4DOVA

Structure of free mouse orc1 bah domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
157
Chain Sequence
QTFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
molecule keywords Origin recognition complex subunit 1
total genus 33
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dovA00
3PTAA 4JJNK 1M4ZA 3PT9A 1W4SA 4FSXA 4KULA 4FT4A 1ZHIA 4DOVA 3TU4K 2FL7A 4FT2A 4KUDK 2FVUA 4DOWA 4BB7A 1ZBXA 4LD9K 4DA4A 4KUIA
chains in the Genus database with same CATH superfamily
4EDUA 3UA6A 3FIFA 2YWWA 1W2BA 2EGAA 4IUUA 3SB2A 1B07A 4M7DE 1RAEB 1OULA 2H3EB 5FLXE 4XQ3A 4KGXB 4BY6C 4XTZA 3H41A 1GFCA 2K5FA 2JZ2A 5GANf 1X75C 4BE0A 1PWTA 5IHNA 3EFOA 1VYTA 2O9VA 2H3JA 1M1KR 1X01A 4R0KA 2PUOB 1VQ4Q 1LCKA 3GIBA 4IUVA 3OSVA 4OMNA 3DB4A 3I5RA 2QGGA 1PD1A 2A28A 2E10A 4OMPA 3OW2P 1PCXA 4F7UG 3L1AA 1YHQT 2JOYA 4M78A 1ARKA 3PMIA 1BI2A 2VVKA 1Z9ZA 3CCQA 5FW9A 1OU9A 2M9UA 5HK0A 1WHMA 4KULA 1OX8A 2O4XB 1HXDA 2DD4A 1QVGP 4J9BA 2CP2A 1NM7A 2DXBA 1M8MA 4QVZA 3M0QA 1MV3A 2L3QA 4WF2A 7AT1B 1YJ9A 2XDBA 3ZFJA 2OI3A 4E7ZA 1Y07A 1XQHA 2XMFA 4EMKC 3JCMV 1VQ6Q 1PRLC 1PC0A 4LDYA 2KYMA 4M7AA 3THKA 2JTFA 3VRYA 1VQ6T 4J6WA 1DJ7B 2KMTA 1VQ9T 4J7IA 3JCMg 1Q82C 4WTOB 1YJ9Q 1IXDA 1LPLA 3I56Q 2RI2A 5LJ5d 3V8JA 2YT6A 4CC2A 3MKDA 1NPPA 2LZ6B 4CC3A 3CCSQ 2BKDN 1KQSP 4M78F 1AVZC 2EYYA 1JBMA 2JS0A 3WVDB 2COWA 1IB8A 4E6RA 1BB9A 5KYUB 1KD1C 2XIDA 2BZXA 1IRXA 5IHIA 2W0ZA 5EG2A 3LWHA 3OYCA 1WXTA 2JMCA 4OGCA 3CCEA 1QWFA 2E64A 1U8RA 2C0TA 2SRCA 1OQKA 9ATCB 5A0DA 1Q82R 3BDLA 2GQIA 4IUTA 1WPYA 2M1HA 4PJOE 2GFUA 2VWFA 3VUBA 1SF9A 1VQ4T 4OMFB 4KH0B 4PJOC 5KYXA 2K4YA 2GQVA 3CMET 2DAQA 4L5GA 3G6EQ 2OTJA 2A3LA 3S6WA 3VS1A 3M56A 1BIAA 3DKMA 3QWYA 1X6OA 2JVVA 2XDDA 3CPWS 2FG0A 4FT4A 4M78B 3OA6A 4HCCA 2LT4A 2LX9A 1MUZA 4OP0A 4M7AD 1Q7YR 1YIJA 2DYIA 4C5EA 5LJ3j 3A98A 1YN8A 3C4SA 2DJZA 3OYEA 3CMEQ 2K5IA 2OTJQ 4HXJA 2E5QA 5CCAA 3G71A 2IG0A 3SD4A 3QHSA 3TEEA 1BI0A 5CKFA 1UGSB 4A54A 4MMKA 4Z89A 1NE8A 2EFIA 3OS5A 1N5ZA 1D3BA 3AT1B 1KIKA 2F5TX 1IZ6A 2RHYA 3JCMW 3V7CA 2XICA 3C95A 1SRLA 3EG9A 1Q81R 4IKFA 4LDWA 4LXCA 3EH1A 4OMQA 4O6JA 3HFNA 4C0DC 2IPOB 2YUQA 2RK1A 2P0PA 1W1FA 1BKBA 1D0YA 3NTIA 1WHGA 1KC8R 2RMOA 4C92F 4F14A 1ZHIA 4ZNXA 4PJJA 3H8ZA 2RF0A 2XKOC 2D9TA 1ACMB 2O9SA 2P84A 3JCMe 2NUPA 1NEGA 3EG3A 1EIFA 4CI0C 3E9GA 1C1AA 1WDXA 1SRMA 1YJ9T 1ZLMA 1UE9A 2QQ9A 3MO8A 4DBQA 3SWNA 1ABOA 1QCNA 3M0RA 3RESA 1KQSS 1VQLQ 1GCPA 2DILA 1VQ8Q 3G6EA 1YBYA 3PVQA 4C0GA 2HBPA 3I55T 1K0XA 1JJ2A 3LGLA 1UJYA 1OV3A 3EGXB 5IHKA 4OGEA 4ATOA 3D7SB 1Q7YU 2VGMA 1H3HA 4XK8E 2E6NA 2B8AA 1TSFA 2FRWA 3MEUA 2RQWA 1G5VA 1X2KA 4B6MA 4KUDK 4M75F 1UB4A 4ELZC 1VQNT 1MGQA 2AT1B 4M78C 2X4XA 4NS5A 1N6AA 2DJQA 1EFNA 3JB9J 1SG5A 2YLCA 1S72A 2K3BA 3I55A 3L2WA 2O88A 5CKEA 1KHIA 4LNPA 4PJOB 2MI6A 2ESWA 1KQ2A 2JT4A 4XTYA 1WIEA 2F2VA 2ZPBB 3CC7Q 4XTXA 3PNWC 3BFMA 3CCMA 2C0OA 2LT1A 1N9SA 3MHXA 5AYFA 1YFNA 1ZA1B 2RQUA 1VQMA 2FHDA 5GAMd 1AHJB 5HK3A 2F69A 1Q82U 3Q1JA 2GTJA 2PNIA 1Y57A 1TUCA 1KSWA 4J9HA 3GF5A 4QQGA 2EW3A 2CSQA 2AHJB 1MNEA 1RAHB 4NL2A 5KE2A 2A36A 4M7AG 2KNBB 1NYGA 2DMOA 1BCOA 3M55A 2FZGB 5CKDA 4M7DB 3TSWA 1RI9A 4Z8AA 3OYBA 3A8OB 2HMAA 4FW1A 3QSUA 2FVUA 2QQRA 1OYXA 3CCRA 1AWOA 1AOJA 4JRIA 4Y92A 5I2SA 3CMAQ 4M77E 4FSSA 4F17A 2K2VA 3OYLA 4AT1B 1W2BS 3EHRA 3CCUA 1YCSB 3KUFA 3CBMA 1MNDA 2GTOA 3SHWA 1VQOT 1H3ZA 5M9OA 3V7RA 2LQKA 3P8BB 4ZGJB 3CPWA 3CC4A 3A8LB 2RQTA 2EWNA 4KUIA 4XU1A 3QWXX 5FU7B 2Z0WA 4L59A 3HRTA 1QVFS 1WX6A 1YJNT 3GLXA 2QI2A 1VQPT 1E6GA 1ZSZC 1GBRA 2J6FA 1JEGA 2RI5A 1RAAB 3JCMX 3EFRA 3PIOA 3CCJA 3LLRA 2EGCA 3VU3C 4AG1C 4N4GA 1I5LA 4HVWA 3WVEB 2DD5A 1IGQA 4RTUA 4II1A 1YP5A 3CC4Q 3JCMc 4AFQC 1KK7A 1WQ7A 3L2QA 1D0ZA 3E1SA 2HQEA 2JS2A 2DPPB 5IXBA 3CC4T 1LVKA 3REAB 1VOMA 1GRIA 4M77G 1OX9A 3GNFB 3OYNA 2HZYA 3RERA 2CZ1B 4QQ6A 2DIGA 4JRPA 4C8QF 5GAMh 2ENMA 1R0CB 2DNUA 3QYHB 3TSZA 2CGHA 5A0LA 2V8IA 3M5AA 2KRSA 1Y0MA 5GAOl 4F7UB 4OB3B 5J39A 3MCAB 4A4GA 2QAZA 2HSEB 5KCOA 2DVEA 3GNGA 4HKEA 4P5NA 4DBHA 2FRYA 1VQOQ 3JB9F 2M02A 4F16A 1YJWQ 4HA8A 2RH2A 3EG9B 2LX7A 2L2PA 2AKLA 2MPXC 3KFVA 2RJCA 4RTYA 2EAYA 2NLUA 3OYGA 3CMAT 2QA4A 2QDYB 1VQ8A 2ZPEB 3RKXA 2EQIA 4HVUA 5GAOp 2F1LA 3VYHB 4L6V5 1C0MA 2KT1A 4M7DA 2L5QA 2RJDA 3OW2A 1I81A 2QDLA 2HSPA 4OF1A 5CQXA 2QQBA 4EMKA 3MP8A 2GCXA 2CZ6B 3J80E 3TVTA 2NWMA 3CC2T 1K8AU 4O5VA 1MMAA 4TVRA 3G4ST 3OYAA 2O31A 1KG1A 1YIJT 2GNCA 2KEAA 4RTWA 4ZTJA 2LNHB 5I21A 3QO3A 2D6FA 2ZGWA 1TG0A 1S72T 4J83A 1UGRB 1WHHA 2DLPA 3HFOA 1NPRA 3M54A 2PQWA 4BI8B 1K1ZA 1QLYA 1S1NA 4VUBA 2X51A 1RAGB 3L2RA 5KYWB 4FCYA 3X25B 2E65A 5GMKm 4A4KA 2YDLA 2D0NA 3S3MA 4E47A 3UWNA 2MAMA 3J7AF 4C0ZA 3OYKA 1VQLA 3ASKA 4J8OA 2CS7A 4JZ3A 3X28B 1QWEA 2MIOA 2X4YA 4EPCA 4FT2A 1UG1A 1H92A 1AEYA 1EZZB 3I35A 4AFUC 1BU1A 8AT1B 2ZPFB 4FYVB 4C8QA 1GBQA 4DEXA 4M75C 3RKWA 4PJOA 4C8QC 4C8QG 1VQNA 3CXCA 1T3LA 1YHQA 2RN8A 2KY9A 1X27A 1OOTA 2LJ3A 3E2UA 4ZTFA 1JXOA 2O4XA 4N0AA 3X20B 4X9DA 3CCVQ 2YXYA 1M90R 4QW2A 3CQTA 4MZMA 2F5KA 1SSFA 3EG0A 2LDMA 1Y71A 1NEBA 4LE9A 5D6WA 4N4HA 2J6OA 3NPFA 1NBEB 3MEWA 1ZSZA 3ZEHA 3CC7A 1KC8U 1Y96B 2CDTA 4M7AE 2CT3A 1PSFA 2R58A 1PSEA 3M4YA 3NTHA 2WSCE 3NHNA 3OMGA 4A4HA 2KE9A 5GMKj 4DA4A 2EGEA 3OSSC 4PJLA 4A4FA 2EYZA 3CCJQ 1QKWA 5FU6C 1NJIU 1JXMA 1M3BA 2QGFB 2HL5C 3A8HB 3L2UA 2V26A 3VS3A 4PNOA 4XAXB 1JB0E 1TTHB 2I2LA 3WXMB 3CC2Q 3CMEA 4LD9K 3EH2A 3CCJT 1YITA 1JJ2S 1K4US 4FIBA 5CQYA 1UECA 2QYZA 2D8HA 2PZ1A 2ZPHB 3LX7A 4IIOA 1M2OA 2DFUA 3OYHA 2OTJT 2EYXA 3RNJA 2DL7A 2L3PA 3GP8A 2MOXA 2Y4YA 1SEMA 2DBKA 4C92D 3E9FA 1YITQ 3C94A 1G83A 4E7IA 4A4EA 1RLPC 2DL3A 1VA7A 4OB0B 1ZA2B 2RQRA 5GAN2 3TU4K 1IHWA 1D0XA 1NYFA 1YJWA 3JB9I 4B9XA 2OAUA 3UATA 3OBYA 1AZEA 5CKHA 4A53A 5GANj 2RHIA 2YLBA 5I2MA 2WSEE 2CREA 4DOVA 3VJPA 1M8VA 3CCRQ 2LP5A 4F7UA 1WQWA 1R0BG 2X3WD 4PFOA 3LW5E 1QCFA 5LJ3d 5DLOA 4M75G 1T0JA 2DX1A 1YNZA 5GAOn 4J9EA 5GJWB 5LJ3g 3QPHA 4LD6A 3RMSA 3CCST 5EC7A 5A0GA 4X9CA 3O8VA 3UF4A 1MV0B 1U1SA 3OYYA 2CSIA 2F2WA 1M1KC 1I07A 1HK9A 5FU6B 1D1BA 1V76A 1YJNQ 3HSBA 1U5SA 1RACB 1LNXA 1BI3A 3HTRA 1N9RA 1PD0A 2CH4A 1OI1A 2CT4A 2O2OA 5KCHA 2HD0A 2GGRA 4DQ2A 3G4SQ 2AZVA 1VIEA 2D8JA 2FPDA 5IN1A 2M51A 5D6XA 5KH6A 2K9GA 2DVJA 1QVGS 