4DOVA

Structure of free mouse orc1 bah domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
157
Chain Sequence
b'QTFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Origin recognition complex subunit 1
publication title The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
total genus 33
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dovA00
1M4ZA 4BB7A 4DA4A 4LD9K 3TU4K 2FL7A 1ZHIA 4FT4A 1ZBXA 4KUIA 2FVUA 4DOVA 3PT9A 3PTAA 4FSXA 4FT2A 1W4SA 4JJNK 4KULA 4KUDK 4DOWA
chains in the Genus database with same CATH superfamily
3QPHA 2D8HA 1W1FA 3G7ZA 2DZ9A 3FJ5A 4ANJA 4C92C 5GAMf 2XDPA 2PVDB 4C92A 2L3SA 1E7OA 2CH4A 1M1KR 5IXBA 1PWTA 1VQKA 3CCVQ 2A0FB 3OYIA 2ZPIB 1S72A 3DLLA 2DX1A 2J7IA 2QAZA 2O31A 3MKDA 4E7JA 3PMTA 1VYUA 1D3BA 2RA2A 2JOYA 3S6WA 2OTJQ 3VS2A 2M1HA 1MHNA 2XDBA 2HSEB 1N27A 5KYWB 4L5GA 2Z0WA 2ZPGB 4X9CA 2JMCA 3EAEA 3TQ7P 3CMEQ 4M7AD 3P8BB 3CQTA 1QVPA 1TG0A 2OTLQ 1K0XA 5I2SA 2HBPA 3CCJQ 1XQHA 3CXCS 2KBTA 5CCAA 1WHGA 3JB9F 1M1KC 1N8RU 2DJQA 3FDRA 5LJ5j 4NL2A 2ECZA 1G3WA 2BKDN 4J9DA 2KRMA 1YIJT 3CPWS 3EGXB 2OAWA 1KQSS 3H0HA 3CCRQ 2BE7D 4JRQA 2J05A 4PK4A 4B9XA 4HCCA 3EG3A 2QTVA 5J26A 1QLYA 1OOTA 2FO0A 4RTUA 1GBRA 3ZBDA 2DNUA 5GANd 1K9MU 3OYCA 5GAOm 4IUPA 2ZCFB 2MAMA 5FW9A 2DMOA 1OZ3A 2QA4Q 1IHWA 1LVKA 4BB7A 1UUEA 1Q7YR 4Z8AA 2JTMA 2P0PA 2MWPA 4P5NA 3VUBA 2E1HA 2PVGB 2KY9A 4E7KA 3HP9A 3V7SA 4MMLA 4FSXA 5LJ3e 2QXFA 1EIFA 2YUPA 1VQ7Q 5CK9A 1RACB 2EKHA 4KGXB 1K73U 2D0QB 3OS5A 1TS9A 2LT1A 2KQWA 1JJ2S 1VIEA 3P8HA 4C0ZA 1UGVA 4BDYA 3DB3A 2K9GA 4FM4B 2HMAA 3REBB 4OMOA 1NJIC 2L0AA 4CC7A 1W2BS 3VKIA 5KH6A 1Q7YC 4RCCA 1G83A 4XTYA 3S3NA 5CKDA 1UGSB 1YJ9Q 3LW5E 1JEGA 2XMFA 3I55Q 1VQOT 1E6HA 4OMPA 3TSZA 1B07A 4E7ZA 3AT1B 3A8MB 4JRKA 2FPDA 2C0OA 1N8RR 2EBPA 1YCYA 2J6FA 5KYUA 1Y71A 2YUOA 5IHIA 4C8QB 3FLGA 3CCUQ 4M75E 5LJ5g 3MHXA 4II1A 1UJYA 3CCEQ 1MMDA 3CD6T 1KFZA 3JCMc 1YHQT 3I5RA 1VQ9T 2F69A 2EAYA 2E4HA 2DXTA 3PT9A 3A8LB 1WXTA 1K9MR 1WQWA 5LJ5f 3OYKA 2H8HA 2LX9A 3O5ZA 4HVVA 1D09B 3UWNA 5GAOr 4M78D 2X51A 4N0AC 3V8KA 4N0AA 3EH2A 2DVJA 4PFPA 1H3ZA 2K2VA 4M7DD 1WHKA 2DL8A 3RNJA 1YCSB 4M75A 4R0KA 4M7AF 4KBMB 2EGCA 2K3XA 4WF2A 2L3PA 3UATA 1PD0A 3CCVA 3CCSQ 4TVRA 4FCYA 3MEVA 5KYYB 3EHRA 1UGPB 2FHDA 1N8RC 5EG2A 3UF4A 3GNGA 1Q82U 1OZ2A 1GFDA 3TEEA 4ELZC 2ROTA 1H92A 1K73R 2K57A 4M7AC 4HCBA 4LD9K 4HCZA 4M7AA 3META 4J9FA 5LL6S 2VXEA 2QQAA 3EG9A 5CIUA 5GAMd 4DEYA 1K9MC 2E12A 5A0DA 4OB3B 3CCMQ 4JDSA 5DLOA 2RI5A 1BI0A 5LJ3h 3CCJA 2QTXA 4L6V5 1D1CA 1WFWA 3PIOA 3OBWA 1IGUA 3L2VA 3VS5A 1MV0B 2CP2A 1NLPC 2RH2A 4X9DA 4C5IA 2C06A 3CC4Q 1KD1R 4J9CA 1X01A 3OYJA 5GAOp 3D7SB 1K73C 2BZ8A 4BD3A 3LLRA 3QJ6A 1WZOA 1ZBXA 3M59A 1TOVA 4FYVB 3UDCA 3MP6A 5AYFA 4AMCA 4MMKA 5IHNA 4K11A 1X27A 3NGPA 3G1JA 4QVDA 1OPKA 2WSEE 3H8ZA 3G4ST 5HCKA 4MZMA 3M0RA 1WX6A 4LDVA 4ELYC 4LDWA 4OB2B 2VVKA 1AWWA 1ZSZC 2DVEA 3EGDB 3OYHA 4ZTFA 2R5AA 1ZSZA 1RAGB 4AFSC 1Y96B 1VQ7A 5GAOq 2VASA 1KD1C 2RQTA 1FWZA 1GRIA 1MUZA 3CC2A 2B8AA 1Q82R 4BY6B 2NLUA 1VQPT 2O2OA 2V8IA 3SB2A 1T3SA 1K0SA 3DKMA 4KUIA 5FRNA 1JXMA 3JCMg 3L2ZA 1BB9A 5CKHA 3H0FA 1KJWA 3TSWA 1IHVA 4FYXB 1YNZA 3LWIA 1WJRA 2HBWA 3SDZA 1BU1A 2NWMA 3O8VA 2JTEA 4XU1A 3MPUB 2A08A 2DRMA 5CKFA 4KH0B 3JCMf 1QVGP 4M78F 1YITQ 3L1AA 1QMCA 1NEBA 1QKWA 4C5HA 3VV0A 4PJOB 4E7IA 1AWJA 3REAB 4M7DF 2QEXT 3OW2P 2YT6A 3CMAQ 3CCUA 2RK2A 2CUDA 2LCCA 2ABLA 3PVQA 3FRNA 5D7UA 1O75A 1Q82C 1SSHA 3CCLQ 1TTHB 4M78C 2HEQA 2CZ0B 2DL4A 1RI0A 4M78A 2XDDA 1OU8A 4M7DC 4FT4A 2E64A 4M7DA 5FU7B 2RI3A 4IIMA 1RAAB 2I0NA 1U1SA 1WPYA 3G4SA 3LH0A 1RLPC 2ZPEB 1PG5B 3MCAB 4D6WA 4C0DC 1S1NA 2WSFE 1V29B 1BBZA 1AWOA 2NUPB 4BI4A 5KYUB 3OB9A 4XU3A 2DL3A 1D1BA 4BI3A 4FSSA 5IHKA 1VQ4Q 4RG8A 3OYFA 3NFCA 2O4XA 2Y90A 3JCMP 3I56T 3FJPA 4E7SA 1BCMA 2RJEA 2JUFA 2LMJA 1VQPA 1YI2T 1IZ6A 2LDMA 4C8QG 5LJ5d 3OY9A 2L8DA 2G6FX 2V26A 1SHGA 1YP5A 1G8XA 3RKWA 3M5AA 4E47A 2YDLA 4CI0C 1ACMB 1AEYA 2JXBA 2XI9A 5FRMA 1TUDA 1YWOA 1JU5C 3QYHB 2K3BA 4RG2A 5IH2A 1VQNQ 4A54A 4AFQC 2DL5A 2I2LA 2CT4A 2V8KA 4C8QE 4DBRA 1TWBA 1VQKT 2CDTA 1R0CB 3SHWA 2ATCB 1S72T 3M55A 2G3RA 3H9NA 1NM7A 4PFOA 5KYXB 4QVCA 1GXIE 3OSVA 4AG1C 4JJNK 3E19A 1SRMA 3GF5A 2SEMA 4HCKA 5M9OA 1N9SA 1U5SA 1W6XA 4PNOA 2DYIA 5GAN3 5C6SA 4RTTA 3LH5A 2YRCA 2X3XD 3INZA 2HD0A 3E9GA 3GIBA 1QVFS 2DZCA 1BK2A 1YWPA 2EQMA 1ZA2B 4DOVA 2RMOA 3JCMX 5GANh 1K8AR 1XNIA 1WIEA 1F1BB 1VIFA 4LUEA 1HSQA 4J6WA 3M57A 2QDLA 1UHFA 2A37A 2MOXA 3RESA 2GF7A 1Q86U 2JTFA 1VQ6Q 5GAN8 3ZEHA 1G3TA 1VQ5Q 2X4WA 2AIRB 1I5LA 4OMFB 3VS3A 2COWA 2KVQG 4M77B 1YI2A 4V2SA 4WTOB 4J7IA 2GBQA 3V8JA 4OP0A 1I4K1 2YUNA 1PCXA 3HL8A 1FMKA 5D6YA 4F7UF 4MDXA 5EC7A 1YFNA 4JRIA 1D1AA 2DXCA 2PZ1A 2EIFA 3RMQA 2MK5A 2FPFA 2LP5A 4EDUA 3OYDA 4PLLA 2DYBA 1K8AC 2EJ9A 2RD1A 1NYGA 3EFRA 1M90U 1U1TA 4F7UA 2DKGA 4J9HA 3FB9A 1YITA 3PNWC 2IG0A 1D0YA 1SPKA 3JV3A 2YHTA 2HKQB 4M75D 2L89A 2LQWA 3CMAA 2CZ1B 3VS7A 2VB6A 1M2VB 1QCFA 3UPUA 2GTJA 4O5VA 1TH7A 3X28B 1YBYA 4E7LA 2QGGA 3VS0A 1WNLA 4QT7A 3KBGA 3PE0A 4EMKB 1V76A 2VXFA 4A4GA 2JM8A 3U23A 5HKCA 3CCQQ 2CREA 2QDYB 2E70A 1I1JA 4MZTA 3JCMd 1KHCA 5J3BA 2LT4A 2ENMA 1X6BA 1XOVA 2DPPB 4Q5WA 4E6RA 3G6EQ 5CAIA 4BE2A 2M02A 2LC4A 1RADB 1HD3A 5I11A 2CGHA 1QP2A 1WHJA 2HL5C 2KAFA 3C4SA 1Q86R 2DTOA 1RAIB 1CKBA 4OMNA 2EVRA 1AOJA 1WJSA 3CC7Q 5CKEA 1ABOA 2P84A 2RQUA 1T0HA 1LJOA 4PJOG 3SWNB 4OB1B 2FYKA 1EFNA 1VQ8Q 2JS2A 3PVLA 3CD6Q 4PL6A 1NBEB 1YHQQ 2M51A 1VQ9Q 2P0QA 2B86A 3HRSA 1FXXA 2DETA 1AD5A 1X2QA 2GGRA 1Y0MA 1OX8A 5FU6C 3RIRA 1LPLA 1VQNA 4PJOE 2L3QA 5GAMh 2DJZA 3QSUA 2IIMA 2K5LA 2K6DA 3CCVT 2RHYA 4HT8A 1ZUUA 2FG0A 3JSCA 3UA7A 3M53A 2EYZA 1Q86C 2RB6A 2EQUA 4N4IA 1HXDA 2BTTA 5IN1A 1PD1A 1G3SA 3EGUA 5D6XA 1M8MA 2GQVA 5GMKh 2H3JA 1YJWA 1MMGA 1LCKA 4LNPA 4KULA 2O88A 1N5ZA 1PRMC 5LJ3g 4HXJA 1C6VX 3OYAA 3GNFB 1VA7A 3MO8A 3RR6A 1BIBA 4EMGA 2F2WA 7AT1B 2C0IA 4A4FA 1AT1B 2OTLT 1WJQA 3VS1A 3EFOA 3CCJT 4PKCC 2X4YA 3EH1A 2L5QA 1K1ZA 2YWWA 5LJ3f 3JCMQ 2JW4A 2PUKB 3JCMb 2KDSA 2KYMA 1VQ6A 2F2XA 5L23A 2QQSA 1M1GA 2DL7A 1UE9A 3I5SA 2HSPA 1Z9ZA 1VQ5A 1VQLA 2JVVA 3S3OA 3MP8A 3DLMA 3CCRT 4GLKA 2KT1A 2K5FA 2F5KA 3EG2A 2FRYA 1J3TA 1MGQA 3HRTA 3GP8A 2KE9A 4M75F 1RAEB 1WXBA 2HKNA 4HKEA 2JM9A 2YLCA 