 3H9HB 5FYJH 1JHKL 1P4IH 1X5JA 5ITBH 3ULUE 2EZ0C 3BZEA 3T3PE 5B39G 3HE7D 4Z5RA 4DZ8B 3S88H 1YMHA 3CPLA 4P46A 2H41A 3GSUB 2BOCA 4LSDA 3TIDA 4NKIH 1T7ZA 5INCB 3V4UL 3HZKA 4L4JA 3UBXA 1K4DB 2DBLL 4QXGH 5DO2C 1J1OH 3PWLA 4J3OC 5KZCB 1ZLWK 1EJOL 1PLGL 2Z4QA 5KVEH 3KXFD 4LARL 3KPNA 3WKML 3VD3A 3SPVB 4A2MA 1C12B 4X4MA 3TBYB 4GRWF 1JVKA 1CS6A 1FL3B 5E5UB 1U91A 4F33B 3T0AA 1IAIM 2XTJC 4EI6A 4HKXB 3VXMA 2H2PC 4LVHC 4HH8A 3RWDB 4P2QD 1ACYL 2UVFA 4CNIB 1TVBA 3DYOA 5DRWB 1JK8B 1SYSB 3RNKB 4MWFB 1T20A 5HYJD 2Y72A 3K74B 3WLWC 3P30L 2B0SL 4L4VB 1T1XA 2VKXA 1FNLA 2D0HA 3IF1A 4GKNB 1INDH 1YEDB 4QCIA 3MNWB 4Q2ZB 3MRIB 3UCRA 3IDMB 4R4NC 1XF3B 1A3QA 1F4HA 5F7EH 3BP6B 2C1OA 2VAJA 1ODAA 5HJ3A 4OZFG 3LKSA 5DA0B 4I3GA 3PWJB 4LFHG 3RGVD 1NCBH 5F1SA 3FQUA 5JUEL 3WHE1 3N1MC 1KIRB 4JY5L 5DC4B 3UTZA 3LOWA 3G5ZA 5DDHB 2A73B 4AMKL 2YD6A 3EO0A 5I1JL 2YXFA 3X11B 2V7NB 4U1HA 4F7CB 1XGPB 4Y2OA 2ZOLB 2VZOA 3F7RA 4P4KB 5DK3A 1B9ZA 3HNSL 1S9KC 5H2BA 1A1MA 1FG2B 3UZEA 4CVZA 1ZHKB 2B39A 4OM1L 4UB0L 4LDLB 1HHHB 4DQOL 1QFWI 4ZUSB 2EO9A 1WBXB 3KYMB 1S3KH 1KCUL 5IV2A 2GYSA 2JCCE 1HKLH 5DFTA 4M6OH 4GAJL 2BVUA 1EK3A 2J6EH 1UB5A 4YXHH 1R3HA 4NNPL 5C8JB 3MUGB 4S1DC 1CXHA 3ZYZA 5BQ7A 3C8KB 5CBEA 3WS6A 1OB1B 2Q6WB 5IMKB 4R97B 1UWEL 3GSRA 5C6PB 4LSUH 4MQ7A 1FNAA 4Y5XA 2OXGA 3NN8B 2VLKA 4U3HA 1K3ZA 1AKJD 1XGTA 3MRCA 2IALA 2XKUA 3ULUL 3L7EA 1JFQL 3HZMB 4JQVC 4G6FB 4XI5C 1CDIA 5E2JA 1G0DA 3ARDB 4P2YA 5J3HC 1HZHL 3QIWB 1FV1B 3QZWA 5CJQH 4HJ0C 5C08D 4WI9A 1XH3B 1UH2A 5I6XB 2XWBB 5D2NC 1FZJA 3EUUA 3D0LB 4HBCH 4XCNB 5E8PB 5LGJA 4OSUL 5FF6B 4OIIL 2NNAA 1Q94B 1QR1A 4JFPA 2VXQH 3EFFA 4L8DB 1T66C 1JGLH 1EXUA 5AYUH 4TULH 4X83A 3ULVD 4TRPH 3MUJA 3L5IA 4HS6B 3TPUB 1FBIL 1EEYA 1ZANL 2AK1H 1J0JA 3ALPA 5L6YH 4NKOA 4I2XA 4M1GL 3I2CH 4P4KC 5DJCA 2F58L 2BNRD 2DJSA 5IB5B 3QNZA 5D1ZB 4LCUB 4UQ3A 3IFPA 3UAJD 1P1ZB 1KJVB 1WBZB 4P5MA 3MZTA 5HYSG 1ZHBB 3PWNA 5EU6A 1ZA3A 5D7IE 1JPGB 2BY1A 2W0FA 3VFTB 1I7TB 2CLZA 1Q0XH 4YFLI 3H0TB 3NZHH 4PGCB 3GFUA 4K7PL 3CVHA 4JDTH 1RURH 4JFXA 4X0KB 5C09E 1MVUA 2Y25A 3O3AA 3VA6A 2EDYA 2P8PB 1YC8A 3PQYA 1OGAA 2R0ZL 2PXYA 2G9HA 2VLJB 4R97C 2DD8H 5EIQA 3MX0A 3VWJB 1AC6A 5B3NA 1TCMA 1QRNB 1T0MA 3I85A 4MJIE 5AG8A 5L2JB 3BISA 1MLCA 2EYTB 4AENB 1AH1A 4JHBA 3TNMA 3QHZH 4OLWH 4POYA 2B2XL 5IESL 3KPSB 2ICEB 4WI6A 3MV01 2F5AL 3KG5A 4U1MA 1OVZA 5D96B 3QIWC 5CD3B 4BH7B 5I6XC 2Y7QA 1ZHLB 3RU8L 1KELL 5E9DB 1I9IL 4ERSH 4Z7UB 1EO8H 4HC1H 4LOUD 1N6QL 5ID1B 1WVZA 4PRIB 1J1PH 1WC7A 4I0KA 5EO9B 3CFKA 4PV9A 3TBSB 4OI7A 1DL7L 4QTHA 2VR9A 5T3ZH 4L8CA 1H8OA 3LEYH 3AC0A 4HIXH 1R3IL 1ZWIA 2IADA 1FYTD 5ESAA 3MLVH 4R26H 4XBEL 1YJDH 2K7QA 4YDVB 1Q9OA 2GCYA 1I8KA 1FL5A 4O02L 5KS9F 5FM4A 1DDHB 4G80B 5EU4A 1Q9WB 1JZ3A 5D1ZC 4DZBA 2WBWB 4JN2A 5EH1A 1IMHC 5E2UL 1KNOA 2CIIA 5CZKA 2X10A 2P8LA 4NBXB 3V4PH 1OAQL 5CJOL 1XF5B 2A0LC 3T09A 1A14H 4YNYA 4UUJA 4QKXB 3WIFB 3D25B 1FAIL 4LKCA 4BZ1L 4PP1C 1DQLL 3TYGL 1C5CH 2NY6D 3PWUA 2YKLH 4TUKH 3EOTL 2BNQD 3BAEL 1U58B 2BXZA 3PDOB 4LKXB 3VWJC 1I7RB 4G43B 4P4RB 4NWTL 5EO0B 1RFDH 3BZ4B 2H6PB 2VZSA 5F3BB 5K59E 4OQTL 4WW2A 1FFOB 1LO5B 1U36A 4JFZL 4U7SA 2PR4L 5J57B 4IEFB 3F7VA 4FQPA 3VU2A 3B8SA 4EN3D 5HYIA 3O6ML 1NFDF 4WCYL 5D96C 1V5JA 4JLRB 3O2DA 3LSOA 3BZFB 1UXWB 1JRHL 2XNAA 1N64L 4PJBF 1MCPL 5FK9B 2C4FU 4D9QE 3S37H 1N8ZA 1ZA6A 3BDYL 4KK5D 4LCWB 3T2PA 4JPIA 3MYJB 4J3WA 2OL3L 1RZ8A 4KXZI 4XNUL 1QSED 4J12A 3QCVH 1Q72L 4TSAL 3SY0B 1MI5B 3GK8L 2JTDA 1U93A 3CFJA 5JW4R 4E42A 5DD1L 3T1FB 2OS7A 1I1YB 3EJJX 2X4QB 5DTFA 5E95B 1WAAE 2QL1A 4WTWA 1D3CA 4XBPB 1WIUA 5JDSA 4P9MH 1GZPB 3KPMB 1PD6A 4N5EC 2WSKA 1G7HB 1Y18A 1FPTH 4ZTPL 1F3DJ 4P2OA 5GRXG 4DUVA 3MUHL 2NY1D 4U7MA 4ZSOA 2DJUA 5IBUB 2Z93A 1P9MC 3FO2A 3UYRL 1JGEB 3ZE1F 1PG7L 3RIFF 2AI0L 4HUUA 3E3QE 4FOMA 2ZG2A 12E8L 4MA7L 4TVPH 5ITFB 1OP9A 5SX4H 3SDYH 2R2BB 3VFNA 1BD2D 2XFXB 4NSKA 5D7KD 3WEXB 5FB8A 2C1PB 3DYMA 3NACH 2FCBA 4QOKA 3W9DA 1VGKA 1ED3A 4NQVA 4G9DB 1G7MA 4ZFGH 3I6LE 4UBDD 4CVUA 4O9HH 1A7RL 5DD0H 2P7TA 5INDB 4RFNB 4Q9BA 3KR3L 2YPKA 2ENSA 5TJWK 3AGVA 3G9VA 1UKTA 2ZUXA 4PRDB 5IB4A 4MDJB 1ADQH 4R7NA 1KG0A 3T2NL 5HVFB 5F9JA 2H8PB 5GHWH 5EZLA 5FYJD 1NFIB 5BZWA 4EIZC 5I1DB 5D1XD 1RIVL 5SX5H 1KTDB 2FL5A 3NFSL 3OXRA 4WY7H 1CU4L 2VDLH 3KYKH 3OJVC 4F3FA 1RHHA 5BV7H 4JO1H 3I6GA 4RAUB 3FQTA 3VGHA 4Z7UF 1F4YH 3S5LA 4J3SA 3VI3E 1MCOH 4K7FB 5GJSL 4ZXBA 2EIZA 1MEXL 2XZCL 3BZEB 2D7TH 1NAMA 4Q6IA 5B22A 2OR7A 1DE4A 4Z5RB 1YMHB 1M6OA 4P46B 4KTDL 5C9JA 2Z31D 5D1QA 2BOCB 2NLJA 1YQVH 3TIDB 