1KC8C 2YUOA 4R56A 3HL8A 1RI0A 1ZUKA 3VS4A 3MEAA 3ZL7C 5GANd 3MP1A 1VQ7T 1XJWB 1M90C 1WJSA 2JJ9A 1FMVA 4M7DG 3BY7A 3JAME 1VQMQ 3MPUB 4PL6A 5GJVB 3VS2A 1PHTA 3VYGA 4BE2A 2JMAA 4PK4A 3DLLA 1SPKA 3H0HA 1H641 2KSSA 2EQUA 3UT1A 4HCZA 2CP5A 5IAYA 1K73U 5C0MA 3L42A 2LCSA 3H0IA 2FB7A 3OQ5A 4JPBW 4PJOG 1QKXA 2QXFA 3P8HA 4BUGA 5KYXB 5HCKA 1ZBJA 2G3RA 2PVOB 3CCLQ 2KRMA 4OB2B 1VQ7A 2YUPA 1V1CA 2LCLA 5A2QE 5LJ3f 4M75B 3NTKA 1V29B 2WACA 4C8QB 4CRIA 2LRQA 2L8DA 2RD1A 2C06A 2RHZA 5DY9A 2EVRA 3OYDA 1IO6A 3RKYA 4M75E 4MZTA 3I5SA 4RCCA 2V1RA 3VS6A 2EQKA 3LWIA 3ZBDA 1G3TA 1UUEA 5LJ5h 1M1FA 2OTLQ 3DLMA 1HYOA 1D3BB 4LDVA 3F70A 2JXBA 2HL3A 1OU8A 1D1CA 1OPLA 3M57A 4BI3A 3CCMT 2Y90A 4IUQA 1Q81U 8ATCB 4D8DA 1Y96A 1OZ2A 1KD1R 4FSXA 4WCIA 3G71T 1VYVA 1YI2Q 2PU9B 1K8AC 2EPDA 1Q86U 1OPKA 4KBMB 2ZZDA 4E7JA 3V8LA 4ELYC 1YI2T 1TOVA 1T0HA 3QXEB 2BZ8A 3G71Q 4B9WA 2V8KA 2M0YA 5ECAA 4DBFA 2HKNA 2L3RA 3CCMQ 2AZSA 5GAN3 2EJGA 1TUDA 1VQ9A 1EX4A 2E5KA 1RUWA 2CYZB 4N4IA 3G1JA 4XU3A 3OYJA 3EGDB 1B3QA 2J06A 2JTEA 1I4K1 3CCUQ 4NOYA 4FM4B 2KQWA 3SWNB 5KE3A 3FJPA 2QEXT 5FWBA 5GAOq 3LGFA 3JB9H 1TS9A 4C5GA 3RDVA 3NFCA 2M0OA 1WZOA 1HJDA 4M7DF 3PT9A 2CP0A 3A8MB 2CUDA 1AWXA 1VQOA 1FWZA 2HNIA 2E3IA 5LJ5g 1XNIA 3CD6T 3MEVA 3MJXA 4C92A 4DBRA 4RCBA 1G2BA 3M0PA 2KROA 4ANJA 2R5AA 3RUXA 4JJNK 2DBMA 2A37A 3PGGA 3EFOB 1Z9QA 5IH2A 2X4WA 2YRDA 1K9MC 2Y4XA 2VB6A 2KXCA 1HSQA 1UTIA 2P4RA 3HPWA 2JW4A 2DF6A 5GAN4 5J3BA 2GBQA 4FW2A 1AT1B 3FB9A 3CCLA 3HRUA 1GFDA 1GCQC 2C0IA 4ESRA 4M75A 2OJ2A 1GCQA 1LJOA 2RNAA 3A1PA 4XTVA 1UEBA 4RTXA 3PTAA 5HKCA 4XTUA 1YITT 3UPUA 2DTOA 2RK2A 4RG2A 2EIFA 3VS7A 5LJ5j 5FRNA 5CKBA 3QZ5B 4OMOA 1KFZA 5I11A 3M9QA 5FWCA 3REBB 1VQ5T 1M2VB 4JJDA 1HD3A 4GBQA 1F1BB 2GF7A 2ECZA 1M4ZA 1Q95G 1JJ2P 2ZCFB 1SKUB 3GBQA 4BE1A 2QEXA 1TU0B 2DE0X 3PE0A 3I55Q 1B34A 2AKKA 2KAFA 1WFWA 4JZ4A 4FYXB 4ZN1A 2VC8A 4AG2C 4MDWA 4V2SA 2BTTA 2EKOA 4BDYA 1UFFA 3U23A 1KQ1A 2VGNA 4RKUE 2VASA 2QEXQ 2KYBA 2DL4A 4C92C 1M5Q1 4M78G 4FYWB 3CCUT 1ABQA 1VQKQ 5L8RE 2DTIA 2XI9A 1XTDA 2AIRB 3QJYA 3TCJA 3I56A 4IURA 1ZSGA 3OB9A 4QVDA 4M77F 2E70A 2K3YA 4FL6A 1TH7A 3EGDA 2AK5A 2V8JA 2CP7A 5LJ3e 2HQXA 5FRMA 1YWPA 2PTKA 2DRMA 3CCRT 1Q81C 4PJMA 2MF2A 2YUNA 1M3CA 2HBWA 4M77D 2VYTA 1W70A 2LJ0A 4K11A 3QDRB 2DERA 2JM9A 4C92B 2QK0A 4LUEA 5LJ3h 3EFSA 1N8RU 2GFAA 1RL2A 4E7HA 3BE3A 1N8RR 3JCMQ 1PNJA 4X1VA 3R6NA 2DETA 1O75A 3GPLA 4BD3A 3LH5A 2RM4A 2K57A 2EQMA 3HKSA 1YJNA 5L23A 2E12A 4HT8A 4F7UF 1FX7A 3CBPA 2KT8A 1M27C 2BUDA 3EGUA 1VQPA 3ME9A 4NL3A 1KQSA 2A08A 4AFSC 3JSCA 3TREA 4Y28E 2X9HA 3VUZA 1KJWA 2M16A 3OY9A 3LH0A 1WHLA 3URGA 3FLGA 2CKKA 1UHFA 1YHQQ 1WLPB 1ZUUA 4GLKA 2KBTA 1FMKA 5J26A 4RTZA 2LMJA 5GAOm 1ZQ1A 1K76A 4RMOA 1IREB 1SHFA 3A8GB 4HCBA 5LJ5e 1WXUA 2IVWA 1AWJA 3JB9D 3FJ5A 3TQ7P 3N5BB 1VIFA 3JCMb 5GANh 4J9DA 2H8HA 3CD6Q 3T9NA 4OMLA 1ZBXA 2QTXA 1MMGA 2J6KA 2W10A 2ZPIB 3QZ9B 1QP2A 2OTLA 4J9FA 1JQQA 4JUVA 5IXFA 3M0TA 1U3OA 4KGVB 3VS5A 4AMCA 4M77B 1WA7A 4JLIA 1BK2A 3CBOA 3FRNA 2CP3A 2G6FX 2B86A 3JCMP 2A7YA 1UGPB 2P0KA 2L89A 2FO0A 3HRSA 3AHUA 1QVFA 2E1HA 3RBBB 2QQAA 2QG9B 4RG8A 4J9IA 1MMNA 1M3AA 2MCNA 2K3XA 1NLPC 4PLIA 3DB3A 3CCSA 3CCQQ 4RTTA 2RPNA 3OYMA 1NJIR 1M30A 4E7KA 4JRKA 2DRKA 5GMKl 1YJWT 1KHCA 3A5ZB 2KI7A 3QYGB 1D09B 2BIVA 5KYYB 2MMPA 1G8XA 3M0UA 1M1KU 2ABLA 2PUKB 1BI1A 4A63B 2WSFE 1RLQC 5CIUA 2RI3A 2IIMA 3QJ6A 4UC4A 4M78D 1X69A 4XU2A 4BACA 3G7ZA 3H0FA 1RADB 4LDUA 2R5MA 5GAMe 1QCOA 3EGXA 1CKBA 3HHTB 4QQDA 4RUGA 1U06A 2OTLT 1FYNA 1I8FA 4KGZB 3M0SA 3E19A 5GAN7 2JN0A 1UHCA 1K73C 2LJ1A 5CO7A 2PVDB 4Z02A 2JM8A 5D6YA 4QVCA 1BCMA 2XD0A 5LL6S 1VQ5A 1W2BP 4E7SA 1C6VX 4HT9A 4CC7A 2LQ8A 2EJ9A 2DM1A 4C92G 5AT1B 2FEIA 5FU7C 4C8QE 1AWWA 1RAFB 1T3SA 2QA4T 4J9GA 1VQPQ 3EG2A 3H9NA 4KT0E 2RQVA 3JRZA 2VV5A 2DEUA 3CCVA 2QQSA 5KYNA 1S72Q 1BBZA 1CKAA 5GANg 3CCLT 1M2VA 1N8RC 3OW2S 2E4HA 1QMCA 1U1TA 4XTWA 1IHVA 1IGUA 3PMTA 2NUTB 2MYSA 5GMKh 2R57A 4BI4A 4D8KA 3JCMd 3FC3A 3RR6A 2FPFA 1G3WA 1NG2A 3S3NA 2DZ9A 1VQ4A 1WXBA 1WI7A 1PKSA 4C0DB 1K9AA 4MDXA 2DTHA 4PFPA 3PFSA 4C92E 1VYUA 3S3OA 4EMGA 3EG1A 2FZKB 2ROTA 2X35A 1D1AA 1VQMT 5GMKi 3CD6A 3JCMJ 4RTVA 3H6ZA 3OYIA 2JNGA 4MZPA 2XG8D 5D7UA 1VQ7Q 3M58A 4E2FB 1M1GA 5I22A 2FZCB 4M7AC 4FU6A 4PJNA 2J05A 1UJ0A 2KVQG 2LCCA 4IIMA 5GMKe 1R77A 4M75D 3J81E 1E6HA 4C8QD 1M90U 3CPFA 3JB9G 1WHKA 2NUPB 1GXIE 3RMQA 2EYWA 2X3XD 5DM7R 1NJIC 2HCKA 5CVIA 4Y91A 1QVFP 2ROLA 2O01E 4Z88A 5GAMf 2ZPGB 3JCMh 1O9SA 3OS1A 2KRNA 3OMCA 3META 3BW1A 1M9SA 3VV0A 3L2VA 4ZGDB 3M4GA 4X34A 2E6ZA 4XU0A 4J9CA 1OEBA 5LJ5f 2X4JA 1GL5A 2ED1A 3VS0A 2PVGB 4JDSA 2EKHA 2KK4A 3SFMA 3LYIA 2YRCA 3L2ZA 1A0NB 2FL7A 5GAN5 2DXTA 3SWNC 3CEYA 4M4ZA 3OYFA 4J6XA 2P0QA 2DXCA 1I0CA 1SSHA 4BB7A 4E7LA 2HEQA 1AZGB 4FYYB 5GAMg 1PKTA 4Q5WA 3M59A 1BYMA 4GY5A 2ED0A 3JV3A 4JLGA 2A0FB 1G3YA 4M7DD 1VQNQ 2XDPA 3CCET 3IQLA 3OBWA 2J7IA 2HKQB 4PFZA 5FROA 4JS5A 4ME7A 1TWBA 4N0AC 1YCYA 4C0FA 1QQJA 2E41A 1K9MU 2DO3A 1K9MR 4F04B 3X26B 1R8OB 2KR3A 3VKIA 2K2MA 2V1QA 5CK9A 4QKUA 3VRZA 1FXXA 1PM3A 5GAN6 2JTMA 1PRMC 1VQ8T 1JU5C 3CCEQ 2DYBA 3R6OA 2LVMA 1AD5A 1H8KA 4YTLA 2QTVA 1X43A 4EIKA 5GAMj 2RO0A 1J3TA 2NUTA 4R55A 2YHTA 2BE9B 1UDLA 2LQWA 1MHNA 3QDFA 4J6YA 3M53A 2YSQA 2LTOA 1MMDA 5GANe 4M7DC 2F2XA 4M77A 3G4SA 3GOXA 4M7AF 2ATCB 3X24B 2EYQA 5CR2A 2VUBA 1Q7YC 1I1JA 1QVPA 3ER0A 1Q86R 2VXFA 3CXCS 1WJQA 4F7UE 1VQKA 2K79A 3MP6A 3KBGA 3UDCA 1ZUYA 4PJOF 2DXUA 3KXTA 2YRVA 1LOJA 2DEQA 3SDZA 4HCKA 4JS4A 3QIIA 3NGPA 4PLLA 1YIJQ 1B7TA 2XHCA 3QUIA 1UGVA 5DLQE 2K7AA 2E3HA 4KRTA 4PJOD 1UGQB 3OS2A 2I0NA 2CP6A 3FEOA 3P8DA 4GLMA 4IUPA 5KYYA 3CC7T 1Q86C 1W4SA 1OZ3A 2RHUA 2LQNA 4KH1B 3QG1A 2RB6A 3O5ZA 4LUDA 1TXQA 2EBPA 3PIPA 3CC2A 2D0QB 1QP3A 3SEMA 2SEMA 1CSKA 3RIRA 3FDRA 2LC4A 1VQ6A 1NZ9A 2HAXA 1WHJA 2L3SA 3CCVT 5C6SA 3C12A 3CPWP 2VKNA 1K0SA 2BE7D 2FYKA 1FMWA 2MWOA 3ULRB 1X6BA 1BIBA 3C0CA 1XOVA 2JUFA 2OX7A 2XK0A 4EMHA 2QASA 3G6ET 1VUBA 2COZA 4BY6B 4PKCC 2MWPA 2P4TA 1K73R 1Y7XA 1NLOC 2NYSA 3HP9A 1YWOA 2DZCA 1JO8A 3EAEA 1WNLA 2HDAA 1X6GA 4OMMA 2QA4Q 1X2QA 4HVVA 1VQLT 1QW1A 4DEYA 3NMZC 4ZN3A 4AFZC 4C5HA 4CC4B 2ZAEA 5CAIA 2KDSA 2D1XA 2K5LA 4M78E 2KXDA 4LDXA 5HY6A 3INZA 4JJCA 2COYA 1W6XA 2DKGA 2EQJA 3CXCP 2K6DA 4MMLA 1YI2A 3EHQA 4J5YA 4M77C 5IT9E 1QVGA 1VQKT 2L0AA 2MK5A 2DIQA 2RHXA 2DK3A 5GAOr 2RJEA 1B34B 4M7AB 2XU8A 1ZSZB 2CH4W 4J7FA 3I56T 2LNVA 1N27A 2CZ7B 1I5OB 1VQ9Q 2CZ0B 1E7OA 4JJBA 3QBYA 1KD1U 4EMKB 2DL8A 3V7SA 1RABB 1TUGB 3JCMf 3OS0A 5GAN8 1WYXA 2NUZA 4QT7A 2DL5A 6AT1B 4ORZA 2FPEA 4ZGEB 2OAWA 3QKJA 2CUBA 3CCQT 4D6WA 1RAIB 1JRIA 3BDUA 1SHGA 2KGTA 1WGSA 4OB1B 3V8KA 4C5IA 2BZYA 1VQ5Q 4JRQA 2RA2A 2EJFA 3CMAA 1ZX6A 1G3SA 4LN2A 1WJRA 4OVAA 4BDZA 1P92A 5KYUA 3I9QA 1PG5B 2DA9A 4DOWA 2HQHA 1K8AR 2RJFA 3UA7A 2VXEA 3PVLA 5KYWA
