4DOVA

Structure of free mouse orc1 bah domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
157
Chain Sequence
QTFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
molecule keywords Origin recognition complex subunit 1
total genus 33
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dovA00
4DOWA 3PTAA 4FSXA 1M4ZA 1ZBXA 4DA4A 2FVUA 4KULA 4JJNK 4KUDK 4FT2A 1ZHIA 3PT9A 4DOVA 2FL7A 3TU4K 4LD9K 1W4SA 4FT4A 4BB7A 4KUIA
chains in the Genus database with same CATH superfamily
2HD0A 4MMLA 4OP0A 2NUZA 3JCMb 1LPLA 1TUGB 3Q1JA 4CC4B 1WJSA 1PHTA 2XDBA 3L1AA 2Y90A 4FM4B 1NYGA 3RMSA 5C0MA 2RI2A 1FXXA 4PKCC 3JCMe 3RKWA 4EMKA 1I8FA 4M78F 3TQ7P 4M75C 2DL3A 2KRMA 1OV3A 4J7IA 3G71T 2C0IA 5KE3A 1K1ZA 2K57A 5GANh 2O9VA 3OW2A 2A0FB 4PJNA 4A53A 2LT4A 1E7OA 1K8AC 2QEXQ 2B8AA 5L8RE 1I4K1 4C8QG 1VYVA 2QQBA 2KDSA 1BCMA 3S3NA 1VQNT 2E3HA 1SF9A 4FT4A 3VS7A 5KYNA 3G6ET 1UB4A 2FZGB 4E7KA 1RACB 3V8JA 4HVVA 2E41A 2EQKA 1AVZC 1X2KA 2M02A 1UJ0A 5I2MA 3NGPA 4X1VA 4N0AC 4XU3A 1BI1A 1NG2A 1Y57A 2E5KA 1VQOT 2J6FA 2JMAA 1SSHA 2CUBA 4J6WA 4R56A 1VQ5Q 3SWNB 2KEAA 3URGA 5LJ3d 1VQOA 4JPBW 4A63B 3H9NA 5DY9A 2RD1A 1S72Q 4M7AD 2DYBA 4BI4A 2P0KA 2RI5A 4BE0A 4JRIA 2VXFA 1R8OB 2MI6A 2DVEA 2OI3A 2JN0A 2GQVA 1SHFA 2DVJA 4PJOF 3I5RA 1D1CA 1E6GA 4J6YA 1IHVA 1VYTA 2KRSA 3P8BB 3BFMA 1OU8A 1KQ2A 3CXCS 4DEYA 3M0RA 3ASKA 2COWA 4OF1A 3G4SQ 2MMPA 4R55A 2YRDA 4IUQA 2M1HA 3NTHA 2NWMA 1V29B 1KC8R 5FRNA 3TSWA 2LTOA 1WJRA 3EH1A 3EFRA 4D8DA 4LD9K 4M75A 1K73R 3L2VA 1AD5A 2DNUA 2PUOB 4QQ6A 1VQLA 2IVWA 3SFMA 1PG5B 2MCNA 3CCUT 1Q82C 1G3TA 3RDVA 1VQNA 2DPPB 1VQ4Q 3ER0A 3G4ST 1IO6A 4IURA 1QKXA 2F5KA 1PD0A 2FG0A 3SDZA 1BI2A 1YJ9Q 3G6EQ 2DIQA 3M59A 1X27A 4DOVA 1LOJA 1JB0E 5GJVB 3MPUB 1KFZA 3DB4A 5LJ5d 1UEBA 2YWWA 5KE2A 2KE9A 1YI2T 1IREB 1V1CA 2DETA 4J9CA 4RTTA 5HY6A 1K9MR 4M75B 2G6FX 2OAUA 3JCMc 3QBYA 4DBRA 1Y96A 1UFFA 1MGQA 1ZHIA 3OYHA 1DJ7B 2E65A 4KBMB 1UECA 2VASA 3P8HA 1RI0A 1JEGA 1WHHA 5FW9A 2RK1A 3JCMJ 3EG0A 1ACMB 3CCET 2E70A 3FB9A 3A98A 3CMET 