1K4US 4JJBA 1UEBA 3BDUA 2JJ9A 2E5QA 1C0MA 3CEYA 1B3QA 1JXOA 2FEIA 2D6FA 3JAME 4A4EA 4C0FA 4LDYA 4M75C 2AZVA 2K3YA 2W0ZA 3M56A 1B34A 2FB7A 3ASKA 2NUTB 1NPPA 3A8GB 4RUGA 2QI2A 1QQJA 9ATCB 1VQ7T 1GCPA 2LZ6B 2E3IA 1UGQB 4J9IA 2OTJA 2JT4A 3CC2T 1JB0E 1QVFA 2RHZA 3JCMJ 3R6NA 1KQ2A 4J9EA 2EFIA 3CMEA 4OB0B 3C94A 1E6GA 4M77G 2DE0X 3CCQA 2KNBB 2XHCA 2YXYA 4RTZA 4C92B 2OTLA 4XU0A 1WA7A 3JB9H 2CSQA 1PSEA 1PSFA 2EPDA 2HDAA 3CPFA 1T0JA 5CQXA 2J6KA 3I55T 5GJVB 5HK0A 3JCMV 1VQMQ 4ESRA 4QQGA 3G71Q 4GBQA 1D3BB 4C0GA 1ARKA 5GAN6 4M77E 2EYXA 3CCRA 5GMKi 1KC8U 3CCUT 5C0MA 2YUQA 3HRUA 1Q81U 3WVDB 5KCHA 2QEXQ 4J7FA 2WACA 3E2UA 1AZGB 2DD5A 4X1VA 1ZLMA 2QA4A 1Y7XA 4OMMA 3VYHB 2RPNA 1QP3A 1WGSA 2F2VA 2DIGA 4HVUA 1EZZB 5GAOn 3WXMB 5LJ5h 4O6JA 2CP0A 5L8RE 2LCLA 5GAN5 2E6NA 2RQVA 3SFMA 3QDRB 4BE1A 5KYNA 2DRKA 4C8QD 4RTWA 3FC3A 1FMWA 3M4YA 2AK5A 3J81E 3CCST 4A4HA 3A8HB 3JCMW 2HAXA 3KXTA 3URGA 3X26B 2EYQA 3CBOA 1AVZC 2L3RA 1YJNQ 1CKAA 1TU0B 1M1FA 1OYXA 1M2OA 3QZ5B 5GAN4 2K4YA 3CXCA 4ATOA 3M58A 3C0CA 4LD6A 2LQKA 3T9NA 2DILA 1RAHB 4KUDK 4E2FB 3CPWA 1YJ9A 4IUUA 2GFUA 2EYYA 3I55A 1KQSA 2DBKA 3JB9I 5GANe 5KYWA 2O9SA 3QWXX 1G5VA 4QKUA 1FYNA 2CUBA 3ZL7C 4LN2A 2WSCE 3OYMA 1WQ7A 2CP5A 2EQIA 3MP1A 3CCEA 1SEMA 2Y4YA 1M4ZA 4ZNXA 1UG1A 3RMSA 1S72Q 1WDXA 2NYSA 1T3LA 4FW1A 3X24B 1RABB 2A7YA 2RJDA 3VRZA 3EGXA 2K79A 4RTYA 4DBFA 3FEOA 2RNAA 1M27C 3BFMA 5GMKl 5LJ3d 4AG2C 3GLXA 1WI7A 1JJ2A 3QUIA 2QASA 3SD4A 3CCSA 3C12A 3CXCP 4XAXB 2DIQA 5CR2A 1V1CA 5FLXE 2LQ8A 4JS5A 3VUZA 2PU9B 1Y57A 4ZTJA 1W2BA 2ROLA 4MZPA 3OSSC 1VYTA 1OQKA 2HZYA 3A1PA 4JRPA 1BKBA 2A3LA 3PFSA 5CKBA 2RJCA 2J6OA 4PJJA 1KQSP 3VS4A 2MF2A 1BCOA 2V1QA 5KE2A 4FU6A 1BIAA 1U8RA 4J5YA 4IKFA 2PTKA 2LNHB 2X4XA 1M8VA 1UB4A 2EWNA 1ZBJA 4Z88A 1MMNA 3PIPA 4JPBW 4JLGA 2MPXC 3CCMA 1X75C 1B34B 4M75B 1TXQA 2KR3A 3TREA 2AKKA 4LE9A 4JS4A 1OEBA 1UHCA 4BUGA 4XTZA 4CC4B 4AFUC 2LQNA 2K2MA 2R57A 5FROA 1VQMA 1IXDA 3CC4A 2RF0A 4Y91A 2KYBA 1YITT 1M1KU 2D8JA 2MIOA 4J9GA 2COZA 5DLQE 5ECAA 2XU8A 4M7AB 3C95A 3BY7A 3QIIA 4MDWA 1AWXA 4C8QF 2CYZB 1SHFA 3CMAT 1I81A 1B7TA 1Z9QA 3EG9B 2BE9B 3CCLT 2X3WD 4QQDA 4CRIA 4RTVA 1SRLA 4C8QC 4C8QA 1PKSA 3OYBA 1G3YA 2KMTA 2CZ7B 3ME9A 2MWOA 1I5OB 2YRDA 4PJOD 1RLQC 3V7RA 3NTIA 3DB4A 4C92G 1K76A 3N5BB 4ZN3A 4XTVA 5FWCA 4DEXA 3L42A 5GAMe 1TUCA 1VQ4T 4OVAA 2QG9B 1CSKA 3OYNA 2DXBA 4OMQA 2QQBA 1YJNA 4RTXA 4Y28E 1YIJQ 1PM3A 3OS1A 1QKXA 2M16A 2CH4W 1M9SA 2CP3A 1JBMA 4F16A 3LX7A 1N6AA 1X43A 3VS6A 3HHTB 4C92E 1QWFA 1FMVA 4CC3A 2ZZDA 5KYYA 5GMKe 1ZHIA 2JS0A 1OPLA 1VUBA 1NJIU 4OF1A 2J06A 3NHNA 4QW2A 4IUVA 3THKA 1PHTA 2KROA 1ZSZB 3L2QA 1C1AA 4N4GA 2HL3A 4KGVB 4BI8B 1Q7YU 3HFNA 2DEQA 1VQNT 4FIBA 4DQ2A 3MEWA 1OULA 1KIKA 1SF9A 2EKOA 1QVGS 3TU4K 1RL2A 2RHUA 3E1SA 5IAYA 5CO7A 2EJGA 5DM7R 2DEUA 1D0XA 1FX7A 2DD4A 5LJ3j 3OW2S 1G2BA 2DF6A 2IPOB 1IB8A 4OMLA 2DFUA 2GTOA 3CCLA 1TUGB 3RBBB 1RUWA 3VU3C 4C5EA 4JZ3A 4Y92A 3H0IA 4X34A 2XD0A 2NUZA 2LJ0A 2O9VA 3QDFA 1YJWT 3JB9G 1JRIA 3R6OA 1R8OB 3BW1A 2LCSA 4BACA 5HY6A 1JQQA 4BE0A 2EGEA 5IT9E 2BUDA 3LYIA 3PGGA 4HA8A 5GAN2 4AT1B 3A98A 3BDLA 2AKLA 2M9UA 4IURA 5GAN7 2X9HA 2D1XA 3QJYA 3EFSA 4LDXA 1ZUYA 1VQ4A 5FWBA 1MV3A 1VQ6T 1VQOQ 2FZGB 2VUBA 2MMPA 5J39A 1VQ5T 1VQLT 2EGAA 4M78B 3ZFJA 2JMAA 1H641 4XQ3A 3HFOA 3CBMA 1W4SA 2OAUA 4M7DB 2EYWA 2DBMA 3L2WA 3M0UA 4XTUA 3EGDA 3BE3A 8ATCB 2V8JA 2FRWA 4RCBA 1IGQA 1Y96A 2DAQA 2KT8A 4E7HA 4UC4A 2P0KA 4C0DB 2ZPBB 2D0NA 1QW1A 2DTHA 2QYZA 3VRYA 4XK8E 4BY6C 1NJIR 3OYEA 1WHLA 2KXDA 3S3MA 1YN8A 2HQEA 2O4XB 4WCIA 4VUBA 2KGTA 1M90R 4RMOA 4M77D 1OX9A 4DA4A 4PJOF 3ER0A 4A63B 4ZGEB 4ZGJB 2F5TX 4OGEA 1BI3A 1WXUA 2OTJT 1PRLC 2RHXA 2KK4A 2FZCB 5GJWB 3EHQA 1MNDA 4NS5A 1K9AA 4NL3A 1ZUKA 1Y07A 5AT1B 1XTDA 1LNXA 4PJOC 3OYLA 1SSFA 2OI3A 4DOWA 3NTHA 5GAOl 3CC2Q 4PJOA 3CMET 1WHMA 3CCQT 3RKYA 1Q95G 3V7CA 4ZN1A 1KQ1A 1KHIA 4HT9A 2KI7A 4IUTA 4J6XA 4C5GA 5LJ5e 1H8KA 4RKUE 3G6ET 2VC8A 4M75G 4ORZA 5FU7C 4R55A 1M90C 2PUOB 3FIFA 1WYXA 3TVTA 2VV5A 3P8DA 2CS7A 1R77A 3GOXA 2AT1B 2XIDA 1YIJA 2KRSA 1NE8A 2LRQA 3CC7T 1KD1U 2KRNA 2BZYA 1D0ZA 2K5IA 2NUPA 4M7AG 3WVEB 1TSFA 1UTIA 4EIKA 4DBHA 4JLIA 1VQ8T 2VKNA 2QA4T 4PJMA 2D9TA 5I21A 2FL7A 2LNVA 1MMAA 2GFAA 2VWFA 4PJLA 1OV3A 4FYWB 2RI2A 4R56A 2ZGWA 1R0BG 1M3AA 4FW2A 5A0GA 1RAFB 2GCXA 3L2UA 4KRTA 4HVWA 3M0QA 3G4SQ 4M7AE 3L2RA 4JZ4A 3LWHA 1SKUB 3KUFA 2BIVA 4YTLA 1UJ0A 2CP6A 1U3OA 4QVZA 2E3HA 1BI1A 2K7AA 2A28A 4FL6A 5HK3A 1UGRB 3IQLA 4XTXA 3MEUA 4J9BA 1UFFA 1SG5A 2EW3A 2QGFB 5A0LA 1NLOC 1BI2A 4BDZA 1VQPQ 5KYXA 4F7UB 1YJ9T 1MNEA 3V8LA 1O9SA 1QCNA 2A36A 4DBQA 5CQYA 1A0NB 2CZ6B 2XG8D 2PVOB 2QQRA 3G6EA 2RQWA 2XK0A 3QKJA 4LXCA 2E41A 4F04B 1VQOA 2QK0A 4IUQA 1BYMA 3UA6A 3CC7A 5GANj 3EG1A 2LJ1A 3F70A 3QZ9B 3CCET 1GBQA 4M77F 2CKKA 1ZA1B 2M0OA 4LUDA 1WHHA 1VQ8A 4KH1B 4NOYA 2KXCA 2LTOA 2X35A 3CD6A 4XTWA 1P92A 1I8FA 1YHQA 2F1LA 1VQ9A 1KK7A 3QG1A 2YLBA 4M77C 1GL5A 4LDUA 1QVGA 4M77A 4J8OA 2LVMA 2PQWA 1NG2A 3VYGA 4Z89A 3MJXA 1QVFP 2HCKA 2PNIA 5I22A 3OW2A 2EQKA 1I0CA 3J80E 2JNGA 3H6ZA 2RN8A 4OGCA 2P4TA 3NPFA 2V1RA 3OA6A 4J83A 3QHSA 5D6WA 2AHJB 2COYA 1IRXA 3JCMe 5IXFA 3HSBA 2W10A 3NTKA 2HQHA 2QQ9A 3I56Q 2GNCA 2FVUA 3I35A 4EPCA 4CC2A 1QWEA 4M78G 3M0SA 1YI2Q 1LOJA 2AZSA 5FU6B 4M7DG 3CCMT 3A8OB 3I9QA 3LGFA 5I2MA 2L2PA 1IO6A 1M2VA 3OQ5A 2OX7A 2ED1A 1EX4A 3KFVA 3J7AF 1DJ7B 2E6ZA 3UT1A 4EMKC 2R5MA 3HKSA 1VQMT 1ZQ1A 4EMKA 5GMKm 3QWYA 3G71T 2BZXA 3CC4T 4A4KA 4M78E 4ZGDB 2MI6A 1AZEA 3NMZC 4L59A 1GFCA 2YRVA 4M7DE 1VQKQ 5CVIA 1HK9A 3SEMA 1KC8R 1UECA 1OI1A 1JO8A 1NZ9A 1Q81R 4C92D 2ZPFB 1KSWA 2VYTA 5GANg 3EFOB 2FZKB 3H41A 3VJPA 1X6GA 1PNJA 2DTIA 1M3CA 1ZX6A 1RI9A 1M5Q1 2ED0A 1NPRA 1M3BA 1QCOA 6AT1B 2YSQA 3M54A 2DXUA 3OMGA 3SWNC 2DLPA 1NYFA 3SWNA 3OYGA 5GANf 1K8AU 1UDLA 1I07A 3OMCA 2E10A 3CBPA 2RQRA 2FPEA 2HNIA 2X4JA 1VYVA 2RJFA 4EMHA 3CPWP 3LGLA 2DK3A 2E5KA 1YJNT 1KC8C 1HJDA 2IVWA 5GAMj 5KE3A 2VGMA 1Q81C 3OS0A 3X25B 3TCJA 2CT3A 2LX7A 4F14A 4GY5A 3PTAA 5A2QE 4PLIA 1N9RA 2MYSA 1ZSGA 2RK1A 2CP7A 3M9QA 2H3EB 2KEAA 3RERA 3EG0A 2MCNA 1OU9A 3RUXA 3M0PA 3OS2A 1XJWB 4Z02A 3HTRA 3Q1JA 5GMKj 2DERA 3JB9D 3G71A 1WLPB 3RKXA 3OBYA 2JZ2A 1X2KA 2LJ3A 2M0YA 4JJDA 3JCMh 1X6OA 3RDVA 1VOMA 3HPWA 4J6YA 2GQIA 4IIOA 2KSSA 3M0TA 2EJFA 4PFZA 2RO0A 2QEXA 1JJ2P 3JRZA 4M4ZA 2VGNA 4D8DA 2P4RA 2EQJA 4B6MA 2DO3A 8AT1B 1HYOA 2HQXA 2RHIA 2ZPHB 3MEAA 1GCQC 4GLMA 1X69A 3OYYA 4QQ6A 1GCQA 4ME7A 3ULRB 4FYYB 3QYGB 1W2BP 2JN0A 1AHJB 1U06A 1YJWQ 2RM4A 4F17A 4KT0E 4PJNA 2ESWA 2XICA 5DY9A 2DM1A 1ABQA 3GBQA 1NEGA 1PC0A 4JUVA 3PMIA 4N4HA 3JB9J 4F7UG 4B9WA 2C0TA 4AFZC 4D8KA 2Y4XA 2CSIA 1M30A 2DA9A 3M4GA 2OJ2A 3QBYA 3QXEB 2ZAEA 4A53A 3E9FA 4KGZB 2SRCA 3GPLA 4XU2A 3I56A 3QO3A 2NUTA 2O01E 1PKTA 1VQLQ 1KG1A 1IREB 3A5ZB 3X20B 4F7UE 4FT2A 4C92F 5GAMg 1W70A 2R58A 5KCOA 4JJCA 3AHUA 2E65A 2XKOC 1H3HA