chains in the Genus database with same CATH topology
5FU7B 4EDUA 5CIUA 3VYGA 2RI3A 3FIFA 4BE2A 3QJ6A 4UC4A 3DLLA 1W2BA 4L59A 3HRTA 1H641 2KSSA 4M78D 4IUUA 1QVFS 2EQUA 4XU2A 3SB2A 3UT1A 4BACA 3G7ZA 1YJNT 4M7DE 3GLXA 4HCZA 2QI2A 1VQPT 4KUIA 4LDUA 5IAYA 5FLXE 1K73U 2R5MA 4XQ3A 4BY6C 4XTZA 5GAMe 5C0MA 2K5FA 2JZ2A 5GANf 3HHTB 2RI5A 4QQDA 3L42A 3JCMX 1X75C 4BE0A 3EFRA 2FB7A 3PIOA 3OQ5A 3CCJA 4PJOG 2H3JA 3LLRA 1X01A 3VU3C 2OTLT 1I8FA 4N4GA 1I5LA 2QXFA 3P8HA 3WVEB 4BUGA 2PUOB 2DD5A 3GIBA 2G3RA 3E19A 4II1A 2PVOB 5GAN7 3JCMc 4OB2B 1VQ7A 1WQ7A 3OSVA 4IUVA 3L2QA 2JN0A 3DB4A 2LCLA 3E1SA 1K73C 5CO7A 2PVDB 5A2QE 2HQEA 5LJ3f 2DPPB 4M75B 2E10A 5D6YA 3NTKA 4Z02A 4QVCA 1V29B 2WACA 5LL6S 3CC4T 2XD0A 4C8QB 1VQ5A 4CRIA 2LRQA 2L8DA 2RD1A 3L1AA 4F7UG 2C06A 1YHQT 4M77G 4HT9A 2LQ8A 2EJ9A 3GNFB 2JOYA 3OYNA 4C92G 3RERA 2CZ1B 2RHZA 4M78A 5DY9A 5FU7C 4QQ6A 3PMIA 2DIGA 4C8QE 3RKYA 1BI2A 4C8QF 3OYDA 4JRPA 5GAMh 3CCQA 4M75E 2QA4T 4MZTA 4RCCA 3QYHB 2CGHA 2M9UA 3JRZA 4KT0E 2VV5A 5A0LA 3CCVA 2V8IA 3M5AA 5HK0A 2QQSA 2EQKA 3LWIA 3ZBDA 5GAOl 1G3TA 5GANg 4KULA 4F7UB 3CCLT 4OB3B 1N8RC 5J39A 5LJ5h 3MCAB 3OW2S 2O4XB 1HXDA 1M1FA 2DD4A 4A4GA 3DLMA 5KCOA 1U1TA 4XTWA 1D3BB 4LDVA 2DVEA 3GNGA 3F70A 3PMTA 4HKEA 5GMKh 4P5NA 2DXBA 2R57A 4BI4A 4QVZA 3JB9F 3JCMd 3FC3A 3M57A 4HA8A 2RH2A 1G3WA 4WF2A 3S3NA 2DZ9A 1VQ4A 4BI3A 3CCMT 2Y90A 1YJ9A 4C0DB 2XDBA 4IUQA 1Q81U 4MDXA 2DTHA 2RJCA 1Y96A 3ZFJA 2EAYA 3PFSA 4C92E 1OZ2A 4FSXA 3S3OA 2NLUA 4EMGA 1Y07A 3OYGA 3G71T 1XQHA 3CMAT 2X35A 4EMKC 1VQMT 5GMKi 3JCMV 3CD6A 2QA4A 3JCMJ 2PU9B 1K8AC 2QDYB 1Q86U 1VQ8A 2ZPEB 3RKXA 3H6ZA 4KBMB 4LDYA 5GAOp 3OYIA 2JNGA 2ZZDA 2XG8D 4MZPA 3VYHB 3M58A 4M7AA 4L6V5 1M1GA 4E7JA 2JTFA 1VQ6T 3V8LA 4ELYC 4J6WA 1YI2T 4M7AC 3QXEB 4M7DA 2L5QA 2RJDA 1DJ7B 4FU6A 2KMTA 4B9WA 1I81A 2KVQG 3OW2A 1VQ9T 2LCCA 4J7IA 3JCMg 2V8KA 5GMKe 4M75D 1Q82C 3J81E 4OF1A 4C8QD 1M90U 2L3RA 3CPFA 5CQXA 2QQBA 4EMKA 3JB9G 5GAN3 2EJGA 2RI2A 3MP8A 5LJ5d 2GCXA 2CZ6B 3J80E 3V8JA 1VQ9A 1GXIE 3RMQA 3CC2T 1K8AU 5DM7R 1NJIC 4O5VA 2CYZB 4N4IA 1NPPA 4TVRA 4XU3A 5CVIA 2O01E 4Y91A 3G4ST 3OYAA 3OYJA 5GAMf 2BKDN 2ZPGB 1KG1A 3JCMh 1YIJT 1I4K1 1O9SA 3OS1A 3OMCA 3META 4ZTJA 4NOYA 4FM4B 5I21A 3QO3A 2D6FA 4M78F 2KQWA 3SWNB 3BW1A 1JBMA 1M9SA 2ZGWA 3FJPA 3VV0A 3WVDB 5KE3A 3L2VA 2QEXT 4ZGDB 3M4GA 5GAOq 3LGFA 4X34A 1S72T 4J83A 4C5GA 3JB9H 1UGRB 2E6ZA 3HFOA 3NFCA 4XU0A 1NPRA 2M0OA 3M54A 2PQWA 4BI8B 3PT9A 3A8MB 4M7DF 1KD1C 2XIDA 5LJ5f 2X4JA 4VUBA 1VQOA 2PVGB 4JDSA 2KK4A 1FWZA 3SFMA 2HNIA 5EG2A 3LYIA 5LJ5g 3LWHA 3OYCA 1XNIA 3CD6T 3L2ZA 3L2RA 3MEVA 4OGCA 2FL7A 4C92A 5GAN5 2DXTA 3SWNC 3CEYA 3CCEA 3X25B 3OYFA 2E65A 4J6XA 4RCBA 4A4KA 2P0QA 2DXCA 5GMKm 2E64A 1U8RA 4BB7A 4E7LA 3S3MA 4E47A 5A0DA 5GAMg 3UWNA 2MAMA 4Q5WA 3BDLA 4IUTA 2R5AA 3M59A 1WPYA 2M1HA 3RUXA 4JJNK 3J7AF 4PJOE 3PGGA 4C0ZA 3OYKA 1VQLA 1BYMA 2GFUA 2X4WA 4GY5A 3VUBA 3ASKA 4J8OA 1K9MC 2Y4XA 2CS7A 1VQ4T 3X28B 4OMFB 4JLGA 2X4YA 4PJOC 4EPCA 2K4YA 1G3YA 3HPWA 4M7DD 2XDPA 2GQVA 5GAN4 3CCET 4FT2A 5J3BA 3CMET 2DAQA 3FB9A 3OBWA 4L5GA 3CCLA 2OTJA 3HRUA 2A3LA 3S6WA 3M56A 1BIAA 3DKMA 4M75A 5FROA 4JS5A 1LJOA 2ZPFB 4XTVA 1X6OA 1UEBA 2JVVA 4ME7A 4C8QA 2XDDA 3CPWS 3PTAA 4M75C 4N0AC 3RKWA 4PJOA 1YCYA 4C8QC 5HKCA 4C0FA 4XTUA 4C8QG 1YITT 3UPUA 3OA6A 2DTOA 4FT4A 4M78B 2E41A 4HCCA 3CXCA 1VQNA 1YHQA 2RK2A 4RG2A 2LT4A 2LX9A 1K9MU 2DO3A 4M7AD 4OP0A 3X26B 1R8OB 2EIFA 3VKIA 5CK9A 2KY9A 1YIJA 5LJ5j 4C5EA 5LJ3j 5FRNA 1FXXA 5GAN6 5CKBA 3C4SA 2DJZA 2JTMA 3QZ5B 3OYEA 1VQ8T 2K5IA 2E5QA 4ZTFA 3M9QA 5CCAA 2IG0A 3SD4A 3G71A 3QHSA 1VQ5T 3TEEA 3R6OA 1BI0A 5CKFA 1UGSB 2O4XA 2LVMA 4N0AA 3X20B 4A54A 4MMKA 4X9DA 4YTLA 5GAMj 2RO0A 1NE8A 2GF7A 2EFIA 3OS5A 1VQMA 1D3BA 1M4ZA 2F5TX 4QW2A 1IZ6A 2RHYA 2YHTA 4R55A 3JCMW 2F5KA 2ZCFB 1SSFA 2XICA 4MZMA 3V7CA 4BE1A 2LDMA 2QEXA 1Y71A 3C95A 5D6WA 1B34A 4N4HA 1MHNA 4J6YA 4IKFA 4LDWA 3M53A 2LTOA 3MEWA 3ZEHA 5GANe 3CC7A 1KC8U 2KAFA 4M7DC 1Y96B 4O6JA 4M7AE 3HFNA 4M77A 1PSFA 3G4SA 3GOXA 4M7AF 4C0DC 3X24B 2EYQA 5CR2A 2R58A 1PSEA 1QVPA 2VUBA 3ER0A 3M4YA 2VC8A 2WSCE 2RK1A 3NTHA 3OMGA 4A4HA 2P0PA 2VXFA 4MDWA 3CXCS 1WJQA 5GMKj 4F7UE 4V2SA 4DA4A 3OSSC 1BKBA 4A4FA 1VQKA 2EKOA 4BDYA 3MP6A 3KBGA 3NTIA 3UDCA 1KQ1A 5FU6C 1NJIU 4C92F 2VGNA 4RKUE 1ZHIA 2DXUA 4PJOF 3KXTA 2YRVA 1LOJA 4C92C 1M5Q1 2DEQA 3SDZA 4JS4A 3QIIA 4M78G 3H8ZA 3A8HB 3CCUT 2XKOC 4PLLA 3L2UA 2D9TA 4PNOA 4XAXB 1JB0E 3JCMe 2XHCA 2I2LA 5L8RE 3QUIA 5DLQE 2DTIA 2XI9A 3WXMB 1XTDA 3QJYA 1EIFA 4CI0C 3CMEA 4LD9K 1UGQB 3E9GA 3TCJA 4IURA 3OS2A 3I56A 3CCJT 1YITA 3OB9A 1JJ2S 3FEOA 3P8DA 4FIBA 4IUPA 4QVDA 4M77F 2E70A 3CC7T 1Q86C 2K3YA 1TH7A 1W4SA 4FL6A 5CQYA 1YJ9T 2V8JA 1OZ3A 2RHUA 5LJ3e 2QQ9A 2ZPHB 2HQXA 3MO8A 3QG1A 2RB6A 3LX7A 3SWNA 5FRMA 3CCRT 3OYHA 1Q81C 2OTJT 3RESA 2MF2A 1KQSS 3PIPA 3CC2A 3G6EA 1YBYA 4C0GA 3GP8A 2D0QB 2HBPA 2Y4YA 1QP3A 4M77D 3I55T 2VYTA 3RIRA 1JJ2A 3FDRA 2LC4A 3LGLA 1VQ6A 4C92D 3E9FA 3QDRB 4OGEA 4ATOA 1Q7YU 2VGMA 1NZ9A 3C94A 2HAXA 4XK8E 4E7IA 4C92B 4A4EA 3CCVT 5C6SA 3C12A 2E6NA 2FYKA 2MWOA 5LJ3h 3EFSA 1N8RU 2GFAA 1RL2A 1BIBA 4OB0B 4E7HA 3JCMQ 2B8AA 5GAN2 1XOVA 2JUFA 3TU4K 1O75A 1YJWA 3MEUA 2XK0A 1G5VA 4EMHA 3JB9I 4BD3A 3G6ET 3GPLA 1VUBA 2RM4A 4M75F 2K57A 1UB4A 4ELZC 4BY6B 4KUDK 1VQNT 4B9XA 2EQMA 2OAUA 4PKCC 1MGQA 2MWPA 2P4TA 3HKSA 1YJNA 1Y7XA 3OBYA 2X4XA 4M78C 2E12A 4HT8A 3HP9A 1N6AA 4NS5A 5CKHA 4A53A 4F7UF 1FX7A 3CBPA 2BUDA 2DZCA 3JB9J 1VQPA 2YLCA 3ME9A 4NL3A 1S72A 3EAEA 1KQSA 3I55A 1WNLA 3L2WA 5GANj 2RHIA 2YLBA 5I2MA 3JSCA 3TREA 2WSEE 4DOVA 3VJPA 4Y28E 3VUZA 5CKEA 1M8VA 1VQLT 2M16A 1QW1A 3OY9A 3LH0A 3URGA 4ZN3A 4C5HA 1KHIA 4PJOB 3FLGA 