2X9WA 2CIKA 2ATKA 5KSVB 4JGMA 5AYQA 1A6VH 3GMOA 1AI1L 1OP3K 3PWLB 3OKEA 3QRGL 3FT2A 2PYEB 2Z4QB 5CUSH 3N85L 3GHBL 4MB4A 3T2QA 3KPNB 3HE6B 1R24A 1KULA 2OMNA 2DM7A 2EE2A 4IM8A 1RZGA 4S0SD 2IPTL 1T2JA 4HJGA 4U1NA 4UT7L 2YD5A 4P3WA 3IETB 5E00A 1QACA 4GQ9L 4EI6B 1SJEB 4GRWH 3VXMB 4QXTA 1MF2H 5DR5H 3EHBC 4RFNC 5K9JH 4JN1H 4KKLC 1TVBB 2QHRH 5CHNB 2NY5H 4OFYA 2ARWA 1QYGH 3DI3B 3MRDA 4PG9A 3TYFA 2X41A 3NCJL 1S7QA 1T1XB 4JRXE 4DKFH 3SJVA 2BC4A 4JFEA 4ZDHA 4FMFA 4P59L 4Z7QF 2JB5L 5EZOH 2IMMA 3RVXC 2C1OB 3EDEA 3ZLQC 3D3VE 1EAPB 5E08L 4Y8DC 3FQUB 1DBAH 1LP9A 4K55A 3QXWA 1UZ6F 3CSGA 3ROLA 3UTZB 4LU5H 2EXYD 3G5ZB 1EEQA 4B50A 3C5JA 1NGXA 3EO0B 1YPZB 3CSBA 3HUJE 1TIUA 2EDKA 1F2QA 2VITA 5FGCB 1MCFA 3NIDF 3VRLE 3KPOA 4LAQH 4Z7VE 5H2BB 2IWGA 2O5YL 4DTGH 4PRHD 1IT9L 1GZQA 4P46C 3DRTA 2EYRA 5ANMB 5GJTH 4CU8A 4ZS6C 5KN5A 3GSVB 4TOYH 5IV2B 1ZGLA 3VFWA 1QFHA 4R96B 3BSZL 1LNUA 1EO7A 1BEYH 3QHFH 4XWGL 3TA3B 3DX6A 5HTSA 4U6HB 2GT9B 2GTWA 2YRZA 4XHJD 1NCAH 1RUMH 4HHAB 4V2BA 4K8RD 4TNVF 5BQ7B 1S8DA 5CBEB 3BWUC 2XWJA 1TTUA 1DCLA 1V3LA 4TYUA 2VZ3A 4WUUA 2QQNL 3QXAA 2LABA 5C70A 4Y5XB 5E4EB 2WP3O 4BFBD 2VLKB 1JV5B 1QSFA 4DGYH 3RPIA 1XGTB 3MRCB 2IALB 2JJUA 3LPWA 2FEEI 4FQ1L 4KJYB 1MCJA 5K93A 3FL7A 4MNGA 1NUDA 4TUOA 2ED9A 3HC0B 1NJ9B 3I50L 2VUYA 2DLTA 1FZJB 5JW5A 3UC0H 5FYKD 4UQ2A 4GSDL 3JWNC 4JFPB 1K5NA 4NOBA 5SWQA 5DQJA 1JMZA 3IDXL 4M1DH 1H3WM 2C3GA 4AEFA 4JVPA 2YBRA 3JV6B 1EXUB 2ZJSL 2YS4A 1WFUA 1S7WA 1Z3GL 1UT9A 4OLUH 3REWA 4GLRH 5JR1L 2EEDA 1YEFH 2P4AB 1EEYB 3V5HA 4YE4L 3MV8D 5MENB 2BDNH 4GRLD 4WU7B 5DMGD 3VJ6A 5DJCB 5LQBH 5TF1L 2FGWL 2VXTH 5CKGA 2ZUTA 4DKAA 1A0QH 1ZSDA 3LRGA 5CIPH 4UQ3B 4GKSA 2X44D 5LBSL 3UO1H 2GJ6D 3LH2L 5EU6B 1ZA3B 2HMID 3W2DL 2W0FB 1P4LA 2VIRA 2YA1A 1ETZA 1A2YA 3CH1B 4GW1A 3GIZL 2CLZB 3E8UH 4PJGB 5TDPA 1FLTX 4LQFH 2DQIL 3LV3B 4G6JH 5BZDB 3CVHB 3TA3C 1WITA 4JFXB 3UPAA 1B4JL 3V6FA 4KV5F 1YDPA 2E9JA 4BFEA 2ZCLL 1OGAB 2PXYB 3GJEB 3WS6C 1MAML 1QFWL 5IFHL 4I18A 2AEQL 5KJRL 2I60L 4Y5XC 5E4EC 1MRCH 5T3XD 1I1CA 2W65A 4P2QE 5FUCE 3C5ZD 2DQCH 3H42H 1MLCB 4AEIH 2E9BA 4DEPB 5HYJE 3OSKA 3THMH 5CSBA 3RX8A 2Y5TA 4J6RH 5IB2A 3JWDC 4AL8H 1BX2B 5C0ND 3JTTB 5TE6L 1RZJL 2NY7H 1YA5A 2Y7QB 5LXGH 1IGYA 4KPHL 4P9HC 5CJBA 5GS0H 1M4KA 3ABZA 3F7YB 2YMXH 3BKYL 5JPNA 4GUPA 1PQZA 1WC7B 4WWID 3RGHA 1OTTD 5DZNA 3CFKB 2IG2H 1JNLL 4HAFA 4M7LL 4R2GD 3N9GL 3LMJH 2IADB 5ESAB 2HVKA 2VAAB 5E8EB 2GCYB 1FL5B 2I26N 3PWPE 2CUMA 5LCVL 1T22A 4HPOH 1I8LA 3C5SA 5EU4B 4ZMAT 4NQTA 4RRPG 3FB5A 4P5TD 2VLME 1EBAA 4QRUA 1HI6B 1MWAA 3UTTE 4NIKB 3NIFE 1KNOB 1NC2A 2P8LB 3U1SL 4GG8A 3CVIL 1QFUH 3B83A 5FFLA 3MBXL 4KTYA 4RA0C 1CE1H 3BGFB 4UUJB 4LVOB 5B39A 4OAWA 5KSAA 1YPZF 3PWUB 1YECL 2R2HA 5AZEL 3QFJD 2PXYC 3SGDI 4G6AD 4KY1H 1JP5A 4HIIB 4D9LH 3MA7A 5I1KH 3BOVA 3P4MB 1I9RL 2LTQB 1SM3L 1CL7H 3MBED 4ODWB 4XPTH 1JWMA 4KQ4H 2R69H 4WW2B 1PKQA 1J11A 2B20A 2P5ED 2VH5H 1UCBL 3R06A 5FCSH 3T65A 1FIGH 1UM4H 3U0WL 3F7VB 2BXYA 4FXGB 1G7JA 2OTUA 4H20L 5C08E 4U2YA 4JHWH 4BZ2L 5IQ9A 2R29L 1IGTB 3ARTA 4JHAL 4RWYH 5H35B 2XNAB 2YD2A 1N8ZB 1CGUA 2ZCKL 4GO6B 1A7QL 4JPIB 2FLRT 3ULVE 1FLRH 1C16A 3FRUB 4KGLA 1X5IA 4HLZH 3MOAH 1U93B 2HFTA 4QRRD 1E27A 2AJYH 3MLUL 1MCCA 1B0WA 5E1AA 2FLBT 4PB0H 1QP1A 4H1LG 4NHUA 4PRPD 1NBQA 5C0AD 4Y2DA 4OZFA 4H0GA 3K1KC 4FQQA 4NCC1 1JHLH 2K3TA 4ISVA 5E8DL 1GYAA 5D72L 5JDSB 2GJZB 3KLAB 5ETUA 3SGJA 3VXSE 4Z8FH 3HMXL 4Y4KA 1XGQA 1DQJA 2B5IB 1Y18B 4WO4D 2HJLA 2SEBA 4ETQA 5C0DB 2WLZA 3BGFC 2YRLA 4P2OB 1NMBH 4LVOC 1QR4A 2F53A 1XIWD 2Z93B 4Y19A 1KIQB 3EIFA 3FO2B 2O5ZL 1PX4A 4BKLB 1BZ7B 4R3SA 4CGTA 4HUUB 1RD6A 2NXZB 4KVCL 4UTBL 4XNYL 3V5KA 2EO1A 3VW3H 1C5DB 2LTQC 4MLSA 2FATL 4ZUUA 2HH0H 1L4IA 2DIBA 3SDXA 3VFNB 4WW2C 1J86A 4NSKB 1JYWA 3RVVC 5FB8B 1BQLH 4UT6H 4PJGF 5FYKU 4LEXL 4JKPL 4QOKB 1KCSH 1VGKB 2VZUA 1AY1L 1ED3B 4HCRA 3DIFB 4NQVB 2YPVH 4YWGL 2P7TB 3HG1D 1E28A 2Q20A 4NN6B 2YPKB 3MV9E 3O4LA 1FO0B 1HHGA 3QUKA 3EJYC 3B5HA 5IB4B 4PJ5A 4DUWA 4HUVA 5DJYB 1BMGA 5HVWA 1CLCA 1NUGA 5F7KC 5BZWB 4PJAF 4Y5YA 3HMWH 1MFCH 1OCWH 1R3LA 5IVXE 1BFOB 3IAQA 2BSED 1GPOH 1SEQL 4WEBH 1RHHB 4X4ZA 2ARJB 3CXHK 1N0XL 3FQTB 1WGOA 4K9EC 2J8HA 4Y4HD 3PHOB 5DRZA 4DFHA 4I5BA 3S5LB 2W1NA 4ODHH 2FRGP 1A6AA 2EIZB 3CFDA 5DUPH 2B5IC 3G5VA 2ERJB 3UJJL 4NNXA 2ICCA 4PJ7B 4Q6IB 4XNXH 1DE4B 5JW4Q 1TXKA 1CFTA 1M6OB 1NMAL 1LE9B 4P2OC 1QLFA 5C9JB 5EORH 5D1QB 5H37G 3FB8A 2NLJB 4CJ0A 5EO1A 1A6PA 1KJMA 5D7SL 4K7PX 5CLTA 2W9DH 5HYSA 3ULVL 4Y4FA 4KKAC 4HCRH 1BZ9A 4M6MH 2YD7A 4FTVE 