4DOVA

Structure of free mouse orc1 bah domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
157
Chain Sequence
QTFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Origin recognition complex subunit 1
publication title The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
total genus 33
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dovA00
3PTAA 4JJNK 4KUIA 4DOVA 1M4ZA 4DA4A 1ZHIA 4LD9K 3PT9A 2FL7A 2FVUA 4FSXA 4KUDK 4FT2A 4KULA 4BB7A 3TU4K 1W4SA 4FT4A 1ZBXA 4DOWA
chains in the Genus database with same CATH superfamily
3NTHA 4M7DC 2J7IA 3LGLA 2HD0A 2O01E 2CT4A 4E7HA 1B07A 1O9SA 3TEEA 3CCLT 2JM8A 2KR3A 2RQTA 4JLIA 3H6ZA 4F7UE 4PJOD 2RA2A 1E6GA 3E9GA 4F7UG 3CBOA 2CGHA 4C8QD 3M57A 4BY6B 3CXCA 2V1RA 4FU6A 3JCMX 1BBZA 3MKDA 1ZHIA 3EHQA 3OYNA 3GOXA 4RTUA 2L3PA 3E2UA 2KEAA 3G4SA 3FLGA 4M78F 2VB6A 2DXCA 3L2ZA 4J9CA 4BI4A 1Q7YR 1NEGA 4XQ3A 5CKEA 1WZOA 4RTYA 2NWMA 2BKDN 1PWTA 4OMLA 1BCOA 2LX7A 1NLOC 2QQ9A 5HK0A 2O2OA 4OMMA 3EGUA 1KQSA 2YSQA 4BI8B 3CC4Q 3GBQA 1W2BA 4JZ3A 5KCHA 2XU8A 4L6V5 4KGXB 1RAHB 3BY7A 2PVOB 4FL6A 1NE8A 3FDRA 5LJ5h 2Y4XA 1SF9A 3GP8A 1M1KR 5FRNA 3DLMA 1QVPA 2J6OA 4HXJA 3DKMA 2YLCA 1VQOA 2HL3A 2D6FA 2YLBA 2QA4T 2J6KA 2PNIA 2GFUA 2EYWA 2KBTA 5HKCA 4Y91A 4MZPA 3QKJA 1UG1A 1HYOA 2QEXT 2A08A 4TVRA 4HCCA 3CD6Q 3QZ5B 1K9MR 2M0OA 1H3HA 3JCMc 1VQ4T 1RAGB 2DL4A 2ZZDA 3HFOA 2DX1A 4QQDA 4HVVA 3L1AA 3NMZC 4JJBA 3V8KA 1YBYA 3V8JA 3GNFB 3OYEA 3EFOA 2K7AA 1VUBA 3LH5A 2V8KA 1WQWA 2FB7A 2BZ8A 1VQ9Q 2FEIA 5FU6C 6AT1B 1UHCA 3I35A 3MEUA 5KYYB 1UECA 1SHGA 3TSWA 3CPWA 1M2OA 4HT8A 1QKXA 1ABOA 1PCXA 2AKLA 5LJ5g 5LJ5f 1R77A 5KYUB 2CP7A 2X3XD 3CEYA 1S1NA 1YJWA 3EGDA 4C0DC 1QP2A 2MAMA 2A7YA 1D1BA 3CCSQ 2NYSA 3OYGA 4FIBA 3I56A 4A4KA 3JB9F 2KDSA 4RUGA 3I55A 1M90U 2L8DA 1Y0MA 2VGNA 5FU7B 2RQWA 1I4K1 3EG3A 3RERA 2RJCA 4J5YA 1TOVA 4PL6A 4CC4B 4FYXB 2EKOA 3ZEHA 1UGVA 2F5KA 5J39A 5GANe 5KE3A 3CQTA 3VYGA 4QQ6A 2DL7A 3U23A 2HZYA 3RIRA 2EQIA 3MP6A 2M9UA 4ORZA 4RG2A 3RMQA 3CC4T 1U8RA 3VS4A 1KC8U 1SPKA 2DJQA 2V8IA 4OMPA 1SSFA 4RTZA 4Q5WA 1X27A 3DB3A 1E6HA 1YCYA 1K73U 3RNJA 1QVGP 2CZ1B 1K8AU 2DVJA 1Q82U 5LJ3e 1VQ7A 4ZN1A 3GPLA 4FSSA 1RACB 3VRZA 3OYYA 4QVDA 1XQHA 4OMQA 1WNLA 2XDBA 2KRNA 3QJYA 3FJPA 5CCAA 4LD9K 1Q81R 2RQUA 1ZQ1A 4IURA 2V1QA 2I0NA 2YRCA 3LWIA 4JRKA 4AMCA 1SKUB 5C0MA 2PUOB 4D8KA 1W6XA 4C8QA 1YI2A 1CSKA 2FZCB 2HNIA 4CI0C 3CD6T 3PIOA 3IQLA 2K5FA 3OYJA 3M0UA 4EMKA 4DBQA 5KE2A 3LGFA 2ZPHB 1GRIA 1B7TA 5LJ3g 3NHNA 2HSEB 5KH6A 2Y90A 2EJGA 5GAOr 3G4SQ 4O5VA 2YXYA 4JRPA 4CC2A 5LJ5d 1VQ9T 2ZAEA 2YHTA 2X4YA 1EZZB 1GBRA 1ACMB 5D6WA 1M3BA 2EKHA 3FRNA 3M0RA 2L89A 8AT1B 2KI7A 4XU1A 2EGCA 4KT0E 1PRLC 2KMTA 3H0FA 1SHFA 4PK4A 1YITQ 4Y28E 1ABQA 4EDUA 2DO3A 2PVGB 1N9RA 1QKWA 2KT8A 1MUZA 2LQ8A 3X25B 1WI7A 1NZ9A 2YWWA 3CCST 4HA8A 3TSZA 3PFSA 2BZYA 1T3SA 1SEMA 3M0TA 3CCRA 5CKHA 3RDVA 2XK0A 5CR2A 2CUBA 1UDLA 2OAUA 2EYYA 1IREB 3RKWA 1VQOQ 1CKAA 4MZMA 1UEBA 2PTKA 2CYZB 3TCJA 4M7DF 2DIGA 2QQBA 2NUPA 4R0KA 2QA4A 1UTIA 2DE0X 3JCMh 2F5TX 1KFZA 3OSVA 1OX9A 1RLPC 1VYUA 1AHJB 4KGVB 2L3SA 1OEBA 2CH4W 2FZGB 3HFNA 2LDMA 5J3BA 4KUDK 3UATA 1AT1B 4RTTA 3CCEQ 4A4GA 3OS5A 5I21A 5A0DA 3R6OA 1KQ2A 3L2RA 3UPUA 5GMKh 1PC0A 1RAEB 2P0KA 2XDDA 3VS5A 3OYKA 1NEBA 3HPWA 1E7OA 3OYHA 1ZA1B 5LJ5j 5FU7C 2NUPB 5A0LA 4J9BA 1BIBA 3OYLA 3CCVA 1T0JA 3OMGA 3CMAA 1H3ZA 4ESRA 4C5EA 2RJEA 3QO3A 1QCOA 2M02A 5GMKi 3I56Q 1Q7YC 4WCIA 3G4ST 1KIKA 1IZ6A 1NJIR 4MDXA 2GCXA 1YN8A 4PFOA 3BFMA 3JCMf 3JCMg 1Y96A 1VQNA 4F7UA 4RTXA 2EJ9A 4BE2A 1AOJA 1R0BG 5CKFA 1UGSB 4XTZA 1MNDA 2HQHA 2O4XB 3L42A 2ROTA 1I07A 3VS1A 2EW3A 4XU3A 3VUZA 1YITT 4ATOA 1WLPB 1I1JA 1I81A 5IHKA 3M53A 4MMKA 1JBMA 2CT3A 5A0GA 1M1KC 4J9FA 2E1HA 3OW2P 2EVRA 4FT4A 1VQ7Q 1BI3A 3EGXB 2COZA 3SDZA 2RB6A 4EPCA 1VQOT 2CZ7B 3JB9H 2LTOA 4C8QG 1Q86R 4ZN3A 2KQWA 2JN0A 2PUKB 5C6SA 3DB4A 2CSQA 2X4JA 1VQMQ 5EC7A 1AZGB 1RAAB 1K9MC 3QBYA 3JV3A 3L2QA 5FRMA 1YI2Q 2EGAA 2EJFA 3UF4A 4GY5A 1XTDA 3JCMJ 1H92A 2QDLA 3EG9A 1X2KA 3VUBA 4AT1B 2LJ3A 4M77B 4FYWB 5GAOn 3JCMW 2EQKA 4B6MA 3RKYA 2XIDA 1K1ZA 2MMPA 2SRCA 4PNOA 5FROA 3CCET 4C8QC 1N8RR 4FCYA 3CXCP 4BD3A 2V26A 2XG8D 1M9SA 1PKSA 1WDXA 1VQ9A 2RM4A 1RI0A 3QYHB 4XU2A 3HHTB 5A2QE 1KHCA 1M8VA 3LH0A 3A8LB 4AG2C 3QXEB 2X35A 2DEQA 1TUCA 1TTHB 2V8JA 1SRLA 1EFNA 2DPPB 3JCMd 4A4FA 1YIJQ 5CVIA 4C92B 1O75A 1C0MA 2CSIA 3I56T 1KQSP 1YJ9Q 2RQVA 3M59A 3CCRQ 4QT7A 3CCSA 4RMOA 1W2BP 1G2BA 1N27A 5AYFA 1M4ZA 3OS0A 2XICA 1WYXA 4M7AF 3URGA 3V7CA 4PJMA 4KRTA 1JO8A 2MI6A 3A8HB 5ECAA 1RAIB 3WXMB 1AWJA 1HSQA 3RR6A 4ELZC 3KBGA 2ZPEB 2RQRA 2PVDB 3MP8A 4M75B 2HBWA 3HL8A 1BB9A 3SWNB 3INZA 1FMWA 2I2LA 5GJWB 2ZPGB 3M55A 5L8RE 1X01A 1Z9QA 1MMNA 2VYTA 3E1SA 2K5IA 2FO0A 1VQ7T 2P0PA 1OZ3A 4JJDA 5HY6A 3EG1A 1M5Q1 1Q81C 2MK5A 1U1SA 2IVWA 2QXFA 4AFZC 5GAN5 3VKIA 5FW9A 1BI2A 1H8KA 4RTWA 4C0ZA 1VQMT 2VKNA 1PKTA 2ROLA 1YI2T 3NGPA 2KE9A 2K9GA 4JDSA 5AT1B 3CCVQ 3QDRB 4LUEA 3CMAQ 3ULRB 1G3WA 2K2VA 2E10A 3CPWP 2OTLA 1PRMC 3ME9A 3RMSA 3TVTA 3UDCA 4KUIA 3QIIA 2JTFA 2F2XA 1KG1A 1VQNQ 2K2MA 4M77E 2B86A 3AHUA 3H0IA 4M77G 4EMHA 4Y92A 2LRQA 3I5RA 4HVUA 2LQNA 4CC3A 3PTAA 1PNJA 2OJ2A 1TUDA 4C5GA 2E6ZA 1X2QA 2EYZA 3PMTA 3VU3C 2DEUA 2IIMA 2KNBB 4V2SA 2HEQA 4GBQA 3JB9J 2X51A 3EFRA 2YUOA 1YITA 2KAFA 1V1CA 2RI2A 2QQRA 5GMKj 1YJ9T 3CCRT 1U3OA 3FEOA 4HT9A 3REBB 3C4SA 3F70A 2F69A 1PD0A 2DYBA 2MOXA 4C92E 4M77C 3JB9I 4E7JA 4DEXA 4C92G 1QVFS 1FWZA 5KYYA 1LCKA 2FRWA 2JNGA 3TU4K 3PMIA 2HSPA 5KYUA 3V8LA 3CC2A 4IIOA 3J7AF 2ZCFB 5I2MA 4BUGA 2DTOA 2DRMA 1X69A 5D6XA 3MEWA 4KBMB 5LJ5e 3J80E 2HDAA 4F04B 4EMGA 4OGCA 8ATCB 2CDTA 3REAB 4M75E 4LDXA 1NYFA 4LDUA 3OBYA 4J6WA 3R6NA 1WJRA 2JVVA 4M75G 2E3IA 3E9FA 2M51A 1EIFA 4L59A 3LLRA 2A28A 1KD1C 2COYA 4M78B 4C92C 3CCEA 1KSWA 2HL5C 3G6EA 2JZ2A 2K79A 4NOYA 3OYIA 2FYKA 2FHDA 3CCVT 3FJ5A 3CMAT 4XTYA 3M0SA 2MF2A 1NJIC 2LZ6B 2PU9B 3SHWA 1KQ1A 4M75C 2KY9A 1NG2A 3SWNC 1B34B 1JB0E 2KXCA 3META 1VQNT 1ZBJA 4NS5A 1VIFA 1M1FA 2XD0A 3QPHA 2MYSA 2RHUA 5GAN4 1D3BB 2EQMA 3CCQA 2DA9A 2AT1B 1X75C 1M30A 3P8DA 5KYXB 2VC8A 4II1A 2DXUA 1LVKA 1M90R 1Q86C 1B3QA 4M77D 2LX9A 4PJOF 4F16A 1QLYA 3MHXA 2LCCA 2QGFB 1BKBA 1U1TA 1Q81U 3PVLA 3JAME 3M0PA 4C8QF 2NUTB 4D8DA 3OA6A 