chains in the Genus database with same CATH topology
3NTHA 4BI4A 3QPHA 3OB9A 3CMET 3HRUA 1Q81U 4XU3A 3CCQT 3G7ZA 3RKYA 3V7CA 2DZ9A 4BI3A 4ZN1A 1KQ1A 3WVDB 5KCHA 1KHIA 4J7FA 4RG8A 3NFCA 4C92C 2O4XA 2Y90A 5GAMf 3OYFA 3I56T 3FJPA 2XDPA 3JCMP 2PVDB 2WACA 4C92A 4HT9A 4IUTA 4J6XA 2DD5A 4C5GA 2RJEA 2QA4A 1Y7XA 2JUFA 5LJ5e 3VYHB 1VQKA 1QP3A 1WGSA 2DIGA 1VQPA 4RKUE 3G6ET 1YI2T 3OYIA 2VC8A 1IZ6A 4M75G 5GAOn 5FU7C 3WXMB 4R55A 5LJ5h 2LDMA 2PUOB 2ZPIB 4O6JA 1S72A 3FIFA 4C8QG 3DLLA 5LJ5d 3OY9A 4E7JA 5L8RE 2VV5A 3PMTA 2LCLA 2L8DA 5GAN5 2E6NA 2OTLT 3P8DA 3SFMA 3QDRB 1D3BA 2RA2A 2JOYA 2CS7A 4BE1A 3S6WA 4C8QD 3FC3A 3GOXA 2XIDA 2M1HA 3RKWA 1YIJA 1MHNA 1NE8A 2LRQA 3M5AA 3M4YA 4E47A 1KD1U 3CC7T 2XDBA 4CI0C 2K5IA 3J81E 4A4HA 1N27A 3A8HB 3CCST 2XI9A 3JCMW 2HAXA 3KXTA 3URGA 3X26B 2EYQA 3CBOA 4L5GA 3WVEB 5FRMA 4M7AG 3QYHB 2ZPGB 4RG2A 4X9CA 3EAEA 4A54A 1VQ8T 4JLIA 2L3RA 2I2LA 2QA4T 2V8KA 4C8QE 4M7AD 1M1FA 1VQKT 3P8BB 1OYXA 1QVPA 2D9TA 3QZ5B 5I21A 5GAN4 5I2SA 2HBPA 2FL7A 2K4YA 1XQHA 2LNVA 3CXCA 3M58A 3CXCS 4ATOA 2GFAA 1S72T 3M55A 2G3RA 5CCAA 4LD6A 2LQKA 2RI2A 4QVCA 2ZGWA 4R56A 3JB9F 1M1KC 1N8RU 1GXIE 3FDRA 3T9NA 5LJ5j 5A0GA 3OSVA 2GCXA 3L2UA 4NL2A 1G3WA 2BKDN 4JJNK 4M7AE 4KUDK 1YIJT 3CPWS 3CPWA 1YJ9A 4IUUA 3L2RA 3E19A 5M9OA 3GF5A 3LWHA 1N9SA 2GFUA 5GAN3 4PNOA 3KUFA 5C6SA 3I55A 1KQSS 1KQSA 2BIVA 4YTLA 3INZA 4JRQA 2HD0A 3E9GA 4B9XA 3JB9I 4HCCA 5GANe 3GIBA 1QVFS 2DZCA 5J26A 2EQMA 4QVZA 1BI1A 1G5VA 3ZBDA 4DOVA 3JCMX 5GANh 4FL6A 5HK3A 1XNIA 1UGRB 5GANd 1K9MU 4XTXA 5GAOm 3OYCA 1VIFA 3MEUA 2ZCFB 4IUPA 2MAMA 2WSCE 4J6WA 3M57A 3OYMA 1WQ7A 5A0LA 1OZ3A 3MP1A 3CCEA 1BI2A 2Y4YA 4BDZA 4BB7A 3RESA 1M4ZA 2GF7A 1Q86U 2JTFA 2JTMA 2P0PA 2MWPA 3RMSA 5GAN8 3ZEHA 4F7UB 1YJ9T 4P5NA 3VUBA 1G3TA 2E1HA 2PVGB 2KY9A 3V8LA 4E7KA 1Q81C 2X4WA 1O9SA 1I5LA 3X24B 5CQYA 2CZ6B 4OMFB 2A7YA 2RJDA 3HP9A 2XG8D 3V7SA 2PVOB 2QQRA 2KVQG 4M77B 3G6EA 1YI2A 4V2SA 4MMLA 2XK0A 4FSXA 3QKJA 4J7IA 3V8JA 5LJ3e 2QXFA 4OP0A 1EIFA 3FEOA 1I4K1 2E41A 5CK9A 3HL8A 3BFMA 5GMKl 5LJ3d 1VQOA 2D0QB 4IUQA 1K73U 3GLXA 5D6YA 1BYMA 4F7UF 3OS5A 4MDXA 2LT1A 2KQWA 1JJ2S 1JJ2A 1VIEA 3QUIA 4JRIA 3P8HA 3CC7A 2DXCA 4C0ZA 2EIFA 3RMQA 5GANj 3SD4A 3F70A 3CCSA 3QZ9B 4BDYA 3CCET 3DB3A 3C12A 4M77F 2CKKA 4FM4B 4XAXB 2DIQA 4EDUA 5CR2A 3OYDA 2M0OA 4PLLA 5FLXE 2LQ8A 1K8AC 2EJ9A 1NJIC 2RD1A 4JS5A 1VQ8A 3VUZA 2PU9B 4ZTJA 1W2BS 1W2BA 4MZPA 4NOYA 3OSSC 2LTOA 3EFRA 2X35A 3VKIA 3CD6A 4XTWA 1M90U 1P92A 1I8FA 1U1TA 5KH6A 4F7UA 1YHQA 4JRPA 1BKBA 2A3LA 1VQ9A 3PFSA 5CKBA 2DKGA 1YITA 3FB9A 3PNWC 2IG0A 2YLBA 2RJCA 3QG1A 4RCCA 1Q7YC 4XTYA 3S3NA 4M77C 1UGSB 5CKDA 3LW5E 2MF2A 4LDUA 1QVGA 4M77A 2YHTA 4J8OA 5KE2A 4M75D 2L89A 2LVMA 2PQWA 4FU6A 3CMAA 3VYGA 1BIAA 1VQOT 1U8RA 4J5YA 2CZ1B 4IKFA 1M8VA 2X4XA 1UB4A 2EWNA 3OW2A 3PIPA 3UPUA 3A8MB 4JLGA 2EQKA 3CCMA 4JRKA 4O5VA 1X75C 1B34B 1TH7A 2JNGA 3J80E 4M75B 3X28B 1YBYA 3H6ZA 4E7LA 1YCYA 4OGCA 1Y71A 2P4TA 1WNLA 4C8QB 3TREA 3KBGA 3FLGA 4EMKB 2VXFA 4JS4A 3OA6A 4A4GA 4J83A 3QHSA 4BUGA 4M75E 4XTZA 5D6WA 5LJ5g 2AHJB 5HKCA 3MHXA 4II1A 2QDYB 2R57A 3JCMe 1VQMA 5FROA 3CD6T 2E70A 3JCMc 1YHQT 3CC4A 3HSBA 1VQ9T 3NTKA 2F69A 4Y91A 1YITT 2QQ9A 1M1KU 4MZTA 2EAYA 3JCMd 2FVUA 5DLQE 2DXTA 2XU8A 3PT9A 4M7AB 4EPCA 3C95A 1KHCA 3BY7A 3QIIA 4MDWA 5J3BA 4C8QF 3A8LB 2CYZB 2LT4A 3CMAT 1XOVA 4M78G 2DPPB 4Q5WA 1I81A 1WQWA 5CAIA 5LJ5f 4BE2A 3OYKA 2LX9A 2LC4A 1LOJA 3UWNA 5FU6B 4M7DG 3CCMT 3A8OB 5GAOr 4M78D 3LGFA 4N0AC 3CCLT 3V8KA 5I2MA 2CGHA 1QP2A 4N0AA 3OQ5A 4QQDA 2K2VA 1H3ZA 2KAFA 3C4SA 4CRIA 2DTOA 4M7DD 4M7AF 4M75A 4C8QC 1WJSA 2K3XA 4KBMB 4WF2A 3J7AF 5CKEA 1DJ7B 2E6ZA 3UT1A 4C8QA 4EMKC 3CCVA 2R5MA 3HKSA 1VQMT 1ZQ1A 4TVRA 4EMKA 5GMKm 3MEVA 3OYBA 1G3YA 1LJOA 4PJOG 3SWNB 2KMTA 3G71T 2CZ7B 3ME9A 3CC4T 1UGPB 2FHDA 2MWOA 4OB1B 5EG2A 2FYKA 4A4KA 4M78E 4ZGDB 1N8RC 2MI6A 3GNGA 1Q82U 1OZ2A 4L59A 4PJOD 2YRVA 3TEEA 4ELZC 4M7DE 5CVIA 3V7RA 1HK9A 2K57A 4M7AC 3NTIA 4PL6A 3DB4A 4C92G 1OI1A 4HCBA 3N5BB 4LD9K 2P0QA 3HRSA 4HCZA 1FXXA 4M7AA 4ZN3A 3META 1NZ9A 4XTVA 3L42A 5LL6S 5GAMe 4C92D 2ZPFB 1VQ4T 4OVAA 5FU6C 2VXEA 2VYTA 3RIRA 3OYNA 2QQAA 2DXBA 1VQNA 5GANg 4PJOE 5CIUA 5GAMh 2DJZA 2QQBA 1YJNA 3VJPA 5GAMd 1K9MC 2E12A 4Y28E 3QSUA 2K5LA 2DTIA 5A0DA 3OS1A 4OB3B 2M16A 3CCVT 4JDSA 5DLOA 2RI5A 1M5Q1 1BI0A 2RHYA 1NPRA 5LJ3h 4HT8A 1M9SA 3JSCA 1JBMA 3CCJA 3LX7A 3M53A 1N6AA 3M54A 2QTXA 2DXUA 3HHTB 3OMGA 4L6V5 3SWNC 4C92E 3PIOA 3OBWA 1Q86C 3L2VA 3SWNA 2ZZDA 3OYGA 5GMKe 1ZHIA 2RB6A 2EQUA 4N4IA 1HXDA 5GANf 5IN1A 1K8AU 1VUBA 2RH2A 4X9DA 1G3SA 4OF1A 4C5IA 1NJIU 5D6XA 3OMCA 2E10A 2C06A 3CBPA 2GQVA 5GMKh 2H3JA 1YJWA 2HNIA 4IUVA 4QW2A 1X01A 2X4JA 4KULA 3L2QA 2RJFA 4N4GA 4BI8B 1Q7YU 4EMHA 3OYJA 3HFNA 5LJ3g 5GAOp 2DEQA 3LGLA 1VQNT 4FIBA 1K73C 3OYAA 2DK3A 3GNFB 4DQ2A 3MEWA 1YJNT 1KC8C 3MO8A 1BIBA 4EMGA 2EKOA 4A4FA 4BD3A 1QVGS 3TU4K 2IVWA 1RL2A 1WJQA 2VGMA 3LLRA 2RHUA 3QJ6A 5KE3A 5GAMj 4PKCC 3X25B 1ZBXA 3OS0A 3E1SA 3M59A 2X4YA 3CCJT 3UDCA 3MP6A 5CO7A 2EJGA 3TCJA 5AYFA 5IAYA 5DM7R 1FX7A 2DD4A 2L5QA 4GY5A 5LJ3j 5A2QE 3PTAA 3OW2S 4PLIA 4MMKA 1N9RA 2RK1A 5LJ3f 3JCMQ 2PUKB 3M9QA 3CCLA 4QVDA 3RERA 3JCMb 2KDSA 3VU3C 2WSEE 3H8ZA 4C5EA 1VQ6A 3G4ST 2QQSA 1M1GA 4X34A 2XD0A 4MZMA 3RUXA 1YJWT 3JB9G 3OS2A 1JRIA 3R6OA 1VQ5A 4LDVA 2JVVA 1VQLA 4ELYC 4LDWA 4Z02A 3S3OA 4OB2B 3MP8A 1R8OB 3DLMA 3Q1JA 3BW1A 5GMKj 3CCRT 4GLKA 3JB9D 3G71A 1M90C 2DVEA 3OYHA 2K5FA 4BACA 4ZTFA 2R5AA 5HY6A 3RKXA 3OBYA 2F5KA 2JZ2A 4BE0A 1MGQA 3HRTA 3JCMh 3GP8A 1Y96B 1X6OA 4M75F 1VQ7A 3HPWA 4J6YA 5GAOq 5IT9E 2BUDA 1KD1C 4HKEA 3LYIA 1FWZA 3PGGA 2KSSA 3CC2A 2YLCA 4HA8A 5GAN2 