3BHBA 2NXZC 1DQDL 1FNFA 3VXQB 2CKBA 4G8GE 1R24B 3MCLH 2NX5A 3CCHA 2W07A 2YK1L 4YGAB 2Q8AL 2A83B 4Z0BL 2ZWLT 3DOSA 4HG4K 5D9SA 4LSRL 1ZV5A 3BIBX 1ZE3C 3O0RL 5HGBA 4DKEH 4G42A 1ZGLM 5E00B 3T3MF 5B3JF 1ZT1A 4QXTB 1HOCA 5LVEA 1E4XL 1MREH 2VDPH 3EDJA 5T1KD 1G9NL 3RTQA 4NN6C 2ZG1A 3MRDB 4PG9B 2H1PL 1WFTA 1QSEE 3TM6A 2JIXB 3SJVB 2BC4B 4RGOH 4JFEB 4PJDB 4X9IA 1HH9A 3DGCR 1YEJH 2X4PB 5J13B 1GC1H 5JMRA 3ZE2F 2Q76A 2EYSB 3WFZA 1KFAL 2KUTA 4X9FA 1PFCA 5IIEB 1UB6A 1TETL 3C5JB 5ILTH 1TZGL 4EVNB 1H3UA 5HPMA 2AQ2A 4NQDE 3S34H 2VITB 2IANA 2XT1B 3QP3A 4ZXBC 3MRNB 1J1XH 5D7LD 4L1HA 4R4BB 1PZUB 3E6FB 2ERJC 4Q6IC 5I9QB 1GZQB 2HRPL 4GXVH 5A1AA 2E9WA 3VMPA 3MROB 1GIGH 5D1QC 4R90H 3IU4H 3DX7A 3TFKC 3ROOB 4S1QH 2FH8A 3I84A 4WI5A 5KN5B 1VDGA 2YOCA 4KKCD 4E41D 5F7UA 5DI8A 3S36L 4UIMB 3P2TA 3VMNA 3HR5A 3MRLB 1NGQL 5SX4I 2EZ0D 1TZIA 3QWRA 3BH8A 2GTWB 5HVGB 5KVGH 4XVUC 2XWJB 5BOZG 3CLFH 3QO0A 1BAFH 2JJSC 1YZZA 4GAYA 4OZ4B 4PREB 4WUUB 3QXAB 3L5XH 2AP2A 5DJ8A 4W6XB 4GJTB 1QSFB 4GAGL 5DO2D 1EHLL 2R15A 5IBLC 5EBLA 4EQ3A 1AQDA 3EBAA 4TUOB 4HG4J 3UZVB 5FYJE 1EZVY 2J1KA 3HRZB 3QIUA 3T8XA 3NCYS 5JW5B 3TV3L 1LHZA 1A6UH 1T03L 1HEZA 1R5VA 3HS0A 2XTJD 5J13C 4QRSA 2W9EH 4F15C 5DEZA 2H2PD 1RULL 3DMMA 2BY0A 4JPWH 1YEHH 1M7DB 2YBRB 5F1IB 1UGNA 4KKBC 3EO9L 1S7WB 3REWB 2DQJH 3TT3L 3WLWD 4M4PA 1QBLL 3WS3A 3O8XA 3HC4L 3VJ6B 4N0UE 2HKFL 4MVBC 4R4ND 2EH7L 1KBGH 4TNWF 1I3GH 1TZHA 5I9QC 4ZODA 4GKSB 3V9FA 3X17A 3CGTA 2EEBA 2CLRA 4XMKH 3MCKA 4S1RH 2FIKA 5DT1H 5C0CE 3D39A 1P4LB 1T2XA 2VIRB 4JJ5A 3S96B 4FFZH 5F6HI 1ETZB 3KYNA 1A2YB 4GW1B 2EC9U 3D5OF 2RBLA 3MJ9A 3TCLA 1PG7X 1UZ8B 2LAAA 4WI4A 5CBAB 4X7EC 1OD9A 3RJQB 4NRYA 4XBGA 1D5IL 3VI4E 1LQSR 2UVEA 1BQUA 4PJ7F 3IS0X 3K4ZA 3SKJH 5HDOA 4MAYA 4O2EB 3VGAB 2W65B 1PSKH 5JIHA 2Y07H 3FAXA 2HFEB 3IXTA 4XMPH 5KZCD 3WO3B 1JPTL 2J8UF 1CGXA 1QO3B 4MJ4A 2AJUL 3QJHA 1D6VL 1BM3H 4S1DD 1GGBH 1A9EA 1A5FL 1Z0MA 1A1OB 5I16A 3NIGF 2DMBA 2HJFA 4PB9H 4LLMA 3DVNB 2VJXA 5JPNB 2QSTA 3MNZA 5GGTA 4MAUL 1WIPA 2FEEL 1P7KA 5DRNA 5DJ0A 3RUGE 4FQCH 3WFEH 4XI5D 2OR9L 1RZ7L 1CLZH 5J3HD 4L4VD 3H6JA 2HVKB 3BRFA 3FB6A 4OGXL 4HJ0D 5I1LA 4ZOEA 3LHPL 2YA2A 1T22B 3K1DA 1P7HL 3C5SB 1FZMA 3KJ6L 3FB5B 2EDQA 3QPXH 2FX8H 4PJ9A 4QRUB 4ONFL 1Z9MA 2CGRH 3MLSL 4PJDF 5IFJB 3PP3H 4YHZH 1MWAB 2C4XA 1T66D 3C8HA 4R4FL 3ME0A 4X5WA 4PJFA 1X5AA 3SGEI 4JFDE 5FYJL 1VHPA 3BDBA 4XCCL 1P4IL 3K8LA 4NO0D 5EPMA 3D85A 3ES6A 2FECI 2P47B 3KPRA 4P4KD 3ZT7A 3OKOA 3VFVB 4L3AA 3S88L 3CK0L 5BRZB 1L0QA 4K94H 4UOW1 3WNLA 2V9QA 4NKIL 3GNML 1P7QB 3DUHA 3GBNH 4BQBA 3TJEH 3VFRA 5FUZL 2DMKA 2P5WB 3FO9A 2B4CC 5EC1A 1J1OL 3EGSA 3SKOB 2KH2B 4BQ9A 1JWMB 1HDMA 3VMOA 4HIHA 3MYZA 5I1GH 4RDQF 4F9LA 1G7JB 2OTUB 3OF6D 4JCLA 4XNQA 3GB7A 2BCKA 1PG7W 3MFFA 2CDGA 4NNYA 4H8WL 2R4SH 3PV7A 2VSCA 3GUTB 1M05A 4U6VH 3SQOL 4FFYL 1LK3H 4NC1C 4LRIC 1KLFA 1XGRB 2CMRH 4YHPA 1KCKA 2B1AL 3MR9A 2DLFH 2R0LH 2V7HB 4WNQA 3GO1L 4GLRI 4G6FD 1A6TA 1IQDA 1OHQA 5EUOE 3JTSA 1OWWA 4DKDC 1FNGA 5SV4A 8FABA 3MV8E 5T33H 1E27B 3QIWD 5E1AB 2X1XR 3FRPG 2OTWA 3LQAH 4OLZH 4Y2DB 4OZFB 1F58L 3V6ZB 1I8LC 2XI9A 4LLYB 3STBA 4J2XA 4FQQB 4OKVB 5IW1A 5L2KB 3BP4A 1FFQA 1U9KA 4ZD3H 4HFWA 5ETUB 3HNTL 2X4NB 5GRWA 2A6KB 1XGQB 3ORJA 1DQJB 3H2WA 4R8WL 3PGFL 1NCDL 3IFOA 2HJLB 1X5XA 4ETQB 5JHDB 3U0TA 5GS2D 3L3JA 2G5BB 1BQHB 1XGYH 4K07A 5D1ZD 3MLPA 3JXAA 4Y19B 1XGUA 5ALBH 1U6AH 3PL6B 3D2UA 4I1NB 4R3SB 4HKJA 3RA7H 4XAWL 5GRUH 5HY9A 1S3KL 4HFUL 2DTML 4MNQA 4ZUUB 4M6OL 3SDXB 1F90L 1QBAA 2A0LD 1IL1A 1UQSA 4U1KA 4JPKL 4JFFA 2H9GA 5T3ZE 2OMBA 3L9RA 4PP1D 2F74B 3U7YL 4N9OB 3K4AA 2MQ0A 4XRCB 3L5WB 2VLJD 3MRQB 5F96H 2YD3A 2ORBL 1G84A 3VWJD 4X6EA 3VG0H 5I1HH 3RWEA 5C0JA 5KTEH 1QRND 5FA4B 3O4LB 4KI5E 3GJFK 4NZRH 2HT4C 4MB5A 2UZIH 1QD0A 4K8RL 1LD9A 2DS4A 4IOSD 3K8KA 3OKLA 3CMOH 4JM2A 4OD3H 5CJQL 4ODSH 4ZPVB 1TJGL 3KPSD 4Y5YB 3GSNL 4NZTH 3SE9H 1DSFH 1W0YT 4X6CE 4YFEA 1R3LB 3Q3GB 4Y2DC 1EFXA 3QCUL 5E9DD 1K4CA 4OZHE 5I8EA 4XZUA 3WFBH 4ZS7H 2EDDA 4PRID 5DRZB 3GGWA 5MEPB 4I5BB 1AD0A 3SGJC 3SQBA 1ZLVH 3L7FA 2FX7H 2YPLA 4Y4KC 5HGGS 1A6AB 3MLZH 2YA0A 4NRXA 1WTLA 4NNXB 2VDNL 5FYKL 3RPKA 1SY6H 1X4ZA 1CFTB 3OR7A 2D03H 4MD4A 5DZOA 1KPVA 2DQEH 3FB8B 1KJMB 2P8MA 5HYSB 5E0QA 4Y4FB 2CK0H 3JV4A 4YR6A 4XB7A 5HD8C 5GGVY 1UCTA 4ODVL 4H26A 1FHGA 5TQ0H 4PY8I 4N5ED 2CKBB 4GS7B 1RK0B 3U48A 3MPCA 4KROB 5A3IC 4PGEA 1AHWA 2WUCL 5D9SB 2DWEA 1I4FA 5IB1B 3F6LA 3LRSA 1QUNA 1QLEH 5HGBB 2DD8L 2W92A 3FO1A 3LCYA 3BEWB 5I1AB 5HHNA 1ZT1B 3ZMRA 4JG1H 1JNJA 3DUUB 3KPPB 