4DOHE

Il20/il201/il20r2 ternary complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
204
structure length
204
Chain Sequence
b'KPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYARVRAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-20
molecule tags Signaling protein
source organism Homo sapiens
publication title Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
pubmed doi rcsb
total genus 37
structure length 204
sequence length 204
chains with identical sequence R
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dohE01
2GY7B 1J1OL 4PY8J 1A6VH 3HUJB 4LPYA 2X1OA 4JFXB 5J06A 3WDJA 1OPGH 1B2WL 4XHJD 2HKHL 2JF1A 5TQ0L 1RK1B 3E8UH 3B9KB 4LCWD 4KKAC 4QT5A 4TOYL 3HR6A 4JDZB 2XG5A 1AGCB 5F6IC 4P59L 1DCLA 4D9LL 3KXFA 2CK0H 1ZLWH 1UJTA 5C9KA 4FQXB 3S97C 3FQWA 1MRFH 2HT3D 5AD0A 5BCAA 4PRPE 4G8EB 4PJHE 4WFFD 2NY3C 4P0DA 2FGWL 1EO8L 1XCTB 5TE4H 4YDKL 3VRLE 3AAZB 1Y6KR 2FCBA 3MV7B 4XVUD 4L3CA 4OFPA 5FO9B 1CLZL 3UC0L 1ZGLA 2AABH 4BK4A 5JW4N 4KJWC 4L8SC 1V3MA 1H8SA 4Z76A 2CRYA 5MI0B 3E8UL 2EH7H 1S7QB 4JY4A 5FM5M 4TQEH 5C2BH 3IDJB 4NKIL 2JIXB 2QSCH 3VXMD 5JW4R 4FTVB 2OK0L 3LCYA 2LU3A 2WIMA 2XACC 5I9QC 1NMBL 4U0QB 3RAJH 4TUOA 5HVFB 5MENE 1MFEL 3GMRA 1OAUH 5E6ID 2QADD 4HJJH 3IXTA 3GJEB 4PJ8D 1WVZA 1ZS8A 4HWNA 2OLDA 3MA7A 2WWKO 3DMMC 1B2WH 4Z7VB 2HH0L 4YDKH 5I1EL 1QFWM 2Z91A 3CFCH 3QIWD 3TH4T 4OUUB 4OZ4B 3RIFF 5MEOA 1H15A 1CE6B 4UV7L 1P6AB 1G7IA 4OF6A 2HG5A 4P4KA 5IESH 2CK0L 4M8QB 4PRAA 3C60A 4ELKA 1ZANH 4ZMAT 2AEIT 1F4WL 3DXAB 4YXKL 5DYOB 4PRHA 1FSKC 1ZGLM 1EHXA 5FV1L 3WD5H 4C56E 3QBTB 4Y1AA 1HINH 2Z8WC 3EOBA 1KIPB 4MXVE 4YE4L 2X5PA 4MA1B 4WFEE 4PRHD 4Q9RL 4L9LC 3CUPB 2WWKT 4NN5B 5EU6D 5HI3C 3V8OA 5AEAA 4WO4A 2QR0B 1J0ZA 3C9NB 2G75B 1KLUB 1NBQA 4Y8DC 5ALCL 1VPOH 3OF6A 1NGPL 1A8JH 2A77H 2VL4A 1F00I 5I1LB 1FE8H 3ARXA 4YXLH 1CFQB 1K3ZA 5MP6L 2WBJC 1J10A 3QRGL 5C2BL 4RFEA 3U7YH 3HE7A 1I4FA 1MCBA 4MJ5B 2YRPA 4Y4HA 3RP1A 2UZXB 5EZJB 4M93B 3T2NL 1BWMA 1WEJL 1JPTH 2G5RA 1U3YA 2X9YA 5I0DA 3E0GA 1T2QL 5ALBH 3MV7E 2Q6WB 1OGTB 4ODBD 3SHSA 4AIZA 5C0JB 3GSUB 4OFYA 5I1JH 1CLYL 4K3EH 1N0XL 2ITCB 5C07A 3L7EB 4MLIA 1IC5L 2EO9A 3HZMB 5C1MB 5T3ZE 4CDHA 4IRJA 4QTHB 4HG4J 3F5WA 4L8SA 3G5VA 3P40A 5J1AB 4QOKE 4U6XB 2KZWA 1DBKL 3X3GH 2FH8A 4LPXA 3FQXB 3K8LA 4FQPA 4JG0H 4OCLC 1S5IH 4HT1L 2R1XB 1REIA 4HXAL 4G8GD 4CAGA 4NQCE 3FO2B 5GSRA 3O8XD 1T1ZA 1GPOH 5GS0D 3WFZA 4LSUL 3V4PH 1T4KB 2X42A 3VXOB 3SQOL 4PGJA 4OI8A 1KB5B 5FF6A 3BKJH 2NTFA 4JFDD 4CMMB 1TVHB 4Z95L 1I8MA 1KEMH 4OGXH 2NY5C 3CSPA 3LSOB 4NPYA 4LVNB 2XXMB 3MV7A 3ARVA 3C8KA 3HI5L 1NUFA 5LGHH 1MY5A 1DLHA 3EO1A 4PB9H 4JQVC 3EKCA 5I8OL 3T2OA 2A6IA 5FB8B 1L0QA 1RJZB 4NQDE 1CTNA 2GYSA 4Y16C 3NVQA 4J4PD 1T6VN 3MBXL 4K7PH 4G6ML 3ZKMC 1RK0A 5C86A 3EDDA 4N5ED 3IDUA 5E8NA 5ITBL 1CGWA 2R29H 1TXKA 1A7NH 4GW4A 4PJEB 1XEDA 2AI0H 1RQ5A 2DKSA 2H32A 2A74A 3ROLB 3JVGC 1TTUA 4FXLA 1RK1A 2R23A 3TBYB 2E6QA 5ID0B 1DBBH 3QXDA 2BVOA 5DHVA 1U8QA 4LF3B 2JE8A 1QBBA 1DFBH 2WWMC 5F1SA 3O41A 4JKPH 1IJ9A 1L7TH 4ZYKA 2HLAB 2BERA 3S37L 1CFVH 5L6YL 1LE9A 5HHPA 1KCVL 3OJVC 2YS4A 2BSSB 2NW2A 5T1DL 3QUMA 3MNWA 35C8L 2HT4C 4TRPH 4JRYE 5DQ9A 2VNCA 4LIQH 1A0QH 1P1ZB 4J3VA 3IU3B 1R0AH 4I5BB 3CVHL 5JIHA 4E0RB 4HMEA 3LD8C 2IFGA 3TNNB 1CGXA 1ORQB 4N8CL 4MJIB 3DV6B 3WN5B 5MENA 4EUPB 5JW4M 3RIAK 2V5TA 2AERT 1NCBL 3P4MB 3U4AA 1OB1B 1JE6A 2FHCA 5HYQA 1UACL 2ATKB 1F8TL 2AV1A 2BCKB 4K7PL 5HHQB 4ODTL 5DT1L 2GKIA 5DURD 2SEBA 1IKNA 4P2RD 5GGUA 5C0ND 1H5BB 4XP6L 1JYXA 1CF8H 3U30C 4KTDL 2QLVB 3QG6B 2ENYA 2OL3L 2R2BB 1U91B 1JGEA 3WCYA 1YN6B 3WHE1 3CFEA 1ZA3B 3HG1D 3X12A 3QI9D 1CL7H 5D7LE 1L7TL 2VZOA 4PLJD 4YDVA 4KMTL 3THMH 4PG2A 4U3CA 4ZUWB 1LDPL 4S1SH 3TO2B 1E0OB 3TN0C 2IPTH 1MHCB 1T5WB 3IDGB 43CAB 3HRPA 5D1QB 4ISVA 4XP9L 3SY0A 4YO0A 5I30H 5E2WL 4K07A 1JZ6A 5CJQH 3HNTL 5HGDB 5KZCB 1NAKL 3OKEA 3IAPA 3WXVL 1T66D 5D2NE 3PL6D 3VGAC 3TJEH 3EYQD 3GKZA 3I85A 3T8XB 2WMPA 2DTMH 4GUPA 5D1XA 3U9UA 2I07B 2IMNA 1ADQH 4HQQH 3C8HA 4M1GH 5IVXE 3DX9B 2R1WA 3FB8A 3EDEA 3E6FA 4QHLA 3FN0L 3R06B 1CDJA 4Q6IA 1JYVA 3VW3H 3D3VD 4EUPH 3R8QA 5E2UL 3KWWA 1V3LA 4U4BA 2ESVB 3MLXL 2NY0C 5DMIH 1DBAH 4MCZB 4HK0A 4JN1H 3DETC 4DWHA 1ZVYA 4PJFA 5I19H 5K59E 4YXHH 4UDUA 1JZ2A 3BH9B 4M93C 3BRGC 3P4OB 4NRYA 4ERSH 2GJZB 4HS8L 5GJTH 2YPKB 5TGBA 1M1SA 1A47A 4F8QA 2A83A 2DQFA 3QISA 4NUJB 5KSVA 5GRJH 4JGMA 5T3XD 2Y4SA 3RWJB 5C0DB 1G7HA 4KDWA 4TTGA 2KUTA 4PJDA 1V7NL 3ZTNH 3CZJA 4R90H 1O7SA 3ABZA 4OV6F 2NY1B 2JB5H 3WUWA 4MA1C 5I15H 4MQXC 4Z0BL 5JORA 3DO3A 5DS8A 3X11A 4UDTB 2YD6A 1FSKB 3MX0A 5ACMA 3RWEB 1AD0B 2E7BA 4I3SH 4FZ8H 1X7QB 4Y2DC 5I1HH 1JZ7A 1E4WL 2HAZA 4MXQD 5B38B 3O45A 4Y1AE 4Y4KA 4ZSOB 4WJ5B 2DQHL 5D2LB 5B8CC 2FB4L 4DTGL 2B8OT 4TTDC 3LOWA 2VH5H 2XWBB 2WLYA 1FVDA 4JRXA 3VXUE 1HHGA 4RNRB 5DJ8A 2VXSH 1I1RA 4KZEL 1R5VA 5T1LB 3H8NA 4ONFL 1YYLH 1IM9B 3TFKC 1U8IA 4GAJH 1UEYA 3S34L 4CNIB 5HYJD 1N59B 1YJDL 1GC1C 4J3OC 3M17A 4MJ4A 1HNGA 3VWJB 5GIRA 3HI6L 4AY0A 5I1LA 5SWSE 1MNUH 2HT2C 5BV7H 1MCKA 3EYFB 5D1QC 4CJ1A 1NBVL 1X5GA 4OTXL 1C5CH 2FX9L 3L3DA 3PG2A 1Q9WA 5ADPL 5FB8A 3WIIL 1NAML 