3CCUT 2B8AA 1UEBA 3BDLA 3BDUA 2M9UA 4IURA 2E5QA 4BY6B 2EJFA 5GAN7 2RO0A 3CEYA 3QJYA 3EFSA 4LDXA 2NLUA 1VQ4A 2D6FA 2QEXA 3JAME 3JRZA 1VQPT 2VGNA 4A4EA 1VQ6T 2EQJA 4C0FA 2V8IA 4LDYA 2DO3A 2VUBA 4M75C 3SB2A 2HQXA 2K3YA 3M56A 2MMPA 1B34A 2FB7A 3DKMA 4KUIA 2RHIA 2ZPHB 5J39A 1VQ5T 5FRNA 1VQLT 3MEAA 3JCMg 3L2ZA 4M78B 3ASKA 3OYYA 4QQ6A 5CKHA 3ZFJA 1H641 4ME7A 4XQ3A 3HFOA 3CBMA 1NPPA 3A8GB 3LWIA 1W4SA 1WJRA 2OAUA 4M7DB 2QI2A 3QYGB 3L2WA 2JN0A 1AHJB 2RM4A 4KT0E 1VQ7T 3SDZA 4XTUA 2V8JA 3O8VA 2XICA 4XU1A 1UGQB 5DY9A 4RCBA 2OTJA 3CC2T 1Y96A 2DAQA 1JB0E 5CKFA 4E7HA 3JCMf 4UC4A 2P0KA 4C0DB 2ZPBB 4M78F 1QVFA 3L1AA 4JUVA 4C5HA 3PMIA 4N4HA 1QW1A 2DTHA 3VV0A 4PJOB 2RHZA 3JCMJ 3JB9J 4E7IA 1KQ2A 4F7UG 4M7DF 4XK8E 4B9WA 4BY6C 3OYEA 2QEXT 2EFIA 3CCUA 2RK2A 2Y4XA 2LCCA 3CMEA 4OB0B 3S3MA 3C94A 4M77G 3CCQA 2HQEA 3FRNA 2O4XB 3M4GA 2XHCA 3QBYA 4C92B 1O75A 4VUBA 1Q82C 3QXEB 2OTLA 4XU0A 4A53A 4M78C 3E9FA 4RMOA 3JB9H 4M77D 2CZ0B 3GPLA 1RI0A 4XU2A 3I56A 4M78A 4DA4A 4PJOF 3ER0A 3QO3A 1PSEA 4ZGEB 4ZGJB 2XDDA 2F5TX 4M7DC 1PSFA 4OGEA 2O01E 3CPFA 1BI3A 5CQXA 4FT4A 2E64A 4M7DA 3I55T 5FU7B 2RI3A 1IREB 5HK0A 3JCMV 1KG1A 3A5ZB 4PJOA 3X20B 4F7UE 2OTJT 1U1SA 1WPYA 2KK4A 2RHXA 4QQGA 3G4SA 1D3BB 3LH0A 2ZPEB 4C0GA 4FT2A 4C92F 5GAMg 4NS5A 2R58A 3MCAB 5KCOA 4D6WA 4NL3A 5GAN6 4C0DC 4M77E 2WSFE 3AHUA 1Y07A 1V29B 1XTDA 1LNXA 2E65A 2XKOC 3OYLA 3CCRA 5GMKi 1KC8U 4PJOC 1SSFA 5C0MA 4DOWA 5GAOl
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4Z A;  4BB7 A;  4DA4 A;  4LD9 K;  3TU4 K;  2FL7 A;  1ZHI A;  4FT4 A;  1ZBX A;  4KUI A;  2FVU A;  4DOV A;  3PT9 A;  3PTA A;  4FSX A;  4FT2 A;  1W4S A;  4JJN K;  4KUL A;  4KUD K;  4DOW A; 
#chains in the Genus database with same CATH topology
 3QPH A;  2D8H A;  1W1F A;  3G7Z A;  2DZ9 A;  3FJ5 A;  4ANJ A;  4C92 C;  5GAM f;  2XDP A;  2PVD B;  4C92 A;  2L3S A;  1E7O A;  2CH4 A;  1M1K R;  5IXB A;  1PWT A;  1VQK A;  3CCV Q;  2A0F B;  3OYI A;  2ZPI B;  1S72 A;  3DLL A;  2DX1 A;  2J7I A;  2QAZ A;  2O31 A;  3MKD A;  4E7J A;  3PMT A;  1VYU A;  1D3B A;  2RA2 A;  2JOY A;  3S6W A;  2OTJ Q;  3VS2 A;  2M1H A;  1MHN A;  2XDB A;  2HSE B;  1N27 A;  5KYW B;  4L5G A;  2Z0W A;  2ZPG B;  4X9C A;  2JMC A;  3EAE A;  3TQ7 P;  3CME Q;  4M7A D;  3P8B B;  3CQT A;  1QVP A;  1TG0 A;  2OTL Q;  1K0X A;  5I2S A;  2HBP A;  3CCJ Q;  1XQH A;  3CXC S;  2KBT A;  5CCA A;  1WHG A;  3JB9 F;  1M1K C;  1N8R U;  2DJQ A;  3FDR A;  5LJ5 j;  4NL2 A;  2ECZ A;  1G3W A;  2BKD N;  4J9D A;  2KRM A;  1YIJ T;  3CPW S;  3EGX B;  2OAW A;  1KQS S;  3H0H A;  3CCR Q;  2BE7 D;  4JRQ A;  2J05 A;  4PK4 A;  4B9X A;  4HCC A;  3EG3 A;  2QTV A;  5J26 A;  1QLY A;  1OOT A;  2FO0 A;  4RTU A;  1GBR A;  3ZBD A;  2DNU A;  5GAN d;  1K9M U;  3OYC A;  5GAO m;  4IUP A;  2ZCF B;  2MAM A;  5FW9 A;  2DMO A;  1OZ3 A;  2QA4 Q;  1IHW A;  1LVK A;  4BB7 A;  1UUE A;  1Q7Y R;  4Z8A A;  2JTM A;  2P0P A;  2MWP A;  4P5N A;  3VUB A;  2E1H A;  2PVG B;  2KY9 A;  4E7K A;  3HP9 A;  3V7S A;  4MML A;  4FSX A;  5LJ3 e;  2QXF A;  1EIF A;  2YUP A;  1VQ7 Q;  5CK9 A;  1RAC B;  2EKH A;  4KGX B;  1K73 U;  2D0Q B;  3OS5 A;  1TS9 A;  2LT1 A;  2KQW A;  1JJ2 S;  1VIE A;  3P8H A;  4C0Z A;  1UGV A;  4BDY A;  3DB3 A;  2K9G A;  4FM4 B;  2HMA A;  3REB B;  4OMO A;  1NJI C;  2L0A A;  4CC7 A;  1W2B S;  3VKI A;  5KH6 A;  1Q7Y C;  4RCC A;  1G83 A;  4XTY A;  3S3N A;  5CKD A;  1UGS B;  1YJ9 Q;  3LW5 E;  1JEG A;  2XMF A;  3I55 Q;  1VQO T;  1E6H A;  4OMP A;  3TSZ A;  1B07 A;  4E7Z A;  3AT1 B;  3A8M B;  4JRK A;  2FPD A;  2C0O A;  1N8R R;  2EBP A;  1YCY A;  2J6F A;  5KYU A;  1Y71 A;  2YUO A;  5IHI A;  4C8Q B;  3FLG A;  3CCU Q;  4M75 E;  5LJ5 g;  3MHX A;  4II1 A;  1UJY A;  3CCE Q;  1MMD A;  3CD6 T;  1KFZ A;  3JCM c;  1YHQ T;  3I5R A;  1VQ9 T;  2F69 A;  2EAY A;  2E4H A;  2DXT A;  3PT9 A;  3A8L B;  1WXT A;  1K9M R;  1WQW A;  5LJ5 f;  3OYK A;  2H8H A;  2LX9 A;  3O5Z A;  4HVV A;  1D09 B;  3UWN A;  5GAO r;  4M78 D;  2X51 A;  4N0A C;  3V8K A;  4N0A A;  3EH2 A;  2DVJ A;  4PFP A;  1H3Z A;  2K2V A;  4M7D D;  1WHK A;  2DL8 A;  3RNJ A;  1YCS B;  4M75 A;  4R0K A;  4M7A F;  4KBM B;  2EGC A;  2K3X A;  4WF2 A;  2L3P A;  3UAT A;  1PD0 A;  3CCV A;  3CCS Q;  4TVR A;  4FCY A;  3MEV A;  5KYY B;  3EHR A;  1UGP B;  2FHD A;  1N8R C;  5EG2 A;  3UF4 A;  3GNG A;  1Q82 U;  1OZ2 A;  1GFD A;  3TEE A;  4ELZ C;  2ROT A;  1H92 A;  1K73 R;  2K57 A;  4M7A C;  4HCB A;  4LD9 K;  4HCZ A;  4M7A A;  3MET A;  4J9F A;  5LL6 S;  2VXE A;  2QQA A;  3EG9 A;  5CIU A;  5GAM d;  4DEY A;  1K9M C;  2E12 A;  5A0D A;  4OB3 B;  3CCM Q;  4JDS A;  5DLO A;  2RI5 A;  1BI0 A;  5LJ3 h;  3CCJ A;  2QTX A;  4L6V 5;  1D1C A;  1WFW A;  3PIO A;  3OBW A;  1IGU A;  3L2V A;  3VS5 A;  1MV0 B;  2CP2 A;  1NLP C;  2RH2 A;  4X9D A;  4C5I A;  2C06 A;  3CC4 Q;  1KD1 R;  4J9C A;  1X01 A;  3OYJ A;  5GAO p;  3D7S B;  1K73 C;  2BZ8 A;  4BD3 A;  3LLR A;  3QJ6 A;  1WZO A;  1ZBX A;  3M59 A;  1TOV A;  4FYV B;  3UDC A;  3MP6 A;  5AYF A;  4AMC A;  4MMK A;  5IHN A;  4K11 A;  1X27 A;  3NGP A;  3G1J A;  4QVD A;  1OPK A;  2WSE E;  3H8Z A;  3G4S T;  5HCK A;  4MZM A;  3M0R A;  1WX6 A;  4LDV A;  4ELY C;  4LDW A;  4OB2 B;  2VVK A;  1AWW A;  1ZSZ C;  2DVE A;  3EGD B;  3OYH A;  4ZTF A;  2R5A A;  1ZSZ A;  1RAG B;  4AFS C;  1Y96 B;  1VQ7 A;  5GAO q;  2VAS A;  1KD1 C;  2RQT A;  1FWZ A;  1GRI A;  1MUZ A;  3CC2 A;  2B8A A;  1Q82 R;  4BY6 B;  2NLU A;  1VQP T;  2O2O A;  2V8I A;  3SB2 A;  1T3S A;  1K0S A;  3DKM A;  4KUI A;  5FRN A;  1JXM A;  3JCM g;  3L2Z A;  1BB9 A;  5CKH A;  3H0F A;  1KJW A;  3TSW A;  1IHV A;  4FYX B;  1YNZ A;  3LWI A;  1WJR A;  2HBW A;  3SDZ A;  1BU1 A;  2NWM A;  3O8V A;  2JTE A;  4XU1 A;  3MPU B;  2A08 A;  2DRM A;  5CKF A;  4KH0 B;  3JCM f;  1QVG P;  4M78 F;  1YIT Q;  3L1A A;  1QMC A;  1NEB A;  1QKW A;  4C5H A;  3VV0 A;  4PJO B;  4E7I A;  1AWJ A;  3REA B;  4M7D F;  2QEX T;  3OW2 P;  2YT6 A;  3CMA Q;  3CCU A;  2RK2 A;  2CUD A;  2LCC A;  2ABL A;  3PVQ A;  3FRN A;  5D7U A;  1O75 A;  1Q82 C;  1SSH A;  3CCL Q;  1TTH B;  4M78 C;  2HEQ A;  2CZ0 B;  2DL4 A;  1RI0 A;  4M78 A;  2XDD A;  1OU8 A;  4M7D C;  4FT4 A;  2E64 A;  4M7D A;  5FU7 B;  2RI3 A;  4IIM