3VYHB 1ZUYA 4BY6C 1RLQC 9ATCB 1VQLA 3PT9A 3RUXA 4GLKA 2RK1A 1VQMA 3NTIA 4OB3B 5KYWB 5GAMh 1KC8R 1UJYA 2CP5A 1UE9A 4NL2A 1VQ6A 2DJZA 4HCZA 4A63B 2OTLQ 1D0XA 3KUFA 2DD4A 1ZA2B 4FYVB 2G6FX 1K73R 1IGUA 2DAQA 1DJ7B 3O5ZA 1Q82R 2AZSA 2XMFA 1N8RC 1VQKQ 3JCMQ 2QTXA 2X4WA 3SEMA 1QVFA 1UJ0A 4C92D 2CZ0B 1P92A 4K11A 4OB1B 3VS6A 1LOJA 2JMCA 4J9EA 3BE3A 4PKCC 3CMEA 3A98A 4Z89A 1PD1A 3V7RA 2QQSA 3UT1A 4R55A 2GQIA 4PLIA 2M16A 3QWYA 4M78E 3M5AA 1JXMA 2BTTA 2NUZA 4M75D 1NYGA 4M78G 3MEAA 4HCKA 5CO7A 2DNUA 4RKUE 1GCPA 2OTJQ 4N4HA 2HKNA 1YIJA 2ED1A 2JTMA 2HCKA 5DM7R 1J3TA 5FWCA 1YJ9A 4B9WA 5GAMf 5GAMg 5KYNA 4PJOB 2K57A 2LT4A 4N4GA 3E19A 2RK2A 3QWXX 2H3EB 4Z88A 2YUNA 5I2SA 4X34A 4MDWA 1I0CA 2E64A 4ZGJB 1Y71A 2X3WD 2QK0A 1VIEA 4VUBA 1C6VX 3CC2Q 4LDVA 3T9NA 1V29B 4DOWA 1ZX6A 1X6BA 3KXTA 1IXDA 1OV3A 4M78C 2RHIA 1JXOA 1M2VB 3UWNA 1W70A 3M58A 4JJCA 2VWFA 4LXCA 1AD5A 3UA7A 4J6YA 3CCJQ 4PJLA 2DRKA 3EG2A 2L0AA 2MPXC 4DBRA 4HCBA 4A53A 4BE0A 4N4IA 2L2PA 3A5ZB 4PLLA 1N9SA 3BW1A 4R56A 4BI3A 2K3YA 5IT9E 1D1AA 1G3SA 3BDLA 3C94A 1K4US 4P5NA 2QASA 3G6EQ 3GLXA 2P4TA 3D7SB 3OBWA 3JCMe 1XNIA 2O4XA 1AVZC 3WVEB 4Z02A 2EYXA 1OX8A 4KGZB 1KD1R 4XTWA 1ZSGA 2VV5A 2OTLT 1TU0B 1WHHA 1WA7A 5D7UA 1ZBXA 1SG5A 3L2UA 1RL2A 1NJIU 4F7UF 4OMFB 4A4EA 2CP2A 4C5IA 2GBQA 3EGXA 1GCQC 3MJXA 4IUUA 3QJ6A 5CK9A 2NLUA 5GMKe 2VVKA 3GIBA 3M4YA 1VYVA 2D8JA 4KULA 4PJNA 1UHFA 1BCMA 1TXQA 2M0YA 1JQQA 3CCQQ 1M3CA 1HXDA 1WPYA 3CCUA 3HRUA 4X1VA 4M7DB 4LDYA 4J6XA 4DQ2A 2DYIA 1MMDA 1X43A 2LMJA 4DEYA 4DBFA 4ZGEB 2X9HA 2YRDA 5GAMd 5GAOm 1WHMA 1QW1A 2E70A 4AFSC 4M77A 1UGPB 2Z0WA 1WJSA 1XOVA 1WHJA 2F1LA 2FG0A 2K5LA 2KROA 2OTJT 1AEYA 3A8GB 5GAOl 2XI9A 4PFPA 2RJDA 1WHGA 1RUWA 3AT1B 1IB8A 4E7LA 1VQLQ 2JOYA 2DKGA 1C1AA 1K0SA 1Y07A 4IUQA 2ZPIB 4M78D 1YJNQ 4JUVA 4PJOE 3CC2T 1VQ6Q 2EQUA 1UFFA 4DBHA 4E7KA 4E47A 2RHZA 4J9DA 4C92A 3S3OA 2P0QA 3CBPA 2YUPA 2CREA 4LE9A 3CCJT 1BU1A 4BACA 3PE0A 3M9QA 1PG5B 3CMEQ 4J83A 1JJ2S 3G6ET 1AWOA 1IHVA 1OYXA 2E12A 4RG8A 1HJDA 2O88A 2K3BA 2HKQB 2YUQA 2AK5A 2FRYA 4M75A 4QVZA 3OYDA 3SWNA 2M1HA 2D9TA 1S72Q 1AWXA 3N5BB 4BB7A 3EAEA 1MNEA 2MCNA 1RAFB 4AFUC 1OU9A 1QWEA 2JS0A 4A4HA 1LNXA 2JUFA 3QG1A 3CC7A 3JCMb 1CKBA 2DTIA 3NTKA 4YTLA 1TWBA 2KRMA 5GAMj 5GAN7 4OF1A 1WHLA 2E5KA 2A37A 2EIFA 1K9AA 2KYBA 4OB0B 3CCQT 4M4ZA 3H9NA 4OB2B 3DLLA 1YNZA 1D0YA 1WHKA 3SFMA 1T3LA 5GJVB 1PSEA 3TREA 4XTXA 1M90C 3CBMA 3OYAA 1QWFA 1QCNA 1K76A 3L2VA 4ELYC 4X9CA 1I5OB 1OPLA 1NPRA 2F2WA 4M7DE 1JU5C 2A36A 4JLGA 1OZ2A 3BDUA 1GFCA 1TS9A 2A3LA 3EH2A 2DVEA 2L5QA 2JXBA 1WGSA 1VQ5Q 3GF5A 3S3NA 2O9VA 4E7ZA 1VQLT 3OS1A 2XKOC 5LL6S 2R58A 3M54A 1KC8C 4RCBA 1M8MA 3VRYA 2GFAA 3JB9D 2FZKB 2O31A 3GNGA 1YJNT 2J05A 2MIOA 1VQ6T 1K73C 2K3XA 1Q82C 4AG1C 5IXBA 2BE9B 2OI3A 2E6NA 1Z9ZA 4C5HA 2F2VA 3HKSA 5CAIA 2GTOA 2ZGWA 2ECZA 1ZSZB 1WFWA 3ER0A 2QTVA 3MP1A 2D8HA 1MMAA 1VQKA 1Q7YU 2DBMA 1PSFA 3CMET 1UGRB 2CP0A 2RN8A 4WF2A 3LW5E 4ZTFA 3CPFA 2LJ0A 4M7AB 1W1FA 3EG0A 3CCUQ 2JW4A 3ZL7C 2JM9A 1KJWA 2CP3A 2DL8A 1PM3A 2IPOB 1S72T 2RI5A 1MHNA 3L2WA 2BIVA 3RKXA 2CS7A 3PGGA 1JJ2A 1IRXA 1YIJT 2P84A 3FIFA 5IHNA 4E2FB 2H3JA 4LNPA 2JS2A 1M1KU 2O9SA 1BK2A 2VXFA 2H8HA 2OTJA 1TH7A 2DETA 2D1XA 1A0NB 4FW2A 1YP5A 4M78A 1MMGA 4MZTA 7AT1B 4ME7A 3THKA 1ARKA 3G71A 1QQJA 1BI0A 3H41A 1K9MU 1BIAA 2KXDA 4J9IA 3M4GA 5DLOA 3JRZA 1ZLMA 3WVDB 2RD1A 2LCSA 4WTOB 4HVWA 3OYCA 4KH0B 1WXBA 1VQPQ 1B34A 2QQAA 2C06A 2VASA 3CCJA 3MEVA 1VQ5T 2R57A 3CCMA 1YWOA 1QVFP 1UB4A 2E41A 1D3BA 3G1JA 1VOMA 1X6OA 2LVMA 5GAOp 1GCQA 5KYXA 4XK8E 4IUVA 2FPFA 3VS7A 4M7DD 4JZ4A 4OMOA 1D09B 3CC7Q 2LNHB 1AZEA 3QDFA 1U06A 4ANJA 3SD4A 1Q95G 2W0ZA 1N6AA 2CZ6B 1VQ8Q 2DXTA 2PQWA 4IIMA 2C0TA 2ZPFB 2HMAA 2DILA 2NUTA 3S3MA 1D1CA 1M27C 2KGTA 4J7FA 1X6GA 3CCUT 5GANh 3M56A 4FW1A 5J26A 2GF7A 5KYWA 1NLPC 1G5VA 1YHQQ 2RHYA 2RJFA 4JPBW 4M7AE 2P4RA 1QVGS 2ATCB 4XTUA 1HD3A 3EFOB 1SRMA 2EBPA 4M7AG 3OB9A 2DFUA 1G3TA 1UUEA 3QYGB 5IAYA 1G83A 1JRIA 3MO8A 4J9HA 5LJ3h 4LUDA 2JTEA 5GAN6 4AFQC 4ZTJA 4RTVA 2ABLA 5CQYA 2GQVA 3V7SA 4QW2A 2DERA 5IHIA 2YDLA 4IUPA 2FPDA 2D0NA 4ZGDB 1FXXA 1ZSZC 4NL3A 3VV0A 3LWHA 3FB9A 4XAXB 3ZBDA 3EGDB 4HKEA 1OQKA 2RNAA 4MMLA 2KT1A 3RBBB 1YJNA 2G3RA 2QYZA 2W10A 1OULA 4JRQA 4M7AC 2E4HA 3LYIA 4N0AC 3S6WA 2LNVA 3A8OB 1K8AR 5GANg 5GANf 2COWA 2J06A 1T0HA 4FYYB 1VQPT 3J81E 1M1GA 4PJOA 2ENMA 4J9GA 2DL5A 2E3HA 4FT2A 2EWNA 5DY9A 4XU0A 5GAMe 1TSFA 2DIQA 3OQ5A 3CCLA 4E6RA 2RF0A 3OSSC 5LJ3f 5CKDA 4DA4A 2FPEA 2JT4A 3HSBA 1BYMA 3A1PA 1M2VA 3PNWC 2LCLA 4LD6A 4JS5A 2VXEA 3CC7T 1S72A 5FWBA 4RCCA 2OAWA 2QG9B 3SB2A 2KRSA 2ZPBB 1VQ8T 2YT6A 2DD5A 3HP9A 1M3AA 1QCFA 1SSHA 3OYBA 4D6WA 4QQGA 1RI9A 1OU8A 1IHWA 2CP6A 4C8QB 2FVUA 3G71Q 2EYQA 2WSEE 4EMKB 2GNCA 3VS0A 1W4SA 2B8AA 5CIUA 3EH1A 1YHQT 2C0OA 2DZCA 2A0FB 1LPLA 3MCAB 5GMKm 3OY9A 3X24B 1V76A 2R5MA 3C95A 1I5LA 2DBKA 5D6YA 3QZ9B 3OYMA 3CCMQ 2AKKA 1KHIA 1GBQA 2OX7A 5GMKl 3HRTA 1LJOA 1VQ5A 3FC3A 1VYTA 1KD1U 4CC7A 3QUIA 1QVGA 4A54A 2CUDA 2BE7D 3ASKA 4E7SA 2QEXA 2D0QB 5I11A 4M7DA 1FYNA 4JRIA 2QDYB 4M7AD 5GANd 4BDZA 1K0XA 4PFZA 1YCSB 1VQ4A 2L3RA 2KK4A 2KVQG 2CKKA 4OVAA 2RHXA 3O8VA 2VUBA 1QP3A 1GL5A 4JJNK 1VQKT 2EGEA 4XTVA 2L3QA 4OGEA 2LQWA 5IXFA 4FM4B 1D0ZA 4GLMA 5GAN2 2MWPA 3G7ZA 4CRIA 2X4XA 5LJ3d 1RADB 1IGQA 2QAZA 1YJWQ 4BDYA 2AHJB 5GAN8 2E65A 1VA7A 2KSSA 4M77F 2RO0A 1TG0A 1WXTA 5CQXA 2C0IA 1FMKA 3OW2S 3I55Q 2K6DA 1G3YA 2RPNA 3JB9G 2XHCA 1HK9A 4J8OA 4QKUA 2BZXA 2IG0A 3C12A 4F14A 2WACA 3X28B 4OMNA 2EPDA 1RABB 1QMCA 1EX4A 1UGQB 1Q86U 3H0HA 3HRSA 3UA6A 2GGRA 1BI1A 2AIRB 4IKFA 3PIPA 3OYFA 5I22A 1WJQA 3VJPA 3I9QA 2DM1A 3G71T 2DLPA 1MGQA 1R8OB 4C92F 1ZUUA 3OMCA 3Q1JA 3CC4A 2RI3A 2HQEA 5KCOA 4JS4A 5CKBA 3NFCA 4PJOG 4C8QE 2DF6A 2LT1A 3EFSA 1OPKA 3H8ZA 5FLXE 4BE1A 4IUTA 4UC4A 5M9OA 4ZNXA 3VS2A 5GANj 3PVQA 1Y96B 1YFNA 3CXCS 2Y4YA 4F7UB 1N8RU 1OI1A 1WXUA 4Z8AA 3CCMT 3X20B 2LP5A 3P8HA 4M75F 3ZFJA 1H641 2HBPA 2CH4A 2JMAA 1IO6A 1XJWB 1VQPA 3KFVA 4E7IA 3CCLQ 2HQXA 1JEGA 2RMOA 1I8FA 4J7IA 1ZUKA 3VS3A 3JCMP 2DTHA 3CD6A 5LJ3j 2E5QA 4LDWA 3NPFA 4PJOC 1KQSS 2DMOA 1NM7A 3X26B 4OP0A 2MWOA 1AWWA 1W2BS 3M0QA 2EQJA 2RH2A 2DK3A 4EMKC 3C0CA 2R5AA 1R0CB 4C0FA 3LX7A 2J6FA 4PJJA 2QI2A 3A8MB 5IH2A 2DXBA 1WX6A 4DOVA 2AZVA 2HAXA 1JJ2P 1GXIE 5EG2A 5GAOq 1VQ8A 1YJWT 1TUGB 3HTRA 2KYMA 3JCMV 2SEMA 4FSXA 2K4YA 1WIEA 5IN1A 2ESWA 3EG9B 4LN2A 4F17A 5HCKA 5FU6B 2DL3A 1Y7XA 3MPUB 3I55T 2GTJA 2VGMA 4C0GA 3P8BB 5DLQE 1FMVA 1MV0B 1YHQA 4KH1B 3OS2A 1U5SA 2FL7A 2LC4A 2PZ1A 1ZSZA 1N5ZA 3QHSA 4X9DA 4C0DB 2QA4Q 4M7DG 2JJ9A 4QVCA 2BUDA 4L5GA 2WSCE 2LJ1A 3EHRA 5HK3A 1YWPA 2XDPA 2LQKA 3OW2A 4M7AA 3QSUA 3JSCA 4N0AA 1G8XA 5L23A 2QEXQ 1NPPA 1MV3A 2DZ9A 3RESA 2EFIA 1PHTA 2EAYA 3CPWS 4B9XA 1NBEB 2YRVA 1VQ4Q 1KK7A 2ED0A 1WQ7A 5GAN3 4O6JA 1K8AC 1GFDA 1Y57A 1FX7A 1F1BB 3TQ7P 2WSFE 4EIKA 2QGGA 3I5SA 1OOTA