2NY6D 3UAJD 5EU4A 4CVWA 3TH3T 1ZEAL 1NQBA 1T0PB 4U6HB 3SDCC 4G6FD 1IGYB 4JVPA 3QULA 2R0ZH 5DGQA 3AFLA 4XCCL 4X9HA 2AJSH 3GHBL 2WQRA 3G5XA 2BVOB 1HHHA 1FAKT 3TVMC 1NCDH 5CILL 3AU1A 4HULB 4OLEA 3V9FA 4L4JA 4FP8H 4ZS6C 3VFWA 2Z0BA 3VDAA 5ISZA 2XZCH 5DK3A 1LK3L 4P2YA 4Z7WB 3ULVE 4C57C 1OT2A 4NC2B 4PB0L 4Y89A 4Y8AA 3WKNA 2R69L 3VXTA 1IZJA 1R3IL 1QBMH 4NWTH 4XHQA 1A6AB 1Z9MA 3MRNA 4OZGA 5DD1H 1S7VB 2YPLD 3IS1X 1KACB 4MQSB 5EOTA 4ODVH 5KANG 3HB3D 4HIEB 4GRWE 4M1CC 4MNGE 5GS2H 2UVEA 4FS0A 4OM1H 4RZCA 4E0RA 2NZ9C 4Y19B 3F5WB 4L8SB 4MAYD 4NZUH 4KZDL 2O5YL 5DDHA 3V6FA 2DYPB 3ULSB 2QHLA 4JFFD 3RWCA 1FBIL 4XAWH 2Z93B 3B6SB 4IOSD 3GIZL 1N6UA 4F37F 1ZHNA 1ZLSL 4UTAH 5DUMH 4G80A 4Y5XA 1NAMH 4ZSOE 4KMLB 4H8WC 1ULVA 4G3YL 4YNYA 4TULH 3EFDL 5GRXG 4KFZC 4NGHL 5E2VL 5HHME 1EAPA 4HC1H 4GAYB 1G7QB 3EHBD 2YD2A 4CVXA 4XCCH 1T5XB 3V6OE 3QNZB 2X4NB 4RFEB 5F7YC 1KTDB 4JDZA 5DJZB 4PRNB 1IRAY 4KU1A 5EU7C 3S88H 3CU1A 4EZMA 3UMTA 4UT9L 5JLZB 4P57A 5C0CB 3LB6C 5F7FA 3PWNA 2Z4QB 1U58A 2PYED 1DQTA 4MCYA 1TMCB 1VACB 1SJVA 4P57B 4NOBA 2MQ0A 5J13B 1BWWA 1XGPB 1RULL 5JPMA 1KGCD 4HUMB 4Z7OE 2B4CL 2VABB 4OZFA 3IDJA 5I15L 5HPMB 3QEQB 5KVFH 4AYFA 3P9MB 4GRWB 3U46B 1V8HA 3LY6A 1QR1A 1JWSB 3SDYH 2IG2L 1AXIB 3KDMA 1QR4A 5DC4B 3PV6B 1I1FB 3MV01 4NWUL 4HWEL 1T21A 5HYSA 3PWLB 2FBJL 1KC5H 2F54D 5T5NG 3B6SA 2AJVL 1KCRL 4S1RH 4OQTH 4Q0XL 5BRZB 3LS5H 5HD8D 5C2UB 1JWUB 4P48A 2EDTA 1NC4B 2BC4A 4OGAC 4E42A 1SVCP 1FZMB 2UY6A 2BFVL 3GGWA 3MUZ1 4XPFL 5TJWK 4MD4B 5EU4B 1M7XA 5FYLD 3KPLB 4H8WL 5FDYA 3QQ3A 2EIEA 4C54A 1NCCL 1NBZA 2ZNXA 3NIFE 3G5YB 3SKJH 1T7ZA 3BI9X 3GZKA 3LKOA 1LO5A 2BSRA 2M2DA 3WDIA 1MCWM 1DSFH 4R4BA 2WUBL 4GS7C 1WBYB 2XV6B 1GGCL 3PWLA 5T3XE 1VHPA 3LPFA 4GQ9L 4J8RB 3FT2A 2V2XA 1OWRM 4KXZI 2R0LH 3RU8H 4LPVA 4YHKH 1PZ5A 4UIKL 1INEL 8FABA 1AGFB 3R4DA 4KJYB 3P0YH 3QIWA 4FQXA 2Q1EA 1EHNA 4TUOB 4LIQE 4PTUB 4NM8L 4FQHA 2Q8BH 4WW1A 1ZHLA 5CSZB 1MCOL 2BVPA 3U0TB 1WFTA 4NKQB 2IG2H 3FO1B 4PJIF 1FO0H 1MIEL 1MIML 4Y16D 4PJ9C 2BVQB 4ZDHA 5SWZB 1BVKA 2ZSVA 5EOCJ 1RY7B 2BY3A 1X7QA 5MEQA 4U1NA 3EAKA 4EVNB 4R96B 4LLYA 2EDXA 4FMKA 3CMOH 1KXVC 2OJZH 2X4QB 4TVPE 4Y1AB 4Z7OF 3N1FC 3UDWA 4NNXA 3WHXB 2B39A 1MFNA 3MXVH 2HVJB 2DLFL 4GMSH 1CICA 1CT8B 4ZO8A 1EDQA 3PHQB 5EUOA 1Q94A 2CMRL 5HHXH 5T1LA 4LQ1A 2ZOLB 3T4YB 3RAJL 1HEZA 3BDXA 4RBPK 4LCCB 5FYKE 4R26L 3B3IA 4EJ1C 3BZ4A 3O6FD 2C4FU 2VTFA 4CVZB 1RHHA 3MV8A 2FNBA 3QDHA 4RMUA 5TQ2L 4UT6H 4MLSA 1I7RB 4K2UL 3H9SA 2UWEE 2DMBA 2NYYC 2EDEA 3C2SA 1U42A 4L4VD 5BOZG 5JHDE 2YN3A 3D3VA 3WNKA 2R56H 1RIVH 5E9DB 2CLZB 4GXVH 5JDSB 7FABH 3M1BA 2ZCLL 2H1PH 1EEYB 5ESQA 1WF5A 3V4UL 4M6OL 3TCLA 4QEGA 3RUGF 5IFHL 4LAQH 4MDIA 2EH8L 2CDEB 2VZUA 1IGIH 3ULVD 4N0CD 2WBJD 3ARFA 5IM7A 3MRPA 2J4WL 4M5YH 5EO0A 1NGWA 3HNVL 2CKBA 3GHEH 3W5NA 3VFSA 3FN0H 3DECA 4FQXC 4UAOC 3QIUA 4OQ1A 1KN4H 4KK5D 5DK2A 2F53D 3GMNA 3STZB 3WD5L 4WHDA 4FQCH 1JN6B 4HIXL 3RWHB 4LSPH 1EERB 4PJ5E 4HF5H 1OARL 3OAZK 3CFDA 4FQ2L 1WEJH 1RJLA 5GRZA 5JZ7D 4LVOB 1ZT1A 5ITFB 1NGZA 3BH8A 4MNGA 5EIVA 4JPVL 5FUOH 4YZFE 3GMPB 5IW6A 2XWTB 2D31B 4HKJB 3PABB 3VWJA 3SJVE 1F58H 5JW3H 1J8HE 3GJFK 3OX8A 2WQ8A 5C7XH 1G0XA 4D9QE 5K9JL 3VMOA 2CQVA 1DUZB 3P11L 3I3BA 3OKMA 1TCRA 1RU9H 4OT1H 4JFEE 1ACYL 2QKIB 5IJKA 5SWSB 4WTWA 3L3KA 4M5ZL 4MHHG 5EULV 4QXTA 1J86A 3U1SL 3S4SG 4ISVB 3SY0B 4M1CD 1LP9F 4RRPA 2CLVA 3BZEB 1MHPH 5K33A 1N0XH 1QFWL 2E9BA 3D9AL 4PGCB 3RWIB 5LGJB 3KPRB 5FUOL 2Y1VA 3TA3D 3AGVA 3NAAH 5KOVC 3QG6A 1PYWA 5IB3A 2A0LD 4X7SL 1QRNB 5DJCA 4EDXA 1G7PB 4GRMA 3P4NA 1G6RH 2NXYB 3W9EA 4P2RB 2YD3A 3S36X 5ADOL 3Q5YA 4PREB 3BKYH 1OOAA 1LHZA 3FOMA 4YGVB 3BJLA 4QHUB 4WHTA 3GSOA 4J3UA 4NN5C 3H3PL 1XR8A 2K7QA 1Q0XH 1BD2D 4L9LB 1N2RA 3S36L 3RHWK 3BISA 2R1YA 2HFEA 1DBKH 3RUGE 1AGEB 3U4BL 3X13B 2WP3T 5DVOA 4H1LG 4P5MA 2HFFA 2R2EB 5HSFA 3DV4A 3H0TB 4FZEH 2CDGB 4YK4B 3V2AR 3MLSH 1MFAH 5CKGA 5DQJB 3GMMA 5E9DE 1RJYA 4NUGL 4EIGB 1IGJB 4CVZA 5EC2B 1P53A 1LNUA 3UTTD 4BZ2L 3RVUD 3P11H 1S9VA 2FD6L 3WO3B 3RWHA 1HZHH 5K9KA 3HZKA 4MDJB 4NNYB 3KLAA 5GQBA 1MCSA 3MFFA 1EO7A 4AK1A 5BV7C 1KF9B 1NLBH 2VDQL 1WFUA 4F2MB 5DQ9B 4KHXH 3D25A 5ACLA 4IRZH 1JTTA 1I3RB 1T7XA 4KKAD 3I75A 4PJFE 4X6CB 5KSBB 1DE4A 5I19L 1DLHB 4NCC2 1IE5A 3IJYB 4X5WB 4Z77B 3MYJA 3K81A 5FYKH 1I9RL 3JZ7A 3GHBH 1MVUB 2HVKA 3CVHH 4LLVB 2I60H 2R2HB 4BSVA 1WAAA 2Z8SA 2XWJA 4PGBA 1UZ6F 5CBEB 1QFWI 4LPUA 4JFQB 4HIHA 5ADOH 2F5BH 3MR9A 1F13A 5I1GL 1F4HA 1KOAA 5C3LD 4ONGL 5F71A 4OKDA 3BAEL 4XP5H 3MBEA 4NQDD 2WBJA 3ARFD 3KPLA 3OZ9L 2VUOA 3LN5A 4IEFB 5ESVB 3P77A 3UTSD 2OP4L 1XR9A 1AQKH 1OSZA 4IJ3C 1N6VA 4L8BA 2N56A 4GMTL 2CH8A 1IMHC 3MJ9H 1OP3K 3N50A 1T04B 4OCRL 3KG5A 3TBTA 1YN6A 1JWUA 1WBXB 4AQOA 5EU5A 4PRPB 1S9KC 5EU6E 1N4XH 1QPPA 1G6VK 4HS3A 1WISA 1VEOA 4PTTB 3QO1B 1ORSB 1ONQB 4HUUB 4X6DE 4APQC 4ETQB 2I9LA 4P9HC 4L1DA 1F02I 3VXRE 2YWYA 2HWZH 3TCXA 3AMKA 4IRZL 1BREA 2EXYC 4O9HH 4GG6E 4TSBH 4WENB 2DOCA 2DS4A 2KL6A 3T65A 5KS9A 3DROA 4C56D 1QFUH 1ZV5A 3A0OA 4CW1B 1B0RB 1GH7A 3ARBC 5SWZA 3P73A 3BN9D 2I60L 3DSFH 4KXZH 4YH6A 1WK0A 3P9LB 1C5BL 1KELH 4M7JL 3BWAA 2NX5D 3D87B 4M1DL 3MJ8A 4HWUA 