A;  1RAA B;  2I0N A;  1U1S A;  1WPY A;  3G4S A;  3LH0 A;  1RLP C;  2ZPE B;  1PG5 B;  3MCA B;  4D6W A;  4C0D C;  1S1N A;  2WSF E;  1V29 B;  1BBZ A;  1AWO A;  2NUP B;  4BI4 A;  5KYU B;  3OB9 A;  4XU3 A;  2DL3 A;  1D1B A;  4BI3 A;  4FSS A;  5IHK A;  1VQ4 Q;  4RG8 A;  3OYF A;  3NFC A;  2O4X A;  2Y90 A;  3JCM P;  3I56 T;  3FJP A;  4E7S A;  1BCM A;  2RJE A;  2JUF A;  2LMJ A;  1VQP A;  1YI2 T;  1IZ6 A;  2LDM A;  4C8Q G;  5LJ5 d;  3OY9 A;  2L8D A;  2G6F X;  2V26 A;  1SHG A;  1YP5 A;  1G8X A;  3RKW A;  3M5A A;  4E47 A;  2YDL A;  4CI0 C;  1ACM B;  1AEY A;  2JXB A;  2XI9 A;  5FRM A;  1TUD A;  1YWO A;  1JU5 C;  3QYH B;  2K3B A;  4RG2 A;  5IH2 A;  1VQN Q;  4A54 A;  4AFQ C;  2DL5 A;  2I2L A;  2CT4 A;  2V8K A;  4C8Q E;  4DBR A;  1TWB A;  1VQK T;  2CDT A;  1R0C B;  3SHW A;  2ATC B;  1S72 T;  3M55 A;  2G3R A;  3H9N A;  1NM7 A;  4PFO A;  5KYX B;  4QVC A;  1GXI E;  3OSV A;  4AG1 C;  4JJN K;  3E19 A;  1SRM A;  3GF5 A;  2SEM A;  4HCK A;  5M9O A;  1N9S A;  1U5S A;  1W6X A;  4PNO A;  2DYI A;  5GAN 3;  5C6S A;  4RTT A;  3LH5 A;  2YRC A;  2X3X D;  3INZ A;  2HD0 A;  3E9G A;  3GIB A;  1QVF S;  2DZC A;  1BK2 A;  1YWP A;  2EQM A;  1ZA2 B;  4DOV A;  2RMO A;  3JCM X;  5GAN h;  1K8A R;  1XNI A;  1WIE A;  1F1B B;  1VIF A;  4LUE A;  1HSQ A;  4J6W A;  3M57 A;  2QDL A;  1UHF A;  2A37 A;  2MOX A;  3RES A;  2GF7 A;  1Q86 U;  2JTF A;  1VQ6 Q;  5GAN 8;  3ZEH A;  1G3T A;  1VQ5 Q;  2X4W A;  2AIR B;  1I5L A;  4OMF B;  3VS3 A;  2COW A;  2KVQ G;  4M77 B;  1YI2 A;  4V2S A;  4WTO B;  4J7I A;  2GBQ A;  3V8J A;  4OP0 A;  1I4K 1;  2YUN A;  1PCX A;  3HL8 A;  1FMK A;  5D6Y A;  4F7U F;  4MDX A;  5EC7 A;  1YFN A;  4JRI A;  1D1A A;  2DXC A;  2PZ1 A;  2EIF A;  3RMQ A;  2MK5 A;  2FPF A;  2LP5 A;  4EDU A;  3OYD A;  4PLL A;  2DYB A;  1K8A C;  2EJ9 A;  2RD1 A;  1NYG A;  3EFR A;  1M90 U;  1U1T A;  4F7U A;  2DKG A;  4J9H A;  3FB9 A;  1YIT A;  3PNW C;  2IG0 A;  1D0Y A;  1SPK A;  3JV3 A;  2YHT A;  2HKQ B;  4M75 D;  2L89 A;  2LQW A;  3CMA A;  2CZ1 B;  3VS7 A;  2VB6 A;  1M2V B;  1QCF A;  3UPU A;  2GTJ A;  4O5V A;  1TH7 A;  3X28 B;  1YBY A;  4E7L A;  2QGG A;  3VS0 A;  1WNL A;  4QT7 A;  3KBG A;  3PE0 A;  4EMK B;  1V76 A;  2VXF A;  4A4G A;  2JM8 A;  3U23 A;  5HKC A;  3CCQ Q;  2CRE A;  2QDY B;  2E70 A;  1I1J A;  4MZT A;  3JCM d;  1KHC A;  5J3B A;  2LT4 A;  2ENM A;  1X6B A;  1XOV A;  2DPP B;  4Q5W A;  4E6R A;  3G6E Q;  5CAI A;  4BE2 A;  2M02 A;  2LC4 A;  1RAD B;  1HD3 A;  5I11 A;  2CGH A;  1QP2 A;  1WHJ A;  2HL5 C;  2KAF A;  3C4S A;  1Q86 R;  2DTO A;  1RAI B;  1CKB A;  4OMN A;  2EVR A;  1AOJ A;  1WJS A;  3CC7 Q;  5CKE A;  1ABO A;  2P84 A;  2RQU A;  1T0H A;  1LJO A;  4PJO G;  3SWN B;  4OB1 B;  2FYK A;  1EFN A;  1VQ8 Q;  2JS2 A;  3PVL A;  3CD6 Q;  4PL6 A;  1NBE B;  1YHQ Q;  2M51 A;  1VQ9 Q;  2P0Q A;  2B86 A;  3HRS A;  1FXX A;  2DET A;  1AD5 A;  1X2Q A;  2GGR A;  1Y0M A;  1OX8 A;  5FU6 C;  3RIR A;  1LPL A;  1VQN A;  4PJO E;  2L3Q A;  5GAM h;  2DJZ A;  3QSU A;  2IIM A;  2K5L A;  2K6D A;  3CCV T;  2RHY A;  4HT8 A;  1ZUU A;  2FG0 A;  3JSC A;  3UA7 A;  3M53 A;  2EYZ A;  1Q86 C;  2RB6 A;  2EQU A;  4N4I A;  1HXD A;  2BTT A;  5IN1 A;  1PD1 A;  1G3S A;  3EGU A;  5D6X A;  1M8M A;  2GQV A;  5GMK h;  2H3J A;  1YJW A;  1MMG A;  1LCK A;  4LNP A;  4KUL A;  2O88 A;  1N5Z A;  1PRM C;  5LJ3 g;  4HXJ A;  1C6V X;  3OYA A;  3GNF B;  1VA7 A;  3MO8 A;  3RR6 A;  1BIB A;  4EMG A;  2F2W A;  7AT1 B;  2C0I A;  4A4F A;  1AT1 B;  2OTL T;  1WJQ A;  3VS1 A;  3EFO A;  3CCJ T;  4PKC C;  2X4Y A;  3EH1 A;  2L5Q A;  1K1Z A;  2YWW A;  5LJ3 f;  3JCM Q;  2JW4 A;  2PUK B;  3JCM b;  2KDS A;  2KYM A;  1VQ6 A;  2F2X A;  5L23 A;  2QQS A;  1M1G A;  2DL7 A;  1UE9 A;  3I5S A;  2HSP A;  1Z9Z A;  1VQ5 A;  1VQL A;  2JVV A;  3S3O A;  3MP8 A;  3DLM A;  3CCR T;  4GLK A;  2KT1 A;  2K5F A;  2F5K A;  3EG2 A;  2FRY A;  1J3T A;  1MGQ A;  3HRT A;  3GP8 A;  2KE9 A;  4M75 F;  1RAE B;  1WXB A;  2HKN A;  4HKE A;  2JM9 A;  2YLC A;  1K4U S;  4JJB A;  1UEB A;  3BDU A;  2JJ9 A;  2E5Q A;  1C0M A;  3CEY A;  1B3Q A;  1JXO A;  2FEI A;  2D6F A;  3JAM E;  4A4E A;  4C0F A;  4LDY A;  4M75 C;  2AZV A;  2K3Y A;  2W0Z A;  3M56 A;  1B34 A;  2FB7 A;  3ASK A;  2NUT B;  1NPP A;  3A8G B;  4RUG A;  2QI2 A;  1QQJ A;  9ATC B;  1VQ7 T;  1GCP A;  2LZ6 B;  2E3I A;  1UGQ B;  4J9I A;  2OTJ A;  2JT4 A;  3CC2 T;  1JB0 E;  1QVF A;  2RHZ A;  3JCM J;  3R6N A;  1KQ2 A;  4J9E A;  2EFI A;  3CME A;  4OB0 B;  3C94 A;  1E6G A;  4M77 G;  2DE0 X;  3CCQ A;  2KNB B;  2XHC A;  2YXY A;  4RTZ A;  4C92 B;  2OTL A;  4XU0 A;  1WA7 A;  3JB9 H;  2CSQ A;  1PSE A;  1PSF A;  2EPD A;  2HDA A;  3CPF A;  1T0J A;  5CQX A;  2J6K A;  3I55 T;  5GJV B;  5HK0 A;  3JCM V;  1VQM Q;  4ESR A;  4QQG A;  3G71 Q;  4GBQ A;  1D3B B;  4C0G A;  1ARK A;  5GAN 6;  4M77 E;  2EYX A;  3CCR A;  5GMK i;  1KC8 U;  3CCU T;  5C0M A;  2YUQ A;  3HRU A;  1Q81 U;  3WVD B;  5KCH A;  2QEX Q;  4J7F A;  2WAC A;  3E2U A;  1AZG B;  2DD5 A;  4X1V A;  1ZLM A;  2QA4 A;  1Y7X A;  4OMM A;  3VYH B;  2RPN A;  1QP3 A;  1WGS A;  2F2V A;  2DIG A;  4HVU A;  1EZZ B;  5GAO n;  3WXM B;  5LJ5 h;  4O6J A;  2CP0 A;  5L8R E;  2LCL A;  5GAN 5;  2E6N A;  2RQV A;  3SFM A;  3QDR B;  4BE1 A;  5KYN A;  2DRK A;  4C8Q D;  4RTW A;  3FC3 A;  1FMW A;  3M4Y A;  2AK5 A;  3J81 E;  3CCS T;  4A4H A;  3A8H B;  3JCM W;  2HAX A;  3KXT A;  3URG A;  3X26 B;  2EYQ A;  3CBO A;  1AVZ C;  2L3R A;  1YJN Q;  1CKA A;  1TU0 B;  1M1F A;  1OYX A;  1M2O A;  3QZ5 B;  5GAN 4;  2K4Y A;  3CXC A;  4ATO A;  3M58 A;  3C0C A;  4LD6 A;  2LQK A;  3T9N A;  2DIL A;  1RAH B;  4KUD K;  4E2F B;  3CPW A;  1YJ9 A;  4IUU A;  2GFU A;  2EYY A;  3I55 A;  1KQS A;  2DBK A;  3JB9 I;  5GAN e;  5KYW A;  2O9S A;  3QWX X;  1G5V A;  4QKU A;  1FYN A;  2CUB A;  3ZL7 C;  4LN2 A;  2WSC E;  3OYM A;  1WQ7 A;  2CP5 A;  2EQI A;  3MP1 A;  3CCE A;  1SEM A;  2Y4Y A;  1M4Z A;  4ZNX A;  1UG1 A;  3RMS A;  1S72 Q;  1WDX A;  2NYS A;  1T3L A;  4FW1 A;  3X24 B;  1RAB B;  2A7Y A;  2RJD A;  3VRZ A;  3EGX A;  2K79 A;  4RTY A;  4DBF A;  3FEO A;  2RNA A;  1M27 C;  3BFM A;  5GMK l;  5LJ3 d;  4AG2 C;  3GLX A;  1WI7 A;  1JJ2 A;  3QUI A;  2QAS A;  3SD4 A;  3CCS A;  