4F7UA 2MI6A 2CKKA 5CAIA 2KDSA 1WQWA 4GLKA 2K5LA 4PL6A 1KQ2A 4M78E 4XTYA 3LW5E 4LDXA 2ZPBB 4XTXA 5J26A 5GAOm 1ZQ1A 5HY6A 3PNWC 3INZA 3BFMA 3CCMA 4RMOA 5LJ3d 1IREB 2DKGA 5DLOA 2EQJA 4M75G 3A8GB 4HCBA 5LJ5e 2IVWA 2LT1A 1N9SA 4MMLA 3JB9D 3MHXA 5AYFA 5GAOn 1YI2A 5LJ3g 4J5YA 3N5BB 1VIFA 4M77C 3QPHA 2FHDA 3JCMb 5GAMd 5GANh 1AHJB 5HK3A 2F69A 5IT9E 1QVGA 1Q82U 1VQKT 4LD6A 3RMSA 3CCST 3Q1JA 5A0GA 4X9CA 3O8VA 3T9NA 2DIQA 2RHXA 1U1SA 1ZBXA 3OYYA 2DK3A 2QTXA 1M1KC 2ZPIB 3GF5A 1HK9A 3QZ9B 5FU6B 4QQGA 5GAOr 1QP2A 2RJEA 1B34B 2AHJB 2OTLA 3HSBA 4JUVA 4NL2A 5KE2A 4M7AB 2XU8A 4M7AG 1LNXA 1BI3A 4J7FA 3I56T 2LNVA 3M55A 4M77B 1N27A 5CKDA 1N9RA 4JLIA 4M7DB 2CZ7B 3CBOA 3FRNA 2CZ0B 3JCMP 2A7YA 3OYBA 1UGPB 1OI1A 2P0KA 2L89A 3A8OB 3QBYA 3HRSA 3AHUA 1QVFA 2E1HA 5KCHA 2HD0A 4DQ2A 4EMKB 1KD1U 3QSUA 3V7SA 1VIEA 2FVUA 2QQAA 2QQRA 1OYXA 3JCMf 5GAN8 3OS0A 3CCRA 4RG8A 5I2SA 4JRIA 4ZGEB 2K3XA 3QKJA 4M77E 5IN1A 3CCQT 5D6XA 4D6WA 5KH6A 1JRIA 4PLIA 3BDUA 3DB3A 4ZN1A 2K2VA 3OYLA 1WGSA 3CCSA 1QVGS 4R56A 1KC8C 4OB1B 3OYMA 1W2BS 3V8KA 4E7KA 4C5IA 3CCUA 3KUFA 3CBMA 4JRKA 4JRQA 2RA2A 1RI0A 3HL8A 2EJFA 3CMAA 5GMKl 1G3SA 3MEAA 1YJWT 5GANd 1KHCA 1WJRA 3A5ZB 3MP1A 4OVAA 1VQOT 1H3ZA 1VQ7T 3QYGB 1P92A 5M9OA 4BDZA 1Q7YC 4PJOD 2BIVA 1M90C 1WJSA 3V7RA 2MMPA 1M1KU 4DOWA 4M7DG 3BY7A 2LQKA 3JAME 3P8BB 4ZGJB 2RJFA 3CPWA 3CC4A 2PUKB 3A8LB 1BI1A 2VXEA 2EWNA 4XU1A 2WSFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTA A;  4JJN K;  1M4Z A;  3PT9 A;  1W4S A;  4FSX A;  4KUL A;  4FT4 A;  1ZHI A;  4DOV A;  3TU4 K;  2FL7 A;  4FT2 A;  4KUD K;  2FVU A;  4DOW A;  4BB7 A;  1ZBX A;  4LD9 K;  4DA4 A;  4KUI A; 
#chains in the Genus database with same CATH topology
 4EDU A;  3UA6 A;  3FIF A;  2YWW A;  1W2B A;  2EGA A;  4IUU A;  3SB2 A;  1B07 A;  4M7D E;  1RAE B;  1OUL A;  2H3E B;  5FLX E;  4XQ3 A;  4KGX B;  4BY6 C;  4XTZ A;  3H41 A;  1GFC A;  2K5F A;  2JZ2 A;  5GAN f;  1X75 C;  4BE0 A;  1PWT A;  5IHN A;  3EFO A;  1VYT A;  2O9V A;  2H3J A;  1M1K R;  1X01 A;  4R0K A;  2PUO B;  1VQ4 Q;  1LCK A;  3GIB A;  4IUV A;  3OSV A;  4OMN A;  3DB4 A;  3I5R A;  2QGG A;  1PD1 A;  2A28 A;  2E10 A;  4OMP A;  3OW2 P;  1PCX A;  4F7U G;  3L1A A;  1YHQ T;  2JOY A;  4M78 A;  1ARK A;  3PMI A;  1BI2 A;  2VVK A;  1Z9Z A;  3CCQ A;  5FW9 A;  1OU9 A;  2M9U A;  5HK0 A;  1WHM A;  4KUL A;  1OX8 A;  2O4X B;  1HXD A;  2DD4 A;  1QVG P;  4J9B A;  2CP2 A;  1NM7 A;  2DXB A;  1M8M A;  4QVZ A;  3M0Q A;  1MV3 A;  2L3Q A;  4WF2 A;  7AT1 B;  1YJ9 A;  2XDB A;  3ZFJ A;  2OI3 A;  4E7Z A;  1Y07 A;  1XQH A;  2XMF A;  4EMK C;  3JCM V;  1VQ6 Q;  1PRL C;  1PC0 A;  4LDY A;  2KYM A;  4M7A A;  3THK A;  2JTF A;  3VRY A;  1VQ6 T;  4J6W A;  1DJ7 B;  2KMT A;  1VQ9 T;  4J7I A;  3JCM g;  1Q82 C;  4WTO B;  1YJ9 Q;  1IXD A;  1LPL A;  3I56 Q;  2RI2 A;  5LJ5 d;  3V8J A;  2YT6 A;  4CC2 A;  3MKD A;  1NPP A;  2LZ6 B;  4CC3 A;  3CCS Q;  2BKD N;  1KQS P;  4M78 F;  1AVZ C;  2EYY A;  1JBM A;  2JS0 A;  3WVD B;  2COW A;  1IB8 A;  4E6R A;  1BB9 A;  5KYU B;  1KD1 C;  2XID A;  2BZX A;  1IRX A;  5IHI A;  2W0Z A;  5EG2 A;  3LWH A;  3OYC A;  1WXT A;  2JMC A;  4OGC A;  3CCE A;  1QWF A;  2E64 A;  1U8R A;  2C0T A;  2SRC A;  1OQK A;  9ATC B;  5A0D A;  1Q82 R;  3BDL A;  2GQI A;  4IUT A;  1WPY A;  2M1H A;  4PJO E;  2GFU A;  2VWF A;  3VUB A;  1SF9 A;  1VQ4 T;  4OMF B;  4KH0 B;  4PJO C;  5KYX A;  2K4Y A;  2GQV A;  3CME T;  2DAQ A;  4L5G A;  3G6E Q;  2OTJ A;  2A3L A;  3S6W A;  3VS1 A;  3M56 A;  1BIA A;  3DKM A;  3QWY A;  1X6O A;  2JVV A;  2XDD A;  3CPW S;  2FG0 A;  4FT4 A;  4M78 B;  3OA6 A;  4HCC A;  2LT4 A;  2LX9 A;  1MUZ A;  4OP0 A;  4M7A D;  1Q7Y R;  1YIJ A;  2DYI A;  4C5E A;  5LJ3 j;  3A98 A;  1YN8 A;  3C4S A;  2DJZ A;  3OYE A;  3CME Q;  2K5I A;  2OTJ Q;  4HXJ A;  2E5Q A;  5CCA A;  3G71 A;  2IG0 A;  3SD4 A;  3QHS A;  3TEE A;  1BI0 A;  5CKF A;  1UGS B;  4A54 A;  4MMK A;  4Z89 A;  1NE8 A;  2EFI A;  3OS5 A;  1N5Z A;  1D3B A;  3AT1 B;  1KIK A;  2F5T X;  1IZ6 A;  2RHY A;  3JCM W;  3V7C A;  2XIC A;  3C95 A;  1SRL A;  3EG9 A;  1Q81 R;  4IKF A;  4LDW A;  4LXC A;  3EH1 A;  4OMQ A;  4O6J A;  3HFN A;  4C0D C;  2IPO B;  2YUQ A;  2RK1 A;  2P0P A;  1W1F A;  1BKB A;  1D0Y A;  3NTI A;  1WHG A;  1KC8 R;  2RMO A;  4C92 F;  4F14 A;  1ZHI A;  4ZNX A;  4PJJ A;  3H8Z A;  2RF0 A;  2XKO C;  2D9T A;  1ACM B;  2O9S A;  2P84 A;  3JCM e;  2NUP A;  1NEG A;  3EG3 A;  1EIF A;  4CI0 C;  3E9G A;  1C1A A;  1WDX A;  1SRM A;  1YJ9 T;  1ZLM A;  1UE9 A;  2QQ9 A;  3MO8 A;  4DBQ A;  3SWN A;  1ABO A;  1QCN A;  3M0R A;  3RES A;  1KQS S;  1VQL Q;  1GCP A;  2DIL A;  1VQ8 Q;  3G6E A;  1YBY A;  3PVQ A;  4C0G A;  2HBP A;  3I55 T;  1K0X A;  1JJ2 A;  3LGL A;  1UJY A;  1OV3 A;  3EGX B;  5IHK A;  4OGE A;  4ATO A;  3D7S B;  1Q7Y U;  2VGM A;  1H3H A;  4XK8 E;  2E6N A;  2B8A A;  1TSF A;  2FRW A;  3MEU A;  2RQW A;  1G5V A;  1X2K A;  4B6M A;  4KUD K;  4M75 F;  1UB4 A;  4ELZ C;  1VQN T;  1MGQ A;  2AT1 B;  4M78 C;  2X4X A;  4NS5 A;  1N6A A;  2DJQ A;  1EFN A;  3JB9 J;  1SG5 A;  2YLC A;  1S72 A;  2K3B A;  3I55 A;  3L2W A;  2O88 A;  5CKE A;  1KHI A;  4LNP A;  4PJO B;  2MI6 A;  2ESW A;  1KQ2 A;  2JT4 A;  4XTY A;  1WIE A;  2F2V A;  2ZPB B;  3CC7 Q;  4XTX A;  3PNW C;  3BFM A;  3CCM A;  2C0O A;  2LT1 A;  1N9S A;  3MHX A;  5AYF A;  1YFN A;  1ZA1 B;  2RQU A;  1VQM A;  2FHD A;  5GAM d;  1AHJ B;  5HK3 A;  2F69 A;  1Q82 U;  3Q1J A;  2GTJ A;  2PNI A;  1Y57 A;  1TUC A;  1KSW A;  4J9H A;  3GF5 A;  4QQG A;  2EW3 A;  2CSQ A;  2AHJ B;  1MNE A;  1RAH B;  4NL2 A;  5KE2 A;  2A36 A;  4M7A G;  2KNB B;  1NYG A;  2DMO A;  1BCO A;  3M55 A;  2FZG B;  5CKD A;  4M7D B;  3TSW A;  1RI9 A;  4Z8A A;  3OYB A;  3A8O B;  2HMA A;  4FW1 A;  3QSU A;  2FVU A;  2QQR A;  1OYX A;  3CCR A;  1AWO A;  1AOJ A;  4JRI A;  4Y92 A;  5I2S A;  3CMA Q;  4M77 E;  4FSS A;  4F17 A;  2K2V A;  3OYL A;  4AT1 B;  1W2B S;  3EHR A;  3CCU A;  1YCS B;  3KUF A;  3CBM A;  1MND A;  2GTO A;  3SHW A;  1VQO T;  1H3Z A;  5M9O A;  3V7R A;  2LQK A;  3P8B B;  4ZGJ B;  3CPW A;  3CC4 A;  3A8L B;  2RQT A;  2EWN A;  4KUI A;  4XU1 A;  3QWX X;  5FU7 B;  2Z0W A;  4L59 A;  3HRT A;  1QVF S;  1WX6 A;  1YJN T;  3GLX A;  