2DMCA 3U4EA 2IQ9H 3PL6A 3ULVL 3CDGB 2FYYA 2DTML 3TYGH 2H2PC 3QQ4B 5BXFB 3N06B 4D0CA 1U41A 3OKOA 3QPXH 4E41E 1K5NA 1U93B 2XTJD 3QXWA 5D93B 5D1ZA 3NIGE 2MHAA 1BMGA 2Q6WA 4UQ3A 2VABA 3L3JA 4EOWL 3GMOA 3BXNB 4GBXD 2AJXL 4KI5C 2GCYA 3GSNL 2DB8A 3V7AE 4YDLB 3VFMA 1ZE3C 5IHUH 5JZ7C 4JFHD 1KBGL 3TBYA 4ALAH 3RWCB 4G6FB 5D5MF 5DEFB 3VI3F 2Q86A 3MLVL 3BFOA 2D0GA 2JCCA 3IDNB 4OFKA 5HY9B 1KPVB 3OXSB 1P7QB 3BWAB 4PD4J 1T3FB 1FAIL 1DQJB 4PUBH 2VYRE 4R4ND 4YUEH 4OGYL 2GFBA 3HAEH 1A7OH 3WUWG 2IEPA 1TNNA 5CINH 5IK3B 1FZMA 3MRCB 3SDCB 5KSUB 3QFJA 3ZTNL 5KS9B 5IK3A 1A6AA 1DQDH 4DZ8A 2GSIA 2YHGA 2X4TA 2YRZA 3PNWB 2VLKA 3MNVB 2C4XA 4IM8A 1QOKA 1HHKA 4NZRL 4ZUTB 3HPLA 2CRZA 3C08H 3WFDH 2GUOA 2ZCHH 4JHZA 2R4SH 4MS8C 3ZYZA 3TCLB 2VIRB 4NQDA 1ZGLB 1FFOB 1ONQA 2ZWLT 3KXFE 4MVBC 4NQDB 5TF1H 2M8XA 1IGMH 1IKFH 1G84A 2ICCA 1JZ5A 4HS3B 2FEEL 2R0LL 3RU8L 5ILTL 1AIFA 4DJMA 5FO8A 3ARGD 4X5LA 3A67H 4BUHA 3O3BA 5EZLA 3RWDB 3GIZH 5T5NF 4O02L 3G5YA 3NH7L 4L3EB 1T89C 4NCC1 3L3JB 4DCQA 4W81A 1CFSB 1YN7B 3BGAA 3FO2A 5GSRB 5L8JB 3DJ9A 1FZJA 1CK0L 1CXHA 2AXFA 2W1NA 5JO5B 3E2HB 1XR9B 3CX2A 4CMHC 1CICC 5F72S 4QWWD 3ZT7A 4IS6B 1IAKB 1KJVA 4LCWA 4NGHH 1SM3L 3BDBA 4NBXB 2OSLA 2BZDA 1T7YA 2ZG2A 2ZSWA 1BQHA 5C6TH 1GOGA 5DJZA 3FN9A 5I8KL 1NCNA 1BFSA 1LILA 3EYFA 3NN8A 1NDMB 3REWB 4XC1H 1R3KB 4KK6C 2NY7H 3STLA 2PTTB 4LCIL 3KLHC 4DKFL 4DVRL 2V6HA 4P3WA 4MD0B 4HZLA 4UQ2A 1F97A 2DQJH 3RL1A 3FQTB 3CFBB 2X4RA 2PYFB 3WXWL 4BA8A 1X4ZA 1ZA6A 2DL9A 5J12B 1FLRL 5CWSA 3ARWA 2I5YH 5FCUH 4GS7B 3UTZB 5D5ME 1MJJA 3W11C 4LHUA 1KPUA 2ORBL 4J7RA 4WJ5A 1OSPL 3BQUB 1H0DA 2CIIA 2DQEL 4JREC 1FNEB 3OB0H 3QWOB 1T0MA 3MOAL 4GAJL 1RUKH 3NFPA 1U8MA 4N1CA 4DAGH 5FHAL 1MFDH 5KVMC 3EIFA 1D5ZA 2I9TA 1EAPB 1MWAL 3TO4D 1NAKH 5IB2B 2P49B 1A7PH 2A1WH 4LGSB 2EE2A 4S0TD 2EKJA 4LSTL 1ZT7B 5JORB 4HMCA 3CJJA 5E8DL 1E4JA 4ODSL 2EYTA 1S5HA 4U1KA 5E8PB 1WC7B 4JDVA 1XT5A 2MHAB 3WXWH 1XIWD 1GSMA 3BGMB 3O4LE 1TZIA 3OKLA 1JK8B 2OR7A 1ZTXH 4MAUH 2BHZA 4LLVA 5C0DA 5DRWA 4Z7WF 4RIRA 1RZGB 4GRMB 4EQ2A 4K55A 4N9GA 5AWNL 5JUEH 2AVGA 3BEWA 3Q2CA 1G1YA 4C4KO 1YJDC 1B3JA 3ARDA 1F3DJ 4R3SB 3OAYH 3MFGB 5ISZD 1QSZA 4K3GA 4RMQA 3PP3K 1WFOA 3V5DA 3MBED 1MUJB 2Q8BL 4NM8H 3ZE0F 4QTIL 1P7KA 1YEEH 4EOWH 3W2DL 4I3RH 1UB6A 1PKQB 2AQ1A 5JOPE 5D1QD 3UBXI 3MRMA 4MS8D 1HKLH 4AH2B 5DVLA 4K71C 4QHLB 3QQNA 5CP3A 1FFOA 4NZUL 2QSCL 2ERJB 1Q9OA 4MJ2A 3RWFA 1CGTA 3MBEC 5GISL 4H5SB 5IEKA 3MGTB 1M6OB 2WBWB 2ZKHL 4ZTPL 1HH6B 1FNFA 3NFSL 3GNML 5EPMA 2QQLL 3RTQA 4UQ3B 3QPQD 1EJOL 1GGBL 3O3DA 2EIZB 4PR5B 5DJ6A 4NQEE 4G9FE 3SCMB 3NCFB 1XR8B 4I3SL 1P2CA 5F3BA 5E8DH 3K0WA 1G7JA 1F3JA 4D0DA 4ZTOH 4CGTA 1BQLH 2EZ0C 4QKXB 4XNYH 4WI8A 3CLFH 4XNQB 2OTWA 1MY7A 4LHJB 5EH1A 1AC6A 5GGQL 4UB0L 4BSJA 3NCEB 4LSQL 3ME0A 3KYMA 4ODXB 3OL2A 3MRBB 3JWDC 5DJ2A 1EA9C 1KCRH 4I13B 4HC1L 1ZMYA 5DS8B 1A1OA 3RJDA 4WUUB 3HZYA 2W0FA 4OCYH 2YD9A 3PWJB 4NHCH 2FGZA 5T1KA 4GW1B 5HI4C 5KVFL 3DMMD 2UV3A 4APQB 2DQTH 1Y6NR 2MKLC 1W72A 2D7TH 5EA0L 5D7JA 2R0WL 2NR6D 4IIQB 1Q0YL 2GJ6D 1TENA 3OG4B 5EWIH 5F1OB 1H3PL 2AJVH 4PRPA 3P73B 3VFRA 1PG7L 3DTXA 4EUPA 3PF2A 2XNAB 5C9JB 4X80H 1XF3B 3DTXB 4FQIL 3T2PA 4JM4H 3HLAA 4H20H 4L5FH 5IVXF 3W9DB 5ELIA 3TA3A 3ZE2F 2YMXL 3KPSE 1ADQA 3O4LB 1JHLL 4N8PA 2JKXA 3IU3A 1S5IL 1YMMB 4F58H 1L7IH 3D1MC 5GGUB 4KRNA 5J1SC 1Q72H 2MOVA 4ONHB 1Z9LA 2HA1A 3U7YL 5IF0B 4L8CB 3KXFD 2OXGA 1JIBA 1UC6A 1K6QL 2IALB 4ZYKB 3NBNA 4ZO9A 2DI9A 2QL1A 1KFAL 5SV4A 2GJ6B 1F6LL 5GGRA 3UCRA 3RX5A 5KAQF 3PIQB 3QUZB 2BXZA 1B0GA 2JB6B 3L3OA 4OM0H 3V0AC 5DXWA 3O3EA 2ITDA 3CFDB 3LQAH 1MCJA 5CJXC 2RQ8A 1JNNL 1R3JB 4KUCF 1Q1JL 4FFZL 2GITB 3HC4H 1JWMA 3MQIA 1S7WB 3T04D 2EIDA 2HRLA 1YNLH 3L3KB 3CFEB 1FP5A 4XBGB 2DLEA 1CLOL 1NGWB 5IVOA 4BSVB 3BHBA 2ADFH 4MAUL 1E6JH 1DUZA 1VGEH 2DWEB 1ZVHA 4M7LL 3L5HA 2V5RA 3SQOH 2FJHA 3IXAA 4TNWF 3NIDF 1AGDA 3HE6B 4IJ3B 4RAHA 1TJIL 4ZNEE 3S35X 4EI6B 3KS0H 2VJXA 4U1SB 1OF2A 1CVRA 5FYKU 4F2MA 2OL3B 4PV8B 3S37H 4YFEA 5IMKB 4ONHA 1S5HB 4U1KB 4OLXH 3MOQA 2ADIA 4EXPX 1YEIH 3QA3A 3S35L 4HH9B 1Z0NA 1T1WA 4X4ME 4ACPA 1YDPB 1JPFB 2LU7A 4PP2A 5K9OB 1O5DT 4BH7B 2AQ3A 4G9DA 4PJEE 1QRNA 1FE8L 4YDVB 5DJCB 2V7NA 2WANA 5E2TL 5IFAH 2DQUH 3QUZA 3W9DA 4U3XA 1C16A 4XPHL 2ATPA 3EO0B 3U82B 5I17A 5I73B 5ABDE 4QRSB 1U8PA 4NSKB 2XNAA 3C5SB 3HE7D 1GIGL 3U2SA 3JXAA 4GBXB 4K8RD 4OM0L 3FT4A 4JFOB 4PYGA 1BD2B 4OV5B 3T4YA 1UFUA 3OTTA 1N5AA 3FFCB 5AZEL 3QPXL 1GL4B 1R24A 2PCPA 2X4PA 5D7SH 1ZT4B 2EYTB 4PTUA 2Y9RT 2H32H 4O2FA 1PG7X 4P5TD 3GSQB 3RWJA 1U8JA 3MRFA 3V4UH 4NN6B 2DQCH 1AR1C 4EVNA 1EBPA 4L3AA 5DQDH 1TVBB 3G5VB 5FA3B 4Q9BA 1F6AB 3MRRA 5E08H 4QXUH 4P4KD 4EIZC 3SKMB 4HK0B 3L7EA 2X1XR 1INQB 4HFWA 4DGVL 1UWGH 1A7OL 1U8OB 1JTOA 2ZPKH 4HW6A 4PRDA 3TJHD 5IFHH 5BW7C 3K7UA 1F3JB 3G6AB 5ID1A 4QY8B 4Y2OA 2D0HA 4FQ2H 2EDFA 1Q94B 1QZ1A 5DA0B 5D7SL 4I0PD 1T66C 1CDCA 1D5BB 4UUJB 1N7MH 5I9QB 3ZSSA 3BKML 4GRWF 1MCCA 5BVJA 5FDWA 2CKBB 4GLRI 1IFHH 2VLJE 1CR9L 4IDLA 3LSOA 4PJDE 5IM7B 4M6ML 4G80B 4Y5XB 3RNQA 3DLQR 4MMZC 3D2UD 3BX7C 5E00B 3QXDB 3MCKB 1TCMA 3KLSA 4OGZA 4F8TA 3I50L 12E8H 5F88A 5IBLC 3NAAL 3I2CH 