1KSRA 5CSGA 3RTQB 1F4XH 3RL1A 5LG1A 2E7HA 1TPXB 4LF3B 3FN9A 4Z95H 1P4BH 1JYVA 4M9PA 1S5IH 1OLLA 1HH9B 2EIDA 3RY5A 4U05A 2XTLA 5JMOC 1U8JB 1IKFH 4PRPE 4Y5YC 2Q76B 5T3XL 1JIBA 2V17H 4FG6C 5EBWA 1HKFA 1I85C 4F58L 1UENA 3QDME 5JHLL 4LHUG 1CGTA 4QHKI 5JNYA 3SDCB 1KC5H 3BEVA 1UB6B 4LCWD 5HPMB 2BNUA 4PPTA 4HIXL 4ETYA 2IANB 4LIQH 1YNTA 3RWCA 4TVPE 4OJFL 4PJCE 3W0WB 1TJHL 1MI5D 2DM2A 3PUCA 4XP1H 3C6SA 2UWEE 4RRPA 4XCFL 3OPZH 3DX7B 4S10A 2H45A 3O3EA 2W9LA 1FYHB 3QUMH 4ONOA 4FQJL 1RUKH 4XPHH 4ZFZA 5GGRY 4Y4FC 3CIQA 3T0EE 5DI8B 4XPBH 2CQVA 4HGMA 3HR5B 3TCXA 4AYFA 4RX4D 1NC4A 4UINH 4CVXB 3QB7C 4GS7C 5DUMH 3BH8B 1ZLUH 5EU3A 3SOBH 5I30H 3VRJA 3DTXA 2QQLH 4KROC 4WW1A 5L8JB 1C5CL 4ELMA 3QO0B 4P49A 4RMTA 3B9KB 4GAYB 4HWZA 2AJSH 3X12A 4IDJH 1UG9A 3HG1E 3OKDA 4X5XA 2A9ML 3RTQC 5EBLB 5TE4L 3MREB 1BF2A 1AQDB 1TPXC 3GMNA 3G6JA 4L4TE 3Q1SL 1U8HA 4FABL 1CXKA 4QF1A 1E0OB 2NPLX 1KTKE 4OUUA 5DD3L 3SCMA 3T8XB 4LNRB 3SDXF 3SE8L 1JHKH 5AWNH 4XPAL 1HEZB 3HS0B 1J88A 4QRSB 3RZWA 4XX1E 5CWSA 3N50A 3AUVA 4NYLA 5EBMB 1A22B 3BXNB 3EHBD 4NC2B 4KKLD 3ZKSD 3SDCC 4WTZG 3V4UH 1XMWA 2HT3C 2DBLH 5HPOA 3O8XB 4YXKL 4JGUA 5LGKA 2NW3A 1ROWA 2XWTA 1DQQA 3CSPA 1EJOH 1PLGH 5TGBA 4LARH 3WKMH 4FZ8L 3RVXD 4HS3A 3JWOL 4H1LA 1FVEA 3LKPA 1TZHB 4QRPE 4YDIL 2A6DA 4KAQL 4Y1AA 3DHMA 1FO0H 3MCKB 3MLTB 3D39B 4JJ5B 1S7SA 4DVBA 3KYNB 4GRWE 3ZKXB 3A6BL 4Z76B 3OKMA 3STZA 2DLEA 32C2A 2BP3A 2BVYA 1ACYH 3TCLB 3FB7A 3OTTA 1W0VA 5ICZB 3P30H 2B0SH 4NRYB 4P46D 4XBGB 5IF0A 4BSJA 4MX7A 3WFHB 3B9KC 2VDOL 4ZS6D 3FHQA 4MAYB 1OP5H 1JHTA 3DLQR 2R2CA 1A1NA 4GBXA 5DUBA 3IXTB 3SDYL 1TMCB 3VXRE 3V6OA 2PYED 5JUEH 1W0WB 3QJHB 2NY4B 4AMKH 3EYFB 4FS0A 3WJJA 3TBVB 3F58L 5I1JH 1A9EB 3B9VA 1CYGA 1O7VA 2OI9B 2UUDK 3QIUC 4F8TA 4CL7A 5I18L 1U8QA 5I16B 3Q5YA 3HNSH 1YYML 3KWWA 3BI9X 4X4YA 2E7MA 4O9HL 3WXWL 3VDCA 4LLMB 2ZOKB 5M95B 2CK2A 2AXFA 3VXMD 3MNZB 4HULB 2Q7NA 1DEEB 4UB0H 4OM1H 3WBDA 4A2LA 5IR1A 3WN5A 4RISL 4DQOH 3INUL 1MAJA 2G2RA 1KCUH 3O8XC 3P9MB 2IQAA 3NAAL 5IQ7L 2E6PA 5ENWA 3FB6B 4OCXL 4GAJH 3QEQE 4YBLB 4M5YL 4GH7B 4NFDA 5FGSA 1FZMB 4NNPH 4PJ9B 3H7LA 4UMGA 4X5WB 4D8PA 4PJFB 1UWEH 1E4WL 5ESVB 1JBJA 4X8JA 3ZKXC 1CK0L 2YRPA 2NTFA 4K3GA 3ULUH 4FP8L 3ES6B 4LSTL 1JFQH 1RHFA 4IJ3B 4PJIB 1REIA 2BZDA 4HUXA 4GMTL 4TQEL 4S0TD 1H15A 2R8SL 1YQVL 1HZHH 1AGFB 4LMQI 3WV0A 1D5ZB 5IOPB 3QDHA 4MD0B 1A6VL 4LSQL 4M03A 2FB4L 4OSUH 3TGXA 3EGSB 4OIIH 4MAYC 2NY2B 5GS1A 3S35L 2ICES 2NZ9C 4UIKL 3CU1A 5CUSL 1HDMB 2EE3A 4HIHB 4X5LA 3P0YL 3TA3D 2KZ1B 4M7LT 1F8TL 3IDYB 4XNQB 2NY4C 1FBIH 1ZANH 5I17A 2BCKB 2XG5A 2D7QA 4I0CC 3MFFB 2OI9C 2JCCA 2DYPA 2F58H 4Y16B 4NQEE 3CFCL 1M05B 4LSVL 1T3FA 1BBDL 2VLKD 4FQXA 2QHRL 1BPVA 4G9FA 3RQ3A 2NY5L 4YHPB 1EX0A 4ODBD 1LO2L 3QUZA 3VFSA 1E4JA 2K1MA 1IARB 3F65A 4WNQB 1A6TB 1IQDB 2N7BA 4CVWA 2X70A 4JZJA 3JTSB 8FABB 4PIRF 3OQ3B 5EOTB 4K7PH 3QXTA 3T4AA 4YBLC 2OTWB 2DB8A 1S7RA 2Y23A 3MA9L 5EIVA 1IBGH 4PJ9C 3BP4B 4XB8A 2R0ZH 5DEGA 1X9QA 5H37H 1DQML 5B21A 2OCFD 1N26A 4CUCA 3EYOA 3IFOB 3IXAA 4PRNA 3DVGA 3U0TB 1U8PA 3BWAB 4XAKD 2NY0C 3L3JB 5MEND 5TPWL 4JDVA 3QPQC 4IJ3C 4RMWA 1SMOA 3FN0L 3DX9B 4ALAL 3IJHA 2B2XH 3P4NA 5FGBC 4RZCA 4AM0A 5IESH 4ORGA 2F5AH 4KZEL 1AO7E 4JB9L 5BOPA 3D2UB 4HKJB 4A6YB 2H3NA 3QNXB 1NLBL 3NGBB 2GHWB 2YUWA 3RU8H 5HY9B 4TOYL 1KELH 3EKCA 1I9IH 5EU6D 1MCHA 4MSWA 4MNQB 2NY2C 1N6QH 2WQ8A 1IL1B 1CDHA 3V5DB 1P84K 2Y6SC 3L9RB 5JW4M 1KXTB 4F9LC 3IDYC 2BOBA 5HHQB 4LCCA 2EDXA 3VFGL 4WHYG 1R3IH 1VADA 5D7IA 2X7LA 2CSPA 4XBEH 1OGAD 4JEGB 2PXYD 4N5UA 5GSVA 4O02H 1ZKAA 4PJEB 4X6EB 1KXVC 3RWEB 4Y16C 4IRZH 3FAWA 5C07B 5C09A 2OL3A 4TTGA 5SWZE 2PW2A 2VXUL 5E2UH 4PLNC 4X98A 1LD9B 4U1JB 4XCEA 5KS9E 1S7XA 4JM2B 1IGML 4G6KL 1OAQH 4J8RA 5CJOH 1FSKB 3R0MA 4MJIA 43CAA 5EG6C 2VL4A 1FAIH 3AAZA 4M6NL 4BZ1H 1EFXB 1DQLH 1G9EA 4JVWA 4M1DL 1G0XA 4XZUB 4QHLB 5D6CA 1SBSL 2QTEA 3PIQA 3EOTH 1NGZB 1H8SA 3GGWB 1AD0B 3BAEH 3X14A 5F21B 1KGCD 2WLYA 5JLZA 2W91A 4NWTH 3ARWA 3U36A 2GSGA 4NRXB 3RWIA 1OQXA 4OQTH 5T5FH 3OR7B 4JFZH 1ZMYA 2PR4H 4UU9A 1GHFL 5IG7B 1YMME 4HT1L 3O6MH 5I74B 2P8MB 1N2RB 2IBZY 4WCYH 3ZHLA 4M62H 4YC2C 4YR6B 3IU3A 4ZYKA 1IILE 2YD1A 4CN4A 4OF5A 3NGBC 3BMVA 1G1CA 1JRHH 1N64H 1MCPH 4G8EB 4M02A 3WXVL 1DN0A 2W59A 1J9CT 1NFDE 1MELA 5E7BA 1NDMA 2Z91B 4PGEB 1AHWB 1AXSA 5F72S 2DWEB 1I4FB 4XNUH 2GFBB 3S3JA 4PJBE 3LRSB 1Q72H 3BKML 4TSAH 3V79C 4OZIF 3QDJA 3G04A 5HHNB 5DD1H 5I19L 4PJIF 2FJGA 3UTOA 1CI5A 1MRCL 3K2MC 1G7QB 4AQ1B 1U95B 3LN4A 3RL1B 3PP4L 4XXDA 2FSEB 1K8DB 4XPFL 5IK3B 