2QI2 A;  1VQP T;  1E6G A;  1ZSZ C;  1GBR A;  2J6F A;  1JEG A;  2RI5 A;  1RAA B;  3JCM X;  3EFR A;  3PIO A;  3CCJ A;  3LLR A;  2EGC A;  3VU3 C;  4AG1 C;  4N4G A;  1I5L A;  4HVW A;  3WVE B;  2DD5 A;  1IGQ A;  4RTU A;  4II1 A;  1YP5 A;  3CC4 Q;  3JCM c;  4AFQ C;  1KK7 A;  1WQ7 A;  3L2Q A;  1D0Z A;  3E1S A;  2HQE A;  2JS2 A;  2DPP B;  5IXB A;  3CC4 T;  1LVK A;  3REA B;  1VOM A;  1GRI A;  4M77 G;  1OX9 A;  3GNF B;  3OYN A;  2HZY A;  3RER A;  2CZ1 B;  4QQ6 A;  2DIG A;  4JRP A;  4C8Q F;  5GAM h;  2ENM A;  1R0C B;  2DNU A;  3QYH B;  3TSZ A;  2CGH A;  5A0L A;  2V8I A;  3M5A A;  2KRS A;  1Y0M A;  5GAO l;  4F7U B;  4OB3 B;  5J39 A;  3MCA B;  4A4G A;  2QAZ A;  2HSE B;  5KCO A;  2DVE A;  3GNG A;  4HKE A;  4P5N A;  4DBH A;  2FRY A;  1VQO Q;  3JB9 F;  2M02 A;  4F16 A;  1YJW Q;  4HA8 A;  2RH2 A;  3EG9 B;  2LX7 A;  2L2P A;  2AKL A;  2MPX C;  3KFV A;  2RJC A;  4RTY A;  2EAY A;  2NLU A;  3OYG A;  3CMA T;  2QA4 A;  2QDY B;  1VQ8 A;  2ZPE B;  3RKX A;  2EQI A;  4HVU A;  5GAO p;  2F1L A;  3VYH B;  4L6V 5;  1C0M A;  2KT1 A;  4M7D A;  2L5Q A;  2RJD A;  3OW2 A;  1I81 A;  2QDL A;  2HSP A;  4OF1 A;  5CQX A;  2QQB A;  4EMK A;  3MP8 A;  2GCX A;  2CZ6 B;  3J80 E;  3TVT A;  2NWM A;  3CC2 T;  1K8A U;  4O5V A;  1MMA A;  4TVR A;  3G4S T;  3OYA A;  2O31 A;  1KG1 A;  1YIJ T;  2GNC A;  2KEA A;  4RTW A;  4ZTJ A;  2LNH B;  5I21 A;  3QO3 A;  2D6F A;  2ZGW A;  1TG0 A;  1S72 T;  4J83 A;  1UGR B;  1WHH A;  2DLP A;  3HFO A;  1NPR A;  3M54 A;  2PQW A;  4BI8 B;  1K1Z A;  1QLY A;  1S1N A;  4VUB A;  2X51 A;  1RAG B;  3L2R A;  5KYW B;  4FCY A;  3X25 B;  2E65 A;  5GMK m;  4A4K A;  2YDL A;  2D0N A;  3S3M A;  4E47 A;  3UWN A;  2MAM A;  3J7A F;  4C0Z A;  3OYK A;  1VQL A;  3ASK A;  4J8O A;  2CS7 A;  4JZ3 A;  3X28 B;  1QWE A;  2MIO A;  2X4Y A;  4EPC A;  4FT2 A;  1UG1 A;  1H92 A;  1AEY A;  1EZZ B;  3I35 A;  4AFU C;  1BU1 A;  8AT1 B;  2ZPF B;  4FYV B;  4C8Q A;  1GBQ A;  4DEX A;  4M75 C;  3RKW A;  4PJO A;  4C8Q C;  4C8Q G;  1VQN A;  3CXC A;  1T3L A;  1YHQ A;  2RN8 A;  2KY9 A;  1X27 A;  1OOT A;  2LJ3 A;  3E2U A;  4ZTF A;  1JXO A;  2O4X A;  4N0A A;  3X20 B;  4X9D A;  3CCV Q;  2YXY A;  1M90 R;  4QW2 A;  3CQT A;  4MZM A;  2F5K A;  1SSF A;  3EG0 A;  2LDM A;  1Y71 A;  1NEB A;  4LE9 A;  5D6W A;  4N4H A;  2J6O A;  3NPF A;  1NBE B;  3MEW A;  1ZSZ A;  3ZEH A;  3CC7 A;  1KC8 U;  1Y96 B;  2CDT A;  4M7A E;  2CT3 A;  1PSF A;  2R58 A;  1PSE A;  3M4Y A;  3NTH A;  2WSC E;  3NHN A;  3OMG A;  4A4H A;  2KE9 A;  5GMK j;  4DA4 A;  2EGE A;  3OSS C;  4PJL A;  4A4F A;  2EYZ A;  3CCJ Q;  1QKW A;  5FU6 C;  1NJI U;  1JXM A;  1M3B A;  2QGF B;  2HL5 C;  3A8H B;  3L2U A;  2V26 A;  3VS3 A;  4PNO A;  4XAX B;  1JB0 E;  1TTH B;  2I2L A;  3WXM B;  3CC2 Q;  3CME A;  4LD9 K;  3EH2 A;  3CCJ T;  1YIT A;  1JJ2 S;  1K4U S;  4FIB A;  5CQY A;  1UEC A;  2QYZ A;  2D8H A;  2PZ1 A;  2ZPH B;  3LX7 A;  4IIO A;  1M2O A;  2DFU A;  3OYH A;  2OTJ T;  2EYX A;  3RNJ A;  2DL7 A;  2L3P A;  3GP8 A;  2MOX A;  2Y4Y A;  1SEM A;  2DBK A;  4C92 D;  3E9F A;  1YIT Q;  3C94 A;  1G83 A;  4E7I A;  4A4E A;  1RLP C;  2DL3 A;  1VA7 A;  4OB0 B;  1ZA2 B;  2RQR A;  5GAN 2;  3TU4 K;  1IHW A;  1D0X A;  1NYF A;  1YJW A;  3JB9 I;  4B9X A;  2OAU A;  3UAT A;  3OBY A;  1AZE A;  5CKH A;  4A53 A;  5GAN j;  2RHI A;  2YLB A;  5I2M A;  2WSE E;  2CRE A;  4DOV A;  3VJP A;  1M8V A;  3CCR Q;  2LP5 A;  4F7U A;  1WQW A;  1R0B G;  2X3W D;  4PFO A;  3LW5 E;  1QCF A;  5LJ3 d;  5DLO A;  4M75 G;  1T0J A;  2DX1 A;  1YNZ A;  5GAO n;  4J9E A;  5GJW B;  5LJ3 g;  3QPH A;  4LD6 A;  3RMS A;  3CCS T;  5EC7 A;  5A0G A;  4X9C A;  3O8V A;  3UF4 A;  1MV0 B;  1U1S A;  3OYY A;  2CSI A;  2F2W A;  1M1K C;  1I07 A;  1HK9 A;  5FU6 B;  1D1B A;  1V76 A;  1YJN Q;  3HSB A;  1U5S A;  1RAC B;  1LNX A;  1BI3 A;  3HTR A;  1N9R A;  1PD0 A;  2CH4 A;  1OI1 A;  2CT4 A;  2O2O A;  5KCH A;  2HD0 A;  2GGR A;  4DQ2 A;  3G4S Q;  2AZV A;  1VIE A;  2D8J A;  2FPD A;  5IN1 A;  2M51 A;  5D6X A;  5KH6 A;  2K9G A;  2DVJ A;  1QVG S;  1KC8 C;  2YUO A;  4R56 A;  3HL8 A;  1RI0 A;  1ZUK A;  3VS4 A;  3MEA A;  3ZL7 C;  5GAN d;  3MP1 A;  1VQ7 T;  1XJW B;  1M90 C;  1WJS A;  2JJ9 A;  1FMV A;  4M7D G;  3BY7 A;  3JAM E;  1VQM Q;  3MPU B;  4PL6 A;  5GJV B;  3VS2 A;  1PHT A;  3VYG A;  4BE2 A;  2JMA A;  4PK4 A;  3DLL A;  1SPK A;  3H0H A;  1H64 1;  2KSS A;  2EQU A;  3UT1 A;  4HCZ A;  2CP5 A;  5IAY A;  1K73 U;  5C0M A;  3L42 A;  2LCS A;  3H0I A;  2FB7 A;  3OQ5 A;  4JPB W;  4PJO G;  1QKX A;  2QXF A;  3P8H A;  4BUG A;  5KYX B;  5HCK A;  1ZBJ A;  2G3R A;  2PVO B;  3CCL Q;  2KRM A;  4OB2 B;  1VQ7 A;  2YUP A;  1V1C A;  2LCL A;  5A2Q E;  5LJ3 f;  4M75 B;  3NTK A;  1V29 B;  2WAC A;  4C8Q B;  4CRI A;  2LRQ A;  2L8D A;  2RD1 A;  2C06 A;  2RHZ A;  5DY9 A;  2EVR A;  3OYD A;  1IO6 A;  3RKY A;  4M75 E;  4MZT A;  3I5S A;  4RCC A;  2V1R A;  3VS6 A;  2EQK A;  3LWI A;  3ZBD A;  1G3T A;  1UUE A;  5LJ5 h;  1M1F A;  2OTL Q;  3DLM A;  1HYO A;  1D3B B;  4LDV A;  3F70 A;  2JXB A;  2HL3 A;  1OU8 A;  1D1C A;  1OPL A;  3M57 A;  4BI3 A;  3CCM T;  2Y90 A;  4IUQ A;  1Q81 U;  8ATC B;  4D8D A;  1Y96 A;  1OZ2 A;  1KD1 R;  4FSX A;  4WCI A;  3G71 T;  1VYV A;  1YI2 Q;  2PU9 B;  1K8A C;  2EPD A;  1Q86 U;  1OPK A;  4KBM B;  2ZZD A;  4E7J A;  3V8L A;  4ELY C;  1YI2 T;  1TOV A;  1T0H A;  3QXE B;  2BZ8 A;  3G71 Q;  4B9W A;  2V8K A;  2M0Y A;  5ECA A;  4DBF A;  2HKN A;  2L3R A;  3CCM Q;  2AZS A;  5GAN 3;  2EJG A;  1TUD A;  1VQ9 A;  1EX4 A;  2E5K A;  1RUW A;  2CYZ B;  4N4I A;  3G1J A;  4XU3 A;  3OYJ A;  3EGD B;  1B3Q A;  2J06 A;  2JTE A;  1I4K 1;  3CCU Q;  4NOY A;  4FM4 B;  2KQW A;  3SWN B;  5KE3 A;  3FJP A;  2QEX T;  5FWB A;  5GAO q;  3LGF A;  3JB9 H;  1TS9 A;  4C5G A;  3RDV A;  3NFC A;  2M0O A;  1WZO A;  1HJD A;  4M7D F;  3PT9 A;  2CP0 A;  3A8M B;  2CUD A;  1AWX A;  1VQO A;  1FWZ A;  2HNI A;  2E3I A;  5LJ5 g;  1XNI A;  3CD6 T;  3MEV A;  3MJX A;  4C92 A;  4DBR A;  4RCB A;  1G2B A;  3M0P A;  2KRO A;  4ANJ A;  2R5A A;  3RUX A;  4JJN K;  2DBM A;  2A37 A;  3PGG A;  3EFO B;  1Z9Q A;  5IH2 A;  2X4W A;  2YRD A;  1K9M C;  2Y4X A;  2VB6 A;  2KXC A;  1HSQ A;  1UTI A;  2P4R A;  3HPW A;  