chains in the Genus database with same CATH topology
2JTMA 3SD4A 5DM7R 1YJ9A 1N6AA 1VQOT 2CZ7B 4B9WA 2CZ6B 3NTHA 5GAMf 5GAMg 3JB9H 2LTOA 4C8QG 4M7DC 4PJOB 2K57A 2DXTA 2PQWA 4ZN3A 2KQWA 2JN0A 2LT4A 4N4GA 2PUKB 2ZPFB 3E19A 3LGLA 2RK2A 5C6SA 3DB4A 2X4JA 2HD0A 2O01E 3S3MA 4E7HA 1O9SA 3TEEA 5I2SA 3CCLT 4J7FA 4X34A 4MDWA 1K9MC 3QBYA 2E64A 4ZGJB 4JLIA 1Y71A 3H6ZA 3L2QA 3CCUT 5FRMA 5GANh 1VIEA 2EJFA 3M56A 4VUBA 4F7UE 4GY5A 4PJOD 1XTDA 3JCMJ 2RA2A 5J26A 4LDVA 3T9NA 1V29B 2GF7A 3E9GA 4DOWA 4F7UG 3KXTA 3CBOA 1G5VA 2CGHA 4M78C 3VUBA 4C8QD 3M57A 2RHIA 4BY6B 3UWNA 2RHYA 2RJFA 4M77B 3CXCA 4M7AE 3M58A 1QVGS 5GAOn 4FU6A 3JCMX 4XTUA 3OYNA 3JCMW 1ZHIA 2EQKA 3GOXA 4M7AG 3OB9A 1G3TA 4J6YA 3QYGB 3RKYA 5IAYA 3G4SA 2XIDA 3FLGA 4M78F 2MMPA 2DXCA 4A53A 4HCBA 4BE0A 4PNOA 5FROA 3CCET 4C8QC 1JRIA 3L2ZA 3MO8A 4BI4A 5LJ3h 4N4IA 3A5ZB 4PLLA 1N9SA 3BW1A 4R56A 4BI3A 4XQ3A 5CKEA 5GAN6 4BD3A 2K3YA 4ZTJA 2XG8D 5IT9E 1G3SA 3C94A 3BDLA 5CQYA 2GQVA 3V7SA 1M9SA 4P5NA 2BKDN 4QW2A 1VQ9A 2QQ9A 3GLXA 2P4TA 2RM4A 1RI0A 3QYHB 4IUPA 5HK0A 4XU2A 3OBWA 4ZGDB 1KQSA 1FXXA 3HHTB 3JCMe 4NL3A 1XNIA 1KHCA 2O4XA 3VV0A 5A2QE 4BI8B 3LWHA 3FB9A 1M8VA 3WVEB 4XAXB 3LH0A 3ZBDA 4Z02A 3A8LB 4HKEA 4XTWA 1W2BA 3QXEB 5KCHA 2XU8A 2X35A 4L6V5 2DEQA 2V8JA 2VV5A 4MMLA 2OTLT 1YJNA 2G3RA 2DPPB 3JCMd 4A4FA 1ZBXA 5CVIA 4C92B 1O75A 3BY7A 3L2UA 4JRQA 4M7AC 3I56T 1RL2A 2PVOB 3LYIA 3M59A 4N0AC 1NJIU 4FL6A 1NE8A 3FDRA 3S6WA 4F7UF 5LJ5h 4OMFB 2Y4XA 4A4EA 2LNVA 3A8OB 4C5IA 3CCSA 4RMOA 3GP8A 5GANg 5GANf 5FRNA 3DLMA 1QVPA 1N27A 4IUUA 3QJ6A 5AYFA 1M4ZA 5CK9A 3OS0A 2NLUA 2XICA 5GMKe 3J81E 3DKMA 1VQPT 3GIBA 3M4YA 1M1GA 3URGA 2YLCA 1VQOA 4M7AF 3V7CA 2D6FA 4PJOA 2YLBA 2QA4T 1VQNT 2GFUA 2MI6A 4FT2A 4KULA 3A8HB 3WXMB 2EWNA 4Y91A 5HKCA 5DY9A 4ELZC 4MZPA 3KBGA 2ZPEB 4XU0A 3QKJA 5GAMe 2DIQA 2PVDB 3MP8A 3OQ5A 3CCLA 1HXDA 4M75B 1WPYA 2QEXT 3CCUA 3HRUA 3HL8A 4M7DB 4TVRA 4LDYA 3OSSC 3INZA 3SWNB 4HCCA 2I2LA 3QZ5B 4J6XA 2ZPGB 4DQ2A 2M0OA 5LJ3f 3JCMc 1VQ4T 5CKDA 3M55A 5L8RE 4DA4A 3HSBA 4ZGEB 2ZZDA 5GAMd 1X01A 1BYMA 5GAOm 3PNWC 1QW1A 2E70A 3HFOA 4M77A 2VYTA 1UGPB 3E1SA 2LCLA 4QQDA 3V8KA 3L1AA 4LD6A 2K5IA 4JS5A 1WJSA 1YBYA 3GNFB 1XOVA 3V8JA 2VXEA 3OYEA 2K5LA 1VQ7T 2P0PA 1S72A 1VUBA 3CC7T 1OZ3A 4RCCA 2OTJT 5HY6A 2V8KA 1WQWA 2FB7A 1M5Q1 3SB2A 1Q81C 3A8GB 2ZPBB 1U1SA 1VQ8T 5FU6C 2IVWA 5GAOl 2DD5A 2QXFA 5GAN5 3VKIA 2XI9A 3HP9A 1BI2A 3OYBA 2RJDA 4C0ZA 3MEUA 4QQGA 4D6WA 1VQMT 4E7LA 3CPWA 2JOYA 4HT8A 2DKGA 1Y07A 5LJ5g 4C8QB 4IUQA 5LJ5f 1YI2T 2ZPIB 2FVUA 4M78D 4JUVA 2EYQA 2WSEE 4PJOE 3CC2T 4JDSA 2EQUA 4EMKB 3CEYA 3QDRB 1YJWA 1W4SA 4C0DC 2B8AA 5CIUA 1QP2A 2MAMA 1YHQT 1G3WA 2K2VA 2E10A 2A7YA 4E7KA 2OTLA 3ME9A 2DZCA 3RMSA 4E47A 3UDCA 2RHZA 4KUIA 4C92A 3OYGA 3S3OA 2P0QA 3CBPA 3MCAB 3QIIA 4FIBA 3I56A 5GMKm 4A4KA 3JB9F 3OY9A 2KDSA 3X24B 3CCJT 3I55A 2R5MA 3C95A 4BACA 2L8DA 1M90U 2JTFA 2VGNA 3M9QA 5FU7B 1I5LA 1I4K1 3RERA 2RJCA 1KG1A 4J5YA 4M77E 4PL6A 5D6YA 3QZ9B 3OYMA 3AHUA 4J83A 1JJ2S 1KHIA 2EKOA 3ZEHA 4M77G 3G6ET 4EMHA 5GMKl 2F5KA 1OYXA 3HRTA 5J39A 2LRQA 5GANe 5KE3A 2E12A 1LJOA 4RG8A 3VYGA 4QQ6A 1VQ5A 3PTAA 3FC3A 1KD1U 3QUIA 3MP6A 3RIRA 4C5GA 2E6ZA 2M9UA 4A54A 1QVGA 3PMTA 4RG2A 3ASKA 3VU3C 4M75A 3RMQA 3CC4T 2QEXA 2D0QB 4QVZA 4M7DA 3OYDA 4V2SA 4JRIA 3SWNA 1U8RA 2M1HA 2QDYB 1KC8U 4M7AD 5GANd 3JB9J 4BDZA 3EFRA 2D9TA 2V8IA 1SSFA 1VQ4A 1YITA 2L3RA 4Q5WA 2KAFA 2RI2A 3N5BB 2QQRA 5GMKj 3DB3A 1YCYA 1K73U 4BB7A 3EAEA 2KK4A 1YJ9T 3CCRT 2CZ1B 2KVQG 1K8AU 1Q82U 2CKKA 4OVAA 2RHXA 3FEOA 4A4HA 3O8VA 5LJ3e 1VQ7A 2VUBA 4HT9A 2JUFA 1LNXA 1QP3A 3QG1A 4ZN1A 3JCMb 2DTIA 3GPLA 3NTKA 3CC7A 4YTLA 3C4SA 4JJNK 1VQKT 4XTVA 3OYYA 4QVDA 1XQHA 3F70A 4OGEA 5GAMj 2F69A 5GAN7 4OF1A 1WNLA 4C92E 4FM4B 4M77C 2XDBA 5GAN2 3JB9I 2MWPA 3G7ZA 4CRIA 4E7JA 2X4XA 3QJYA 2EIFA 3FJPA 5LJ3d 5CCAA 4LD9K 4C92G 4OB0B 1ZQ1A 4IURA 1QVFS 3CCQT 1FWZA 3LWIA 4BDYA 4JRKA 5C0MA 2PUOB 2AHJB 5GAN8 2E65A 2JNGA 3PMIA 3TU4K 2KSSA 4C8QA 4M77F 1YI2A 2RO0A 2HNIA 4OB2B 4CI0C 3CD6T 3PIOA 3V8LA 3DLLA 3SFMA 2K5FA 5CQXA 3OYJA 3CC2A 4EMKA 3J7AF 2ZCFB 5I2MA 4BUGA 5KE2A 2DTOA 3LGFA 1PSEA 3TREA 4XTXA 5D6XA 3CBMA 3MEWA 2ZPHB 3OW2S 1M90C 4KBMB 5LJ5e 3J80E 3OYAA 5LJ3g 1G3YA 4EMGA 4OGCA 5KH6A 3JB9G 2Y90A 2XHCA 4M75E 4ELYC 3L2VA 2EJGA 4X9CA 5GAOr 1HK9A 1NPRA 4J8OA 4LDUA 4LDXA 4O5VA 4M7DE 4JLGA 1OZ2A 4JRPA 3BDUA 3OBYA 4J6WA 2IG0A 1WJRA 2JVVA 2WACA 2A3LA 3C12A 4M75G 3X28B 3E9FA 5LJ5d 2DVEA 1EIFA 1VQ9T 2YHTA 2X4YA 2L5QA 4L59A 1UGQB 1WGSA 3GF5A 3LLRA 5D6WA 1Q86U 3HRSA 3S3NA 1KD1C 4M78B 4C92C 3CCEA 1BI1A 3FRNA 4IKFA 3PIPA 1VQLT 3OS1A 2XKOC 5LL6S 3OYFA 1WJQA 2L89A 2R58A 3M54A 4XU1A 2JZ2A 3G6EA 1KC8C 3VJPA 4RCBA 3JB9D 2GFAA 4KT0E 4NOYA 3OYIA 2KMTA 3GNGA 3G71T 1YJNT 1MGQA 2FYKA 4Y28E 2FHDA 1R8OB 4C92F 4EDUA 1K73C 2K3XA 2DO3A 3CCVT 1VQ6T 3OMCA 3CMAT 3Q1JA 3CC4A 2RI3A 2PVGB 4XTYA 1N9RA 1Q82C 2HQEA 5KCOA 2E6NA 2LQ8A 4JS4A 3X25B 1NZ9A 5CKBA 2MF2A 3CCST 3NFCA 4HA8A 4C5HA 1NJIC 2PU9B 4PJOG 3PFSA 4C8QE 3HKSA 5CAIA 2LT1A 3EFSA 2ZGWA 1KQ1A 3H8ZA 2KY9A 4M75C 5CKHA 3CCRA 5FLXE 4BE1A 4IUTA 2XK0A 3SWNC 4UC4A 5M9OA 5CR2A 2OAUA 5GANj 1B34B 3ER0A 1JB0E 1Y96B 3CXCS 1IREB 2Y4YA 3MP1A 3RKWA 3META 4F7UB 1Q7YU 4NS5A 1N8RU 1PSFA 4MZMA 1VQKA 1OI1A 1VIFA 1UEBA 3CMET 3CCMT 1UGRB 1M1FA 4WF2A 3X20B 3P8HA 2CYZB 4M75F 1H641 3ZFJA 3LW5E 2HBPA 3TCJA 2XD0A 4M7DF 3QPHA 4ZTFA 2DIGA 3CPFA 1VQPA 2RHUA 4M7AB 5GAN4 4E7IA 2QQBA 1D3BB 2EQMA 3CCQA 2QA4A 2HQXA 1I8FA 4J7IA 3JCMP 3JCMh 1X75C 3P8DA 2DTHA 3CD6A 2F5TX 5LJ3j 2VC8A 2E5QA 3OSVA 4LDWA 1S72T 4PJOC 2RI5A 1AHJB 1KQSS 4II1A 1MHNA 3X26B 3L2WA 2DXUA 4OP0A 2MWOA 