3C12 A;  3CXC P;  4XAX B;  2DIQ A;  5CR2 A;  1V1C A;  5FLX E;  2LQ8 A;  4JS5 A;  3VUZ A;  2PU9 B;  1Y57 A;  4ZTJ A;  1W2B A;  2ROL A;  4MZP A;  3OSS C;  1VYT A;  1OQK A;  2HZY A;  3A1P A;  4JRP A;  1BKB A;  2A3L A;  3PFS A;  5CKB A;  2RJC A;  2J6O A;  4PJJ A;  1KQS P;  3VS4 A;  2MF2 A;  1BCO A;  2V1Q A;  5KE2 A;  4FU6 A;  1BIA A;  1U8R A;  4J5Y A;  4IKF A;  2PTK A;  2LNH B;  2X4X A;  1M8V A;  1UB4 A;  2EWN A;  1ZBJ A;  4Z88 A;  1MMN A;  3PIP A;  4JPB W;  4JLG A;  2MPX C;  3CCM A;  1X75 C;  1B34 B;  4M75 B;  1TXQ A;  2KR3 A;  3TRE A;  2AKK A;  4LE9 A;  4JS4 A;  1OEB A;  1UHC A;  4BUG A;  4XTZ A;  4CC4 B;  4AFU C;  2LQN A;  2K2M A;  2R57 A;  5FRO A;  1VQM A;  1IXD A;  3CC4 A;  2RF0 A;  4Y91 A;  2KYB A;  1YIT T;  1M1K U;  2D8J A;  2MIO A;  4J9G A;  2COZ A;  5DLQ E;  5ECA A;  2XU8 A;  4M7A B;  3C95 A;  3BY7 A;  3QII A;  4MDW A;  1AWX A;  4C8Q F;  2CYZ B;  1SHF A;  3CMA T;  1I81 A;  1B7T A;  1Z9Q A;  3EG9 B;  2BE9 B;  3CCL T;  2X3W D;  4QQD A;  4CRI A;  4RTV A;  1SRL A;  4C8Q C;  4C8Q A;  1PKS A;  3OYB A;  1G3Y A;  2KMT A;  2CZ7 B;  3ME9 A;  2MWO A;  1I5O B;  2YRD A;  4PJO D;  1RLQ C;  3V7R A;  3NTI A;  3DB4 A;  4C92 G;  1K76 A;  3N5B B;  4ZN3 A;  4XTV A;  5FWC A;  4DEX A;  3L42 A;  5GAM e;  1TUC A;  1VQ4 T;  4OVA A;  2QG9 B;  1CSK A;  3OYN A;  2DXB A;  4OMQ A;  2QQB A;  1YJN A;  4RTX A;  4Y28 E;  1YIJ Q;  1PM3 A;  3OS1 A;  1QKX A;  2M16 A;  2CH4 W;  1M9S A;  2CP3 A;  1JBM A;  4F16 A;  3LX7 A;  1N6A A;  1X43 A;  3VS6 A;  3HHT B;  4C92 E;  1QWF A;  1FMV A;  4CC3 A;  2ZZD A;  5KYY A;  5GMK e;  1ZHI A;  2JS0 A;  1OPL A;  1VUB A;  1NJI U;  4OF1 A;  2J06 A;  3NHN A;  4QW2 A;  4IUV A;  3THK A;  1PHT A;  2KRO A;  1ZSZ B;  3L2Q A;  1C1A A;  4N4G A;  2HL3 A;  4KGV B;  4BI8 B;  1Q7Y U;  3HFN A;  2DEQ A;  1VQN T;  4FIB A;  4DQ2 A;  3MEW A;  1OUL A;  1KIK A;  1SF9 A;  2EKO A;  1QVG S;  3TU4 K;  1RL2 A;  2RHU A;  3E1S A;  5IAY A;  5CO7 A;  2EJG A;  5DM7 R;  2DEU A;  1D0X A;  1FX7 A;  2DD4 A;  5LJ3 j;  3OW2 S;  1G2B A;  2DF6 A;  2IPO B;  1IB8 A;  4OML A;  2DFU A;  2GTO A;  3CCL A;  1TUG B;  3RBB B;  1RUW A;  3VU3 C;  4C5E A;  4JZ3 A;  4Y92 A;  3H0I A;  4X34 A;  2XD0 A;  2NUZ A;  2LJ0 A;  2O9V A;  3QDF A;  1YJW T;  3JB9 G;  1JRI A;  3R6O A;  1R8O B;  3BW1 A;  2LCS A;  4BAC A;  5HY6 A;  1JQQ A;  4BE0 A;  2EGE A;  5IT9 E;  2BUD A;  3LYI A;  3PGG A;  4HA8 A;  5GAN 2;  4AT1 B;  3A98 A;  3BDL A;  2AKL A;  2M9U A;  4IUR A;  5GAN 7;  2X9H A;  2D1X A;  3QJY A;  3EFS A;  4LDX A;  1ZUY A;  1VQ4 A;  5FWB A;  1MV3 A;  1VQ6 T;  1VQO Q;  2FZG B;  2VUB A;  2MMP A;  5J39 A;  1VQ5 T;  1VQL T;  2EGA A;  4M78 B;  3ZFJ A;  2JMA A;  1H64 1;  4XQ3 A;  3HFO A;  3CBM A;  1W4S A;  2OAU A;  4M7D B;  2EYW A;  2DBM A;  3L2W A;  3M0U A;  4XTU A;  3EGD A;  3BE3 A;  8ATC B;  2V8J A;  2FRW A;  4RCB A;  1IGQ A;  1Y96 A;  2DAQ A;  2KT8 A;  4E7H A;  4UC4 A;  2P0K A;  4C0D B;  2ZPB B;  2D0N A;  1QW1 A;  2DTH A;  2QYZ A;  3VRY A;  4XK8 E;  4BY6 C;  1NJI R;  3OYE A;  1WHL A;  2KXD A;  3S3M A;  1YN8 A;  2HQE A;  2O4X B;  4WCI A;  4VUB A;  2KGT A;  1M90 R;  4RMO A;  4M77 D;  1OX9 A;  4DA4 A;  4PJO F;  3ER0 A;  4A63 B;  4ZGE B;  4ZGJ B;  2F5T X;  4OGE A;  1BI3 A;  1WXU A;  2OTJ T;  1PRL C;  2RHX A;  2KK4 A;  2FZC B;  5GJW B;  3EHQ A;  1MND A;  4NS5 A;  1K9A A;  4NL3 A;  1ZUK A;  1Y07 A;  5AT1 B;  1XTD A;  1LNX A;  4PJO C;  3OYL A;  1SSF A;  2OI3 A;  4DOW A;  3NTH A;  5GAO l;  3CC2 Q;  4PJO A;  3CME T;  1WHM A;  3CCQ T;  3RKY A;  1Q95 G;  3V7C A;  4ZN1 A;  1KQ1 A;  1KHI A;  4HT9 A;  2KI7 A;  4IUT A;  4J6X A;  4C5G A;  5LJ5 e;  1H8K A;  4RKU E;  3G6E T;  2VC8 A;  4M75 G;  4ORZ A;  5FU7 C;  4R55 A;  1M90 C;  2PUO B;  3FIF A;  1WYX A;  3TVT A;  2VV5 A;  3P8D A;  2CS7 A;  1R77 A;  3GOX A;  2AT1 B;  2XID A;  1YIJ A;  2KRS A;  1NE8 A;  2LRQ A;  3CC7 T;  1KD1 U;  2KRN A;  2BZY A;  1D0Z A;  2K5I A;  2NUP A;  4M7A G;  3WVE B;  1TSF A;  1UTI A;  4EIK A;  4DBH A;  4JLI A;  1VQ8 T;  2VKN A;  2QA4 T;  4PJM A;  2D9T A;  5I21 A;  2FL7 A;  2LNV A;  1MMA A;  2GFA A;  2VWF A;  4PJL A;  1OV3 A;  4FYW B;  2RI2 A;  4R56 A;  2ZGW A;  1R0B G;  1M3A A;  4FW2 A;  5A0G A;  1RAF B;  2GCX A;  3L2U A;  4KRT A;  4HVW A;  3M0Q A;  3G4S Q;  4M7A E;  3L2R A;  4JZ4 A;  3LWH A;  1SKU B;  3KUF A;  2BIV A;  4YTL A;  1UJ0 A;  2CP6 A;  1U3O A;  4QVZ A;  2E3H A;  1BI1 A;  2K7A A;  2A28 A;  4FL6 A;  5HK3 A;  1UGR B;  3IQL A;  4XTX A;  3MEU A;  4J9B A;  1UFF A;  1SG5 A;  2EW3 A;  2QGF B;  5A0L A;  1NLO C;  1BI2 A;  4BDZ A;  1VQP Q;  5KYX A;  4F7U B;  1YJ9 T;  1MNE A;  3V8L A;  1O9S A;  1QCN A;  2A36 A;  4DBQ A;  5CQY A;  1A0N B;  2CZ6 B;  2XG8 D;  2PVO B;  2QQR A;  3G6E A;  2RQW A;  2XK0 A;  3QKJ A;  4LXC A;  2E41 A;  4F04 B;  1VQO A;  2QK0 A;  4IUQ A;  1BYM A;  3UA6 A;  3CC7 A;  5GAN j;  3EG1 A;  2LJ1 A;  3F70 A;  3QZ9 B;  3CCE T;  1GBQ A;  4M77 F;  2CKK A;  1ZA1 B;  2M0O A;  4LUD A;  1WHH A;  1VQ8 A;  4KH1 B;  4NOY A;  2KXC A;  2LTO A;  2X35 A;  3CD6 A;  4XTW A;  1P92 A;  1I8F A;  1YHQ A;  2F1L A;  1VQ9 A;  1KK7 A;  3QG1 A;  2YLB A;  4M77 C;  1GL5 A;  4LDU A;  1QVG A;  4M77 A;  4J8O A;  2LVM A;  2PQW A;  1NG2 A;  3VYG A;  4Z89 A;  3MJX A;  1QVF P;  2HCK A;  2PNI A;  5I22 A;  3OW2 A;  2EQK A;  1I0C A;  3J80 E;  2JNG A;  3H6Z A;  2RN8 A;  4OGC A;  2P4T A;  3NPF A;  2V1R A;  3OA6 A;  4J83 A;  3QHS A;  5D6W A;  2AHJ B;  2COY A;  1IRX A;  3JCM e;  5IXF A;  3HSB A;  2W10 A;  3NTK A;  2HQH A;  2QQ9 A;  3I56 Q;  2GNC A;  2FVU A;  3I35 A;  4EPC A;  4CC2 A;  1QWE A;  4M78 G;  3M0S A;  1YI2 Q;  1LOJ A;  2AZS A;  5FU6 B;  4M7D G;  3CCM T;  3A8O B;  3I9Q A;  3LGF A;  5I2M A;  2L2P A;  1IO6 A;  1M2V A;  3OQ5 A;  2OX7 A;  2ED1 A;  1EX4 A;  3KFV A;  3J7A F;  1DJ7 B;  2E6Z A;  3UT1 A;  4EMK C;  2R5M A;  3HKS A;  1VQM T;  1ZQ1 A;  4EMK A;  5GMK m;  3QWY A;  3G71 T;  2BZX A;  3CC4 T;  4A4K A;  4M78 E;  4ZGD B;  2MI6 A;  1AZE A;  3NMZ C;  4L59 A;  1GFC A;  2YRV A;  4M7D E;  1VQK Q;  5CVI A;  1HK9 A;  3SEM A;  1KC8 R;  1UEC A;  1OI1 A;  1JO8 A;  1NZ9 A;  1Q81 R;  4C92 D;  2ZPF B;  1KSW A;  2VYT A;  5GAN g;  3EFO B;  2FZK B;  3H41 A;  3VJP A;  1X6G A;  