4L8DA 4P9ML 4S1QL 5H94A 4JQXA 5I1DB 5IQ9A 4QXUL 4Y7MA 3UTSB 2BK8A 3TP4A 4Y19D 4KRPB 4LVHC 3OV6A 5E8NB 3MNVA 3OGOE 3U1SH 1UB5A 4QOKD 1RSFA 3WNNA 3KNBB 3V0WL 1C7TA 2A6IB 4A6YH 4P46B 3EOYG 3L7FA 5I8KH 4GMSL 2EXWC 3UTOA 5KVEH 5BS0B 4DUWA 1HXYB 4M6MH 4XVTL 2G5BB 5JNYA 1Z6JT 4NP4H 4HS6B 4QCIB 4QF1A 2VLLB 4XC3L 3MA7B 1MCQA 5F7WC 5GS2D 3TJEL 1LP9A 3GJEA 4Z7VF 3VXOA 3L3HA 4H1LH 2VDPH 3QDGB 3DUHA 1NBZB 4ODUA 1EEZA 2XT1B 2JB5L 4D94A 1BBDH 4NQSB 1NLBL 2VDQH 2H8PB 2V2WB 3FMGH 5GS1C 3FN3A 1H3WM 3ARPA 5LBSL 4POZC 4RX4D 5BRZE 5DEFA 3KYKH 3QEQD 3ARBD 1EEUA 3QXAA 2F5AL 2FJFA 3QXUA 4DQOH 2OQJB 4NT6B 4Z0BH 3L3GA 4Y4HD 1MFDL 3JWDH 3MO1A 4GKSA 4KUCD 2YA2A 5CWSB 4K9EH 3C60C 4X7DC 4P2QE 4F7MA 5FOBB 4CRPA 5BVJB 4P5TC 5EORL 1CGUA 3MV9D 3ZYIA 4WWKA 1LP9B 5ERWB 2FD6H 4OIIH 5IBTH 4MJ5A 2AXHA 2KQMA 3AS1A 4M61A 2P4AB 4OUUA 4Z18A 4NFDA 2FYYB 1CYGA 3BPLC 3QUKA 4XPHH 3D18A 1Z9OA 4MCYB 1RUQH 1KN2H 3SDCD 1FYTE 3R8BB 3BKCL 3LKRB 3H3KA 4LOUD 2VE6A 1J1PH 2P45B 4X7EC 5B3JE 1ZHLB 5C0FA 1RJZA 5BJTA 3NH7H 3MRQA 1PSKL 1SEQH 3AY4A 3LIZL 5HHMB 2VAAA 3S96B 2J3SA 2X4RB 1E27A 3VH8G 2B0SL 3B9VA 2DYPD 1Y18B 3TEUA 1J0JA 4HKBA 4NQTA 4PJXB 5EIIA 2BX5A 1R3HB 5LGHL 4TSBL 5AUMB 3HG1B 4Z78A 3MCKA 2ZZUT 2DWDB 3RNQB 3OZ9H 3BJ91 1CD1A 5LXGL 3NPSC 2L4OA 1S7TA 1CBVH 1MLBA 5EBWB 3UPAA 1OW0C 1N59A 1FORL 3S4SA 2RB8A 4Q9RH 3KS0J 4KK5C 1VFUA 3ZHDA 1UWEL 3LMJH 3QFJD 4P2QD 1HYRC 1I3RA 4EN3D 1OPGL 1QPXA 2XN9E 4I9WD 4P2OB 3MV9E 3PGCB 3Q6GH 4N0UB 1A9EA 3LIZH 4JHWL 5D6DA 1UB5B 1PAMA 1WV7T 2GJJA 2UUDH 4WGWB 4XP1L 4XVSL 1YMME 4Y4KB 3OSKA 2N4IA 5L88H 4Z7WE 5C0CA 4MWFB 3STBA 2KKQA 3MRRB 5HD8C 4LSQH 5F9JB 3N85L 4LSSH 1IAIH 4U0RB 3IFNH 1JFQH 5M94B 3MXWH 2DQEH 2JB6A 3L3OB 4GAFB 4NKDB 1XF5A 5BS0A 1I9JH 4MNQB 4M7ZC 3KYNB 4PJAE 4AT6B 1T0NB 3O3AB 2XYCA 1S9XB 4Z7UE 4XBGA 1PBYA 2CUHA 2IANE 4WTXA 4WWKC 2B5IC 3MRCA 3SDCA 4NUGH 1KJMA 5AYUL 3WE6A 2EEBA 4G7YH 1D9KD 3QQ4A 3SOBL 4P2RA 2NX5E 1G7PA 2ATPB 3EO0A 4IMKA 4PUBL 3D0LA 2YZ1A 3T0BA 4LMQI 2ZUSA 3NIFF 5CCKL 3F7YA 1T1WB 1BOYA 3VXME 2DM4A 3RZCC 4YHMH 4MA3A 3WJLA 1U8IB 3OHXB 5DTFA 2CXGA 4PRBA 5J13C 1VERA 1OCWH 3T0EA 4O2FB 3C09B 2BXYA 5I6XB 1ZWIB 2XKNB 3KPSA 3NCCB 5HHQA 5SWQA 1S7SA 4FN0A 3AU1B 1EMTH 2AGJL 5HYQB 2DWEA 1CDYA 5DEZA 4ZAKB 5GRVL 4R7NB 1A4KA 3PDGA 2ARJQ 3GMQB 3J8F7 4HUNB 1K4CA 5C0RH 1X5XA 1FIEA 5GHWL 1NDGB 2VLJA 1VKXB 2E6PA 1INDL 4LSRL 1J18A 5EOCL 3ET9F 3QDJE 3QP3A 3UEZA 4EUPG 1VSCA 1AR1D 3LZFH 3GKWL 3HHRB 4PIRF 4POYA 1P4LB 5GRUL 3TVMD 3UXFA 5H8DA 1AP2A 3UJTL 1MELA 2Y25A 2VLRA 4BQ6A 1MJUL 4JFQA 3LKNB 3RBGA 4A2MA 1LMKA 1X5ZA 1J9CT 2H9GB 1A2YA 4G8IB 2E7HA 4N0CC 3DUUA 3FT3A 4YX2L 5KVGL 5EPMB 2J88L 5IQ7H 5EO0B 2MSPA 3ZT6A 3BRFA 4CKVX 1KN2L 4GQ9H 5FK9A 1NBYA 4IRSC 1D6VH 4YHZL 3KR3H 3FQWB 2JJSC 4ZS7L 4U6TA 4OCYL 5ID1B 4TSCL 3LN5B 4KRPC 4LVHB 1SEQL 3DRQA 4U49A 4XNQA 4ORZC 5E99L 5CEXB 3HC0A 1PX3A 2FRGP 5GRJL 1E4XH 3HAEA 5FECA 4RQQB 4H88L 5EFIB 2ADIB 5F7UA 3W39A 3OGCB 5E6YA 3GB7A 1T1XA 4U1JA 1HYSD 3UTTA 5F7DB 3S3JA 3VD5A 4U1IA 5E6ZA 3VFSB 3HMWH 5CZVL 1LNUB 4Q6IB 5I75B 4TQEL 2P8MA 1AGDB 3H9YA 1BM3L 4Z0XA 1GPOL 3BEWB 5IP4A 3PIQA 5F70A 4OQTA 5EZOH 3VFOA 4F57H 5KVDH 5ACZA 1RZGA 3OQ3B 3BT2H 4LLUA 5FCUL 3BKJL 2UZIH 5KS9F 1QRKA 2HFEB 5HVGB 4KROC 2X70B 4OLZH 4ALAL 5IB5A 4G6AC 1S7WA 4JPWH 5CZXC 2LAAA 2VO5A 3FFDB 1RUKL 3ROOA 4ZUSA 1IGTB 4LCUA 5KG9B 3SDXA 5I74B 2EYRB 1ZLSH 2G2RB 1UZ8A 5JXEC 43C9B 1TJHH 4D8PB 4NQXB 1U95B 4JN2A 4TPRH 4M62L 4WFHE 3QH3B 5C8JA 4MNHA 3MBXH 5C08D 1EGJL 4G6KL 3LEXB 4XCYA 4J3WA 3OXRA 2GJ6A 4YJZL 3X11B 1KXTB 2AXJA 2W65A 3NACL 3QA3B 3FJTA 3CSGA 2XTJC 3IDYB 1KJ2B 2GT9B 3BN9C 1D5IH 1UM4L 2XA8H 3IFPB 2XTJB 1VFBA 1BHGA 4X4ZA 5BZDB 1Z3GL 2YA1A 5H37G 1HKLL 1YUHB 4Q97A 1U3JA 5T3XL 1NFDF 4NJAL 3LQZB 1AGBB 4LASH 4R8WH 1RAMA 2J6EL 4B50A 2CJUL 2DM7A 1U8MB 2V2XB 4OD2A 1WAAF 3ORJA 4B53A 3K80A 1FC2D 1R5IB 2JK5B 3C60D 3L3GB 2XQYG 5F89B 1HI6A 4JY6A 2G75A 4H8WH 4Y88A 3ZKND 1MFCL 3O4OB 5EFIA 4HXBL 4RBPH 1CZ8H 4KWUA 3BP7A 3MLPA 4GG6F 4LHUG 4P2OA 4U6VH 1ZA6B 1FIGH 1VENA 4TUJA 1SEBB 4BKLA 5F8RC 4WNQB 4J4PA 4AM0B 1BECA 1OTSD 3HE6C 3HUJE 3BW9B 4JRYD 4P59H 1Z3GH 4OKVB 4DGYH 1TJHL 1NC4A 1OAYL 2BC4B 5SX5H 4E42B 3RTQB 5GGVY 5EA0H 2YD4A 3HMXA 3AVEA 3C60B 3B5HA 2Z31C 3CVHA 2LTQC 1TPXC 2DWDA 7FABL 3NIDE 4NP4L 1AR2A 3NCMA 2FGWH 1OLLA 4NKDA 5EBLB 4ODVL 3GI8H 4M43H 3MREA 2V5MA 4NHCL 5D1QA 5H35A 1H5BA 4MQTB 4KTDH 1XZ0B 1QR1B 4PV9B 3LQMA 3T0EB 1Q9KA 1UB6B 3U0PA 2V7HA 2Y5TA 3IETB 2F58H 4ZUTA 3SKOB 4LRIA 3D69B 1OAQL 3H9SD 5FO7B 1YYML 1I4FB 1MRDL 4XWOC 1MHPL 1RZJL 1NEZA 4U3HA 5CHNB 1T0MB 1CFQA 4EN3C 5FM8A 3MV8D 1HHJA 3MOBH 2EDBA 4UBDD 4X80L 3SN6N 1QLEL 3RWFB 1F42A 2PO6A 1MLBB 3TVMA 5F96H 4IMLA 2WBKA 4R4NC 1SYVB 3I3EA 4WU7A 1PW3A 4JLRA 4PJ9A 1TVHA 5JHLH 1I8MB 4YE4H 1KSRA 2VDML 4PJAB 5JW3L 4OCMC 5INCA 4PBWD 3KPTA 5E99H 4YHIA 4C58B 4LHUD 3UJIH 1FQ9C 5FOBA 3HC4L 3SGEH 3LV3B 4WHCA 4K94C 1TFHA 4S0SD 1PLGH 1LO3L 5LCVH 3DV6A 4E5XA 3OPZL 4F58L 4PJGE 1H3GA 2FJFB 1I1AA 1XMWA 1B6UA 3RZCA 1D7FA 1FNSL 1I75A 3ARSA 4RGNE 5KVDL 4F57L 3V52L 2RCSL 4PJEA 5D2NC 1AY1L 2KDGA 1NC4D 4IHOB 1R3LB 4RGMB 3DARA 1A6VL 