2JW4 A;  2DF6 A;  5GAN 4;  5J3B A;  2GBQ A;  4FW2 A;  1AT1 B;  3FB9 A;  3CCL A;  3HRU A;  1GFD A;  1GCQ C;  2C0I A;  4ESR A;  4M75 A;  2OJ2 A;  1GCQ A;  1LJO A;  2RNA A;  3A1P A;  4XTV A;  1UEB A;  4RTX A;  3PTA A;  5HKC A;  4XTU A;  1YIT T;  3UPU A;  2DTO A;  2RK2 A;  4RG2 A;  2EIF A;  3VS7 A;  5LJ5 j;  5FRN A;  5CKB A;  3QZ5 B;  4OMO A;  1KFZ A;  5I11 A;  3M9Q A;  5FWC A;  3REB B;  1VQ5 T;  1M2V B;  4JJD A;  1HD3 A;  4GBQ A;  1F1B B;  2GF7 A;  2ECZ A;  1M4Z A;  1Q95 G;  1JJ2 P;  2ZCF B;  1SKU B;  3GBQ A;  4BE1 A;  2QEX A;  1TU0 B;  2DE0 X;  3PE0 A;  3I55 Q;  1B34 A;  2AKK A;  2KAF A;  1WFW A;  4JZ4 A;  4FYX B;  4ZN1 A;  2VC8 A;  4AG2 C;  4MDW A;  4V2S A;  2BTT A;  2EKO A;  4BDY A;  1UFF A;  3U23 A;  1KQ1 A;  2VGN A;  4RKU E;  2VAS A;  2QEX Q;  2KYB A;  2DL4 A;  4C92 C;  1M5Q 1;  4M78 G;  4FYW B;  3CCU T;  1ABQ A;  1VQK Q;  5L8R E;  2DTI A;  2XI9 A;  1XTD A;  2AIR B;  3QJY A;  3TCJ A;  3I56 A;  4IUR A;  1ZSG A;  3OB9 A;  4QVD A;  4M77 F;  2E70 A;  2K3Y A;  4FL6 A;  1TH7 A;  3EGD A;  2AK5 A;  2V8J A;  2CP7 A;  5LJ3 e;  2HQX A;  5FRM A;  1YWP A;  2PTK A;  2DRM A;  3CCR T;  1Q81 C;  4PJM A;  2MF2 A;  2YUN A;  1M3C A;  2HBW A;  4M77 D;  2VYT A;  1W70 A;  2LJ0 A;  4K11 A;  3QDR B;  2DER A;  2JM9 A;  4C92 B;  2QK0 A;  4LUE A;  5LJ3 h;  3EFS A;  1N8R U;  2GFA A;  1RL2 A;  4E7H A;  3BE3 A;  1N8R R;  3JCM Q;  1PNJ A;  4X1V A;  3R6N A;  2DET A;  1O75 A;  3GPL A;  4BD3 A;  3LH5 A;  2RM4 A;  2K57 A;  2EQM A;  3HKS A;  1YJN A;  5L23 A;  2E12 A;  4HT8 A;  4F7U F;  1FX7 A;  3CBP A;  2KT8 A;  1M27 C;  2BUD A;  3EGU A;  1VQP A;  3ME9 A;  4NL3 A;  1KQS A;  2A08 A;  4AFS C;  3JSC A;  3TRE A;  4Y28 E;  2X9H A;  3VUZ A;  1KJW A;  2M16 A;  3OY9 A;  3LH0 A;  1WHL A;  3URG A;  3FLG A;  2CKK A;  1UHF A;  1YHQ Q;  1WLP B;  1ZUU A;  4GLK A;  2KBT A;  1FMK A;  5J26 A;  4RTZ A;  2LMJ A;  5GAO m;  1ZQ1 A;  1K76 A;  4RMO A;  1IRE B;  1SHF A;  3A8G B;  4HCB A;  5LJ5 e;  1WXU A;  2IVW A;  1AWJ A;  3JB9 D;  3FJ5 A;  3TQ7 P;  3N5B B;  1VIF A;  3JCM b;  5GAN h;  4J9D A;  2H8H A;  3CD6 Q;  3T9N A;  4OML A;  1ZBX A;  2QTX A;  1MMG A;  2J6K A;  2W10 A;  2ZPI B;  3QZ9 B;  1QP2 A;  2OTL A;  4J9F A;  1JQQ A;  4JUV A;  5IXF A;  3M0T A;  1U3O A;  4KGV B;  3VS5 A;  4AMC A;  4M77 B;  1WA7 A;  4JLI A;  1BK2 A;  3CBO A;  3FRN A;  2CP3 A;  2G6F X;  2B86 A;  3JCM P;  2A7Y A;  1UGP B;  2P0K A;  2L89 A;  2FO0 A;  3HRS A;  3AHU A;  1QVF A;  2E1H A;  3RBB B;  2QQA A;  2QG9 B;  4RG8 A;  4J9I A;  1MMN A;  1M3A A;  2MCN A;  2K3X A;  1NLP C;  4PLI A;  3DB3 A;  3CCS A;  3CCQ Q;  4RTT A;  2RPN A;  3OYM A;  1NJI R;  1M30 A;  4E7K A;  4JRK A;  2DRK A;  5GMK l;  1YJW T;  1KHC A;  3A5Z B;  2KI7 A;  3QYG B;  1D09 B;  2BIV A;  5KYY B;  2MMP A;  1G8X A;  3M0U A;  1M1K U;  2ABL A;  2PUK B;  1BI1 A;  4A63 B;  2WSF E;  1RLQ C;  5CIU A;  2RI3 A;  2IIM A;  3QJ6 A;  4UC4 A;  4M78 D;  1X69 A;  4XU2 A;  4BAC A;  3G7Z A;  3H0F A;  1RAD B;  4LDU A;  2R5M A;  5GAM e;  1QCO A;  3EGX A;  1CKB A;  3HHT B;  4QQD A;  4RUG A;  1U06 A;  2OTL T;  1FYN A;  1I8F A;  4KGZ B;  3M0S A;  3E19 A;  5GAN 7;  2JN0 A;  1UHC A;  1K73 C;  2LJ1 A;  5CO7 A;  2PVD B;  4Z02 A;  2JM8 A;  5D6Y A;  4QVC A;  1BCM A;  2XD0 A;  5LL6 S;  1VQ5 A;  1W2B P;  4E7S A;  1C6V X;  4HT9 A;  4CC7 A;  2LQ8 A;  2EJ9 A;  2DM1 A;  4C92 G;  5AT1 B;  2FEI A;  5FU7 C;  4C8Q E;  1AWW A;  1RAF B;  1T3S A;  2QA4 T;  4J9G A;  1VQP Q;  3EG2 A;  3H9N A;  4KT0 E;  2RQV A;  3JRZ A;  2VV5 A;  2DEU A;  3CCV A;  2QQS A;  5KYN A;  1S72 Q;  1BBZ A;  1CKA A;  5GAN g;  3CCL T;  1M2V A;  1N8R C;  3OW2 S;  2E4H A;  1QMC A;  1U1T A;  4XTW A;  1IHV A;  1IGU A;  3PMT A;  2NUT B;  2MYS A;  5GMK h;  2R57 A;  4BI4 A;  4D8K A;  3JCM d;  3FC3 A;  3RR6 A;  2FPF A;  1G3W A;  1NG2 A;  3S3N A;  2DZ9 A;  1VQ4 A;  1WXB A;  1WI7 A;  1PKS A;  4C0D B;  1K9A A;  4MDX A;  2DTH A;  4PFP A;  3PFS A;  4C92 E;  1VYU A;  3S3O A;  4EMG A;  3EG1 A;  2FZK B;  2ROT A;  2X35 A;  1D1A A;  1VQM T;  5GMK i;  3CD6 A;  3JCM J;  4RTV A;  3H6Z A;  3OYI A;  2JNG A;  4MZP A;  2XG8 D;  5D7U A;  1VQ7 Q;  3M58 A;  4E2F B;  1M1G A;  5I22 A;  2FZC B;  4M7A C;  4FU6 A;  4PJN A;  2J05 A;  1UJ0 A;  2KVQ G;  2LCC A;  4IIM A;  5GMK e;  1R77 A;  4M75 D;  3J81 E;  1E6H A;  4C8Q D;  1M90 U;  3CPF A;  3JB9 G;  1WHK A;  2NUP B;  1GXI E;  3RMQ A;  2EYW A;  2X3X D;  5DM7 R;  1NJI C;  2HCK A;  5CVI A;  4Y91 A;  1QVF P;  2ROL A;  2O01 E;  4Z88 A;  5GAM f;  2ZPG B;  3JCM h;  1O9S A;  3OS1 A;  2KRN A;  3OMC A;  3MET A;  3BW1 A;  1M9S A;  3VV0 A;  3L2V A;  4ZGD B;  3M4G A;  4X34 A;  2E6Z A;  4XU0 A;  4J9C A;  1OEB A;  5LJ5 f;  2X4J A;  1GL5 A;  2ED1 A;  3VS0 A;  2PVG B;  4JDS A;  2EKH A;  2KK4 A;  3SFM A;  3LYI A;  2YRC A;  3L2Z A;  1A0N B;  2FL7 A;  5GAN 5;  2DXT A;  3SWN C;  3CEY A;  4M4Z A;  3OYF A;  4J6X A;  2P0Q A;  2DXC A;  1I0C A;  1SSH A;  4BB7 A;  4E7L A;  2HEQ A;  1AZG B;  4FYY B;  5GAM g;  1PKT A;  4Q5W A;  3M59 A;  1BYM A;  4GY5 A;  2ED0 A;  3JV3 A;  4JLG A;  2A0F B;  1G3Y A;  4M7D D;  1VQN Q;  2XDP A;  3CCE T;  3IQL A;  3OBW A;  2J7I A;  2HKQ B;  4PFZ A;  5FRO A;  4JS5 A;  4ME7 A;  1TWB A;  4N0A C;  1YCY A;  4C0F A;  1QQJ A;  2E41 A;  1K9M U;  2DO3 A;  1K9M R;  4F04 B;  3X26 B;  1R8O B;  2KR3 A;  3VKI A;  2K2M A;  2V1Q A;  5CK9 A;  4QKU A;  3VRZ A;  1FXX A;  1PM3 A;  5GAN 6;  2JTM A;  1PRM C;  1VQ8 T;  1JU5 C;  3CCE Q;  2DYB A;  3R6O A;  2LVM A;  1AD5 A;  1H8K A;  4YTL A;  2QTV A;  1X43 A;  4EIK A;  5GAM j;  2RO0 A;  1J3T A;  2NUT A;  4R55 A;  2YHT A;  2BE9 B;  1UDL A;  2LQW A;  1MHN A;  3QDF A;  4J6Y A;  3M53 A;  2YSQ A;  2LTO A;  1MMD A;  5GAN e;  4M7D C;  2F2X A;  4M77 A;  3G4S A;  3GOX A;  4M7A F;  2ATC B;  3X24 B;  2EYQ A;  5CR2 A;  2VUB A;  1Q7Y C;  1I1J A;  1QVP A;  3ER0 A;  1Q86 R;  2VXF A;  3CXC S;  1WJQ A;  4F7U E;  1VQK A;  2K79 A;  3MP6 A;  3KBG A;  3UDC A;  1ZUY A;  4PJO F;  2DXU A;  3KXT A;  2YRV A;  1LOJ A;  2DEQ A;  3SDZ A;  4HCK A;  4JS4 A;  3QII A;  3NGP A;  4PLL A;  1YIJ Q;  1B7T A;  2XHC A;  3QUI A;  1UGV A;  5DLQ E;  2K7A A;  2E3H A;  4KRT A;  4PJO D;  1UGQ B;  3OS2 A;  2I0N A;  2CP6 A;  3FEO