2BIVA 3RKXA 3HFNA 2LDMA 5J3BA 2CS7A 4KUDK 3PGGA 1W2BS 1JJ2A 1YIJT 1Q86C 2EQJA 2RH2A 3FIFA 4M77D 2DK3A 2H3JA 2LX9A 4EMKC 1M1KU 4PJOF 4A4GA 2R5AA 2VXFA 3MHXA 2LCCA 3LX7A 3OS5A 4C0FA 1BKBA 2QI2A 1U1TA 5I21A 5A0DA 3R6OA 1KQ2A 1Q81U 3L2RA 3A8MB 3JAME 2OTJA 1TH7A 4C8QF 3UPUA 5GMKh 2P0KA 2XDDA 3OA6A 3VYHB 2DXBA 4DOVA 2HAXA 4M78A 1GXIE 4BY6C 5EG2A 3OYKA 5GAOq 1VQ8A 1YJWT 1VQLA 3HPWA 3PT9A 4MZTA 3OYHA 4ME7A 5LJ5j 3RUXA 3JCMV 4GLKA 5FU7C 2RK1A 4FSXA 5A0LA 1VQMA 3NTIA 4OB3B 2K4YA 3G71A 5GAMh 1BIBA 5IN1A 1BI0A 3OYLA 1VQ6A 4NL2A 2DJZA 3CCVA 3OMGA 4HCZA 3CMAA 1K9MU 1H3ZA 1BIAA 5FU6B 4C5EA 3KUFA 2DD4A 1Y7XA 2RJEA 3I55T 3M4GA 3QO3A 5DLOA 2DAQA 2VGMA 5GMKi 1DJ7B 3JRZA 4C0GA 3P8BB 1Q7YC 1N8RC 5DLQE 3WVDB 2RD1A 3G4ST 3JCMQ 1YHQA 2QTXA 2X4WA 1IZ6A 3OYCA 4MDXA 3OS2A 1QVFA 2FL7A 2LC4A 4C92D 2GCXA 2CZ0B 1P92A 4OB1B 3BFMA 3JCMf 1B34A 2QQAA 1Y96A 3QHSA 4X9DA 1LOJA 3JCMg 2C06A 3CCJA 3MEVA 4C0DB 2R57A 4F7UA 1VQ5T 1VQNA 4M7DG 2EJ9A 4PKCC 4QVCA 2BUDA 3CMEA 3CCMA 4BE2A 4L5GA 2WSCE 5CKFA 1UGSB 4XTZA 5HK3A 2XDPA 2LQKA 2O4XB 3L42A 3OW2A 3V7RA 1UB4A 3QSUA 4M7AA 2QQSA 2E41A 1D3BA 3JSCA 4N0AA 3UT1A 4R55A 4PLIA 4XU3A 3VUZA 1NPPA 1YITT 4ATOA 1I81A 2DZ9A 1X6OA 2M16A 2LVMA 2EFIA 3RESA 4M78E 5GAOp 3M53A 2EAYA 3CPWS 4B9XA 2YRVA 3M5AA 4MMKA 4XK8E 4IUVA 1WQ7A 1JBMA 4M75D 5GAN3 4O6JA 4M78G 5A0GA 4M7DD 1M1KC 1K8AC 2E1HA 1FX7A 3MEAA 5CO7A 2WSFE 4FT4A 1BI3A 4RKUE 3SDZA 4N4HA 1YIJA 2RB6A 4EPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTA A;  4JJN K;  4KUI A;  4DOV A;  1M4Z A;  4DA4 A;  1ZHI A;  4LD9 K;  3PT9 A;  2FL7 A;  2FVU A;  4FSX A;  4KUD K;  4FT2 A;  4KUL A;  4BB7 A;  3TU4 K;  1W4S A;  4FT4 A;  1ZBX A;  4DOW A; 
#chains in the Genus database with same CATH topology
 3NTH A;  4M7D C;  2J7I A;  3LGL A;  2HD0 A;  2O01 E;  2CT4 A;  4E7H A;  1B07 A;  1O9S A;  3TEE A;  3CCL T;  2JM8 A;  2KR3 A;  2RQT A;  4JLI A;  3H6Z A;  4F7U E;  4PJO D;  2RA2 A;  1E6G A;  3E9G A;  4F7U G;  3CBO A;  2CGH A;  4C8Q D;  3M57 A;  4BY6 B;  3CXC A;  2V1R A;  4FU6 A;  3JCM X;  1BBZ A;  3MKD A;  1ZHI A;  3EHQ A;  3OYN A;  3GOX A;  4RTU A;  2L3P A;  3E2U A;  2KEA A;  3G4S A;  3FLG A;  4M78 F;  2VB6 A;  2DXC A;  3L2Z A;  4J9C A;  4BI4 A;  1Q7Y R;  1NEG A;  4XQ3 A;  5CKE A;  1WZO A;  4RTY A;  2NWM A;  2BKD N;  1PWT A;  4OML A;  1BCO A;  2LX7 A;  1NLO C;  2QQ9 A;  5HK0 A;  2O2O A;  4OMM A;  3EGU A;  1KQS A;  2YSQ A;  4BI8 B;  3CC4 Q;  3GBQ A;  1W2B A;  4JZ3 A;  5KCH A;  2XU8 A;  4L6V 5;  4KGX B;  1RAH B;  3BY7 A;  2PVO B;  4FL6 A;  1NE8 A;  3FDR A;  5LJ5 h;  2Y4X A;  1SF9 A;  3GP8 A;  1M1K R;  5FRN A;  3DLM A;  1QVP A;  2J6O A;  4HXJ A;  3DKM A;  2YLC A;  1VQO A;  2HL3 A;  2D6F A;  2YLB A;  2QA4 T;  2J6K A;  2PNI A;  2GFU A;  2EYW A;  2KBT A;  5HKC A;  4Y91 A;  4MZP A;  3QKJ A;  1UG1 A;  1HYO A;  2QEX T;  2A08 A;  4TVR A;  4HCC A;  3CD6 Q;  3QZ5 B;  1K9M R;  2M0O A;  1H3H A;  3JCM c;  1VQ4 T;  1RAG B;  2DL4 A;  2ZZD A;  3HFO A;  2DX1 A;  4QQD A;  4HVV A;  3L1A A;  3NMZ C;  4JJB A;  3V8K A;  1YBY A;  3V8J A;  3GNF B;  3OYE A;  3EFO A;  2K7A A;  1VUB A;  3LH5 A;  2V8K A;  1WQW A;  2FB7 A;  2BZ8 A;  1VQ9 Q;  2FEI A;  5FU6 C;  6AT1 B;  1UHC A;  3I35 A;  3MEU A;  5KYY B;  1UEC A;  1SHG A;  3TSW A;  3CPW A;  1M2O A;  4HT8 A;  1QKX A;  1ABO A;  1PCX A;  2AKL A;  5LJ5 g;  5LJ5 f;  1R77 A;  5KYU B;  2CP7 A;  2X3X D;  3CEY A;  1S1N A;  1YJW A;  3EGD A;  4C0D C;  1QP2 A;  2MAM A;  2A7Y A;  1D1B A;  3CCS Q;  2NYS A;  3OYG A;  4FIB A;  3I56 A;  4A4K A;  3JB9 F;  2KDS A;  4RUG A;  3I55 A;  1M90 U;  2L8D A;  1Y0M A;  2VGN A;  5FU7 B;  2RQW A;  1I4K 1;  3EG3 A;  3RER A;  2RJC A;  4J5Y A;  1TOV A;  4PL6 A;  4CC4 B;  4FYX B;  2EKO A;  3ZEH A;  1UGV A;  2F5K A;  5J39 A;  5GAN e;  5KE3 A;  3CQT A;  3VYG A;  4QQ6 A;  2DL7 A;  3U23 A;  2HZY A;  3RIR A;  2EQI A;  3MP6 A;  2M9U A;  4ORZ A;  4RG2 A;  3RMQ A;  3CC4 T;  1U8R A;  3VS4 A;  1KC8 U;  1SPK A;  2DJQ A;  2V8I A;  4OMP A;  1SSF A;  4RTZ A;  4Q5W A;  1X27 A;  3DB3 A;  1E6H A;  1YCY A;  1K73 U;  3RNJ A;  1QVG P;  2CZ1 B;  1K8A U;  2DVJ A;  1Q82 U;  5LJ3 e;  1VQ7 A;  4ZN1 A;  3GPL A;  4FSS A;  1RAC B;  3VRZ A;  3OYY A;  4QVD A;  1XQH A;  4OMQ A;  1WNL A;  2XDB A;  2KRN A;  3QJY A;  3FJP A;  5CCA A;  4LD9 K;  1Q81 R;  2RQU A;  1ZQ1 A;  4IUR A;  2V1Q A;  2I0N A;  2YRC A;  3LWI A;  4JRK A;  4AMC A;  1SKU B;  5C0M A;  2PUO B;  4D8K A;  1W6X A;  4C8Q A;  1YI2 A;  1CSK A;  2FZC B;  2HNI A;  4CI0 C;  3CD6 T;  3PIO A;  3IQL A;  2K5F A;  3OYJ A;  3M0U A;  4EMK A;  4DBQ A;  5KE2 A;  3LGF A;  2ZPH B;  1GRI A;  1B7T A;  5LJ3 g;  3NHN A;  2HSE B;  5KH6 A;  2Y90 A;  2EJG A;  5GAO r;  3G4S Q;  4O5V A;  2YXY A;  4JRP A;  4CC2 A;  5LJ5 d;  1VQ9 T;  2ZAE A;  2YHT A;  2X4Y A;  1EZZ B;  1GBR A;  1ACM B;  5D6W A;  1M3B A;  2EKH A;  3FRN A;  3M0R A;  2L89 A;  8AT1 B;  2KI7 A;  4XU1 A;  2EGC A;  4KT0 E;  1PRL C;  2KMT A;  3H0F A;  1SHF A;  4PK4 A;  1YIT Q;  4Y28 E;  1ABQ A;  4EDU A;  2DO3 A;  2PVG B;  1N9R A;  1QKW A;  2KT8 A;  1MUZ A;  2LQ8 A;  3X25 B;  1WI7 A;  1NZ9 A;  2YWW A;  3CCS T;  4HA8 A;  3TSZ A;  3PFS A;  2BZY A;  1T3S A;  1SEM A;  3M0T A;  3CCR A;  5CKH A;  3RDV A;  2XK0 A;  5CR2 A;  2CUB A;  1UDL A;  2OAU A;  2EYY A;  1IRE B;  3RKW A;  1VQO Q;  1CKA A;  4MZM A;  1UEB A;  2PTK A;  2CYZ B;  3TCJ A;  4M7D F;  2DIG A;  2QQB A;  2NUP A;  4R0K A;  2QA4 A;  1UTI A;  2DE0 X;  3JCM h;  2F5T X;  1KFZ A;  3OSV A;  1OX9 A;  1RLP C;  1VYU A;  1AHJ B;  4KGV B;  2L3S A;  1OEB A;  2CH4 W;  2FZG B;  3HFN A;  2LDM A;  5J3B A;  4KUD K;  3UAT A;  1AT1 B;  4RTT A;  3CCE Q;  4A4G A;  3OS5 A;  5I21 A;  5A0D A;  3R6O A;  1KQ2 A;  3L2R A;  3UPU A;  5GMK h;  1PC0 A;  1RAE B;  2P0K A;  2XDD A;  3VS5 A;  3OYK A;  1NEB A;  3HPW A;  1E7O A;  3OYH A;  1ZA1 B;  5LJ5 j;  5FU7 C;  2NUP B;  5A0L A;  4J9B A;  1BIB A;  3OYL A;  3CCV A;  1T0J A;  3OMG A;  3CMA A;  1H3Z A;  4ESR A;  4C5E A;  2RJE A;  3QO3 A;  1QCO A;  2M02 A;  5GMK i;  3I56 Q;  1Q7Y C;  4WCI A;  3G4S T;  1KIK A;  1IZ6 A;  1NJI R;  4MDX A;  2GCX A;  1YN8 A;  4PFO A;  3BFM A;  3JCM f;  3JCM g;  1Y96 A;  1VQN A;  4F7U A;  4RTX A;  2EJ9 A;  4BE2 A;  1AOJ A;  1R0B G;  5CKF A;  1UGS B;  4XTZ A;  1MND A;  2HQH A;  2O4X B;  3L42 A;  2ROT A;  1I07 A;  3VS1 A;  2EW3 A;  4XU3 A;  3VUZ A;  1YIT T;  4ATO A;  1WLP B;  1I1J A;  1I81 A;  5IHK A;  3M53 A;  4MMK A;  1JBM A;  2CT3 A;  5A0G A;  1M1K C;  4J9F A;  2E1H A;  3OW2 P;  2EVR A;  4FT4 A;  1VQ7 Q;  1BI3 A;  3EGX B;  2COZ A;  3SDZ A;  2RB6 A;  4EPC A;  1VQO T;  2CZ7 B;  3JB9 H;  2LTO A;  4C8Q G;  1Q86 R;  4ZN3 A;  2KQW A;  2JN0 A;  2PUK B;  5C6S A;  3DB4 A;  2CSQ A;  2X4J A;  1VQM Q;  5EC7 A;  1AZG B;  1RAA B;  1K9M C;  3QBY A;  3JV3 A;  3L2Q A;  5FRM A;  1YI2 Q;  2EGA A;  2EJF A;  3UF4 A;  4GY5 A;  1XTD A;  3JCM J;  1H92 A;  2QDL A;  3EG9 A;  1X2K A;  3VUB A;  4AT1 B;  2LJ3 A;  4M77 B;  4FYW B;  5GAO n;  3JCM W;  2EQK A;  4B6M A;  3RKY A;  2XID A;  1K1Z A;  2MMP A;  2SRC A;  4PNO A;  5FRO A;  3CCE T;  4C8Q C;  1N8R R;  4FCY A;  3CXC P;  4BD3 A;  2V26 A;  2XG8 D;  1M9S A;  1PKS A;  1WDX A;  1VQ9 A;  2RM4 A;  1RI0 A;  3QYH B;  4XU2 A;  3HHT B;  5A2Q E;  1KHC A;  1M8V A;  3LH0 A;  3A8L B;  4AG2 C;  3QXE B;  2X35 A;  2DEQ A;  1TUC A;  1TTH B;  2V8J A;  1SRL A;  1EFN A;  2DPP B;  3JCM d;  4A4F A;  1YIJ Q;  5CVI A;  4C92 B;  1O75 A;  1C0M A;  2CSI A;  3I56 T;  1KQS P;  1YJ9 Q;  2RQV A;  3M59 A;  3CCR Q;  4QT7 A;  3CCS A;  4RMO A;  1W2B P;  1G2B A;  1N27 A;  5AYF A;  1M4Z A;  3OS0 A;  2XIC A;  1WYX A;  4M7A F;  3URG A;  3V7C A;  4PJM A;  4KRT A;  1JO8 A;  2MI6 A;  3A8H B;  5ECA A;  1RAI B;  3WXM B;  1AWJ A;  1HSQ A;  3RR6 A;  4ELZ C;  3KBG A;  2ZPE B;  2RQR A;  2PVD B;  3MP8 A;  4M75 B;  2HBW A;  3HL8 A;  1BB9 A;  3SWN B;  3INZ A;  1FMW A;  2I2L A;  5GJW B;  2ZPG B;  3M55 A;  5L8R E;  1X01 A;  1Z9Q A;  1MMN A;  2VYT A;  3E1S A;  2K5I A;  2FO0 A;  1VQ7 T;  2P0P A;  1OZ3 A;  4JJD A;  5HY6 A;  3EG1 A;  1M5Q 1;  1Q81 C;  2MK5 A;  1U1S A;  2IVW A;  2QXF A;  4AFZ C;  5GAN 5;  3VKI A;  5FW9 A;  1BI2 A;  1H8K A;  4RTW A;  4C0Z A;  1VQM T;  2VKN A;  1PKT A;  2ROL A;  1YI2 T;  3NGP A;  2KE9 A;  2K9G A;  4JDS A;  5AT1 B;  3CCV Q;  3QDR B;  4LUE A;  3CMA Q;  3ULR B;  1G3W A;  2K2V A;  2E10 A;  3CPW P;  2OTL A;  1PRM C;  3ME9 A;  3RMS A;  3TVT A;  3UDC A;  4KUI A;  3QII A;  2JTF A;  2F2X A;  1KG1 A;  1VQN Q;  2K2M A;  4M77 E;  2B86 A;  3AHU A;  3H0I A;  4M77 G;  4EMH A;  4Y92 A;  2LRQ A;  3I5R A;  4HVU A;  2LQN A;  4CC3 A;  3PTA A;  1PNJ A;  2OJ2 A;  1TUD A;  4C5G A;  2E6Z A;  1X2Q A;  2EYZ A;  3PMT A;  3VU3 C;  2DEU A;  2IIM A;  2KNB B;  4V2S A;  2HEQ A;  4GBQ A;  3JB9 J;  2X51 A;  3EFR A;  2YUO A;  1YIT A;  2KAF A;  1V1C A;  2RI2 A;  2QQR A;  5GMK j;  1YJ9 T;  3CCR T;  1U3O A;  3FEO A;  4HT9 A;  3REB B;  3C4S A;  3F70 A;  2F69 A;  1PD0 A;  2DYB A;  2MOX A;  4C92 E;  4M77 C;  3JB9 I;  4E7J A;  4DEX A;  4C92 G;  1QVF S;  1FWZ A;  5KYY A;  1LCK A;  2FRW A;  2JNG A;  3TU4 K;  3PMI A;  2HSP A;  5KYU A;  3V8L A;  3CC2 A;  4IIO A;  3J7A F;  2ZCF B;  5I2M A;  4BUG A;  2DTO A;  2DRM A;  1X69 A;  5D6X A;  3MEW A;  4KBM B;  5LJ5 e;  3J80 E;  2HDA A;  4F04 B;  4EMG A;  4OGC A;  8ATC B;  2CDT A;  3REA B;  4M75 E;  4LDX A;  1NYF A;  4LDU A;  3OBY A;  4J6W A;  3R6N A;  1WJR A;  2JVV A;  4M75 G;  2E3I A;  3E9F A;  2M51 A;  1EIF A;  4L59 A;  3LLR A;  2A28 A;  1KD1 C;  2COY A;  4M78 B;  4C92 C;  3CCE A;  1KSW A;  2HL5 C;  3G6E A;  2JZ2 A;  2K79 A;  4NOY A;  3OYI A;  2FYK A;  2FHD A;  3CCV T;  3FJ5 A;  3CMA T;  4XTY A;  3M0S A;  2MF2 A;  1NJI C;  2LZ6 B;  2PU9 B;  3SHW A;  1KQ1 A;  4M75 C;  2KY9 A;  1NG2 A;  3SWN C;  1B34 B;  1JB0 E;  2KXC A;  3MET A;  1VQN T;  1ZBJ A;  4NS5 A;  1VIF A;  1M1F A;  2XD0 A;  3QPH A;  2MYS A;  2RHU A;  5GAN 4;  1D3B B;  2EQM A;  3CCQ A;  2DA9 A;  2AT1 B;  1X75 C;  1M30 A;  3P8D A;  5KYX B;  2VC8 A;  4II1 A;  2DXU A;  1LVK A;  1M90 R;  1Q86 C;  1B3Q A;  4M77 D;  2LX9 A;  4PJO F;  4F16 A;  1QLY A;  3MHX A;  2LCC A;  2QGF B;  1BKB A;  1U1T A;  1Q81 U;  3PVL A;  3JAM E;  3M0P A;  4C8Q F;  2NUT B;  4D8D A;  3OA6 A;  3VYH B;  1ZUY A;  4BY6 C;  1RLQ C;  9ATC B;  1VQL A;  3PT9 A;  3RUX A;  4GLK A;  2RK1 A;  1VQM A;  3NTI A;  4OB3 B;  5KYW B;  5GAM h;  1KC8 R;  1UJY A;  2CP5 A;  1UE9 A;  4NL2 A;  1VQ6 A;  2DJZ A;  4HCZ A;  4A63 B;  2OTL Q;  1D0X A;  3KUF A;  2DD4 A;  1ZA2 B;  4FYV B;  2G6F X;  1K73 R;  1IGU A;  2DAQ A;  1DJ7 B;  3O5Z A;  1Q82 R;  2AZS A;  2XMF A;  1N8R C;  1VQK Q;  3JCM Q;  2QTX A;  2X4W A;  3SEM A;  1QVF A;  1UJ0 A;  4C92 D;  2CZ0 B;  1P92 A;  4K11 A;  4OB1 B;  3VS6 A;  1LOJ A;  2JMC A;  4J9E A;  3BE3 A;  4PKC C;  3CME A;  3A98 A;  4Z89 A;  1PD1 A;  3V7R A;  2QQS A;  3UT1 A;  4R55 A;  2GQI A;  4PLI A;  2M16 A;  3QWY A;  4M78 E;  3M5A A;  1JXM A;  2BTT A;  2NUZ A;  4M75 D;  1NYG A;  4M78 G;  3MEA A;  4HCK A;  5CO7 A;  2DNU A;  4RKU E;  1GCP A;  2OTJ Q;  4N4H A;  2HKN A;  1YIJ A;  2ED1 A;  2JTM A;  2HCK A;  5DM7 R;  1J3T A;  5FWC A;  1YJ9 A;  4B9W A;  5GAM f;  5GAM g;  5KYN A;  4PJO B;  2K57 A;  2LT4 A;  4N4G A;  3E19 A;  2RK2 A;  3QWX X;  2H3E B;  4Z88 A;  2YUN A;  5I2S A;  4X34 A;  4MDW A;  1I0C A;  2E64 A;  4ZGJ B;  1Y71 A;  2X3W D;  2QK0 A;  1VIE A;  4VUB A;  1C6V X;  3CC2 Q;  4LDV A;  3T9N A;  1V29 B;  4DOW A;  1ZX6 A;  1X6B A;  3KXT A;  1IXD A;  1OV3 A;  4M78 C;  2RHI A;  1JXO A;  1M2V B;  3UWN A;  1W70 A;  3M58 A;  4JJC A;  2VWF A;  4LXC A;  1AD5 A;  3UA7 A;  4J6Y A;  3CCJ Q;  4PJL A;  2DRK A;  3EG2 A;  2L0A A;  2MPX C;  4DBR A;  4HCB A;  4A53 A;  4BE0 A;  4N4I A;  2L2P A;  3A5Z B;  4PLL A;  1N9S A;  3BW1 A;  4R56 A;  4BI3 A;  2K3Y A;  5IT9 E;  1D1A A;  1G3S A;  3BDL A;  3C94 A;  1K4U S;  4P5N A;  2QAS A;  3G6E Q;  3GLX A;  2P4T A;  3D7S B;  3OBW A;  3JCM e;  1XNI A;  2O4X A;  1AVZ C;  3WVE B;  4Z02 A;  2EYX A;  1OX8 A;  4KGZ B;  1KD1 R;  4XTW A;  1ZSG A;  2VV5 A;  2OTL T;  1TU0 B;  1WHH A;  1WA7 A;  5D7U A;  1ZBX A;  1SG5 A;  3L2U A;  1RL2 A;  1NJI U;  4F7U F;  4OMF B;  4A4E A;  2CP2 A;  4C5I A;  2GBQ A;  3EGX A;  1GCQ C;  3MJX A;  4IUU A;  3QJ6 A;  5CK9 A;  2NLU A;  5GMK e;  2VVK A;  3GIB A;  3M4Y A;  1VYV A;  2D8J A;  4KUL A;  4PJN A;  1UHF A;  1BCM A;  1TXQ A;  2M0Y A;  1JQQ A;  3CCQ Q;  1M3C A;  1HXD A;  1WPY A;  3CCU A;  3HRU