2XZZA 2NNAA 1G7QA 2X1QA 1D9KA 5J4MA 4NQSA 5HYEA 1CDIA 5JHLL 4N0UA 3HS0A 1MAJA 2A6KB 2DQGL 2H26B 4HD9A 1A6UH 3MRFB 4J23A 1OTTD 2I25N 3MACL 4V2BA 3DETD 2OX5A 3BKYL 4XVJL 2E6JA 3TC9A 5INDB 2FECL 1JMZA 3VI4E 1JNNH 4X6DF 2FX7H 2BFVH 2GTZB 2CRMA 3RPIB 1ORSA 4HUUA 4KRMB 1IQWH 2W9LA 4L3ED 4XXDA 4MAYA 3TZVA 4F37K 1C1EH 5ETUB 3FT4B 3PE9A 3LKQB 4NO3B 3O2VH 3RTQD 1MCHA 2ENSA 2W92A 2YPLE 4FNLL 3L6FA 4YHOL 1RUML 2VQ1B 3L9RB 5BS0D 3SE3C 4U1HA 3T1FA 3QIWB 5FUZH 3VRJB 3C8KB 2LQRA 1I9IH 1I8KA 1NUNB 3HCVA 1V7MH 4WFED 4GKOA 5GZOD 5FYJD 4PRID 1G7MA 3IU4H 2VB5A 4WGVB 4ZXBA 5F88B 5FEBA 5CS7A 1WZLA 4D2NA 5CEZD 3DURB 3I3DA 1IC7H 3PWPE 3Q6FA 2QSTA 3CVHB 2Y7QB 2YPLB 2BSTA 4HIJA 1LO2H 4DK3A 2MQ3A 5IVZB 1MQ8A 2A6KA 1DANT 3VXMA 4JFFB 3HNTH 1HH9A 3IJYA 4X5WA 4EBQL 1ODAA 1MNUL 1AI1H 1AGCA 4OF7A 3LDBC 1GOHA 1N4XL 3OR6A 1FH5H 3OB8A 3BQUD 4FTVA 5DF0A 1T20A 3INUH 4ZPVB 5EZLB 1G6RL 1I1AC 1JI2A 1I1AB 3H7LA 3Q5TA 4PRIB 3KPPB 4UTBL 4OLYH 3LDBB 1DBAL 4QHKI 3IF1A 4WIQA 2Y07L 4NQEB 1WWBX 3ES6B 3S36H 3TO4A 4YFDB 4I18B 2CLRB 3A6CH 1WIOA 4JDTH 3IVKB 1X5IA 1XFPA 3BE1H 3MLRL 1VFMA 4LSVL 1BF8A 4PJAA 1FZKB 4UI2A 4LQFL 5BS0E 2B0SH 4M8QA 3MLWL 1BJ1J 4RAVB 1YA5A 4Q2ZB 1CFVL 4ZO6A 5HGGS 1DL7L 2OQJA 4NT6A 5CSGA 5D7LB 4YGVA 4GKNB 1T3FA 3V5HA 3UJJL 5CGMA 5C0RL 4TRPL 3DX7B 5L2KB 2EC9U 1J8HB 2ICEA 1N64L 1NFDB 5L7XL 2F8XC 3SJVB 4PBXA 2AK4B 1CBVL 3UTQA 1B0RA 3GSNH 4NHUA 3TBWA 1QBLL 1GGUA 1HCVA 4CN1A 3ZTJH 4OZHE 3G5ZA 1WUNT 3WFEL 5E95B 4LSVH 1QO3A 5BZWB 3BDYH 1TZGH 1SJXA 4N8VA 2QSVA 2KBGA 4PJDB 3Q5OA 3UTSA 2DQDL 4HJGB 1AFVL 5DRNB 5I1AA 1YMMD 2R1WB 3FB8B 2YSSA 4FG6C 4ETQA 5DURB 3W9EB 3H2WA 3GM0A 1HIML 1NMAH 4WY7H 3AAZA 1S3KL 3PQYE 2APFA 4JFOA 3HC3L 4CU6A 5J11B 3QCTL 2ZOKA 4J4PC 3I75B 4HUWB 4UIMB 2VDOH 4BELD 2EDHA 5F93C 5L7XH 3PABA 3PXHA 4NZRH 4WVRA 3DROB 1U8NA 4JM2A 4MD5A 4AMKH 4L8BB 3CSBA 3BZFB 5F6IB 3VFTB 3SKOA 2AEPL 5IR1A 2H2SD 1S9VB 3QHFL 1BFOB 1CD8A 3GMNB 3STZA 2CO6B 1QBAA 4Y0GA 3VFWB 5IW1B 3SEPA 4Y5YB 3HFML 4KC3B 4PV8A 2DLFH 2Z8RA 4JZJB 1U0QA 4PJBE 2A9ML 3RA7H 2J6EA 3FAWA 4PLOB 1ES0A 3WSQH 3QDJB 4YFLI 3MYJB 1EUTA 5IF0A 3GMPA 3RVVD 1Q9LA 5F1IB 3IKCB 4KV5E 4LCCC 3VFNA 4BKLB 1I9EA 1RUMH 2G60H 4GW5B 1KCKA 1DBBL 3TH2T 2C26A 1KJ3L 2RJMA 4NQCA 1BIHA 5TQ2H 4KDTC 1P84J 2IH3B 1BD2A 2CO7B 2IMMA 4JPIA 3ULVH 3KHQA 2YC1B 2BRQA 4G6JH 4GBXA 4X6BA 3F65A 4YC2B 4BFIA 1HKFA 2JK5A 4X83A 1P69B 3H3PH 4PD4K 3HUJA 2X7LB 1BFVH 5EO9B 1IL1A 2BOBA 2MWCA 4LNRB 4OBSA 1JNHB 2CLVB 3BZEA 2CDGA 1U8JB 4GRWH 3MUGB 3PGFH 5KSBA 1ZWIA 4XX1G 2A73A 3ROOB 1C5BH 4OZGF 5L2KE 1YNKH 3DRTA 2YK1H 1WZMA 1AI1L 1QO3B 3QUXD 1UYWH 3JTSA 1N3NB 3CLEH 4ZUUB 4U1SA 3VG9C 3WV0A 2FO1A 2XQBL 4Z0XB 4GAGH 3HE6A 1FAIH 4HBCH 2R9HC 1U8PB 2K1MA 4NSKA 1KJ2H 2WP3O 3TYFB 5SWSD 1LD9A 4ETYA 4PJ7F 5A2KH 4JPIB 5GRYA 4JJ5B 3RWEA 5JTWA 1CF8L 5ITFA 3AS0A 1MREH 3DV4B 3H0TA 1GZQB 5JQHC 1UM6L 3TN0A 2XIDA 4YPGA 5KSAC 4WUUD 3GO1L 2AV7A 1HEZB 4XB7A 4D0DB 1KCSH 1F8TH 3EJJX 4LL9A 4FABL 4NFCA 3I02B 2NPLX 3HAEB 2GJ6E 4RWHA 1OWWA 1UM5H 3T3PE 4YWGH 3HB3C 3WS3A 5FIEA 1XF2B 2FHBA 3UX9B 2F5BL 4WU5B 4YEEA 2ZG3A 4HKXB 4MQ7B 5I1CH 4X7TA 1NCUA 1G1CA 1WTGT 3WEXB 1SY6L 2EDRA 2F53A 3BIAX 4XP9H 2C3VB 4XCNA 2P8MB 2R2CA 1A22B 4XMLL 2XN9B 5KSBF 1J05A 4JAMB 4QTIH 3U0WL 4MXWL 1C5DA 4NFBA 2PO6C 3SDYL 3VXSB 3S5LB 4PJFB 4X6CE 5I8EB 4J12A 4UOW0 4NO5B 1HOCB 3QFJE 5C09E 4ZOCA 1J11A 2APVA 2AJSL 3CMGA 1U8NB 3B5TA 2OSLB 4JM2B 3OJMB 4MD5B 3DWTA 4PG9B 1L0XA 4S2SB 1QLFB 2CPCA 3LS5L 1WQVT 3BZFA 4DN4H 1JNLH 3SDAB 4JR9H 4S1DC 5KW9H 4R7NA 4YHPB 3V7MA 3DYMA 5F1NB 4AL8L 5I74C 1RIVL 3ZTJG 4JO1H 4OD1H 4HKZA 3H3BC 3EFFA 3K46A 4FXKB 3C8DA 1L6ZA 3BEVB 2ZUQC 2DIBA 4C55A 1D5XB 2VDOL 2YOCA 4EI5C 1X5AA 4L8CA 4Q9QH 5C08B 4WUUE 1CI5A 4AIZB 2VDRL 1QHOA 1OP9A 1N5YL 3L95A 2EH8H 9CGTA 1RVFH 1TQCC 4XTRC 4HWZB 1I8KB 3UO1L 1D5IL 1UM4H 1MFAL 2MCPL 5HDOA 2XZCL 3TPUA 3WS6A 4XNMB 3TYGL 5GRUH 4DKFH 5JPMB 3GUTA 2Y72A 4GRLB 5I2IB 2AEQH 1HZHL 2VLRE 3RQ3A 1NL0H 2GFBB 4QXWA 2ZOKB 5F8QC 3FQRA 2JJTC 4ZFGH 1FLRH 2PYEE 2ICEB 2D7QA 4XMPH 5E4EB 4OD1L 2ZP0T 2WIIA 4P2QA 1AHWB 4JQIH 4YHZH 5T1LD 1YYLL 5C07D 4M61B 3QNZA 3CC5B 4FZ8L 3RFZC 4CN4A 2XZQL 4NZDA 1HDMB 4YQXH 3DVFA 2XY2A 3EBAA 2G60L 5DVMA 4XAWL 1BGXL 4Y4HB 2G9HA 3HZYB 3G08B 3C87A 3TPKA 2DI8A 3HE7B 4L4TD 3SDXF 3ARGB 3T3ME 4QNPF 1M6OA 3MGTA 4UILH 2BDNH 5D96B 2V5SA 2C5DC 3KPPA 3TO4B 3PDOA 2Z92A 4M5ZH 5D7JD 2ICWA 4IHOA 1SJEB 5MERB 3WIHA 3CFKB 3T0XA 2ZUYA 2BY2A 1X5KA 4XXCC 2DIJA 4I77H 3CUPA 1YQ2A 3C08L 1CFNB 3TJHC 4PY8I 1EFXD 1MLCA 4RZCB 3X14A 1IAKA 1N5YH 1KPUB 1NCWH 5D1ZD 3PV7A 3NZ8B 3HI6H 1UJ3C 3HUJF 3JV5A 3ARUA 4G8GE 1NGYA 4WEUD 3SGKA 1AQDB 1NFIB 2XN9D 4I9WE 1WBZB 4ONFH 1K4DA 2LU4A 1KB9K 5A1AA 1GAFL 4RGOH 3JUZA 3ZKXC 1F4AA 1J1OH 2EYSA 4JFDE 3PJSA 3PV6A 3T77A 3GBNL 2AJ3B 3O2DA 5EG6C 3F7PC 3QYCA 3RKDC 4ZDHB 4OSUL 5T3ZH 3T1FB 5C0IB 2H1PL 1RIHL 5EZIL 3LKOB 2D7PA 4W6XB 4HIEA 3S37X 3ARBB 1JHTA 4JGUA 5C92A 3HS0B 2NW3B 3S35H 1KCLA 3ALWA 1XGPA 5FOJA 4KQ4H 1OGAD 1RPQA 2IAND 1F90H 5IJVA 4Q74A 2VSDA 1U3HA 1CFSA 4UIKH 1S7TB 3VGFA 4NKIH 2CJUH 5DD1L 1ZHBA 5FHBH 3ZKQD 2X1PA 2AJ3A 2APBA 4U1LB 3PP4L 