1PNJ A;  2DTI A;  1M3C A;  1ZX6 A;  1RI9 A;  1M5Q 1;  2ED0 A;  1NPR A;  1M3B A;  1QCO A;  6AT1 B;  2YSQ A;  3M54 A;  2DXU A;  3OMG A;  3SWN C;  2DLP A;  1NYF A;  3SWN A;  3OYG A;  5GAN f;  1K8A U;  1UDL A;  1I07 A;  3OMC A;  2E10 A;  3CBP A;  2RQR A;  2FPE A;  2HNI A;  2X4J A;  1VYV A;  2RJF A;  4EMH A;  3CPW P;  3LGL A;  2DK3 A;  2E5K A;  1YJN T;  1KC8 C;  1HJD A;  2IVW A;  5GAM j;  5KE3 A;  2VGM A;  1Q81 C;  3OS0 A;  3X25 B;  3TCJ A;  2CT3 A;  2LX7 A;  4F14 A;  4GY5 A;  3PTA A;  5A2Q E;  4PLI A;  1N9R A;  2MYS A;  1ZSG A;  2RK1 A;  2CP7 A;  3M9Q A;  2H3E B;  2KEA A;  3RER A;  3EG0 A;  2MCN A;  1OU9 A;  3RUX A;  3M0P A;  3OS2 A;  1XJW B;  4Z02 A;  3HTR A;  3Q1J A;  5GMK j;  2DER A;  3JB9 D;  3G71 A;  1WLP B;  3RKX A;  3OBY A;  2JZ2 A;  1X2K A;  2LJ3 A;  2M0Y A;  4JJD A;  3JCM h;  1X6O A;  3RDV A;  1VOM A;  3HPW A;  4J6Y A;  2GQI A;  4IIO A;  2KSS A;  3M0T A;  2EJF A;  4PFZ A;  2RO0 A;  2QEX A;  1JJ2 P;  3JRZ A;  4M4Z A;  2VGN A;  4D8D A;  2P4R A;  2EQJ A;  4B6M A;  2DO3 A;  8AT1 B;  1HYO A;  2HQX A;  2RHI A;  2ZPH B;  3MEA A;  1GCQ C;  4GLM A;  1X69 A;  3OYY A;  4QQ6 A;  1GCQ A;  4ME7 A;  3ULR B;  4FYY B;  3QYG B;  1W2B P;  2JN0 A;  1AHJ B;  1U06 A;  1YJW Q;  2RM4 A;  4F17 A;  4KT0 E;  4PJN A;  2ESW A;  2XIC A;  5DY9 A;  2DM1 A;  1ABQ A;  3GBQ A;  1NEG A;  1PC0 A;  4JUV A;  3PMI A;  4N4H A;  3JB9 J;  4F7U G;  4B9W A;  2C0T A;  4AFZ C;  4D8K A;  2Y4X A;  2CSI A;  1M30 A;  2DA9 A;  3M4G A;  2OJ2 A;  3QBY A;  3QXE B;  2ZAE A;  4A53 A;  3E9F A;  4KGZ B;  2SRC A;  3GPL A;  4XU2 A;  3I56 A;  3QO3 A;  2NUT A;  2O01 E;  1PKT A;  1VQL Q;  1KG1 A;  1IRE B;  3A5Z B;  3X20 B;  4F7U E;  4FT2 A;  4C92 F;  5GAM g;  1W70 A;  2R58 A;  5KCO A;  4JJC A;  3AHU A;  2E65 A;  2XKO C;  1H3H A; 
#chains in the Genus database with same CATH homology
 3NTH A;  4BI4 A;  3QPH A;  3OB9 A;  3CME T;  3HRU A;  1Q81 U;  4XU3 A;  3CCQ T;  3G7Z A;  3RKY A;  3V7C A;  2DZ9 A;  4BI3 A;  4ZN1 A;  1KQ1 A;  3WVD B;  5KCH A;  1KHI A;  4J7F A;  4RG8 A;  3NFC A;  4C92 C;  2O4X A;  2Y90 A;  5GAM f;  3OYF A;  3I56 T;  3FJP A;  2XDP A;  3JCM P;  2PVD B;  2WAC A;  4C92 A;  4HT9 A;  4IUT A;  4J6X A;  2DD5 A;  4C5G A;  2RJE A;  2QA4 A;  1Y7X A;  2JUF A;  5LJ5 e;  3VYH B;  1VQK A;  1QP3 A;  1WGS A;  2DIG A;  1VQP A;  4RKU E;  3G6E T;  1YI2 T;  3OYI A;  2VC8 A;  1IZ6 A;  4M75 G;  5GAO n;  5FU7 C;  3WXM B;  4R55 A;  5LJ5 h;  2LDM A;  2PUO B;  2ZPI B;  4O6J A;  1S72 A;  3FIF A;  4C8Q G;  3DLL A;  5LJ5 d;  3OY9 A;  4E7J A;  5L8R E;  2VV5 A;  3PMT A;  2LCL A;  2L8D A;  5GAN 5;  2E6N A;  2OTL T;  3P8D A;  3SFM A;  3QDR B;  1D3B A;  2RA2 A;  2JOY A;  2CS7 A;  4BE1 A;  3S6W A;  4C8Q D;  3FC3 A;  3GOX A;  2XID A;  2M1H A;  3RKW A;  1YIJ A;  1MHN A;  1NE8 A;  2LRQ A;  3M5A A;  3M4Y A;  4E47 A;  1KD1 U;  3CC7 T;  2XDB A;  4CI0 C;  2K5I A;  3J81 E;  4A4H A;  1N27 A;  3A8H B;  3CCS T;  2XI9 A;  3JCM W;  2HAX A;  3KXT A;  3URG A;  3X26 B;  2EYQ A;  3CBO A;  4L5G A;  3WVE B;  5FRM A;  4M7A G;  3QYH B;  2ZPG B;  4RG2 A;  4X9C A;  3EAE A;  4A54 A;  1VQ8 T;  4JLI A;  2L3R A;  2I2L A;  2QA4 T;  2V8K A;  4C8Q E;  4M7A D;  1M1F A;  1VQK T;  3P8B B;  1OYX A;  1QVP A;  2D9T A;  3QZ5 B;  5I21 A;  5GAN 4;  5I2S A;  2HBP A;  2FL7 A;  2K4Y A;  1XQH A;  2LNV A;  3CXC A;  3M58 A;  3CXC S;  4ATO A;  2GFA A;  1S72 T;  3M55 A;  2G3R A;  5CCA A;  4LD6 A;  2LQK A;  2RI2 A;  4QVC A;  2ZGW A;  4R56 A;  3JB9 F;  1M1K C;  1N8R U;  1GXI E;  3FDR A;  3T9N A;  5LJ5 j;  5A0G A;  3OSV A;  2GCX A;  3L2U A;  4NL2 A;  1G3W A;  2BKD N;  4JJN K;  4M7A E;  4KUD K;  1YIJ T;  3CPW S;  3CPW A;  1YJ9 A;  4IUU A;  3L2R A;  3E19 A;  5M9O A;  3GF5 A;  3LWH A;  1N9S A;  2GFU A;  5GAN 3;  4PNO A;  3KUF A;  5C6S A;  3I55 A;  1KQS S;  1KQS A;  2BIV A;  4YTL A;  3INZ A;  4JRQ A;  2HD0 A;  3E9G A;  4B9X A;  3JB9 I;  4HCC A;  5GAN e;  3GIB A;  1QVF S;  2DZC A;  5J26 A;  2EQM A;  4QVZ A;  1BI1 A;  1G5V A;  3ZBD A;  4DOV A;  3JCM X;  5GAN h;  4FL6 A;  5HK3 A;  1XNI A;  1UGR B;  5GAN d;  1K9M U;  4XTX A;  5GAO m;  3OYC A;  1VIF A;  3MEU A;  2ZCF B;  4IUP A;  2MAM A;  2WSC E;  4J6W A;  3M57 A;  3OYM A;  1WQ7 A;  5A0L A;  1OZ3 A;  3MP1 A;  3CCE A;  1BI2 A;  2Y4Y A;  4BDZ A;  4BB7 A;  3RES A;  1M4Z A;  2GF7 A;  1Q86 U;  2JTF A;  2JTM A;  2P0P A;  2MWP A;  3RMS A;  5GAN 8;  3ZEH A;  4F7U B;  1YJ9 T;  4P5N A;  3VUB A;  1G3T A;  2E1H A;  2PVG B;  2KY9 A;  3V8L A;  4E7K A;  1Q81 C;  2X4W A;  1O9S A;  1I5L A;  3X24 B;  5CQY A;  2CZ6 B;  4OMF B;  2A7Y A;  2RJD A;  3HP9 A;  2XG8 D;  3V7S A;  2PVO B;  2QQR A;  2KVQ G;  4M77 B;  3G6E A;  1YI2 A;  4V2S A;  4MML A;  2XK0 A;  4FSX A;  3QKJ A;  4J7I A;  3V8J A;  5LJ3 e;  2QXF A;  4OP0 A;  1EIF A;  3FEO A;  1I4K 1;  2E41 A;  5CK9 A;  3HL8 A;  3BFM A;  5GMK l;  5LJ3 d;  1VQO A;  2D0Q B;  4IUQ A;  1K73 U;  3GLX A;  5D6Y A;  1BYM A;  4F7U F;  3OS5 A;  4MDX A;  2LT1 A;  2KQW A;  1JJ2 S;  1JJ2 A;  1VIE A;  3QUI A;  4JRI A;  3P8H A;  3CC7 A;  2DXC A;  4C0Z A;  2EIF A;  3RMQ A;  5GAN j;  3SD4 A;  3F70 A;  3CCS A;  3QZ9 B;  4BDY A;  3CCE T;  3DB3 A;  3C12 A;  4M77 F;  2CKK A;  4FM4 B;  4XAX B;  2DIQ A;  4EDU A;  5CR2 A;  3OYD A;  2M0O A;  4PLL A;  5FLX E;  2LQ8 A;  1K8A C;  2EJ9 A;  1NJI C;  2RD1 A;  4JS5 A;  1VQ8 A;  3VUZ A;  2PU9 B;  4ZTJ A;  1W2B S;  1W2B A;  4MZP A;  4NOY A;  3OSS C;  2LTO A;  3EFR A;  2X35 A;  3VKI A;  3CD6 A;  4XTW A;  1M90 U;  1P92 A;  1I8F A;  1U1T A;  5KH6 A;  4F7U A;  1YHQ A;  4JRP A;  1BKB A;  2A3L A;  1VQ9 A;  3PFS A;  5CKB A;  2DKG A;  1YIT A;  3FB9 A;  3PNW C;  2IG0 A;  2YLB A;  2RJC A;  3QG1 A;  4RCC A;  1Q7Y C;  4XTY A;  3S3N A;  4M77 C;  1UGS B;  5CKD A;  3LW5 E;  2MF2 A;  4LDU A;  1QVG A;  4M77 A;  2YHT A;  4J8O A;  5KE2 A;  4M75 D;  2L89 A;  2LVM A;  2PQW A;  4FU6 A;  3CMA A;  3VYG A;  1BIA A;  1VQO T;  1U8R A;  4J5Y A;  2CZ1 B;  4IKF A;  1M8V A;  2X4X A;  1UB4 A;  2EWN A;  3OW2 A;  3PIP A;  3UPU A;  3A8M B;  4JLG A;  2EQK A;  3CCM A;  4JRK A;  4O5V A;  1X75 C;  1B34 B;  1TH7 A;  2JNG A;  3J80 E;  4M75 B;  3X28 B;  1YBY A;  3H6Z A;  4E7L A;  1YCY A;  4OGC A;  1Y71 A;  2P4T A;  1WNL A;  