A;  4X1V A;  4M7D B;  4LDY A;  4J6X A;  4DQ2 A;  2DYI A;  1MMD A;  1X43 A;  2LMJ A;  4DEY A;  4DBF A;  4ZGE B;  2X9H A;  2YRD A;  5GAM d;  5GAO m;  1WHM A;  1QW1 A;  2E70 A;  4AFS C;  4M77 A;  1UGP B;  2Z0W A;  1WJS A;  1XOV A;  1WHJ A;  2F1L A;  2FG0 A;  2K5L A;  2KRO A;  2OTJ T;  1AEY A;  3A8G B;  5GAO l;  2XI9 A;  4PFP A;  2RJD A;  1WHG A;  1RUW A;  3AT1 B;  1IB8 A;  4E7L A;  1VQL Q;  2JOY A;  2DKG A;  1C1A A;  1K0S A;  1Y07 A;  4IUQ A;  2ZPI B;  4M78 D;  1YJN Q;  4JUV A;  4PJO E;  3CC2 T;  1VQ6 Q;  2EQU A;  1UFF A;  4DBH A;  4E7K A;  4E47 A;  2RHZ A;  4J9D A;  4C92 A;  3S3O A;  2P0Q A;  3CBP A;  2YUP A;  2CRE A;  4LE9 A;  3CCJ T;  1BU1 A;  4BAC A;  3PE0 A;  3M9Q A;  1PG5 B;  3CME Q;  4J83 A;  1JJ2 S;  3G6E T;  1AWO A;  1IHV A;  1OYX A;  2E12 A;  4RG8 A;  1HJD A;  2O88 A;  2K3B A;  2HKQ B;  2YUQ A;  2AK5 A;  2FRY A;  4M75 A;  4QVZ A;  3OYD A;  3SWN A;  2M1H A;  2D9T A;  1S72 Q;  1AWX A;  3N5B B;  4BB7 A;  3EAE A;  1MNE A;  2MCN A;  1RAF B;  4AFU C;  1OU9 A;  1QWE A;  2JS0 A;  4A4H A;  1LNX A;  2JUF A;  3QG1 A;  3CC7 A;  3JCM b;  1CKB A;  2DTI A;  3NTK A;  4YTL A;  1TWB A;  2KRM A;  5GAM j;  5GAN 7;  4OF1 A;  1WHL A;  2E5K A;  2A37 A;  2EIF A;  1K9A A;  2KYB A;  4OB0 B;  3CCQ T;  4M4Z A;  3H9N A;  4OB2 B;  3DLL A;  1YNZ A;  1D0Y A;  1WHK A;  3SFM A;  1T3L A;  5GJV B;  1PSE A;  3TRE A;  4XTX A;  1M90 C;  3CBM A;  3OYA A;  1QWF A;  1QCN A;  1K76 A;  3L2V A;  4ELY C;  4X9C A;  1I5O B;  1OPL A;  1NPR A;  2F2W A;  4M7D E;  1JU5 C;  2A36 A;  4JLG A;  1OZ2 A;  3BDU A;  1GFC A;  1TS9 A;  2A3L A;  3EH2 A;  2DVE A;  2L5Q A;  2JXB A;  1WGS A;  1VQ5 Q;  3GF5 A;  3S3N A;  2O9V A;  4E7Z A;  1VQL T;  3OS1 A;  2XKO C;  5LL6 S;  2R58 A;  3M54 A;  1KC8 C;  4RCB A;  1M8M A;  3VRY A;  2GFA A;  3JB9 D;  2FZK B;  2O31 A;  3GNG A;  1YJN T;  2J05 A;  2MIO A;  1VQ6 T;  1K73 C;  2K3X A;  1Q82 C;  4AG1 C;  5IXB A;  2BE9 B;  2OI3 A;  2E6N A;  1Z9Z A;  4C5H A;  2F2V A;  3HKS A;  5CAI A;  2GTO A;  2ZGW A;  2ECZ A;  1ZSZ B;  1WFW A;  3ER0 A;  2QTV A;  3MP1 A;  2D8H A;  1MMA A;  1VQK A;  1Q7Y U;  2DBM A;  1PSF A;  3CME T;  1UGR B;  2CP0 A;  2RN8 A;  4WF2 A;  3LW5 E;  4ZTF A;  3CPF A;  2LJ0 A;  4M7A B;  1W1F A;  3EG0 A;  3CCU Q;  2JW4 A;  3ZL7 C;  2JM9 A;  1KJW A;  2CP3 A;  2DL8 A;  1PM3 A;  2IPO B;  1S72 T;  2RI5 A;  1MHN A;  3L2W A;  2BIV A;  3RKX A;  2CS7 A;  3PGG A;  1JJ2 A;  1IRX A;  1YIJ T;  2P84 A;  3FIF A;  5IHN A;  4E2F B;  2H3J A;  4LNP A;  2JS2 A;  1M1K U;  2O9S A;  1BK2 A;  2VXF A;  2H8H A;  2OTJ A;  1TH7 A;  2DET A;  2D1X A;  1A0N B;  4FW2 A;  1YP5 A;  4M78 A;  1MMG A;  4MZT A;  7AT1 B;  4ME7 A;  3THK A;  1ARK A;  3G71 A;  1QQJ A;  1BI0 A;  3H41 A;  1K9M U;  1BIA A;  2KXD A;  4J9I A;  3M4G A;  5DLO A;  3JRZ A;  1ZLM A;  3WVD B;  2RD1 A;  2LCS A;  4WTO B;  4HVW A;  3OYC A;  4KH0 B;  1WXB A;  1VQP Q;  1B34 A;  2QQA A;  2C06 A;  2VAS A;  3CCJ A;  3MEV A;  1VQ5 T;  2R57 A;  3CCM A;  1YWO A;  1QVF P;  1UB4 A;  2E41 A;  1D3B A;  3G1J A;  1VOM A;  1X6O A;  2LVM A;  5GAO p;  1GCQ A;  5KYX A;  4XK8 E;  4IUV A;  2FPF A;  3VS7 A;  4M7D D;  4JZ4 A;  4OMO A;  1D09 B;  3CC7 Q;  2LNH B;  1AZE A;  3QDF A;  1U06 A;  4ANJ A;  3SD4 A;  1Q95 G;  2W0Z A;  1N6A A;  2CZ6 B;  1VQ8 Q;  2DXT A;  2PQW A;  4IIM A;  2C0T A;  2ZPF B;  2HMA A;  2DIL A;  2NUT A;  3S3M A;  1D1C A;  1M27 C;  2KGT A;  4J7F A;  1X6G A;  3CCU T;  5GAN h;  3M56 A;  4FW1 A;  5J26 A;  2GF7 A;  5KYW A;  1NLP C;  1G5V A;  1YHQ Q;  2RHY A;  2RJF A;  4JPB W;  4M7A E;  2P4R A;  1QVG S;  2ATC B;  4XTU A;  1HD3 A;  3EFO B;  1SRM A;  2EBP A;  4M7A G;  3OB9 A;  2DFU A;  1G3T A;  1UUE A;  3QYG B;  5IAY A;  1G83 A;  1JRI A;  3MO8 A;  4J9H A;  5LJ3 h;  4LUD A;  2JTE A;  5GAN 6;  4AFQ C;  4ZTJ A;  4RTV A;  2ABL A;  5CQY A;  2GQV A;  3V7S A;  4QW2 A;  2DER A;  5IHI A;  2YDL A;  4IUP A;  2FPD A;  2D0N A;  4ZGD B;  1FXX A;  1ZSZ C;  4NL3 A;  3VV0 A;  3LWH A;  3FB9 A;  4XAX B;  3ZBD A;  3EGD B;  4HKE A;  1OQK A;  2RNA A;  4MML A;  2KT1 A;  3RBB B;  1YJN A;  2G3R A;  2QYZ A;  2W10 A;  1OUL A;  4JRQ A;  4M7A C;  2E4H A;  3LYI A;  4N0A C;  3S6W A;  2LNV A;  3A8O B;  1K8A R;  5GAN g;  5GAN f;  2COW A;  2J06 A;  1T0H A;  4FYY B;  1VQP T;  3J81 E;  1M1G A;  4PJO A;  2ENM A;  4J9G A;  2DL5 A;  2E3H A;  4FT2 A;  2EWN A;  5DY9 A;  4XU0 A;  5GAM e;  1TSF A;  2DIQ A;  3OQ5 A;  3CCL A;  4E6R A;  2RF0 A;  3OSS C;  5LJ3 f;  5CKD A;  4DA4 A;  2FPE A;  2JT4 A;  3HSB A;  1BYM A;  3A1P A;  1M2V A;  3PNW C;  2LCL A;  4LD6 A;  4JS5 A;  2VXE A;  3CC7 T;  1S72 A;  5FWB A;  4RCC A;  2OAW A;  2QG9 B;  3SB2 A;  2KRS A;  2ZPB B;  1VQ8 T;  2YT6 A;  2DD5 A;  3HP9 A;  1M3A A;  1QCF A;  1SSH A;  3OYB A;  4D6W A;  4QQG A;  1RI9 A;  1OU8 A;  1IHW A;  2CP6 A;  4C8Q B;  2FVU A;  3G71 Q;  2EYQ A;  2WSE E;  4EMK B;  2GNC A;  3VS0 A;  1W4S A;  2B8A A;  5CIU A;  3EH1 A;  1YHQ T;  2C0O A;  2DZC A;  2A0F B;  1LPL A;  3MCA B;  5GMK m;  3OY9 A;  3X24 B;  1V76 A;  2R5M A;  3C95 A;  1I5L A;  2DBK A;  5D6Y A;  3QZ9 B;  3OYM A;  3CCM Q;  2AKK A;  1KHI A;  1GBQ A;  2OX7 A;  5GMK l;  3HRT A;  1LJO A;  1VQ5 A;  3FC3 A;  1VYT A;  1KD1 U;  4CC7 A;  3QUI A;  1QVG A;  4A54 A;  2CUD A;  2BE7 D;  3ASK A;  4E7S A;  2QEX A;  2D0Q B;  5I11 A;  4M7D A;  1FYN A;  4JRI A;  2QDY B;  4M7A D;  5GAN d;  4BDZ A;  1K0X A;  4PFZ A;  1YCS B;  1VQ4 A;  2L3R A;  2KK4 A;  2KVQ G;  2CKK A;  4OVA A;  2RHX A;  3O8V A;  2VUB A;  1QP3 A;  1GL5 A;  4JJN K;  1VQK T;  2EGE A;  4XTV A;  2L3Q A;  4OGE A;  2LQW A;  5IXF A;  4FM4 B;  1D0Z A;  4GLM A;  5GAN 2;  2MWP A;  3G7Z A;  4CRI A;  2X4X A;  5LJ3 d;  1RAD B;  1IGQ A;  2QAZ A;  1YJW Q;  4BDY A;  2AHJ B;  5GAN 8;  2E65 A;  1VA7 A;  2KSS A;  4M77 F;  2RO0 A;  1TG0 A;  1WXT A;  5CQX A;  2C0I A;  1FMK A;  3OW2 S;  3I55 Q;  2K6D A;  1G3Y A;  2RPN A;  3JB9 G;  2XHC A;  1HK9 A;  4J8O A;  4QKU A;  2BZX A;  2IG0 A;  3C12 A;  4F14 A;  2WAC A;  3X28 B;  4OMN A;  2EPD A;  1RAB B;  1QMC A;  1EX4 A;  1UGQ B;  1Q86 U;  3H0H A;  3HRS A;  3UA6 A;  2GGR A;  1BI1 A;  2AIR B;  4IKF A;  3PIP A;  3OYF A;  5I22 A;  1WJQ A;  3VJP A;  3I9Q A;  2DM1 A;  3G71 T;  2DLP A;  1MGQ A;  1R8O B;  4C92 F;  1ZUU A;  3OMC A;  3Q1J A;  3CC4 A;  2RI3 A;  2HQE A;  5KCO A;  4JS4 A;  5CKB A;  3NFC A;  4PJO G;  4C8Q E;  2DF6 A;  2LT1 A;  3EFS A;  1OPK A;  3H8Z A;  5FLX E;  4BE1 A;  4IUT A;  4UC4 A;  5M9O A;  4ZNX A;  3VS2 A;  5GAN j;  3PVQ A;  1Y96 B;  1YFN A;  3CXC S;  2Y4Y A;  4F7U B;  1N8R U;  1OI1 A;  1WXU A;  4Z8A A;  3CCM T;  3X20 B;  2LP5 A;  3P8H A;  4M75 F;  3ZFJ A;  1H64 1;  2HBP A;  2CH4 A;  2JMA A;  1IO6 A;  1XJW B;  1VQP A;  3KFV A;  4E7I A;  3CCL Q;  2HQX A;  1JEG A;  2RMO A;  1I8F A;  4J7I A;  1ZUK A;  3VS3 A;  3JCM P;  2DTH A;  3CD6 A;  5LJ3 j;  2E5Q A;  4LDW A;  3NPF A;  4PJO C;  1KQS S;  2DMO A;  1NM7 A;  3X26 B;  4OP0 A;  2MWO A;  1AWW A;  1W2B S;  3M0Q A;  2EQJ A;  2RH2 A;  2DK3 A;  4EMK C;  3C0C A;  2R5A A;  1R0C B;  4C0F A;  3LX7 A;  2J6F A;  4PJJ A;  2QI2 A;  3A8M B;  5IH2 A;  2DXB A;  1WX6 A;  4DOV A;  2AZV A;  2HAX A;  1JJ2 P;  1GXI E;  5EG2 A;  5GAO q;  1VQ8 A;  1YJW T;  1TUG B;  3HTR A;  2KYM A;  3JCM V;  2SEM A;  4FSX A;  2K4Y A;  1WIE A;  5IN1 A;  2ESW A;  3EG9 B;  4LN2 A;  4F17 A;  5HCK A;  5FU6 B;  2DL3 A;  1Y7X A;  3MPU B;  3I55 T;  2GTJ A;  2VGM A;  4C0G A;  3P8B B;  5DLQ E;  1FMV A;  1MV0 B;  1YHQ A;  4KH1 B;  3OS2 A;  1U5S A;  2FL7 A;  2LC4 A;  2PZ1 A;  1ZSZ A;  1N5Z A;  3QHS A;  4X9D A;  4C0D B;  2QA4 Q;  4M7D G;  2JJ9 A;  4QVC A;  2BUD A;  4L5G A;  2WSC E;  2LJ1 A;  3EHR A;  5HK3 A;  1YWP A;  2XDP A;  2LQK A;  3OW2 A;  4M7A A;  3QSU A;  3JSC A;  4N0A A;  1G8X A;  5L23 A;  2QEX Q;  1NPP A;  1MV3 A;  2DZ9 A;  3RES A;  2EFI A;  1PHT A;  2EAY A;  3CPW S;  4B9X A;  1NBE B;  2YRV A;  1VQ4 Q;  1KK7 A;  2ED0 A;  1WQ7 A;  5GAN 3;  4O6J A;  1K8A C;  1GFD A;  1Y57 A;  1FX7 A;  1F1B B;  3TQ7 P;  2WSF E;  4EIK A;  2QGG A;  3I5S A;  1OOT A; 
#chains in the Genus database with same CATH homology
 2JTM A;  3SD4 A;  5DM7 R;  1YJ9 A;  1N6A A;  1VQO T;  2CZ7 B;  4B9W A;  2CZ6 B;  3NTH A;  5GAM f;  5GAM g;  3JB9 H;  2LTO A;  4C8Q G;  4M7D C;  4PJO B;  2K57 A;  2DXT A;  2PQW A;  4ZN3 A;  2KQW A;  2JN0 A;  2LT4 A;  4N4G A;  2PUK B;  2ZPF B;  3E19 A;  3LGL A;  2RK2 A;  5C6S A;  3DB4 A;  2X4J A;  2HD0 A;  2O01 E;  3S3M A;  4E7H A;  1O9S A;  3TEE A;  5I2S A;  3CCL T;  4J7F A;  4X34 A;  4MDW A;  1K9M C;  3QBY A;  2E64 A;  4ZGJ B;  4JLI A;  1Y71 A;  3H6Z A;  3L2Q A;  3CCU T;  5FRM A;  5GAN h;  1VIE A;  2EJF A;  3M56 A;  4VUB A;  4F7U E;  4GY5 A;  4PJO D;  1XTD A;  3JCM J;  2RA2 A;  5J26 A;  4LDV A;  3T9N A;  1V29 B;  2GF7 A;  3E9G A;  4DOW A;  4F7U G;  3KXT A;  3CBO A;  1G5V A;  2CGH A;  4M78 C;  3VUB A;  4C8Q D;  3M57 A;  2RHI A;  4BY6 B;  3UWN A;  2RHY A;  2RJF A;  4M77 B;  3CXC A;  4M7A E;  3M58 A;  1QVG S;  5GAO n;  4FU6 A;  3JCM X;  4XTU A;  3OYN A;  3JCM W;  1ZHI A;  2EQK A;  3GOX A;  4M7A G;  3OB9 A;  1G3T A;  4J6Y A;  3QYG B;  3RKY A;  5IAY A;  3G4S A;  2XID A;  3FLG A;  4M78 F;  2MMP A;  2DXC A;  4A53 A;  4HCB A;  4BE0 A;  4PNO A;  5FRO A;  3CCE T;  4C8Q C;  1JRI A;  3L2Z A;  3MO8 A;  4BI4 A;  5LJ3 h;  4N4I A;  3A5Z B;  4PLL A;  1N9S A;  3BW1 A;  4R56 A;  4BI3 A;  4XQ3 A;  5CKE A;  5GAN 6;  4BD3 A;  2K3Y A;  4ZTJ A;  2XG8 D;  5IT9 E;  1G3S A;  3C94 A;  3BDL A;  5CQY A;  2GQV A;  3V7S A;  1M9S A;  4P5N A;  2BKD N;  4QW2 A;  1VQ9 A;  2QQ9 A;  3GLX A;  2P4T A;  2RM4 A;  1RI0 A;  3QYH B;  4IUP A;  5HK0 A;  4XU2 A;  3OBW A;  4ZGD B;  1KQS A;  1FXX A;  3HHT B;  3JCM e;  4NL3 A;  1XNI A;  1KHC A;  2O4X A;  3VV0 A;  5A2Q E;  4BI8 B;  3LWH A;  3FB9 A;  1M8V A;  3WVE B;  4XAX B;  3LH0 A;  3ZBD A;  4Z02 A;  3A8L B;  4HKE A;  4XTW A;  1W2B A;  3QXE B;  5KCH A;  2XU8 A;  2X35 A;  4L6V 5;  2DEQ A;  2V8J A;  2VV5 A;  4MML A;  2OTL T;  1YJN A;  2G3R A;  2DPP B;  3JCM d;  4A4F A;  1ZBX A;  5CVI A;  4C92 B;  1O75 A;  3BY7 A;  3L2U A;  4JRQ A;  4M7A C;  3I56 T;  1RL2 A;  2PVO B;  3LYI A;  3M59 A;  4N0A C;  1NJI U;  4FL6 A;  1NE8 A;  3FDR A;  3S6W A;  4F7U F;  5LJ5 h;  4OMF B;  2Y4X A;  4A4E A;  2LNV A;  3A8O B;  4C5I A;  3CCS A;  4RMO A;  3GP8 A;  5GAN g;  5GAN f;  5FRN A;  3DLM A;  1QVP A;  1N27 A;  4IUU A;  3QJ6 A;  5AYF A;  1M4Z A;  5CK9 A;  3OS0 A;  2NLU A;  2XIC A;  5GMK e;  3J81 E;  3DKM A;  1VQP T;  3GIB A;  3M4Y A;  1M1G A;  3URG A;  2YLC A;  1VQO A;  4M7A F;  3V7C A;  2D6F A;  4PJO A;  2YLB A;  2QA4 T;  1VQN T;  2GFU A;  2MI6 A;  4FT2 A;  4KUL A;  3A8H B;  3WXM B;  2EWN A;  4Y91 A;  5HKC A;  5DY9 A;  4ELZ C;  4MZP A;  3KBG A;  2ZPE B;  4XU0 A;  3QKJ A;  5GAM e;  2DIQ A;  2PVD B;  3MP8 A;  3OQ5 A;  3CCL A;  1HXD A;  4M75 B;  1WPY A;  2QEX T;  3CCU A;  3HRU A;  3HL8 A;  4M7D B;  4TVR A;  4LDY A;  3OSS C;  3INZ A;  3SWN B;  4HCC A;  2I2L A;  3QZ5 B;  4J6X A;  2ZPG B;  4DQ2 A;  2M0O A;  5LJ3 f;  3JCM c;  1VQ4 T;  5CKD A;  3M55 A;  5L8R E;  4DA4 A;  3HSB A;  4ZGE B;  2ZZD A;  5GAM d;  1X01 A;  1BYM A;  5GAO m;  3PNW C;  1QW1 A;  2E70 A;  3HFO A;  4M77 A;  2VYT A;  1UGP B;  3E1S A;  2LCL A;  4QQD A;  3V8K A;  3L1A A;  4LD6 A;  2K5I A;  4JS5 A;  1WJS A;  1YBY A;  3GNF B;  1XOV A;  3V8J A;  2VXE A;  3OYE A;  2K5L A;  1VQ7 T;  2P0P A;  1S72 A;  1VUB A;  3CC7 T;  1OZ3 A;  4RCC A;  2OTJ T;  5HY6 A;  2V8K A;  1WQW A;  2FB7 A;  1M5Q 1;  3SB2 A;  1Q81 C;  3A8G B;  2ZPB B;  1U1S A;  1VQ8 T;  5FU6 C;  2IVW A;  5GAO l;  2DD5 A;  2QXF A;  5GAN 5;  3VKI A;  2XI9 A;  3HP9 A;  1BI2 A;  3OYB A;  2RJD A;  4C0Z A;  3MEU A;  4QQG A;  4D6W A;  1VQM T;  4E7L A;  3CPW A;  2JOY A;  4HT8 A;  2DKG A;  1Y07 A;  5LJ5 g;  4C8Q B;  4IUQ A;  5LJ5 f;  1YI2 T;  2ZPI B;  2FVU A;  4M78 D;  4JUV A;  2EYQ A;  2WSE E;  4PJO E;  3CC2 T;  4JDS A;  2EQU A;  4EMK B;  3CEY A;  3QDR B;  1YJW A;  1W4S A;  4C0D C;  2B8A A;  5CIU A;  1QP2 A;  2MAM A;  1YHQ T;  1G3W A;  2K2V A;  2E10 A;  2A7Y A;  4E7K A;  2OTL A;  3ME9 A;  2DZC A;  3RMS A;  4E47 A;  3UDC A;  2RHZ A;  4KUI A;  4C92 A;  3OYG A;  3S3O A;  2P0Q A;  3CBP A;  3MCA B;  3QII A;  4FIB A;  3I56 A;  5GMK m;  4A4K A;  3JB9 F;  3OY9 A;  2KDS A;  3X24 B;  3CCJ T;  3I55 A;  2R5M A;  3C95 A;  4BAC A;  2L8D A;  1M90 U;  2JTF A;  2VGN A;  3M9Q A;  5FU7 B;  1I5L A;  1I4K 1;  3RER A;  2RJC A;  1KG1 A;  4J5Y A;  4M77 