2P5EB 4JDVB 5FYKL 3QNYB 4NZTH 3AC0A 4QRPA 1HCFX 5GRWA 3HNSH 2G9HB 5FDWB 5L2KD 2NY5L 1JZ3A 1QYGH 3QCUH 4NRZB 1G0YR 4I18C 1RMFH 2Y36L 1D5ZB 2ADJA 3GGWB 4P3DA 4X9FA 1UGNA 5BXFA 1Z5LB 3MZGB 5E8OB 5IEHB 2YWZA 5HHNB 2AJUL 4U1NB 2IBBA 2VE6B 1SBSH 3ULVC 3NABH 3OAZH 4XPTL 1FPTL 1JJUA 4HH8A 2NY4D 3RDTD 2JELL 1CFNA 4KK9C 2DQIH 3DIFA 1HYSC 4AG4H 1MVFA 1J8KA 3CCHB 3SE8H 4Y1AD 4MXQC 2AI0L 3V6ZA 1JWSA 1KGCE 2HJKB 1RVFL 1UJ3A 4YX2H 4R26H 3DVNB 1WZ1L 2IWGA 5DGRA 1KXQE 1DLFL 1T22A 3MUHL 4AENA 4KQ3H 4V1DE 1I8IB 1XGRB 3VRIA 3OKYA 2HJFA 5DHVH 4QRRA 3DVGA 4ZS7H 2HH0H 3GBMH 5BV7B 4O02H 1ZHBB 1P5VA 2ZG1A 3GSVA 5D9SA 5KN5B 5IB4A 3UBXA 4R0LB 3BP4A 3OG6B 5IESL 4XPGH 2X4SA 5E8EA 3QQ3B 1PYWB 1EH9A 1MF2H 1T1YB 3QT2A 4J3SA 1JPGB 1AJ7L 5FYJH 4P46A 2ADGB 3B5GA 5K9OA 5ICYA 3DGGB 3MRKA 4OJFL 2IFFH 4HG4K 5JXAH 3MMEA 3DHJA 2J4WH 4M5YL 3QO0A 3QDMA 3HNVH 3TV3L 1FYTD 1BFTA 2VLLA 3QFDB 3MV9B 3QWRA 3FO0H 3MLTA 5JNYB 3ZZ1A 4K3HA 4O2CA 4GQPH 4PJCB 2GIYA 4RA3A 3V4VH 4Z7VA 2EYSB 2FX8L 2PW1B 5FKPA 4WDIA 2YKLL 3DBXA 3PWPA 3CLFL 1XH3A 2H6PA 2DKUA 4U33A 2EIBA 3OKEB 5E94A 3QAZC 4LPCA 5DJ0B 4JPVH 4RFNB 1XF2A 3QJFA 2D31A 5AD0B 1EIBA 1T04A 4LLWA 1CXEA 1T2QH 4TYUA 5KJRH 4HJ0D 5HXMA 1IILE 3VXTB 1AE6H 3H9SE 3N1GC 3QSKB 3D5OF 4JPKH 3U7WH 4QOKA 3CXHK 2YD8A 1B6DA 2AJZB 1DBJL 1AC0A 3ILQC 1A9BB 1Y0LB 4XI5D 2VDPL 4L3CB 5I8EA 1NBYB 1UH3A 4DQOL 3X3GL 2H3NB 4ODSH 5DFVD 4DW2H 2HFFB 2R2EA 2VXVL 4BJLA 5E2WH 3BXNA 1AGEA 3X13A 2R4SL 5IMMA 2FEEI 2IAMC 3LPWA 1BZ9A 4JANB 4NBYB 3LQZA 4K7PX 4MVBD 2VZTA 3SQBA 1ZHNB 1AXTH 2WM0A 4JM4L 4JKLA 2X4OA 1MHCA 2HN7B 3GRWA 4O51A 2X4PB 1HHGB 2E9IA 4U7KA 1G9ML 3AM8A 3FFCA 2B1HL 4NNYA 4K2UH 1J12A 4QHKJ 4PJ7A 2V9QA 5EO1A 5GIRB 4JFXA 3CIQA 2J5LB 1CFBA 4JJ5A 4H0GA 4LEXH 3RVXC 1L6XA 4ZUUA 3GB7B 1ND0A 2FSEA 3WO4B 1F4XL 5GGVL 5JIKA 4XWOD 5IB5B 1IEAB 1CLCA 4PRHE 3SPVA 4X7SH 4I8DA 3SDXB 2I24N 1GXEA 3M8OL 4GW5A 4DN3L 1MEXH 2DLTA 2AAVA 2QJDA 1EBAA 1YQVL 4LAQL 4LLQB 3QG7H 2C1OB 2I9LB 4JRXB 4LLUB 4O00A 4AIOA 1BEYH 1N5AB 5DD5L 2RGSA 4NCDA 4WI9A 1CT8A 4M6NH 2W0FB 5HJ3A 5DJDA 4HHAA 4R90L 4C4KT 1A1NB 1IC7L 3B4NA 4NZJA 5GS1B 3CDFA 3ARDC 5BQ7A 3RWGB 3HE6D 2DQIL 5HVHC 1A64A 2Y06H 4LVNC 4WTZG 2I5YL 4P9HH 5LKNA 1XIWA 3OGCA 2VZ1A 4KJQC 4D8PA 1TNMA 1U9KA 2GQHA 2ZSVB 2RAMA 1KBGH 1M71A 2JLLA 4O51B 5JQ6L 4QGYA 1DEDA 4WO4C 4HV8A 2N7AA 3IKCA 4JFPB 3VFNB 5ALBL 4NQCB 1JNLL 4HEME 5IMKA 1R3JA 4YFLF 4YBHA 4GLRH 2B5IB 4XP6H 2XFXB 1R5IA 2XWJB 1G9MC 4OGYH 4PGBB 4XGZB 2P5EE 4XCNB 3CU7A 4F33A 3O3AA 5DJDB 1JFQL 2NY6B 1IBGL 4R0LC 1LO4L 1BVZA 4LEXL 2R23B 5HHOB 1X9QA 5D8JH 3BHBB 3FFCD 2GJZA 3QRFM 1KLFA 5IMOA 4TN9A 5CP7A 5J8OA 2JJTA 5HGDA 1CL7L 1A6TA 5D7KE 2IPKA 5KSAD 3RVXD 3WLWD 2GSGB 4Y4KC 1T1XB 4U1JB 4AEHL 2CGRH 4LRNH 3G5ZB 3UZVB 1BFOA 1JZ4A 1FN4A 4NQVB 4LLWB 4M8VA 1UYWL 4Y19E 1GGIH 4DKAA 2VLJB 3CXDH 3OXRB 4JDTL 1TPXB 4WHYH 4FHBD 2CDFB 3JWDL 5HHOE 3UJJH 2A38A 3ARTA 5ADPH 1A7QL 1NLDH 4ELMA 1LD9B 2OP4H 4NJ9H 1BBDL 1W8OA 2C7UA 4XP1H 4GG6A 4K94H 1W72B 1SQ2N 4GJTB 1C12A 4MSWB 1KPRA 4UV7H 5HGBB 4F9LC 4YHLL 1QBLH 4KROD 4RWYL 5MEPA 5D8JL 1N3NA 3RZWA 3B8SA 5DD0H 3KPSB 4RSVA 3PWUB 1RV6X 3MMEB 3PHOB 4AENB 5DWUH 5EBMB 1N64H 2MKWA 3QHZL 1TCRB 2E27H 5I8CB 5GXBB 2R29L 5C6PB 2IBZX 4OZIA 5CEZL 3O2WH 5TE6L 3UTQB 2HKFH 1G9NL 1ED3A 3SE4A 5DVKA 3M07A 3NFPB 5C0AD 1TQBB 3WFCH 2CDFA 4LBEB 4D0BA 1CXIA 4RAUA 3ZDZF 3IFLH 4KI5F 3FO9A 3O6KH 1TZGL 2NCMA 1U91A 3UTTB 2C3WA 3AXLA 4JKPL 1JRHL 4KRPD 3UBXG 5C07B 4MA7H 4RQQA 1OP5H 2AJXH 4JRWA 5CUSH 3MCLL 4LVEA 1LVEA 1FV1B 4EDWH 3F6IA 5IEHA 3JVGA 1EPFA 4IRSD 5HI3D 3VJ6B 4XMKH 3BKCH 2O5YH 1HSAB 1IC4H 1J1PL 1RUAL 2GI7A 4EKXA 1FVEA 2CKBL 3KYOB 1PQZB 2EIZA 4PR5A 4TVPL 4HZLB 5CD3B 1BBJB 1CL7I 2FB4H 4DTGH 3U9PL 4XCEB 3ELAT 4O2CB 1P84K 5EN2A 1S9XA 4LEOA 1R5WA 1U3HC 1T0NA 4PP1C 2PYEB 4KUZH 3CH1B 1NGQL 2P43B 4NQEA 4R4BB 5B8CA 2VR9A 1NGZB 5GGTA 4LLDB 2BVUA 4D9QD 2J7LA 4AH2A 1I9RH 3GIVA 1A9EB 4LKCA 4M7KL 1IC1A 3LS4L 2BVQA 1KENL 1ZTXL 3H9ZA 1ZLUH 3BUYA 3N85H 1JGLH 3MRIA 2MCPH 1YQVH 4JJHA 2EEDA 1IGML 2LVCA 5CAYB 1WWWX 3O2WL 1CFTA 4M7LT 5EOCH 1S7VA 3S4SB 2O5XL 3DXAA 2CKNA 4JVUA 5D9SB 3SGJA 3RWDA 3VRLF 2F15A 4Z8FL 1T2JA 1X5HA 2NQCA 5FO8B 2B4CC 3GSNA 4AIXA 1E4WH 4PJCA 5IIEB 4IOIB 5IIEA 4Y4FB 3BMVA 3IYLW 1IEBB 5EOQH 2OZ4A 2IPUG 3VI3E 5FYLH 4G43A 1YECL 2R0ZL 1U3HB 3UDWC 4ZS6D 2K3TA 1W8NA 2ATKA 3QIUD 3HG1A 2K9UA 1GJIA 3BO8B 3BAEH 4WFFE 3HCVB 4XP5L 1AQDA 3QUZC 5SWZE 2MNUA 4Q58C 4R97C 1I1YB 4TSCH 4HFUH 1OGAA 1A7NL 3PP3H 4HZAA 1JHKL 3NOIA 3ARDD 4P3CH 4XPTH 1IT9L 1YY8B 3UBXB 5IB4B 3EOTL 4NKOB 1QBML 3H9HB 3T77B 5T33L 1FFNB 4M02A 1JK8A 4KVNH 5I1KH 1OAXH 3SOBH 2P44B 2V2WA 4I77L 1K8IA 2GY5A 3CZFA 1QG3A 2DD8H 4JZOB 1G7LB 5E1AA 4F15B 3TIDA 1YEGH 4Y4FD 3ARGA 1TQBC 5DYOA 1BZQK 1EO5A 5EU6A 4M7JH 2VZ3A 5CD3A 1NGYB 4JO2L 1M05A 2BVEA 2HVJA 4OCSH 3ARZA 5ENWB 3T3MF 2FR4A 1XAUA 2E9WA 4JLRB 4E9LA 1OM3H 4HS6A 4QCIA 4K71B 2V17L 1QP1A 2D4DA 2DI7A 2DLGA 3LB6D 4X0KA 1R3LA 5BW7A 4OZFH 3WIHL 1YC8A 3O0RH 4P49A 3T0WA 4U7SA 3QUKB 5BO1H 1T2XA 4WHYG 3OR6B 3QIUC 1JHTB 1HXMB 1DR9A 4CADB 2GEEA 5DT1H 2YEZA 5FV2A 2BRRH 2CRIA 4Y4KD 4W4OC 