A;  3P8D A;  4GLM A;  4IUP A;  5KYY A;  3CC7 T;  1Q86 C;  1W4S A;  1OZ3 A;  2RHU A;  2LQN A;  4KH1 B;  3QG1 A;  2RB6 A;  3O5Z A;  4LUD A;  1TXQ A;  2EBP A;  3PIP A;  3CC2 A;  2D0Q B;  1QP3 A;  3SEM A;  2SEM A;  1CSK A;  3RIR A;  3FDR A;  2LC4 A;  1VQ6 A;  1NZ9 A;  2HAX A;  1WHJ A;  2L3S A;  3CCV T;  5C6S A;  3C12 A;  3CPW P;  2VKN A;  1K0S A;  2BE7 D;  2FYK A;  1FMW A;  2MWO A;  3ULR B;  1X6B A;  1BIB A;  3C0C A;  1XOV A;  2JUF A;  2OX7 A;  2XK0 A;  4EMH A;  2QAS A;  3G6E T;  1VUB A;  2COZ A;  4BY6 B;  4PKC C;  2MWP A;  2P4T A;  1K73 R;  1Y7X A;  1NLO C;  2NYS A;  3HP9 A;  1YWO A;  2DZC A;  1JO8 A;  3EAE A;  1WNL A;  2HDA A;  1X6G A;  4OMM A;  2QA4 Q;  1X2Q A;  4HVV A;  1VQL T;  1QW1 A;  4DEY A;  3NMZ C;  4ZN3 A;  4AFZ C;  4C5H A;  4CC4 B;  2ZAE A;  5CAI A;  2KDS A;  2D1X A;  2K5L A;  4M78 E;  2KXD A;  4LDX A;  5HY6 A;  3INZ A;  4JJC A;  2COY A;  1W6X A;  2DKG A;  2EQJ A;  3CXC P;  2K6D A;  4MML A;  1YI2 A;  3EHQ A;  4J5Y A;  4M77 C;  5IT9 E;  1QVG A;  1VQK T;  2L0A A;  2MK5 A;  2DIQ A;  2RHX A;  2DK3 A;  5GAO r;  2RJE A;  1B34 B;  4M7A B;  2XU8 A;  1ZSZ B;  2CH4 W;  4J7F A;  3I56 T;  2LNV A;  1N27 A;  2CZ7 B;  1I5O B;  1VQ9 Q;  2CZ0 B;  1E7O A;  4JJB A;  3QBY A;  1KD1 U;  4EMK B;  2DL8 A;  3V7S A;  1RAB B;  1TUG B;  3JCM f;  3OS0 A;  5GAN 8;  1WYX A;  2NUZ A;  4QT7 A;  2DL5 A;  6AT1 B;  4ORZ A;  2FPE A;  4ZGE B;  2OAW A;  3QKJ A;  2CUB A;  3CCQ T;  4D6W A;  1RAI B;  1JRI A;  3BDU A;  1SHG A;  2KGT A;  1WGS A;  4OB1 B;  3V8K A;  4C5I A;  2BZY A;  1VQ5 Q;  4JRQ A;  2RA2 A;  2EJF A;  3CMA A;  1ZX6 A;  1G3S A;  4LN2 A;  1WJR A;  4OVA A;  4BDZ A;  1P92 A;  5KYU A;  3I9Q A;  1PG5 B;  2DA9 A;  4DOW A;  2HQH A;  1K8A R;  2RJF A;  3UA7 A;  2VXE A;  3PVL A;  5KYW A; 
#chains in the Genus database with same CATH homology
 5FU7 B;  4EDU A;  5CIU A;  3VYG A;  2RI3 A;  3FIF A;  4BE2 A;  3QJ6 A;  4UC4 A;  3DLL A;  1W2B A;  4L59 A;  3HRT A;  1H64 1;  2KSS A;  4M78 D;  4IUU A;  1QVF S;  2EQU A;  4XU2 A;  3SB2 A;  3UT1 A;  4BAC A;  3G7Z A;  1YJN T;  4M7D E;  3GLX A;  4HCZ A;  2QI2 A;  1VQP T;  4KUI A;  4LDU A;  5IAY A;  5FLX E;  1K73 U;  2R5M A;  4XQ3 A;  4BY6 C;  4XTZ A;  5GAM e;  5C0M A;  2K5F A;  2JZ2 A;  5GAN f;  3HHT B;  2RI5 A;  4QQD A;  3L42 A;  3JCM X;  1X75 C;  4BE0 A;  3EFR A;  2FB7 A;  3PIO A;  3OQ5 A;  3CCJ A;  4PJO G;  2H3J A;  3LLR A;  1X01 A;  3VU3 C;  2OTL T;  1I8F A;  4N4G A;  1I5L A;  2QXF A;  3P8H A;  3WVE B;  4BUG A;  2PUO B;  2DD5 A;  3GIB A;  2G3R A;  3E19 A;  4II1 A;  2PVO B;  5GAN 7;  3JCM c;  4OB2 B;  1VQ7 A;  1WQ7 A;  3OSV A;  4IUV A;  3L2Q A;  2JN0 A;  3DB4 A;  2LCL A;  3E1S A;  1K73 C;  5CO7 A;  2PVD B;  5A2Q E;  2HQE A;  5LJ3 f;  2DPP B;  4M75 B;  2E10 A;  5D6Y A;  3NTK A;  4Z02 A;  4QVC A;  1V29 B;  2WAC A;  5LL6 S;  3CC4 T;  2XD0 A;  4C8Q B;  1VQ5 A;  4CRI A;  2LRQ A;  2L8D A;  2RD1 A;  3L1A A;  4F7U G;  2C06 A;  1YHQ T;  4M77 G;  4HT9 A;  2LQ8 A;  2EJ9 A;  3GNF B;  2JOY A;  3OYN A;  4C92 G;  3RER A;  2CZ1 B;  2RHZ A;  4M78 A;  5DY9 A;  5FU7 C;  4QQ6 A;  3PMI A;  2DIG A;  4C8Q E;  3RKY A;  1BI2 A;  4C8Q F;  3OYD A;  4JRP A;  5GAM h;  3CCQ A;  4M75 E;  2QA4 T;  4MZT A;  4RCC A;  3QYH B;  2CGH A;  2M9U A;  3JRZ A;  4KT0 E;  2VV5 A;  5A0L A;  3CCV A;  2V8I A;  3M5A A;  5HK0 A;  2QQS A;  2EQK A;  3LWI A;  3ZBD A;  5GAO l;  1G3T A;  5GAN g;  4KUL A;  4F7U B;  3CCL T;  4OB3 B;  1N8R C;  5J39 A;  5LJ5 h;  3MCA B;  3OW2 S;  2O4X B;  1HXD A;  1M1F A;  2DD4 A;  4A4G A;  3DLM A;  5KCO A;  1U1T A;  4XTW A;  1D3B B;  4LDV A;  2DVE A;  3GNG A;  3F70 A;  3PMT A;  4HKE A;  5GMK h;  4P5N A;  2DXB A;  2R57 A;  4BI4 A;  4QVZ A;  3JB9 F;  3JCM d;  3FC3 A;  3M57 A;  4HA8 A;  2RH2 A;  1G3W A;  4WF2 A;  3S3N A;  2DZ9 A;  1VQ4 A;  4BI3 A;  3CCM T;  2Y90 A;  1YJ9 A;  4C0D B;  2XDB A;  4IUQ A;  1Q81 U;  4MDX A;  2DTH A;  2RJC A;  1Y96 A;  3ZFJ A;  2EAY A;  3PFS A;  4C92 E;  1OZ2 A;  4FSX A;  3S3O A;  2NLU A;  4EMG A;  1Y07 A;  3OYG A;  3G71 T;  1XQH A;  3CMA T;  2X35 A;  4EMK C;  1VQM T;  5GMK i;  3JCM V;  3CD6 A;  2QA4 A;  3JCM J;  2PU9 B;  1K8A C;  2QDY B;  1Q86 U;  1VQ8 A;  2ZPE B;  3RKX A;  3H6Z A;  4KBM B;  4LDY A;  5GAO p;  3OYI A;  2JNG A;  2ZZD A;  2XG8 D;  4MZP A;  3VYH B;  3M58 A;  4M7A A;  4L6V 5;  1M1G A;  4E7J A;  2JTF A;  1VQ6 T;  3V8L A;  4ELY C;  4J6W A;  1YI2 T;  4M7A C;  3QXE B;  4M7D A;  2L5Q A;  2RJD A;  1DJ7 B;  4FU6 A;  2KMT A;  4B9W A;  1I81 A;  2KVQ G;  3OW2 A;  1VQ9 T;  2LCC A;  4J7I A;  3JCM g;  2V8K A;  5GMK e;  4M75 D;  1Q82 C;  3J81 E;  4OF1 A;  4C8Q D;  1M90 U;  2L3R A;  3CPF A;  5CQX A;  2QQB A;  4EMK A;  3JB9 G;  5GAN 3;  2EJG A;  2RI2 A;  3MP8 A;  5LJ5 d;  2GCX A;  2CZ6 B;  3J80 E;  3V8J A;  1VQ9 A;  1GXI E;  3RMQ A;  3CC2 T;  1K8A U;  5DM7 R;  1NJI C;  4O5V A;  2CYZ B;  4N4I A;  1NPP A;  4TVR A;  4XU3 A;  5CVI A;  2O01 E;  4Y91 A;  3G4S T;  3OYA A;  3OYJ A;  5GAM f;  2BKD N;  2ZPG B;  1KG1 A;  3JCM h;  1YIJ T;  1I4K 1;  1O9S A;  3OS1 A;  3OMC A;  3MET A;  4ZTJ A;  4NOY A;  4FM4 B;  5I21 A;  3QO3 A;  2D6F A;  4M78 F;  2KQW A;  3SWN B;  3BW1 A;  1JBM A;  1M9S A;  2ZGW A;  3FJP A;  3VV0 A;  3WVD B;  5KE3 A;  3L2V A;  2QEX T;  4ZGD B;  3M4G A;  5GAO q;  3LGF A;  4X34 A;  1S72 T;  4J83 A;  4C5G A;  3JB9 H;  1UGR B;  2E6Z A;  3HFO A;  3NFC A;  4XU0 A;  1NPR A;  2M0O A;  3M54 A;  2PQW A;  4BI8 B;  3PT9 A;  3A8M B;  4M7D F;  1KD1 C;  2XID A;  5LJ5 f;  2X4J A;  4VUB A;  1VQO A;  2PVG B;  4JDS A;  2KK4 A;  1FWZ A;  3SFM A;  2HNI A;  5EG2 A;  3LYI A;  5LJ5 g;  3LWH A;  3OYC A;  1XNI A;  3CD6 T;  3L2Z A;  3L2R A;  3MEV A;  4OGC A;  2FL7 A;  4C92 A;  5GAN 5;  2DXT A;  3SWN C;  3CEY A;  3CCE A;  3X25 B;  3OYF A;  2E65 A;  4J6X A;  4RCB A;  4A4K A;  2P0Q A;  2DXC A;  5GMK m;  2E64 A;  1U8R A;  4BB7 A;  4E7L A;  3S3M A;  4E47 A;  5A0D A;  5GAM g;  3UWN A;  2MAM A;  4Q5W A;  3BDL A;  4IUT A;  2R5A A;  3M59 A;  1WPY A;  2M1H A;  3RUX A;  4JJN K;  3J7A F;  4PJO E;  3PGG A;  4C0Z A;  3OYK A;  1VQL A;  1BYM A;  2GFU A;  2X4W A;  4GY5 A;  3VUB A;  3ASK A;  4J8O A;  1K9M C;  2Y4X A;  2CS7 A;  1VQ4 T;  3X28 B;  4OMF B;  4JLG