3GMLA 4YPGB 1UM5L 5DQDL 2V2WA 2X09A 4JM2C 3RVVD 2PO6A 4GG6F 5IMLA 3M17B 2NY7L 1FSKC 4ZTPH 2Q87A 2CDFA 4MD5A 1F97A 1X5YA 4D94A 2VLLB 4X99B 3RDTA 2C3XA 2NY6B 2WBKA 3A6OA 1U8LB 5HGHA 5JNYB 2AJ3A 3BEVB 2DQGL 3EJYD 4NJ9L 3UYRH 1PG7H 1EA9C 3VDBA 2AI0H 1CLOL 4XMLH 4MXWL 1OOAA 1YNTB 3RWCB 5EULV 4WJ5A 12E8H 4MA7H 1CE6A 2HA1A 3BESR 2XPGA 3ZE1E 3D69B 3TN0A 1IC1A 3ZTNH 2NXYB 3LB6C 1A9BA 1J0ZA 3V7AE 3O3EB 5JOEA 5IHLB 5I74C 2D31A 5DEFA 1DUYA 4IHOB 4ZFZB 1FJ1B 1MLBA 1S78C 2CO7B 1YNLL 1F5WA 1A7RH 4ZUTA 3FHAA 3OXSA 1NC4B 3LKRA 3QT2A 3KR3H 3UEZA 1BWWA 1MAKA 5EU3B 3VRJB 1WAAA 4WW1B 1HHKA 4HK3J 1AHWC 4P2OD 2DL2A 2Q3ZA 4NRZA 5GRJH 3UTPE 1NCTA 4WTXA 5M94B 4LSSL 2VLJE 4NN7B 1RIVH 1T04A 2F8VA 3X12B 2D4DA 5I1KL 3TIEA 4KKAD 3REVA 3NFSH 1F02I 2O61A 1QRNE 1CU4H 2NXZD 2R69L 1B0RA 3GMNB 3G6JB 4LK4A 1DANU 4QF1B 2E7BA 3SCMB 3NZ8B 4ZAKB 5I66A 5GJSH 3KPSE 1MEXH 2XZCH 4QOKD 3U6RB 2IF7A 4PJXB 3MRBA 3BQUB 5ACLA 2ZNWA 5C0BE 3VGGA 5E9DE 4KTDH 4Z7UE 3NOIA 1TVDA 5DA4A 2AK4B 2ZUYA 5F44A 4H0IA 5TH2A 1KPRA 3HI5L 3Q6FA 1AI1H 4PJEF 5IB3A 3FOMA 4PGBA 3QG7H 2XWTB 3BP5B 1NSNL 1DQQB 3B5TA 3QRGH 3N85H 3GHBH 2F8XC 4IIQB 4IMLA 5JTWA 4NC0B 3FRPA 4HS3B 4H1LB 2IBGA 5I73B 4HWEL 4JM2F 5L8LB 4HUNB 1IM3A 2A6DB 3CMGA 4Y1AB 2IJ0C 2NXYC 4UT7H 4Q7DA 4P99A 4PTTA 3QIBA 4FA8A 1QNZL 4GQ9H 1LMKA 3OKMB 2OJZL 3STZB 1KYOK 32C2B 3AB0B 4TTDC 5D7JA 5MHSD 5DMJB 4ZXBD 3UDWA 1NCCL 3FQXA 3MRFB 3NCJH 4UI2A 5IF0B 4NGHH 5CAYB 4NOFA 4QLRA 4U1IA 1MIML 2CD0A 4MX7B 5D1QD 4P59H 3TFKD 2JB5H 4POUB 1F3JA 4HXAL 4UTAL 1FVDA 3OJ2C 4J23A 4NN7C 3ALWA 4D0DA 3LKNA 3ULSB 1JHTB 4LHJB 5CEXA 4GBXB 5DSCA 5DUBB 2F54B 5SWSB 4Z7QE 3DROA 2C3VA 3G08A 4RFEA 3N1QC 4ONGL 2AVGA 1MVFA 3U46A 4W4NA 4XVUD 2FJHB 4P3CL 2F19L 1AR2A 3SCMC 4ZAKC 1JF6A 1UJ3A 1VERA 2GUOB 2YPVL 3F8UB 3SGKA 1UZ6E 2BSTA 3KWWB 1X6LA 3S6CA 2BMKA 4X4YB 2Z31B 2O5YH 4JRYB 3BQUC 1IT9H 4EDXA 4G7YH 4JKWA 5IBLD 3NIDE 5IR1B 4LCWE 1WWWX 4LLVA 1R5WB 2EDNA 1NDGA 2G2RB 4YPJA 2IQAB 3OKKA 5ENWB 3SJVD 4EXPX 4GMSL 4JFED 4C55A 1T1WA 5C0GB 4WEMB 5I73C 5FGRA 5GSRB 3LQZA 4LMQE 1GPOL 3BJLA 4WEBL 2DJ4A 3GKZA 4P2RE 3HKFA 4KRLB 3HHRB 4KKBD 1U2HA 2QQNH 1W72B 1OPGL 4X8JB 1HINH 3B2UC 5HHOE 4F7TA 5J11B 2XY1A 5DUPL 4UDUA 3GMQA 3AB0C 3D3VA 2X9XA 4FQ1H 2XICA 4XNXL 4MVBD 4HUXB 4M8VA 1NGYB 1N5YL 1H15B 3I50H 1MFNA 3HUJA 1C8PA 1RIHL 3DXAE 3I3BA 4GSDH 3GMPA 5GS1B 3T0VA 4Z7VA 4GBXC 4Z78A 4FQIL 1CICA 2EDHA 4V1DE 2ZJSH 3V6OC 1Z3GH 2O5XL 1K2DB 3OZ9L 3BKCL 1KOAA 5JR1H 2GK0A 1LDPH 3WJJC 3DSFL 5I17B 2X2YA 5KBNC 4YE4H 1CD0A 2D3VA 1FP5A 2A74A 4PRHB 4KK9C 2DYPB 4WUUD 5TF1H 1AJ7L 2FGWH 4N8VG 1Y6NR 4N90D 5GGQL 1T3FB 4E5XA 2XQBL 2MNUA 1QSFD 4FQXB 4G9FB 4CW1A 5LBSH 2CR3A 5I1EL 3FKUS 3LH2H 3QUZB 2I5YL 3U83A 2NW2B 3W2DH 5HYFA 2VDML 5F89B 1KB9J 3VGEA 5I75B 1KUMA 2X70B 4JZJB 3GIZH 3CNKA 4Y0GA 2DQIH 1AFVL 3G6JF 4RMUA 1G9MC 1HXMB 3F5WB 3VGBA 1S9VA 5HHPA 4PJHB 4YAQA 2ZCLH 4LHUA 5DEGB 4ZFOB 4NN5B 3ZHDA 1MAMH 1EERB 4PJXF 5IFHH 1MCDA 2AEQH 5KJRH 1YUHA 4KV5E 4GFTB 3EYOB 3IXAB 5J11C 3I9GL 4K2UH 3ZYOA 3O3BB 5EZJA 4JE4B 3QCTL 4WFGE 2LQRA 1PEWA 4LLDA 1GIGL 3P4NB 4AM0B 4ORGB 3QNYA 1RZJH 4EDWL 1I7ZB 4KPHH 2XYCA 4FXKB 5GS1C 3BKYH 3HE7A 3WJLA 3O45A 1QFOA 4QHMA 2PYEE 4CU6A 3IDGA 3GM0A 3I02A 1JNLH 4XGZA 4M7LH 5F8QC 4S11A 2BOBB 4RIRA 2E7CA 3N9GH 4LCCB 1VEMA 5ICXA 1GXEA 2PTUA 5D7IB 2X7LB 4IRJA 4JHZA 5J89A 3IJSA 5GSVB 5KSUA 2FJFA 3EOBA 5LCVH 4DJMA 1Q9KA 4C54A 1A7BA 5C09B 3T2OA 1WK0A 1CFQB 1T7YA 4FQXC 3KHQA 1WWAX 2FDBP 3QUZC 4XCEB 1S7XB 2CUHA 3U1SH 4J8RB 1I75A 5I75C 3BPOB 4JZJC 3CVIH 4HWNA 3S37X 3MBXH 43CAB 1JZ8A 4P2QA 4MCYB 5ABDE 4JPWL 1YEHL 5D6CB 1YECH 4PGZA 5AZEH 1J7VR 1FDLL 3PIQB 3QQ3A 4GXUN 1JPSL 4WTZA 4NN5C 3X14B 5DRXB 5JLZB 3EZJB 1DN2A 2R9HC 1I9RH 3Q5TA 1SM3H 1YPZE 3U36B 3VG9B 5KVDH 1JTPA 3BKJL 2JJWA 5JW3L 1UCBH 1WISA 4UU9B 1GOHA 2E7LA 3TH4T 1YN6A 2IPUG 1OM3L 5C3LD 3H9SA 2IH3A 4H20H 3DGGA 4PYGA 4YH6A 1MFDL 2MJWA 5ANME 4XMKL 5GZOC 5I71B 4ZYKB 3IU3B 4BZ2H 3UJIL 2R29H 4JHAH 1KN4L 3PWPA 1BFSA 4O51B 1NUNB 2PTTA 1I1AA 4HH9A 2D2OA 2YWZA 2ZCKH 5ICYA 1A7QH 1NDMB 4L8BB 1IC7L 3HAEB 3UTTA 5BRZD 1XFPA 3GM8A 4LCCC 5KSAD 1ORSA 3QDJB 4TUJB 4HS8H 1P7QD 5FM5O 2EDTA 3MLUH 2FJGB 4ZO6A 5KANI 4ZUVA 3EYVA 5FHAH 1KB5B 4M7ZB 3FOLA 2QQKL 3LN4B 3RX7A 4C59B 2OTPA 4XXDB 1MIEL 3O2WL 2KBGA 3RY6A 4HSQA 5E8DH 5D72H 3HPLB 3K2UL 1EGJA 3BJ91 4FQLH 4RSVA 3HMXH 4X9BA 4MS8C 2PO6B 5IMLB 1GJIA 5IT2L 3VD9A 1VB9A 5MERB 1V3MA 2CDFB 3QDGA 4R7DA 3RWGA 3ARGB 4MXVF 5HGHB 3DBXB 2AJ3B 4LLQA 5E8OB 3ZYJA 2O5ZH 2HT4D 5CP7A 3VD4A 