5C0BB 4RMWA 2YPLA 2Q7NA 5FM4A 4UNTA 4ZNCD 4Z7UA 2ED7A 2R4RH 1MI5B 4G9FB 1YPZB 1AO7A 3FQUB 3N9GL 1LO5B 2BSRB 3ZL4H 4I0PA 1CE1L 5EIQA 2P8PA 2C3HA 4UMGA 2ZSWB 1NFIA 4L3EE 4NUJA 3DGGA 4MA7L 2BNQD 3DO7A 1KNOA 4JEGB 4JO1L 3O11A 3DO7B 2NX5A 3C6SB 5C70A 5KSUA 1OQOA 5GJSH 5HHVH 1FNGB 4NQVA 2WINA 2MJWA 2VXQH 4Q9QL 5EZOL 1F5WA 2E7LC 5I1DA 2JJVA 4NO3A 2NY1C 1L9NA 1UEMA 1SJEA 5SV3A 4FA8A 1C5DB 3FQNB 1CE6A 3AM8C 1WIPA 4NC1C 3MV11 2GCYB 5DJXB 4I0KA 1KTDA 5JXED 1JCKA 5B22A 2W91A 5ILTH 4JCMA 4OQTL 4ZTOL 1DUYA 3E3QC 3VFMB 1EHLL 3ZL4L 5D1XC 1MH5B 4YQXL 3ULUH 5C0GB 3I50H 1MOEA 1WBZA 1E28B 2OR9L 3EYUH 1RURH 2EZ0D 3OR7B 1B4JH 1FVDB 5I76B 1FRGL 4XBEH 5IB1A 4QY8A 5CCKH 2Z31A 3V0VA 4D0CB 1OAZH 3FQRB 3MOAH 1TTGA 1U8OA 4Z8FH 3O6LH 4JFHE 1OAQH 1PSKH 5DLML 4ZFZA 4FABH 1UA6H 3MODH 1RJYB 4X9IA 3IDIA 4P4RB 1T5XA 4JN2B 1IAOA 2MPAH 4YHYC 4UB0H 4JRYA 3K4ZA 1C08A 4PP2B 2NTSP 1EMTL 2AGJH 3VH8B 4WU5A 3VFGH 4EXKA 3DYOA 3ECBA 4HDIA 4PTTA 3AS3A 4DVBB 3I6GB 4HEPG 5L2JB 1OF2B 4KAQL 5C7XL 4PGEB 5JPNB 4KK8D 1IAMA 1NEUA 1QQDB 1YEDB 3S5LG 2VISA 5IMLB 5FGBA 3MGOB 3MA9L 2MQCA 4RFOH 4MB4A 4X7CC 5DC0A 3P4LA 3TWCH 2D9QB 3BP5A 1YPZF 3SDDC 2X7LA 3QWQB 5B38A 1CDUA 1FVCA 1A6UL 2DL2A 3KPQB 1DQQB 1OAXL 3FB6B 3MNZA 2FJGB 1C16B 3WIFB 4WTZA 1W0WA 1DVFA 1IGTA 1VADB 5D7IA 4I3RL 3QH3A 2VR5A 3MRIB 5IT2H 5KVGH 1BOGB 1NMBH 1FYTB 3MPCA 4KKBC 4LAJH 5D72H 5DFTA 1NH6A 4FFVD 1BP3B 1OHQA 3EOAA 3KR3L 2E7LA 2QTEA 2IF7A 1ZHKB 3QCVL 5C08A 1XGYH 2OL3A 4BFGA 5DLMH 5EUKA 1YEFL 3VFOB 4UV4L 1LP9E 2X9WA 5L8LB 3IGAA 1KPRB 4H88H 2HVKB 5AYUH 1RZ8A 1A2YB 4G8IA 5FGCE 4R97B 4OB5H 1D5BA 1A7BA 2CIKB 1F3DH 2W07A 1BQLL 3SGJC 4O5LL 4HV8B 2DKMA 4JFPA 1VA9A 4PLKC 3QNXA 1C7SA 1KIRB 1AXSA 1E6JL 1AHWC 3T0VA 4DUXA 3O2VL 3TO2A 5DVNA 3ZKMD 2X4UA 3RVWD 3F58L 1JWMB 3GNMH 1XCQA 1KB5H 1RD6A 1SBSL 1A0QL 1NUGA 1PKQE 1HI6B 3BUTA 4JY6B 3IJHB 1MWAB 5E94B 4LRIC 3ZYOA 3SKNB 3PWPB 3QUXC 5CEYA 3SE9L 5GGRB 3T8XA 2YUXA 3GDBA 3PL6C 4P5KB 2NY2D 4HKXA 4MQ7A 1SJHB 4NQCD 1YUHA 3UYOD 1PY9A 4P23B 5LJYH 1GGBH 5DRXB 2D03L 1J87A 1QVOB 5E9DA 3SKUD 3ZDXF 1KIUA 3G6JA 1F11A 1PG7H 3GK8H 3GI9H 4JFYA 2IBGA 3SE8L 4M9OA 1FGVL 2EECA 2P1YA 3IDXL 4JM2F 4MJ6A 4UV4H 4LPTA 4MJIA 3KPQA 3ARGC 3VDCA 3KPOA 3TNNA 1U8HB 5DQJA 4E41B 4LQFH 3B8YA 3MLYH 5I1EH 1BX2B 3KPRA 2VUYA 5BQ7B 4OIAA 5I1IH 2XZAH 4JRXD 4KHTH 4D9RD 3S9DB 5E70A 3IT8D 3LEVH 4FFWD 3V5KA 2GSGA 3KVQA 5DQDL 4QRRB 2BOCB 2J88H 5LQBH 4LK4A 1T80A 4XAKE 4A6YB 5DFVC 1MSPA 1JF1A 5J7CC 2D7TL 4HKZB 3BZDA 1N6QL 3B43A 1QUNA 3PGDA 4GG6B 5EDXA 1S9WA 3EJZC 1A6ZA 2F54A 5IW6B 3K3QA 3DX6B 4FFYL 1OAKL 1Q72L 5MEQB 2A74B 5C9JA 1MJ7L 4HAFA 5C0AB 2N1KA 2J8UF 1AXSB 1ZANL 3VD4A 2EDKA 3U6RB 4UOJA 3G6JB 3AREB 4AMKL 3FZUD 2XRAL 2NXZC 2W38A 4QXTB 4XPBL 4X4XB 5EU7E 3MJ7A 5SWSA 1JN6A 4KI1A 4QRRD 2DBLH 5DK2B 2FL5A 4LP5A 1VESA 2F53B 1MCDA 4I18A 5EUKB 2UZIL 3QDJA 4NPYB 4HWEH 2H2PD 2E7CA 1BAFH 3VG0H 5EC1A 3CFJB 5FUZL 1LEIA 3NGBB 3V0WH 3WFBH 2XWTA 3NN8B 5BZWA 3I84A 3FFCE 1HILA 3D3VB 2UVFA 2VL5A 3ZDXE 1NSNH 3HKFA 3HR5B 3HMXH 1RUPH 4RISH 3V8CA 4M62H 5IWLC 2AK1H 2NX5B 2YRLA 5M7QA 5LXGH 1A14H 3L5WB 1RK0B 5BJTB 1FZJB 2OMBA 3T0EE 3V6OA 2M1KA 4HIIA 4Y16A 4JFFA 3DX7A 4HX1A 1RZKC 5DD5H 3RWGA 2BJMH 1TLKA 1YMHA 3MRPB 3QEQE 1A1NA 1TZHA 1F4YH 5C0CD 3MROB 3UC0H 3KLHD 4OBRA 3R0MA 1CXLA 1UVQB 1JPSH 2DICA 2Y06L 4Z9KB 5GGVH 2C3GA 3MLWH 2B1HH 2DQUL 2VIRA 2SEBB 1N26A 4HJGA 2M26A 5CUSL 4G6JL 2NW2B 4IRJD 3QDGD 5L2JA 5D96C 1QEWB 4KHXL 2EE3A 4ZFOA 1NSNL 1LE9B 4JFED 4K3DL 4MD0A 2R9HD 1MCOH 3STLB 3DSNA 1JPST 2X9XA 1MFCH 1FHGA 3ARDB 4V1DD 1FVCB 3C9NA 2FATL 4MAYB 3CFCL 1YNKL 5JLZA 4OJFH 2WLZA 2HLFD 3AROA 3B9KA 2DDQH 3D3VE 4LCCA 2OJZL 3QDME 1H8NA 2R15A 4LHUB 1IKNC 2XQBH 5C0GA 1BVLB 5ENWA 5IVXA 3ZKXB 1H9VA 2NXYC 3HZVA 4L29B 3VRIB 3WO4C 4XNXL 4DCQB 4GRLC 1CDBA 4HBQA 2HLAA 1K8DA 3U83A 3BWUC 4PLJC 4O2EB 1AD9B 5EUOF 3T4AB 3QWRD 3DBXB 2BHYA 4UQ2B 2AK4E 4F7TA 3VD9A 2L0DA 4FMFA 5MEOB 3K8MA 2FIKA 4WU7B 4NKOA 3RNKB 4OIIL 4JFEB 5KJRL 1FLTX 1NDMA 3TBSA 4I2XB 4DGVH 1YC7A 4HPOL 3RTQC 3GUTB 1CGSL 2IAMB 5J3HD 2R1XA 3V6OC 3WNMA 1U6AH 2P5ED 3BKMH 5ETUA 1ETZA 4V2CB 1YEHH 5DD6A 3U0WH 1KULA 2Q20A 3ZE0E 2AS5M 5KN5A 4NJ9L 1T21B 3VFPB 2HKFL 3VGHA 2HTKD 2AEPH 3GSVB 3PQYA 1L4IA 3VFPA 3RL2A 4CMMA 5BRZD 3MRLB 1A3QA 3RDTA 3BEVA 4N8VB 4JE4B 3IFLL 2CSPA 2JCCE 1HHKB 1GGYA 3GHEL 4LLMB 5TDOA 1WBXA 5JR1L 3J7HA 4ENEC 5I66B 2GHWB 5GSVB 3HAEG 4CU7A 1DQMH 1YNTA 3QXTA 4KMTH 5D7KD 3THML 4JKWA 1SYSA 4B7IA 3L5WA 3MRQB 3MV7D 5TE6H 5C0EB 1FZOB 2QHRL 5JOEA 1KCUH 1QNZH 3D48R 2F54E 5D7JC 5ECJE 3RNKA 2W0PA 3B2UD 3MLRH 1KLUA 4U6VL 3JUYA 5JHDB 4G9FA 1KJ3H 1LEGB 3SJVD 5J6HA 2X09A 3DXAE 4O58H 5TF1L 1BLNB 4H25B 4NDMB 3JBG7 4DGYL 1S7RB 4BZYA 2X40A 4OD2B 1NCAH 1P9MA 3MRJB 3ZDYE 3BPOB 1LE5A 1WSST 4QRPD 4LARL 2AW2A 4ONGH 1CU4H 4KK6D 1K5NB 5DI8A 3VWKC 3ES6A 4G8EA 5DUPL 1HXMA 4Z5RA 3FTGB 2VDKH 1VB9A 2F19L 3CPLB 1J7VR 3H9HA 4U6YA 4IMLB 4HFWB 1MCLA 5CBAB 1MREL 1PEZA 3WXVH 5KTEL 4X6EB 2P47B 1GC1H 4H1LA 1A3RH 2W65B 2HFGH 4WCYH 1FFNA 1FL5B 2QR0A 2R39A 2JTDA 4FNLH 3RX7A 4JZNB 5IFJA 1K2DB 3HA0A 4HK3J 1DQLL 1Z2KA 1IQDA 4U1MA 1UM5L 1QKZH 3TYFA 4D9LH 1SYSB 1NCWL 2Q7YB 5L6YH 2G2RA 4ZFGL 1UKQA 1YN7A 3UZQA 2ORBH 3RPKA 4X8JB 4KUZL 5D5MA 3NFNA 4L3EA 2HMID 3HC3H 1ZVSA 4C59B 4A6YA 2BSTB 1BJMA 2XXCB 2KPNA 3HZVB 2BHUA 4L29A 5EU3A 5IROA 3IJSB 1R24B 3DGCR 5TE4L 3HRZB 3IDMB 3BQUC 1LO2L 3UPCA 1KV3A 3RL2B 3IDYC 4PJ9B 1RIUH 4G5ZL 3EFFB 3ALPA 1EVUA 3BSZH 5ANMB 1H3TA 2Z91B 4FZEL 3PJSB 1G7HB 1MI5D 3Q3GB 4J1UB 1GHFL 4O58L 4QRQA 3C2AH 3BVNA 2O61B 5EU5B 2EXWD 1U95A 3BUYB 1NUDA 5EZIH 4LFHG 4O5LH 2PF6A 4PG9A 3CVIH 1UACH 4UBDC 5IVNA 2Z9TA 2WK2A 2RR3A 3F7VA 3B2VH 2A9MH 4FQIH 3VA2C 1RURL 1MFEH 2VZSA 5D2NB 3EW3B 4LDEB 5F9WC 1JPFA 2IH1B 4XXDB 1F90L 5MHSD 4JY5L 2LV4A 3T0AA 4OIBA 1IT9H 4N1HB 2XPGA 3MREB 3QUYA 1ITBB 5HHOA 3O6LL 3VCLA 3ULUC 1VGKA 4GT7A 1FIGL 1AH1A 4N90E 3T3PF 4J6RL 1FL6A 1J88A 1SBBA 5B39G 2J8HA 3CMOL 4HAGA 2IALA 5CIPB 1QSFE 4FG6D 4LGRB 1NBVH 4PJ9D 2BOCA 1IQWL 1HSAA 4M4PA 4WHTB 5I6XC 4N0UE 1RMFL 5CEXA 3FO9B 1FGVH 4RA0C 5GRVK 4KGJA 2QEJA 4NO5A 4OCRH 4ORGA 4NZTL 3Q1SL 2E7MA 2X2YA 4UAOB 2F58L 1LEIB 5TPWH 2VOTA 5JUEL 4YHYB 2R4RL 1QLRB 1YNLL 2R2HA 2FH6A 4NQUA 5HTSA 3D39E 1TDQA 4ZOEA 4FP8L 3MYZA 2PR4H 4K3JH 5SX4I 1EHAA 3HG1E 3MOBL 3T0EC 3U36A 3QDJD 3GSOB 4XCFL 5J6GA 4FXGB 2BDNL 3MJ7B 2HWZL 4FXGA 1OL0A 1NGQH 4P23D 4AG4L 1IGCH 1RZFH 2WIIB 3P0VL 1N6QH 3OKDB 4KPHL 3NCYP 5JDJA 5B4MC 1MCNA 1RFDH 3GO1H 3REVB 1LEKA 2XZQH 1VDGA 1A4JA 3DYPA 1C12B 4MSWA 1EVTC 1NFKA 1XF4A 5GGQH 1ACZA 4KVCL 2GK2A 4N90D 4HKJA 3VMPA 5CHNA 5A2FA 1KTRL 3VD7A 5GS3A 2HTLD 5LWYH 3INUL 3GSWB 3I9GL 4XP4H 4YBLC 4U0RC 1JI1A 4DFHA 4S2SA 1T7VA 3OPZH 3KWWB 4L4TB 3MC0A 3R1GL 1QQDA 1BJ1H 4ODHH 4GKNA 1KIRA 5J6GB 4LNVA 2IFFL 3CD4A 4PRBB 3RA7L 5HYFA 5CMAA 2EE9A 1YEJH 3QQ9D 2ICES 5E4EC 5ESAB 5CGYD 2NXYD 5T5FH 1GGCH 1QLRA 3ARFB 1MWAA 5DRZB 1BX2A 1RFDL 3O4LD 1GVIA 1UWXK 4MDIB 4Y5VA 1NC2A 4PJDF 4E41A 4Z6AT 3DNKA 1OQXA 1CXKA 3FAXA 4KGLA 2BNQE 3BW9A 4NC0B 1T83A 2VRAA 2DQHH 5K9JH 3H7BB 3S7GA 4QNPE 4RDQF 4TUJB 5I8OH 2YMXH 1JHLH 1WWCA 3OB0K 3CSYB 1GOFA 1ZK9A 2A9NH 3KLAB 3RRQA 5HDQL 3QXVA 3S5LA 2R0WH 4PJFF 1DEEB 1Q0YH 1G7JB 5GZOC 5FHBL 1JGEB 1CN4A 1JZ8A 4KAQH 5BVPL 2J2ZA 3VWKB 5F3BB 3BP5B 4P5KA 3X12B 5DO2C 1VGKB 3EHBC 3PXJA 2QBWA 4JFZL 4RRPG 5SWQB 3B3IB 5D1XD 2HKHH 4LLQA 3RGVD 2A6DA 3MXVL 3DUUB 3FT3B 4UINH 1C5CL 4YDJA 3OJDB 4EEEA 3PHQA 3HPJB 1MJ8L 4IOFC 1XCQB 2NY2C 2AJUH 2B4CH 5IUSA 1UXSA 3LH2L 1ZVSB 1T4KA 1BOGA 3TT1H 1U36A 4PJXF 3LEYL 3V5DB 2Q76A 3MRGB 4OFIA 2OR8A 3KPMA 3WLWC 3WIHH 4HSQA 2A9NL 1TJIH 3BPNC 2QSQA 3MA9H 2YBRA 5I1JL 4XZUA 1CLOH 4QRQB 3BP4B 3H9SB 5GS0L 2NY0D 4YC2C 2ADFL 4I0PB 1HQRA 1ORQA 3G04A 4A6YL 5D6CB 4IIQA 2B2XL 4WI3A 1PFCA 1HWGB 4RIRB 1KYOK 4Q2ZA 4PJXE 3F12B 1VFAB 5FGRA 3S3SA 3CGTA 1T22B 3TWCL 1W72L 4NWTL 3RVTC 1FNSH 3LH2H 4KJPD 4PJCE 3QG7L 1XF1A 2VDMH 2NY6C 2I9TB 3WJJA 1NMCB 1IL1B 2BOBB 4I4WB 3VGAB 5T3ZD 1BZ7B 3LKSB 2AXGB 3GMLB 1AXTL 3ROLA 3WN5A 1DQQA 4JRYB 1FNEA 1NJ9B 5IFAL 3BRDA 3H6JA 1BVKB 1JTPA 2NNAB 3EYOA 3PWPD 4ODXA 4U1IB 3ARED 1CZ8L 4FFVC 1FCGA 2L7JA 4KQ3L 5IW1A 2OJEA 4XNUL 1I3UA 5IROC 2EO1A 2WINB 4S10A 4HGKC 4BQCA 3BPLB 2NY4C 3RDTC 4F7EB 4FQHB 1YEFH 1Z5LA 3TT1L 3VXSD 4PJCF 1OARH 5DI8B 3EOBB 4FQ1L 3O3DB 5DJ6B 3SCMA 2JIXD 3VXMB 3QJHA 3H42H 3QPQC 4QYOA 3PGFL 4ZO7A 4BSWB 3DVIA 4YHIB 4U1LA 3KPSD 4HPYL 4W68A 1MEXL 5CJBA 4G8FA 3VCLB 4HGWB 3PQYB 4NDMA 3WKML 1UG9A 5AWNH 1QSFD 2A6JA 1W0VB 1PDKA 1ETZB 4R6UA 2Z31B 4MD4A 1DBJH 4RMRA 1P4IH 3OF6D 3MLXH 3QDGE 3QUYC 1C1EL 4S1DD 1UA6L 1S3KH 3WNOA 2QHRH 3MRNB 4OZGB 5DEGA 4P9MH 4FQJL 2OI9B 1UM6H 2O61A 4MNQE 2X4SB 2NY4B 1L9MA 3RDTB 2ITCA 4ZFFA 4BH8B 3AS2A 4IOIA 1QSEA 1KELL 2XKNA 4IRJB 4QTHA 5GGRY 3RVTD 4BH8A 1MRDH 3ZYJA 3O6FC 4LGPB 5J9PA 5C0BA 1BJ8A 2YA0A 3PUCA 1R6VA 1UH2A 1WICA 1GGIL 2DJ4A 3UROR 2ZPKL 2YEZB 3OJ2C 3DVNA 2P7TA 5E5RB 4F7CA 1I8IA 1XGRA 4OZFB 1J0KA 2DN7A 1K4DB 4XT1C 4PJAF 2ED8A 1FNLA 5LQBL 4NN6C 4ODWA 4ODTH 3F7YB 4FQQB 3CCHA 4UUJA 2XKUA 2VWEC 3TBVB 4YXLL 2ZCLH 4X6FA 1CIDA 1G0DA 4G42A 4N0YH 2AK4A 4URTB 2XZAL 1IGFH 5KTEH 5CZKA 1KLGA 5JA8B 3MJ8B 1WZ1H 4LLDA 4PRNA 4U7MA 4Y19A 3BQUA 4FTVD 4OI9A 4L8DB 2UZYB 3TGXA 3IFOA 4UT7H 1FG9C 2OTUB 1QKZL 1ZLUK 5HGHA 2YUWA 1TVBA 4WW2B 1OGTA 1QSVA 5ICZA 4R4FL 2LTQB 1BEYL 2VWEE 4HPOH 4PP1D 3QJHB 5FM5O 1DN0B 4OLXL 1JP5A 2PYFA 1FVEB 3IVKA 3C6LD 4YHLH 1HH9B 5HPMA 4AT6A 1OTUD 3V6ZB 5IVZA 4JFDB 5DHXB 4PRDB 1NPUA 2P5EA 5E2TH 5IHBA 1AHWA 4OLWH 2X6MA 3TLRA 5D6DC 5FAAA 1F58L 3QHZH 3EYVA 4MWFA 2Z93A 3GFUA 5JHDA 4K23H 1KEGH 5D2LA 3W0WD 1PEWA 2DYPA 4KMQA 5E5UB 2RCSH 1NJ9A 1KLGB 1I1YA 4U2ZA 4DK6A 5HHNA 3VRJA 2UWEB 1RUPL 4RISL 1ACYH 5E03A 2ADJB 4P3DB 1FG2B 3LN4A 3CX5J 3FB5B 4G6MH 2O5ZH 3ETBF 5LVEA 1E4KC 1QEWA 1II4E 1QHPA 3NCBB 5JIPA 4HH9A 3V6BR 4X99A 1PX4A 3QEGH 2GK0A 3L95B 2WV3A 3RVUC 2Y7QA 1KCUL 4LFHD 1A6WH 5INCB 5MEPB 1MAMH 5J9PB 4Q9CA 4Y4FA 5DC9B 3MUJA 5HGBA 3V6FB 2H45A 1JGLL 4C56A 2VC2H 4UZGA 3U9PH 1BBJA 1RUQL 3GK8L 1DDHA 1I1AD 4M9PA 4MGXA 3RI5K 5HVHB 5KSVB 4R4FH 5EOQL 5I73C 1CWVA 3QIBA 3LQAL 4NYLB 5KZCD 4F3FA 2WBJB 4X4XA 2PNDA 4WEBH 4N1EA 2Q76B 4BQ8A 5F3HB 4YBQC 1XGQB 4PGDB 3BD5A 2VZVA 5B39A 5E5MB 4B41A 4X0KB 3L5XL 2FBOJ 4JFEA 1KCVH 5EC2A 5H94B