A;  2X4Y A;  4PJO C;  4EPC A;  2K4Y A;  1G3Y A;  3HPW A;  4M7D D;  2XDP A;  2GQV A;  5GAN 4;  3CCE T;  4FT2 A;  5J3B A;  3CME T;  2DAQ A;  3FB9 A;  3OBW A;  4L5G A;  3CCL A;  2OTJ A;  3HRU A;  2A3L A;  3S6W A;  3M56 A;  1BIA A;  3DKM A;  4M75 A;  5FRO A;  4JS5 A;  1LJO A;  2ZPF B;  4XTV A;  1X6O A;  1UEB A;  2JVV A;  4ME7 A;  4C8Q A;  2XDD A;  3CPW S;  3PTA A;  4M75 C;  4N0A C;  3RKW A;  4PJO A;  1YCY A;  4C8Q C;  5HKC A;  4C0F A;  4XTU A;  4C8Q G;  1YIT T;  3UPU A;  3OA6 A;  2DTO A;  4FT4 A;  4M78 B;  2E41 A;  4HCC A;  3CXC A;  1VQN A;  1YHQ A;  2RK2 A;  4RG2 A;  2LT4 A;  2LX9 A;  1K9M U;  2DO3 A;  4M7A D;  4OP0 A;  3X26 B;  1R8O B;  2EIF A;  3VKI A;  5CK9 A;  2KY9 A;  1YIJ A;  5LJ5 j;  4C5E A;  5LJ3 j;  5FRN A;  1FXX A;  5GAN 6;  5CKB A;  3C4S A;  2DJZ A;  2JTM A;  3QZ5 B;  3OYE A;  1VQ8 T;  2K5I A;  2E5Q A;  4ZTF A;  3M9Q A;  5CCA A;  2IG0 A;  3SD4 A;  3G71 A;  3QHS A;  1VQ5 T;  3TEE A;  3R6O A;  1BI0 A;  5CKF A;  1UGS B;  2O4X A;  2LVM A;  4N0A A;  3X20 B;  4A54 A;  4MMK A;  4X9D A;  4YTL A;  5GAM j;  2RO0 A;  1NE8 A;  2GF7 A;  2EFI A;  3OS5 A;  1VQM A;  1D3B A;  1M4Z A;  2F5T X;  4QW2 A;  1IZ6 A;  2RHY A;  2YHT A;  4R55 A;  3JCM W;  2F5K A;  2ZCF B;  1SSF A;  2XIC A;  4MZM A;  3V7C A;  4BE1 A;  2LDM A;  2QEX A;  1Y71 A;  3C95 A;  5D6W A;  1B34 A;  4N4H A;  1MHN A;  4J6Y A;  4IKF A;  4LDW A;  3M53 A;  2LTO A;  3MEW A;  3ZEH A;  5GAN e;  3CC7 A;  1KC8 U;  2KAF A;  4M7D C;  1Y96 B;  4O6J A;  4M7A E;  3HFN A;  4M77 A;  1PSF A;  3G4S A;  3GOX A;  4M7A F;  4C0D C;  3X24 B;  2EYQ A;  5CR2 A;  2R58 A;  1PSE A;  1QVP A;  2VUB A;  3ER0 A;  3M4Y A;  2VC8 A;  2WSC E;  2RK1 A;  3NTH A;  3OMG A;  4A4H A;  2P0P A;  2VXF A;  4MDW A;  3CXC S;  1WJQ A;  5GMK j;  4F7U E;  4V2S A;  4DA4 A;  3OSS C;  1BKB A;  4A4F A;  1VQK A;  2EKO A;  4BDY A;  3MP6 A;  3KBG A;  3NTI A;  3UDC A;  1KQ1 A;  5FU6 C;  1NJI U;  4C92 F;  2VGN A;  4RKU E;  1ZHI A;  2DXU A;  4PJO F;  3KXT A;  2YRV A;  1LOJ A;  4C92 C;  1M5Q 1;  2DEQ A;  3SDZ A;  4JS4 A;  3QII A;  4M78 G;  3H8Z A;  3A8H B;  3CCU T;  2XKO C;  4PLL A;  3L2U A;  2D9T A;  4PNO A;  4XAX B;  1JB0 E;  3JCM e;  2XHC A;  2I2L A;  5L8R E;  3QUI A;  5DLQ E;  2DTI A;  2XI9 A;  3WXM B;  1XTD A;  3QJY A;  1EIF A;  4CI0 C;  3CME A;  4LD9 K;  1UGQ B;  3E9G A;  3TCJ A;  4IUR A;  3OS2 A;  3I56 A;  3CCJ T;  1YIT A;  3OB9 A;  1JJ2 S;  3FEO A;  3P8D A;  4FIB A;  4IUP A;  4QVD A;  4M77 F;  2E70 A;  3CC7 T;  1Q86 C;  2K3Y A;  1TH7 A;  1W4S A;  4FL6 A;  5CQY A;  1YJ9 T;  2V8J A;  1OZ3 A;  2RHU A;  5LJ3 e;  2QQ9 A;  2ZPH B;  2HQX A;  3MO8 A;  3QG1 A;  2RB6 A;  3LX7 A;  3SWN A;  5FRM A;  3CCR T;  3OYH A;  1Q81 C;  2OTJ T;  3RES A;  2MF2 A;  1KQS S;  3PIP A;  3CC2 A;  3G6E A;  1YBY A;  4C0G A;  3GP8 A;  2D0Q B;  2HBP A;  2Y4Y A;  1QP3 A;  4M77 D;  3I55 T;  2VYT A;  3RIR A;  1JJ2 A;  3FDR A;  2LC4 A;  3LGL A;  1VQ6 A;  4C92 D;  3E9F A;  3QDR B;  4OGE A;  4ATO A;  1Q7Y U;  2VGM A;  1NZ9 A;  3C94 A;  2HAX A;  4XK8 E;  4E7I A;  4C92 B;  4A4E A;  3CCV T;  5C6S A;  3C12 A;  2E6N A;  2FYK A;  2MWO A;  5LJ3 h;  3EFS A;  1N8R U;  2GFA A;  1RL2 A;  1BIB A;  4OB0 B;  4E7H A;  3JCM Q;  2B8A A;  5GAN 2;  1XOV A;  2JUF A;  3TU4 K;  1O75 A;  1YJW A;  3MEU A;  2XK0 A;  1G5V A;  4EMH A;  3JB9 I;  4BD3 A;  3G6E T;  3GPL A;  1VUB A;  2RM4 A;  4M75 F;  2K57 A;  1UB4 A;  4ELZ C;  4BY6 B;  4KUD K;  1VQN T;  4B9X A;  2EQM A;  2OAU A;  4PKC C;  1MGQ A;  2MWP A;  2P4T A;  3HKS A;  1YJN A;  1Y7X A;  3OBY A;  2X4X A;  4M78 C;  2E12 A;  4HT8 A;  3HP9 A;  1N6A A;  4NS5 A;  5CKH A;  4A53 A;  4F7U F;  1FX7 A;  3CBP A;  2BUD A;  2DZC A;  3JB9 J;  1VQP A;  2YLC A;  3ME9 A;  4NL3 A;  1S72 A;  3EAE A;  1KQS A;  3I55 A;  1WNL A;  3L2W A;  5GAN j;  2RHI A;  2YLB A;  5I2M A;  3JSC A;  3TRE A;  2WSE E;  4DOV A;  3VJP A;  4Y28 E;  3VUZ A;  5CKE A;  1M8V A;  1VQL T;  2M16 A;  1QW1 A;  3OY9 A;  3LH0 A;  3URG A;  4ZN3 A;  4C5H A;  1KHI A;  4PJO B;  3FLG A;  4F7U A;  2MI6 A;  2CKK A;  5CAI A;  2KDS A;  1WQW A;  4GLK A;  2K5L A;  4PL6 A;  1KQ2 A;  4M78 E;  4XTY A;  3LW5 E;  4LDX A;  2ZPB B;  4XTX A;  5J26 A;  5GAO m;  1ZQ1 A;  5HY6 A;  3PNW C;  3INZ A;  3BFM A;  3CCM A;  4RMO A;  5LJ3 d;  1IRE B;  2DKG A;  5DLO A;  2EQJ A;  4M75 G;  3A8G B;  4HCB A;  5LJ5 e;  2IVW A;  2LT1 A;  1N9S A;  4MML A;  3JB9 D;  3MHX A;  5AYF A;  5GAO n;  1YI2 A;  5LJ3 g;  4J5Y A;  3N5B B;  1VIF A;  4M77 C;  3QPH A;  2FHD A;  3JCM b;  5GAM d;  5GAN h;  1AHJ B;  5HK3 A;  2F69 A;  5IT9 E;  1QVG A;  1Q82 U;  1VQK T;  4LD6 A;  3RMS A;  3CCS T;  3Q1J A;  5A0G A;  4X9C A;  3O8V A;  3T9N A;  2DIQ A;  2RHX A;  1U1S A;  1ZBX A;  3OYY A;  2DK3 A;  2QTX A;  1M1K C;  2ZPI B;  3GF5 A;  1HK9 A;  3QZ9 B;  5FU6 B;  4QQG A;  5GAO r;  1QP2 A;  2RJE A;  1B34 B;  2AHJ B;  2OTL A;  3HSB A;  4JUV A;  4NL2 A;  5KE2 A;  4M7A B;  2XU8 A;  4M7A G;  1LNX A;  1BI3 A;  4J7F A;  3I56 T;  2LNV A;  3M55 A;  4M77 B;  1N27 A;  5CKD A;  1N9R A;  4JLI A;  4M7D B;  2CZ7 B;  3CBO A;  3FRN A;  2CZ0 B;  3JCM P;  2A7Y A;  3OYB A;  1UGP B;  1OI1 A;  2P0K A;  2L89 A;  3A8O B;  3QBY A;  3HRS A;  3AHU A;  1QVF A;  2E1H A;  5KCH A;  2HD0 A;  4DQ2 A;  4EMK B;  1KD1 U;  3QSU A;  3V7S A;  1VIE A;  2FVU A;  2QQA A;  2QQR A;  1OYX A;  3JCM f;  5GAN 8;  3OS0 A;  3CCR A;  4RG8 A;  5I2S A;  4JRI A;  4ZGE B;  2K3X A;  3QKJ A;  4M77 E;  5IN1 A;  3CCQ T;  5D6X A;  4D6W A;  5KH6 A;  1JRI A;  4PLI A;  3BDU A;  3DB3 A;  4ZN1 A;  2K2V A;  3OYL A;  1WGS A;  3CCS A;  1QVG S;  4R56 A;  1KC8 C;  4OB1 B;  3OYM A;  1W2B S;  3V8K A;  4E7K A;  4C5I A;  3CCU A;  3KUF A;  3CBM A;  4JRK A;  4JRQ A;  2RA2 A;  1RI0 A;  3HL8 A;  2EJF A;  3CMA A;  5GMK l;  1G3S A;  3MEA A;  1YJW T;  5GAN d;  1KHC A;  1WJR A;  3A5Z B;  3MP1 A;  4OVA A;  1VQO T;  1H3Z A;  1VQ7 T;  3QYG B;  1P92 A;  5M9O A;  4BDZ A;  1Q7Y C;  4PJO D;  2BIV A;  1M90 C;  1WJS A;  3V7R A;  2MMP A;  1M1K U;  4DOW A;  4M7D G;  3BY7 A;  2LQK A;  3JAM E;  3P8B B;  4ZGJ B;  2RJF A;  3CPW A;  3CC4 A;  2PUK B;  3A8L B;  1BI1 A;  2VXE A;  2EWN A;  4XU1 A;  2WSF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...