E;  4PL6 A;  5D6Y A;  3QZ9 B;  3OYM A;  3AHU A;  4J83 A;  1JJ2 S;  1KHI A;  2EKO A;  3ZEH A;  4M77 G;  3G6E T;  4EMH A;  5GMK l;  2F5K A;  1OYX A;  3HRT A;  5J39 A;  2LRQ A;  5GAN e;  5KE3 A;  2E12 A;  1LJO A;  4RG8 A;  3VYG A;  4QQ6 A;  1VQ5 A;  3PTA A;  3FC3 A;  1KD1 U;  3QUI A;  3MP6 A;  3RIR A;  4C5G A;  2E6Z A;  2M9U A;  4A54 A;  1QVG A;  3PMT A;  4RG2 A;  3ASK A;  3VU3 C;  4M75 A;  3RMQ A;  3CC4 T;  2QEX A;  2D0Q B;  4QVZ A;  4M7D A;  3OYD A;  4V2S A;  4JRI A;  3SWN A;  1U8R A;  2M1H A;  2QDY B;  1KC8 U;  4M7A D;  5GAN d;  3JB9 J;  4BDZ A;  3EFR A;  2D9T A;  2V8I A;  1SSF A;  1VQ4 A;  1YIT A;  2L3R A;  4Q5W A;  2KAF A;  2RI2 A;  3N5B B;  2QQR A;  5GMK j;  3DB3 A;  1YCY A;  1K73 U;  4BB7 A;  3EAE A;  2KK4 A;  1YJ9 T;  3CCR T;  2CZ1 B;  2KVQ G;  1K8A U;  1Q82 U;  2CKK A;  4OVA A;  2RHX A;  3FEO A;  4A4H A;  3O8V A;  5LJ3 e;  1VQ7 A;  2VUB A;  4HT9 A;  2JUF A;  1LNX A;  1QP3 A;  3QG1 A;  4ZN1 A;  3JCM b;  2DTI A;  3GPL A;  3NTK A;  3CC7 A;  4YTL A;  3C4S A;  4JJN K;  1VQK T;  4XTV A;  3OYY A;  4QVD A;  1XQH A;  3F70 A;  4OGE A;  5GAM j;  2F69 A;  5GAN 7;  4OF1 A;  1WNL A;  4C92 E;  4FM4 B;  4M77 C;  2XDB A;  5GAN 2;  3JB9 I;  2MWP A;  3G7Z A;  4CRI A;  4E7J A;  2X4X A;  3QJY A;  2EIF A;  3FJP A;  5LJ3 d;  5CCA A;  4LD9 K;  4C92 G;  4OB0 B;  1ZQ1 A;  4IUR A;  1QVF S;  3CCQ T;  1FWZ A;  3LWI A;  4BDY A;  4JRK A;  5C0M A;  2PUO B;  2AHJ B;  5GAN 8;  2E65 A;  2JNG A;  3PMI A;  3TU4 K;  2KSS A;  4C8Q A;  4M77 F;  1YI2 A;  2RO0 A;  2HNI A;  4OB2 B;  4CI0 C;  3CD6 T;  3PIO A;  3V8L A;  3DLL A;  3SFM A;  2K5F A;  5CQX A;  3OYJ A;  3CC2 A;  4EMK A;  3J7A F;  2ZCF B;  5I2M A;  4BUG A;  5KE2 A;  2DTO A;  3LGF A;  1PSE A;  3TRE A;  4XTX A;  5D6X A;  3CBM A;  3MEW A;  2ZPH B;  3OW2 S;  1M90 C;  4KBM B;  5LJ5 e;  3J80 E;  3OYA A;  5LJ3 g;  1G3Y A;  4EMG A;  4OGC A;  5KH6 A;  3JB9 G;  2Y90 A;  2XHC A;  4M75 E;  4ELY C;  3L2V A;  2EJG A;  4X9C A;  5GAO r;  1HK9 A;  1NPR A;  4J8O A;  4LDU A;  4LDX A;  4O5V A;  4M7D E;  4JLG A;  1OZ2 A;  4JRP A;  3BDU A;  3OBY A;  4J6W A;  2IG0 A;  1WJR A;  2JVV A;  2WAC A;  2A3L A;  3C12 A;  4M75 G;  3X28 B;  3E9F A;  5LJ5 d;  2DVE A;  1EIF A;  1VQ9 T;  2YHT A;  2X4Y A;  2L5Q A;  4L59 A;  1UGQ B;  1WGS A;  3GF5 A;  3LLR A;  5D6W A;  1Q86 U;  3HRS A;  3S3N A;  1KD1 C;  4M78 B;  4C92 C;  3CCE A;  1BI1 A;  3FRN A;  4IKF A;  3PIP A;  1VQL T;  3OS1 A;  2XKO C;  5LL6 S;  3OYF A;  1WJQ A;  2L89 A;  2R58 A;  3M54 A;  4XU1 A;  2JZ2 A;  3G6E A;  1KC8 C;  3VJP A;  4RCB A;  3JB9 D;  2GFA A;  4KT0 E;  4NOY A;  3OYI A;  2KMT A;  3GNG A;  3G71 T;  1YJN T;  1MGQ A;  2FYK A;  4Y28 E;  2FHD A;  1R8O B;  4C92 F;  4EDU A;  1K73 C;  2K3X A;  2DO3 A;  3CCV T;  1VQ6 T;  3OMC A;  3CMA T;  3Q1J A;  3CC4 A;  2RI3 A;  2PVG B;  4XTY A;  1N9R A;  1Q82 C;  2HQE A;  5KCO A;  2E6N A;  2LQ8 A;  4JS4 A;  3X25 B;  1NZ9 A;  5CKB A;  2MF2 A;  3CCS T;  3NFC A;  4HA8 A;  4C5H A;  1NJI C;  2PU9 B;  4PJO G;  3PFS A;  4C8Q E;  3HKS A;  5CAI A;  2LT1 A;  3EFS A;  2ZGW A;  1KQ1 A;  3H8Z A;  2KY9 A;  4M75 C;  5CKH A;  3CCR A;  5FLX E;  4BE1 A;  4IUT A;  2XK0 A;  3SWN C;  4UC4 A;  5M9O A;  5CR2 A;  2OAU A;  5GAN j;  1B34 B;  3ER0 A;  1JB0 E;  1Y96 B;  3CXC S;  1IRE B;  2Y4Y A;  3MP1 A;  3RKW A;  3MET A;  4F7U B;  1Q7Y U;  4NS5 A;  1N8R U;  1PSF A;  4MZM A;  1VQK A;  1OI1 A;  1VIF A;  1UEB A;  3CME T;  3CCM T;  1UGR B;  1M1F A;  4WF2 A;  3X20 B;  3P8H A;  2CYZ B;  4M75 F;  1H64 1;  3ZFJ A;  3LW5 E;  2HBP A;  3TCJ A;  2XD0 A;  4M7D F;  3QPH A;  4ZTF A;  2DIG A;  3CPF A;  1VQP A;  2RHU A;  4M7A B;  5GAN 4;  4E7I A;  2QQB A;  1D3B B;  2EQM A;  3CCQ A;  2QA4 A;  2HQX A;  1I8F A;  4J7I A;  3JCM P;  3JCM h;  1X75 C;  3P8D A;  2DTH A;  3CD6 A;  2F5T X;  5LJ3 j;  2VC8 A;  2E5Q A;  3OSV A;  4LDW A;  1S72 T;  4PJO C;  2RI5 A;  1AHJ B;  1KQS S;  4II1 A;  1MHN A;  3X26 B;  3L2W A;  2DXU A;  4OP0 A;  2MWO A;  2BIV A;  3RKX A;  3HFN A;  2LDM A;  5J3B A;  2CS7 A;  4KUD K;  3PGG A;  1W2B S;  1JJ2 A;  1YIJ T;  1Q86 C;  2EQJ A;  2RH2 A;  3FIF A;  4M77 D;  2DK3 A;  2H3J A;  2LX9 A;  4EMK C;  1M1K U;  4PJO F;  4A4G A;  2R5A A;  2VXF A;  3MHX A;  2LCC A;  3LX7 A;  3OS5 A;  4C0F A;  1BKB A;  2QI2 A;  1U1T A;  5I21 A;  5A0D A;  3R6O A;  1KQ2 A;  1Q81 U;  3L2R A;  3A8M B;  3JAM E;  2OTJ A;  1TH7 A;  4C8Q F;  3UPU A;  5GMK h;  2P0K A;  2XDD A;  3OA6 A;  3VYH B;  2DXB A;  4DOV A;  2HAX A;  4M78 A;  1GXI E;  4BY6 C;  5EG2 A;  3OYK A;  5GAO q;  1VQ8 A;  1YJW T;  1VQL A;  3HPW A;  3PT9 A;  4MZT A;  3OYH A;  4ME7 A;  5LJ5 j;  3RUX A;  3JCM V;  4GLK A;  5FU7 C;  2RK1 A;  4FSX A;  5A0L A;  1VQM A;  3NTI A;  4OB3 B;  2K4Y A;  3G71 A;  5GAM h;  1BIB A;  5IN1 A;  1BI0 A;  3OYL A;  1VQ6 A;  4NL2 A;  2DJZ A;  3CCV A;  3OMG A;  4HCZ A;  3CMA A;  1K9M U;  1H3Z A;  1BIA A;  5FU6 B;  4C5E A;  3KUF A;  2DD4 A;  1Y7X A;  2RJE A;  3I55 T;  3M4G A;  3QO3 A;  5DLO A;  2DAQ A;  2VGM A;  5GMK i;  1DJ7 B;  3JRZ A;  4C0G A;  3P8B B;  1Q7Y C;  1N8R C;  5DLQ E;  3WVD B;  2RD1 A;  3G4S T;  3JCM Q;  1YHQ A;  2QTX A;  2X4W A;  1IZ6 A;  3OYC A;  4MDX A;  3OS2 A;  1QVF A;  2FL7 A;  2LC4 A;  4C92 D;  2GCX A;  2CZ0 B;  1P92 A;  4OB1 B;  3BFM A;  3JCM f;  1B34 A;  2QQA A;  1Y96 A;  3QHS A;  4X9D A;  1LOJ A;  3JCM g;  2C06 A;  3CCJ A;  3MEV A;  4C0D B;  2R57 A;  4F7U A;  1VQ5 T;  1VQN A;  4M7D G;  2EJ9 A;  4PKC C;  4QVC A;  2BUD A;  3CME A;  3CCM A;  4BE2 A;  4L5G A;  2WSC E;  5CKF A;  1UGS B;  4XTZ A;  5HK3 A;  2XDP A;  2LQK A;  2O4X B;  3L42 A;  3OW2 A;  3V7R A;  1UB4 A;  3QSU A;  4M7A A;  2QQS A;  2E41 A;  1D3B A;  3JSC A;  4N0A A;  3UT1 A;  4R55 A;  4PLI A;  4XU3 A;  3VUZ A;  1NPP A;  1YIT T;  4ATO A;  1I81 A;  2DZ9 A;  1X6O A;  2M16 A;  2LVM A;  2EFI A;  3RES A;  4M78 E;  5GAO p;  3M53 A;  2EAY A;  3CPW S;  4B9X A;  2YRV A;  3M5A A;  4MMK A;  4XK8 E;  4IUV A;  1WQ7 A;  1JBM A;  4M75 D;  5GAN 3;  4O6J A;  4M78 G;  5A0G A;  4M7D D;  1M1K C;  1K8A C;  2E1H A;  1FX7 A;  3MEA A;  5CO7 A;  2WSF E;  4FT4 A;  1BI3 A;  4RKU E;  3SDZ A;  4N4H A;  1YIJ A;  2RB6 A;  4EPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...