4C8Q B;  3TRE A;  3KBG A;  3FLG A;  4EMK B;  2VXF A;  4JS4 A;  3OA6 A;  4A4G A;  4J83 A;  3QHS A;  4BUG A;  4M75 E;  4XTZ A;  5D6W A;  5LJ5 g;  2AHJ B;  5HKC A;  3MHX A;  4II1 A;  2QDY B;  2R57 A;  3JCM e;  1VQM A;  5FRO A;  3CD6 T;  2E70 A;  3JCM c;  1YHQ T;  3CC4 A;  3HSB A;  1VQ9 T;  3NTK A;  2F69 A;  4Y91 A;  1YIT T;  2QQ9 A;  1M1K U;  4MZT A;  2EAY A;  3JCM d;  2FVU A;  5DLQ E;  2DXT A;  2XU8 A;  3PT9 A;  4M7A B;  4EPC A;  3C95 A;  1KHC A;  3BY7 A;  3QII A;  4MDW A;  5J3B A;  4C8Q F;  3A8L B;  2CYZ B;  2LT4 A;  3CMA T;  1XOV A;  4M78 G;  2DPP B;  4Q5W A;  1I81 A;  1WQW A;  5CAI A;  5LJ5 f;  4BE2 A;  3OYK A;  2LX9 A;  2LC4 A;  1LOJ A;  3UWN A;  5FU6 B;  4M7D G;  3CCM T;  3A8O B;  5GAO r;  4M78 D;  3LGF A;  4N0A C;  3CCL T;  3V8K A;  5I2M A;  2CGH A;  1QP2 A;  4N0A A;  3OQ5 A;  4QQD A;  2K2V A;  1H3Z A;  2KAF A;  3C4S A;  4CRI A;  2DTO A;  4M7D D;  4M7A F;  4M75 A;  4C8Q C;  1WJS A;  2K3X A;  4KBM B;  4WF2 A;  3J7A F;  5CKE A;  1DJ7 B;  2E6Z A;  3UT1 A;  4C8Q A;  4EMK C;  3CCV A;  2R5M A;  3HKS A;  1VQM T;  1ZQ1 A;  4TVR A;  4EMK A;  5GMK m;  3MEV A;  3OYB A;  1G3Y A;  1LJO A;  4PJO G;  3SWN B;  2KMT A;  3G71 T;  2CZ7 B;  3ME9 A;  3CC4 T;  1UGP B;  2FHD A;  2MWO A;  4OB1 B;  5EG2 A;  2FYK A;  4A4K A;  4M78 E;  4ZGD B;  1N8R C;  2MI6 A;  3GNG A;  1Q82 U;  1OZ2 A;  4L59 A;  4PJO D;  2YRV A;  3TEE A;  4ELZ C;  4M7D E;  5CVI A;  3V7R A;  1HK9 A;  2K57 A;  4M7A C;  3NTI A;  4PL6 A;  3DB4 A;  4C92 G;  1OI1 A;  4HCB A;  3N5B B;  4LD9 K;  2P0Q A;  3HRS A;  4HCZ A;  1FXX A;  4M7A A;  4ZN3 A;  3MET A;  1NZ9 A;  4XTV A;  3L42 A;  5LL6 S;  5GAM e;  4C92 D;  2ZPF B;  1VQ4 T;  4OVA A;  5FU6 C;  2VXE A;  2VYT A;  3RIR A;  3OYN A;  2QQA A;  2DXB A;  1VQN A;  5GAN g;  4PJO E;  5CIU A;  5GAM h;  2DJZ A;  2QQB A;  1YJN A;  3VJP A;  5GAM d;  1K9M C;  2E12 A;  4Y28 E;  3QSU A;  2K5L A;  2DTI A;  5A0D A;  3OS1 A;  4OB3 B;  2M16 A;  3CCV T;  4JDS A;  5DLO A;  2RI5 A;  1M5Q 1;  1BI0 A;  2RHY A;  1NPR A;  5LJ3 h;  4HT8 A;  1M9S A;  3JSC A;  1JBM A;  3CCJ A;  3LX7 A;  3M53 A;  1N6A A;  3M54 A;  2QTX A;  2DXU A;  3HHT B;  3OMG A;  4L6V 5;  3SWN C;  4C92 E;  3PIO A;  3OBW A;  1Q86 C;  3L2V A;  3SWN A;  2ZZD A;  3OYG A;  5GMK e;  1ZHI A;  2RB6 A;  2EQU A;  4N4I A;  1HXD A;  5GAN f;  5IN1 A;  1K8A U;  1VUB A;  2RH2 A;  4X9D A;  1G3S A;  4OF1 A;  4C5I A;  1NJI U;  5D6X A;  3OMC A;  2E10 A;  2C06 A;  3CBP A;  2GQV A;  5GMK h;  2H3J A;  1YJW A;  2HNI A;  4IUV A;  4QW2 A;  1X01 A;  2X4J A;  4KUL A;  3L2Q A;  2RJF A;  4N4G A;  4BI8 B;  1Q7Y U;  4EMH A;  3OYJ A;  3HFN A;  5LJ3 g;  5GAO p;  2DEQ A;  3LGL A;  1VQN T;  4FIB A;  1K73 C;  3OYA A;  2DK3 A;  3GNF B;  4DQ2 A;  3MEW A;  1YJN T;  1KC8 C;  3MO8 A;  1BIB A;  4EMG A;  2EKO A;  4A4F A;  4BD3 A;  1QVG S;  3TU4 K;  2IVW A;  1RL2 A;  1WJQ A;  2VGM A;  3LLR A;  2RHU A;  3QJ6 A;  5KE3 A;  5GAM j;  4PKC C;  3X25 B;  1ZBX A;  3OS0 A;  3E1S A;  3M59 A;  2X4Y A;  3CCJ T;  3UDC A;  3MP6 A;  5CO7 A;  2EJG A;  3TCJ A;  5AYF A;  5IAY A;  5DM7 R;  1FX7 A;  2DD4 A;  2L5Q A;  4GY5 A;  5LJ3 j;  5A2Q E;  3PTA A;  3OW2 S;  4PLI A;  4MMK A;  1N9R A;  2RK1 A;  5LJ3 f;  3JCM Q;  2PUK B;  3M9Q A;  3CCL A;  4QVD A;  3RER A;  3JCM b;  2KDS A;  3VU3 C;  2WSE E;  3H8Z A;  4C5E A;  1VQ6 A;  3G4S T;  2QQS A;  1M1G A;  4X34 A;  2XD0 A;  4MZM A;  3RUX A;  1YJW T;  3JB9 G;  3OS2 A;  1JRI A;  3R6O A;  1VQ5 A;  4LDV A;  2JVV A;  1VQL A;  4ELY C;  4LDW A;  4Z02 A;  3S3O A;  4OB2 B;  3MP8 A;  1R8O B;  3DLM A;  3Q1J A;  3BW1 A;  5GMK j;  3CCR T;  4GLK A;  3JB9 D;  3G71 A;  1M90 C;  2DVE A;  3OYH A;  2K5F A;  4BAC A;  4ZTF A;  2R5A A;  5HY6 A;  3RKX A;  3OBY A;  2F5K A;  2JZ2 A;  4BE0 A;  1MGQ A;  3HRT A;  3JCM h;  3GP8 A;  1Y96 B;  1X6O A;  4M75 F;  1VQ7 A;  3HPW A;  4J6Y A;  5GAO q;  5IT9 E;  2BUD A;  1KD1 C;  4HKE A;  3LYI A;  1FWZ A;  3PGG A;  2KSS A;  3CC2 A;  2YLC A;  4HA8 A;  5GAN 2;  3CCU T;  2B8A A;  1UEB A;  3BDL A;  3BDU A;  2M9U A;  4IUR A;  2E5Q A;  4BY6 B;  2EJF A;  5GAN 7;  2RO0 A;  3CEY A;  3QJY A;  3EFS A;  4LDX A;  2NLU A;  1VQ4 A;  2D6F A;  2QEX A;  3JAM E;  3JRZ A;  1VQP T;  2VGN A;  4A4E A;  1VQ6 T;  2EQJ A;  4C0F A;  2V8I A;  4LDY A;  2DO3 A;  2VUB A;  4M75 C;  3SB2 A;  2HQX A;  2K3Y A;  3M56 A;  2MMP A;  1B34 A;  2FB7 A;  3DKM A;  4KUI A;  2RHI A;  2ZPH B;  5J39 A;  1VQ5 T;  5FRN A;  1VQL T;  3MEA A;  3JCM g;  3L2Z A;  4M78 B;  3ASK A;  3OYY A;  4QQ6 A;  5CKH A;  3ZFJ A;  1H64 1;  4ME7 A;  4XQ3 A;  3HFO A;  3CBM A;  1NPP A;  3A8G B;  3LWI A;  1W4S A;  1WJR A;  2OAU A;  4M7D B;  2QI2 A;  3QYG B;  3L2W A;  2JN0 A;  1AHJ B;  2RM4 A;  4KT0 E;  1VQ7 T;  3SDZ A;  4XTU A;  2V8J A;  3O8V A;  2XIC A;  4XU1 A;  1UGQ B;  5DY9 A;  4RCB A;  2OTJ A;  3CC2 T;  1Y96 A;  2DAQ A;  1JB0 E;  5CKF A;  4E7H A;  3JCM f;  4UC4 A;  2P0K A;  4C0D B;  2ZPB B;  4M78 F;  1QVF A;  3L1A A;  4JUV A;  4C5H A;  3PMI A;  4N4H A;  1QW1 A;  2DTH A;  3VV0 A;  4PJO B;  2RHZ A;  3JCM J;  3JB9 J;  4E7I A;  1KQ2 A;  4F7U G;  4M7D F;  4XK8 E;  4B9W A;  4BY6 C;  3OYE A;  2QEX T;  2EFI A;  3CCU A;  2RK2 A;  2Y4X A;  2LCC A;  3CME A;  4OB0 B;  3S3M A;  3C94 A;  4M77 G;  3CCQ A;  2HQE A;  3FRN A;  2O4X B;  3M4G A;  2XHC A;  3QBY A;  4C92 B;  1O75 A;  4VUB A;  1Q82 C;  3QXE B;  2OTL A;  4XU0 A;  4A53 A;  4M78 C;  3E9F A;  4RMO A;  3JB9 H;  4M77 D;  2CZ0 B;  3GPL A;  1RI0 A;  4XU2 A;  3I56 A;  4M78 A;  4DA4 A;  4PJO F;  3ER0 A;  3QO3 A;  1PSE A;  4ZGE B;  4ZGJ B;  2XDD A;  2F5T X;  4M7D C;  1PSF A;  4OGE A;  2O01 E;  3CPF A;  1BI3 A;  5CQX A;  4FT4 A;  2E64 A;  4M7D A;  3I55 T;  5FU7 B;  2RI3 A;  1IRE B;  5HK0 A;  3JCM V;  1KG1 A;  3A5Z B;  4PJO A;  3X20 B;  4F7U E;  2OTJ T;  1U1S A;  1WPY A;  2KK4 A;  2RHX A;  4QQG A;  3G4S A;  1D3B B;  3LH0 A;  2ZPE B;  4C0G A;  4FT2 A;  4C92 F;  5GAM g;  4NS5 A;  2R58 A;  3MCA B;  5KCO A;  4D6W A;  4NL3 A;  5GAN 6;  4C0D C;  4M77 E;  2WSF E;  3AHU A;  1Y07 A;  1V29 B;  1XTD A;  1LNX A;  2E65 A;  2XKO C;  3OYL A;  3CCR A;  5GMK i;  1KC8 U;  4PJO C;  1SSF A;  5C0M A;  4DOW A;  5GAO l; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...