5HGAB 4AQOA 1CLZL 4KVCH 4O2CA 4OGYH 4XNYH 2P5EB 4WJ5B 1HYRC 1MPAL 2FATH 1CE6B 3VG9C 5BCAA 1A64A 2XPGB 3QSKB 5JOFB 4XX1G 5MENE 5DURB 1OAXL 3ARFB 1A9BB 3TBWA 4KMTH 5FOBA 4Y2DD 4LEXH 4JKPH 4OGZA 4YHZL 2ITCB 4IRSA 5DEFB 1DUYB 1AY1H 2ZSWA 5I71C 1GGIL 5EU6E 3MSPA 4YWGH 1SYVA 1NAKL 3PHQB 5ACZA 4PJGE 2W60B 1VCAA 3OXSB 4PJHF 1V3KA 4Y4KD 1RZIA 5C0FB 3SDDA 5B38G 3TPKA 4Z7WA 1G0YR 5JHDD 3DVFA 3MNVA 4OD1L 4NRZB 4QRTA 3RKDC 3S35X 1OGAE 5SX5K 3VXSA 3S8WA 4Y19D 3B3IA 3ARYA 4CKVX 2Q8BL 1T04B 1HSAA 3TIEB 3REVB 3CX5J 2O61B 5HD8D 1JUFB 5CSZA 4M7ZC 4OZGF 5JPMA 5L9DL 5DLML 3B9EA 3BH9B 1SEQH 1Z5LB 4HK0A 4PJAE 1KTLB 1N0XH 4KXZH 4OBSA 1KCLA 5A3ID 1INEL 4WO4B 2PO6C 4AG4L 3KYOA 3FJTA 1ZLSL 3L3KA 3BYYA 4Y5VB 3MRBB 4YEEA 3UJJH 5IVZA 3DRQA 4A6YH 3STLA 1WJ3A 1OAKH 5L8KB 4WI7A 3RDTC 2R23A 1DBML 4D0BA 3ARGC 3O4LD 3VXOB 3ULVH 5ELIA 5TH2B 1KPRB 2DLFL 3UTSB 3Q6FB 1KGCE 2R0LL 1MQ8A 2BJML 5IB3B 4PGBB 1L7IL 4TSCL 3MRRA 5IKCA 4G8IA 1DQDH 5E8NB 2C7UB 3WUWB 5JDJA 3OG4B 4OLZL 2APXA 2YK1H 5HDQL 2AJVL 3MV9A 4Z0BH 4HZLA 4FG6D 4LSRH 2YD8A 3ARFC 3GJFB 4ESKA 2X6MA 3O0RH 4PTTB 4NDMA 1TENA 2AXJA 5EIIB 3VFOA 3JWDL 2CRMA 4CBPA 2XA8L 2I9TA 1E4XH 3IFLH 1G9NH 5LWYL 4DN3L 2AEIT 4P9HL 5IVXA 4YDJA 1RK1B 3T3ME 3SDAA 4IOFC 5B3JE 3MCG1 1YNKL 4U1IB 3BVNA 5J9PA 3LZFL 2QEJA 4GOSA 3LN9A 1LGVA 3BPCB 1FVDB 4D0DB 3LKNB 1AGCB 4Y4FD 5CGTA 1MHEA 1CF8L 5CEXB 1FCGA 5DSCB 2L4OA 3QBTB 4EJ1C 1FE8L 3DROB 1KFAH 1MSPA 3G08B 3C8DA 1QFWM 4LCYA 1TETH 2ATPA 3ZE2E 4M1CC 3LKOB 4WFFD 5E6IB 3U46B 4KROD 1FRGL 4KRPB 5FKPA 1WBYB 4LIQE 1UJ3B 4N1CA 5J12B 4JG0H 4PG2A 4Y5VC 2BMKB 2PW1A 4FTVA 3HLAA 4MMXC 2JLLA 3QG6A 2HRPH 1Z9LA 4XP9L 4XWOC 5KTEL 4G8GA 4WENB 2KDGA 1RJCA 3QAZB 4NZRL 4DN4L 3LS4L 1INQB 3RTQD 1W8OA 2X4SA 3CVHL 5GS3A 2E8YA 1NDGB 3GSWB 4OD3L 4RNRB 3S36H 3OKKB 3BD5A 3QISA 2DBJA 5DFVC 3DYPA 5D70L 5C6WH 1EO5A 1NGQH 3TESA 2N7AA 3FTGA 5E70A 5A2LH 5F6HJ 5FV1L 1ZT7A 8CGTA 3ILPA 3QIBC 4FN0A 3SDCD 2HT3D 4K3EL 1D5BA 1C5BL 3K3QA 4I9WD 2VO5A 2VQ1A 4F7TB 5IEHB 1URLA 4LQ1A 3OAUL 3GMQB 1EHLH 2IAND 3D3VB 2J4WL 2RFXB 5GGSA 3GRWA 3W0WD 2D7MA 3VRIA 1IGJA 1BQSA 3V2AR 2WINA 4OI9A 4X8XA 3TV3H 1X5ZA 3HUJB 4WHYH 5ERWA 4NQDA 5JA8B 3QULA 3FCTA 1FC1A 1RULH 1MFEL 1ULVA 2D7NA 1J8HE 5AAWA 4N1HB 5DJ2B 3U2SA 3EO9H 3QWRD 4JZNB 4B0MM 1QBLH 5E6IC 2GK0B 4C83A 4KRPC 5IW3A 4UNTA 2MKLC 3HC4H 1OLZA 1UJ3C 2A74B 2BVQA 2HKFH 2OXHA 3B9KD 4MJ6A 5J12C 4OLEA 3SGKC 2X40A 2EH7H 3KDMA 5F1NB 3RZCA 2K7PA 3ZT6A 2Z8VC 1H3TA 3FN3A 4E41B 4XNZB 4PV8A 4Z95L 3QAZC 2ADFL 3U79A 3OWEA 2XZQL 1P6AB 4I48A 3NH7L 1P4BL 5GRVL 4L3CA 4BYHA 4M5ZL 4ODTL 3QIUD 1F11A 1IKFL 1GGCL 1QKZL 1EEZA 2DN7A 1S9VB 5HHPB 3JVGA 3ZKMC 4YAQB 2L7UA 3VFPA 1D5IH 1U92B 1IC5H 4DK3A 4U1SA 2OR8A 3D6GA 3U9PL 3QI9A 3OGOE 1T0PB 2Y06L 1YUHB 5GQBA 4HJJL 4RA3A 5F9WB 4LIQL 3P0VL 3O8XD 5MHSE 3SKNA 1JPTH 3O2DL 4PJ7E 3MUZ1 2A6IA 2AJUH 6CGTA 1OY3B 1PDKA 4LLDB 1D6VH 5DYOB 1WFOA 4NQCA 1A5FH 1GOFA 4HGWA 1G7IA 2XTJB 4JO4L 4X7CC 4XPHL 2J8UE 1VFBA 2ICWI 1A6ZB 1S9WB 2AGJL 3D39D 4N0UA 2XRAL 1JZ5A 4QHMB 3IDGB 1VESA 5I0ZA 3LS5L 4UINL 2AJXH 4TPRL 1IAOA 4XGZB 5CMAB 3NIGE 2OR9H 5CEZD 5C0CA 4IRJB 3B9AA 4OGXH 4K9EL 4PP2B 5KSUB 1D5XB 3EOBB 3LHPH 5CGMA 1MCWM 1VEOA 3BPLB 3IAPA 1XR9A 2W0PA 4MAYD 4ONFH 2NZ9D 3MLSH 4R4FH 3V8OA 1OF2A 3LEXA 4XCYB 2EDEA 4HLZG 5JO5A 4JZOA 4P3DB 5IHZA 1ITCA 2NY4D 2E9IA 4XCCH 3DO3A 4PJDE 3W39A 3DECA 5AWNL 4LSPL 3C60A 4UAOB 3CK0H 4LDEB 1XCTB 4JKKA 1JZ7A 3GNMH 3QQ3B 3BUTA 2IPKA 2H2SC 5FUZH 1M7IB 4YO0A 2B1HL 4MXQC 2A2QT 4KUCD 3TNNA 2ILLA 3DURA 5F9WC 3KLDA 1Q0YL 1JNHA 3MRJA 4J3TA 4S1SL 1CR9L 4X6FB 5HHXL 3C2AL 3H9SB 3QO1B 3UPCA 2IH3B 1KJ2B 1T5WA 1II4E 3AY4C 1K85A 4G8FA 3MACL 1FO0L 4PJ9D 3RUGA 5IFAL 4M6AA 4QWWC 3VXUA 1UA6L 1UXSB 4YBQC 1J0KA 1WT5C 4H8WH 3SQOH 2J6EA 4FFYH 1I1AB 4HH9B 3WJLC 4AT6A 4NO2A 4YUEL 1BOYA 2X1WL 4GKZA 1HH6A 3D85D 2B1AH 2NY0D 3V7AG 1XCQB 3KPRD 3GO1H 3QPQD 3UTTB 2DI9A 3C6LA 1R3KA 2VN4A 4EOWL 1ORSB 3ZSSA 5D2NB 4IRJC 2A6JB 4JFDA 4WI8A 2JE8A 1LEKA 4N90E 3EYVB 1ZK9A 5D5MA 1F58H 3BPLC 3ZDYF 1QSFE 3IYLW 4HKBA 1G6VK 4QNPF 2NY2D 3Q5OA 4HUKB 1FORL 2VABB 4PR5A 1EHAA 3SE4A 2DI7A 2DQDL 4HIJA 1KLUA 3HNTH 1NH6A 3G5YB 2GI7A 5I1CH 2Y6SD 5GGUA 4NO0B 1WSST 3QUYA 4R8WH 2D7OA 3PGFH 1NCDH 2AS5M 4PFEA 3EFDH 3QDGB 5MI0B 3CD4A 1J12A 2VZ1A 2HT2C 4KJWC 1X3DA 2N56A 2ED8A 3D0VA 3CDGA 4R7DB 5JIKA 3RWGB 3VCLA 4UAOC 2Y36L 4Y16D 4LLQB 4KU1A 4YHKL 2I25N 4Y7MA 1Q38A 5CP7B 3BW9A 4XAWH 5ESQA 4YHNB 2H26A 4HFUH 4F57L 3MRHB 1HQRB 1F45A 2DTMH 5E24E 3KPLA 1F90H 2EIBA 2BY2A 3O81A 3RIFK 2XV6B 4JPKH 2E7LC 1OGTA 5T5NF 3SGDH 1NBZA 5IJVA 1PY4A 4XP5L 3U7YH 5EUOA 1SYVB 4PY8J 4PGDB 2ORBH 1U3JA 4GRLA 1WCQA 5JOPE 5ACZB 1RZIB 4Z7WB 1BLNB 1I1AC 4LLAA 1WZ1L 5EOQL 4MJ5A 4K8RH 3E0GA 4J3VA 3TO2A 3MNVB 1BIIB 5D93C 3MXWL 3VXSB 1TJGH 3B3IB 4M93B 1X6NA 1G7LA 2FYYB 5TQ2L 3GSNH 3D2UD 1J87A 1OSZA 1OSPL 4JQXA 5CSZB 1CFNB 3QCUH 3TVMB 3BIKA 2RQ8A 4HK0B 4MNQD 4WDIB 2M8XA 4S2SB 1ZS8A 2RR3A 2IAMA 3KYOB 4JFFD 1HHJA 2XKNA 3EZ8A 3ZO0A 5FYKH 2VDNH 5EU5A 1J18A 3C5ZA 2D4FA 4HC1A 5MI0C 4N8VA 1ONQB 3KPQA 4NO5B 1MY5A 3FT3A 3L5HA 4QHKJ 4D0BB 3TF7C 1NCUA 5DJAB 4AH2A 3EAKA 3UTQA 5C07D 5FKAA 4X6DB 2Y5EA 3CDYA 4OIAA 5IKCB 4XXCA 2GIYA 4JM2D 1J5OH 4ODVH 5C0EA 1IC4L 5K9KA 2YHGA 1S5HA 1F4AA 3MV9B 3PDDA 2WUCH 5DS8A 1IBGL 3SO5A 3RVUC 4FFWC 3X11A 4YEFA 1EFXD 4NDMB 4AIZB 4IRSC 2BSSB 3VFOB 4YIQA 1A4KA 1EMTL 2I9TB 3NCCB 3PGDA 4QT5A 5F88A 1MJ7L 2IH1A 2H32H 3WFDL 1TDQA 3OJDA 4FQ2L 4CN1A 3SDDC 5A2IH 4YDJB 3SDAB 4OZHA 4JFQA 4EUPB 5BRZE 5GGRB 4RGMB 5GISL 3ZTJG 4PRBB 3MMEA 4QHUA 3LB6D 2WM0A 4U2ZA 4Z7NF 5J9PB 1H3VA 1DP0A 2Z35B 2O93L 1N3NB 4L5FH 4M93C 5C0IA 1JZ6A 1IE5A 4OFPA 1S78D 5T3XH 1MHEB 1U8IA 2P5WE 3LPFA 1MHHA 4F58H 1HQ4A 1KV3A 5JHLH 2HTKC 2ID5A 3TVMC 1A7NL 4P57B 2XN9B 5JQ6H 5FKPB 2EDJA 3WKNA 2MSPA 1BJ1J 2JK5A 1IFHL 3QEHA 4OJFH 3HTLX 1TJHH 4FTVB 4X4XA 1MJJA 3QG6B 2CPCA 4IRZL 4G8GB 4XCFH 4RMVA 1G6RB 3L95A 1F6FB 5TDNA 1S9XA 1X7QA 2X4SB 4FQJH 3ZYIA 4QRQA 1I8IB 5DXWA 3L1OL 1CXFA 2ZUUA 3M1BB 4N0CC 1N6UA 5F9OL 1VFUA 5DK0B 3OJMB 4HUWA 4NCC2 3L3GA 2WUBL 3HZVA 3BO8A 2B4CL 3FTGB 1L7TL 1JGDA 1KB5H 3LVEA 3BUYB 4PLKC 3TZVB 1WZLA 4N9GA 2IQ9L 5L2KE 2ITDB 4OV6F 4OF7A 3P3YA 3ZHKA 4MCZB 4WWKA 4PRPA 2A9MH 4MNHB 5I8CB 5TE4H 3PWVA 5JHDE 5T5FL 3PJSB 3QDMA 3Q1SH 3CDCA 3SDAC 4FABH 1IGJB 1NBYA 3MV7A 4FMKA 4PJ8B 5DD3H 3D18A 4RGMC 2NXYD 3I6KA 2OBGA 2WINB 4Y19E 3SE8H 4D0CB 4M62L 2X42A 5ERWB 4NQDB 4XPAH 3GMMB 3SN6N 1H3GA 3QULB 1QVOA 3FCTB 1YEGL 3ALXA 5TF0A 1KCVL 3RWFA 1E6OL 4TTDD 3SDXE 1I7UB 2D0FA 3HNVL 1NC4D 2IMNA 5FO9A 3CSYB 4OGAC 3KLSA 2ADIB 1FFPB 1IAMA 4YXKH 2R2EA 3WLBA 4C56E 3T0EA 1MWAL 4MJ6B 4Z7WF 1FNSL 5EZIL 4FZ8H 3KDMB 2ESVB 4XT1C 1SMAA 1LK2A 1MCIA 3JWOH 3RZCB 2WANA 3QEGL 5E5MA 4YDIH 1NCWH 4JM4L 4UOJA 4KAQH 3E6HB 5E2VL 1ADQA 4NHCL 4HMCA 4OF0A 5IWLA 4I48B 2PCPA 4L3CB 1SEBA 4WU5A 3A6BH 3IJYA 4LLWB 2Z0BA 3ZZ1A 4KHXH 3SCMD 1UVQA 4ZAKD 4RGNE 1F11B 3HG1A 1Y6MR 1DLHA 1AGEA 1N6VA 4NQUA 4L9DA 5DMIL 3BQUD 5BW7A 4CJ1A 1GGUA 2D7PA 3G6DH 5FYLD 4L4TA 3TZVC 3ARBB 4HQQL 3QI9B 2VDOH 2AK4D 4F37K 4JPVH 4XMLL 2E6QA 2J3SA 2QKIB 5JZ7C 2HTLC 3UPRA 1EIBA 1E4XI 1RMFL 2DKUA 1MHPL 5JA9A 3SKNB 4N0FB 1BVZA 3G6AA 3BFOA 3P4OA 4X6DF 3ZTNL 4NZJA 2DI8A 2VDKL 4JO2L 4Y4HA 3F58H 4NQCB 4PJ8C 1CDCA 4Y1AD 5I18H 1CN4A 1VFBB 3TBTA 1YYMH 3T0DA 4MLIA 3WXWH 4N0UB 3GZKA 3OB0H 2NYYC 3OKNA 3B2UD 3WDHA 2G75B 4HV8A 5B38A 1HE7A 1RJLB 4QRPA 2R1YA 5DF0A 3IDIA 1IAOB 4RISH 3INUH 1F2XK 5GRJL 3NAAH 1CD1A 2EDRA 5IQ7H 4OCLC 1JF1A 5ECJE 5DHVA 4OCXH 4M5YH 3C09B 4I77L 4F80A 1J05A 1XR9B 5DK2A 3RZCC 1FL6A 2E6JA 1D7FA 1P5UA 4J3XA 4GBXD 3RNQA 2F54D 3H9ZA 1DFBL 5SWSD 1B0GA 3LEXB 1E4WH 2LV4A 1W8NA 1WFNA 2FO4A 4JZOB 2DMCA 6FABL 1CK0H 4M7JL 2J7LA 3W39B 2A77L 1YEKL 3VFUA 4FP8H 5EOCL 2UZYB 3C60B 4LSTH 5T1KA 4B7IA 1DBJL 3CPLB 4KK9D 4GMTH 3QJFA 2E5EA 4KMLB 4JRYD 4TQEH 3VXRA 3JVGC 4YQXL 2R8SH 4OTXL 2F8OA 3EOAA 4N8PA 1C1EH 1U3ZA 3HZKB 2IPKB 3UBXB 3VFMA 3ARBC 3QI9C 4DAGL 4YO0B 4LSQH 2FB4H 3U82B 3MRMA 3TNNB 3DURB 3QG7L 3NCBB 3S35H 1Q9LA 4UIKH 3WNKA 2IANE 3RL2A 4XPGL 1WZKA 2MTPA 4H5SA 3GIVA 4IDLA 3W0WE 3VXNA 2VLRE 3P0YH 4OCYH 4CU7A 1F8TH 1U91B 4YJZL 1T5WB 4G8FB 3RUGB 2CDEA 5I0DA 4F2MA 1LDSA 3VXUB 1MCNA 2V9RA 5DHVH 1FZKA 3AXLA 3OBAA 2DKSA 3QEQA 3CFCH 2GSIA 4LSVH 1BBDH 4AT6B 2COQA 3PGCA 1XF4A 1T20B 4GKZB 1HH6B 2RAMA 1LO2H 3NABH 5F1KC 5TE7L 4NGHL 3C6LB 3IF1B 1HN1A 3U7WL 1D6EA 4QCIB 2X4UA 4JFDB 4B7LA 3RFZC 1LEKB 4ZNCD 5HJ3B 2I24N 3C09C 5D5MB 2FGZA 3LKSB 3MA9H 5FO8A 4PR5B 2V6HA 1JPST 1DQMH 2VDRL 4HIJB 1T6VN 1QPXA 1KLUB 1CTOA 1MQKL 1QLRA 5GGUB 2EH8L 3GMRA 3RIAK 4U1HB 3QUYB 4W68A 3U0PA 2VMFA 2R0KL 1IEBA 1D5MA 1F3RB 5D71L 3C60C 3CDGB 1ZEAH 4F7PA 1A1MB 5TPWH 1BGXL 3L5JA 2DYPD 3FN0H 4ALAH 1CXIA 4G7YL 4KZEH 4H0HB 4CVZB 1ZVSA 4L3EA 2CKBL 4JB9H 5I8OL 2VB5A 4FQXD 3SGEH 3BW9B 4G9FD 3WSQL 1NLBH 5ESQB 1EBPA 2DM4A 2H26B 3QA3A 3QUZD 5CEYA 5IHUL 4MGXA 3J8F7 4HEME 1PGRB 3KPLB 1OTSC 5CP3H 4NQEA 5E2WL 1U8OA 1UB5B 1R3HB 4CRPA 4ONHA 2WWKT 4N8CL 4U7KA 5CIPA 2PYFA 2EKSA 2EXWC 1OGTB 5ISZE 4N68A 4Z18A 1IEAA 4PD4J 1CFBA 3DV4A 3VFGH 5C71A 3C2SA 4MA1B 3WO4B 1S7TA 3GSRB 4WFHE 5EUOB 3EYUL 4MQ7B 1JNNL 3MFGB 3D39E 2E27L 4DUXA 1HINL 5MP6L 5JQHC 2R9HD 5EBGA 3L7EB 5DGRA 4F7MA 4MJ5B 2VXUH 3TO2B 2HFFA 1IGMH 1PZ5A 5CEZE 3KNBA 4G6KH 3HN3A 3QZWB 3C6LC 5IGXL 5GZOD 4OLVL 5LGJB 2UYLA 5F9AC 2NNAB 1QR1B 4M6NH 3EFFB 1K6QL 5DGQA 2NR6C 15C8L 1SBSH 4DZ8A 5EC2A 1ZHNA 3GI8L 3SE4C 1KJ3L 1ZS8B 1ZLVK 2YUZA 2IAMB 1AO7A 3ZL4L 1LDPL 1OAYL 5INCA 2X05A 1K4DA 3QUYC 3PDGA 4KJQC 3ARVA 4I2XB 1DZBA 4NKOB 5EU5B 4N8VB 4K7PY 3KPQB 3FT3B 1RVFL 2MWCA 3QNZB 3IFNL 1GHFH 3IFPB 4HT1H 2QR0A 3R1GL 5FHBL 3FMGL 4P5MB 4NKDA 4AH2B 5C09D 3UTQB 3PWNB 1TQBB 3WIHH 2A1WL 1RUAL 5IW6A 2YUVA 4MS8D 4I13B 3WXVH 3N1PC 1FGVH 3KXFE 2LAGB 1J0YA 2V5YA 4KDTA 4HWUA 3K80A 4X9GA 1MVUB 3RP1A 3O3AB 3L3IA 2EDWA 3PQYB 5SWZA 1UH3A 1JK8A 3BKMH 2AEWA 2G9HB 3CAFA 4MWFA 3RNKA 5KS9A 3RX5A 4MA1C 3WO4C 1AE6L 5I19H 5E5RB 1N4XH 1T0MB 4X9HA 1D9KA 3PGDB 1N59A 4JAMA 4QT5B 5E2TL 5F88B 3O6KL 2V2TA 4BK5A 3MRIA 3IDMA 3PP4H 4OZIE 3OJDB 4K2UL 4XPFH 3HZYA 3QYCA 4OT1L 3U4AA 2VQUA 1UM5H 4JFQB 5DQDH 4HBQA 4PJIE 1KT2A 3PWJA 3TNMB 2HRLA 3O9WA 1QSZA 5FOJA 2J2ZA 3ARQA 1X5KA 4U1MB 1KIRA 1N0LA 3DI2B 5DDHA 4XH2A 3SO3B 4IS6A 5DMKA 1U8IB 3KS0H 2V7NA 4JQXC 2QADC 1XGPA 2ZOLA 1MHHB 1HQ4B 1FH5L 4GG6E 4P4KA 5KOVC 2P43B 3LEVL 5CJ8A 1A7OL 2DQGH 4NJ9H 4PV9B 1V7ML 1YMMA 4LPWA 4QTHB 4L8CB 1DBKL 4HDIA 2IAMC 2I27N 1CLOH 1YEEL 3VGDA 1ZHKA 1KJ2H 5CD5C 3BP7A 1ZWIB 4MXWH 3RKDD 3IKKA 3QEHB 1CT8A 1AR1C 4ZUSA 1Q9OB 3F6IA 1I8KB 4X4XB 1DVFA 3QDJD 2DQTL 1KIPA 1MJJB 1EJ6A 1NFDA 1BVLA 4RAHA 4EI5A 1LO4H 3U30B 2FEDC 2APFA 3L95B 4URTB 4DZBB 1S9XB 1X7QB 4JN2B 3DX8A 3MUGA 1BOGA 4PJBA 2CIIB 1TQBC 1YNLH 3C8KA 1OB1A 5D5MF 5IMKA 2Q6WA 5CEZL 3NPZB 3LKQA 4XXCC 1YJDC 2PO6D 4HUWB 4YNYB 3NN8A 3BO8B 2Q7YA 2PF6A 4LKCB 1JGDB 4KI5C 3D1MC 2YC1A 3RDTD 4N9GB 4LCIL 1DLFL 3ARGD 3TEUA 1RV6X 2DIAA 4LSSH 1NKRA 2JJTA 4DOHE 3ARDA 3SKUD 1A6WL 3K8MA 1XH3A 1A02N 4YHML 5KVDL 3D0LA 4XCNA 4GAFB 5E8PA 5FF6A 4HMDA 3PWVB 5DJ6A 3QDMB 1R0AH 4XNMA 1SJXA 1Q94A 4KVNL 2R1WA 4L8DA 3SHSA 5DURD 3MV7B 2VERN 4D9QD 2QSQA 3TJHD 5GGTL 3ARFD 5FDWA 3KJ4B 3MJ8A 4OFIA 3LSOB 3SO3C 3TPUA 1QVOB 3U4EA 1L6XA 1ZA6B 4NWUL 5FO9B 4BUGA 1RZ8B 4LCUA 3HI5H 2I9LA 4N1EA 4HPYL 4IOFD 3WLBB 1NSNH 1ZHBA 3NCMA 1JPGA 3CFJB 4Z0XA 4E42B 4HS8L 1I7TA 3E2HB 5B8CA 2BNRE 5FHAL 2RB8A 4PJEE 3H0TA 4HWEH 5DTFB 1S7VA 1MNUL 5F93C 3U30C 4GT7A 5HHMB 5C07E 1TJIL 1QNZH 4FQLL 1SEBB 5L88H 1KN2L 2P8PA 4M1CD 2OJZH 4Q9RL 3IJYB 2VLJA 2V5MA 1UVQB 2BRRL 5GGVH 2OK0L 3H3KA 1DLHB 1QRNA 1AGEB 1QPPA 4DFIA 4Z7OF 1NCCH 3WMSA 3MGTA 4F9PA 5BV7B 4ZSOB 1C08A 4XWOD 4L4TB 3RBSA 2O26U 1MIMH 1W2KT 2MPAL 4HXAH 1OP5K 4UTAH 2PUQT 3KPSA 2ICEA 3UTSD 3UPRB 4OGYL 5CD3A 1XZ0A 1ZHLA 4WWKC 1RZKC 5GS2H 1X44A 5C0BA 1NL0L 5DFVD 1EVUA 4HF5H 5E9DA 3I6LD 1PY9A 3WIIL 4Z7UA 2X1QA 3G6AB 3GEWB 3P4OB 4ONGH 4KWUA 1RSFA 2ZUQB 1Q1JL 4KMTL 5ID1A 4P3CH 3TH2T 2F19H 3W9DB 2AQ3A 3TBSA 5EWIH 1G7MB 1MUJA 2QSCL 3KJ4C 3QIBD 1CBVL 3LD8B 2OYPA 1BP3B 1ZT4A 3OKNB 1OD7A 4HV8B 5B38B 4G80A 4R7NB 4U6YA 1NPUA 3OX8A 4O58H 1KG0B 2YSSA 5F9JB 1FYTE 5EZLB 2FWOA 4RDQG 1X5HA 4GRWB 4GMSH 1JI1A 2VXSL 2HG5A 3T0EC 4RMQA 1BJ1H 2FL5B 3EDDA 3E2HC 3IT8D 3R8BB 1J05B 5DK2B 1P5VA 1F00I 1FL6B 3OXRB 1OQOA 4F3FB 3RNQB 1HNGA 2P46B 1B0GB 3I6GB 4FNLH 3O2VL 3HC3L 5IWLC 2FO4B 3OMZA 1OPGH 1P9MA 5E6ID 5FM5M 4ZXBB 2D9CA 3Q2CA 4KRPD 4LKXA 3RBGA 1I7RA 1NAMB 4G43A 4A6YL 4MMZC 5EO0A 5E6ZA 1OAKL 5JIPA 3V7MA 4OB5H 2AEPL 3QJFB 1N5YH 3VXRB 5F3BA 1GAFH 2R56L 2OM5A 2CIKB 2ATKB 2V5SA 3R4DA 5BV7C 3O6FA 4I3RL 3VFMB 2BNQE 3QXUA 3GMOB 2QV2A 3EJZC 1RIHH 3HB3C 1FCCA 3MRMB 3OKEB 4YBHA 4PTUA 3MTRA 3FT2B 4G7VL 3RL2B 3BZFA 4FQIH 4H5SB 3GIVB 4ZO8A 5F97E 4PY7A 5HDBF 1RZGB 2O5XH 3OZ9H 3BKCH 4HJGB 4U1NB 2ZUQC 4LCWA 1K8IA 3DSFH 3ZKMD 1G6RH 4NZUL 4HWBL 1E4KA 4QYOA 1B88A 2N4IA 1AJ7H 1FZKB 3NMEA 3SY0A 1H0DA 1CFSA 3QEQB 3QUXA 3LD8C 3IFLL 2CRYA 5GGQH 4PBXA 1V05A 2XQBH 1GOGA 5KSBA 1XF4B 3T1FA 3AS3A 5I1EH 4FZEL 4UILH 3TYFB 2I5YH 3D3VD 2X4QA 5A16A 1S7QB 2VDMH 1MRDL 4P2RA 1D6EB 4ZDHB 5EU7E 2X4UB 1HNFA 4WW2F 2DOCA 2EEAA 3T77A 1AFVH 5T1LA 4NUJA 5HHOA 3KPMA 4F15B 3S7GA 5KAQF 3BDXA 4FFVC 4WFED 2BVEA 5FO8B 4OM0H 2NY5C 2XXCB 1FZOA 1LP9B 2MOVA 4JFYA 3ROLB 3G6JE 4Y89A 4MJ2A 1NGXB 3FFCA 3GMRB 3U0PB 1D5MB 3DXAA 3I9GH 4JG0L 3KPOB 4FRWA 4PJXE 3AU1A 3PXJA 3QCTH 3DRTB 3WNNA 5FYLE 5TDOA 4V1DA 2EYRB 2R2BA 3MJGX 2VISA 4KH2A 1QSVA 2MKWA 4L3EB 2XFXA 2AK4E 4EDWH 5FUOL 1GCFA 1V8HA 4JKMA 2C1PA 5ALCL 5CEYB 3JBG7 4WHCA 1ZGLB 3VFWB 2NY3B 1ZGLP 1LNUB 3RKPA