4JS5A 1N8RC 2CDTA 3E9FA 4C92E 2KI7A 4GY5A 3I56Q 2EGAA 1QVFA 2AK5A 3BW1A 2ATCB 2L3PA 1TSFA 4HVUA 5FRMA 1AZEA 4LDUA 3MEUA 3I55T 1U1SA 4WCIA 3GNFB 3VS2A 2BKDN 2EBPA 1G3SA 3E2UA 5GAMj 2QGGA 2EQIA 1YIJT 2EYXA 3NFCA 2H8HA 1AHJB 5D6WA 4DQ2A 1B34B 3VYHB 1BU1A 4AFSC 4LN2A 2D6FA 3CCVA 1PKTA 2L8DA 4MZMA 3JB9I 1QVPA 5CIUA 1TUCA 1WIEA 4AFQC 3I56T 1B07A 3EG1A 1M3AA 1T3SA 3OS5A 1D1BA 2OJ2A 5GAN4 1FMWA 2K3YA 1QVGP 5GAN3 1M90C 5GANj 3FDRA 4JRPA 3VYGA 4JLGA 2HKQB 3CMAA 3CBPA 3CCRT 3I5SA 1SKUB 1GFCA 2RJCA 2MOXA 2RM4A 3TREA 1XOVA 1BBZA 2VYTA 1VQ9A 2RHIA 1WHLA 2K5IA 2CKKA 3M0PA 5GAMh 2KROA 1AZGB 4IUUA 2C0OA 2HMAA 4OGEA 4CRIA 1SPKA 3HSBA 1GL5A 2QEXA 1IRXA 3CMEQ 2GTOA 3EAEA 4XTYA 1ZUYA 1VQKA 1W6XA 1RAHB 1KD1R 2K5FA 3OYBA 2HCKA 3CQTA 4KRTA 2KNBB 3QO3A 1RAFB 4L5GA 4KH0B 1VYUA 2VB6A 2JNGA 2DRKA 2HNIA 3M4GA 1OULA 4LDVA 4EIKA 1N8RU 3OA6A 3HPWA 2DZ9A 3VV0A 1NJIC 3QJ6A 2KMTA 2NLUA 4MDXA 3JSCA 5FWBA 2CT4A 1OYXA 2X4WA 2JM9A 3REBB 2OTJT 1NJIU 1KHCA 1VQMQ 1PC0A 2R5MA 1GCQC 5GAN7 1X6GA 2E3IA 1K8AU 3OYCA 1O75A 2PVDB 5FU6B 2X4XA 3CMAT 1XNIA 2X35A 3QJYA 2ZPBB 4QT7A 3PIOA 2DLPA 3R6NA 5GMKj 4M77A 3OBWA 3MHXA 3JCMf 1HXDA 3CPWS 1Q81C 3OYLA 1B7TA 2LCCA 1YCSB 3QDFA 5IHIA 3EHRA 5GAMg 1WHKA 4F14A 2E6ZA 1UG1A 4PNOA 2EFIA 3CCLA 2B86A 1M1KU 3A8HB 2IPOB 2HQHA 4M77E 4M7DE 1PSEA 4F7UA 5EG2A 4HCCA 2DBKA 4M7AB 5GAOn 2P4RA 4Z88A 2HBWA 5IHNA 2QXFA 1T3LA 2EJFA 3PTAA 3CCJT 3T9NA 3L42A 1RUWA 3LYIA 4DA4A 2J6KA 3A8LB 4RG8A 4C8QB 5GAMf 2RI3A 1RLPC 3JV3A 2DJZA 2SRCA 1VQ5A 2Y4XA 4FYYB 3HP9A 1K0XA 1YHQA 1X6OA 1TOVA 1RLQC 2AZVA 4OMMA 6AT1B 3X25B 8ATCB 3RBBB 2HQXA 2KRNA 1M27C 1M1KR 3C0CA 1FWZA 3DB3A 1QVGS 3QZ5B 2XDDA 3V8KA 2OTLQ 4JJCA 1BIAA 1KJWA 1KC8C 4FU6A 4KULA 4MDWA 3JB9G 1NLOC 1G3YA 2GGRA 4HKEA 4HXJA 4M7AG 2DZCA 4DBFA 2VGNA 3ULRB 4C5IA 5GAN8 4RG2A 1OZ2A 1KQSA 5GAOm 4JLIA 1TUDA 1YN8A 4RTUA 3UA6A 1NPPA 1QLYA 2BTTA 4MMKA 5DM7R 3PGGA 1G3WA 2K5LA 1EIFA 3CEYA 2O4XA 4M4ZA 3UPUA 1KD1U 1M1FA 2OTLT 3L2QA 4C92B 2DERA 4ATOA 3BDUA 3SWNC 4BI3A 2RQRA 1WJQA 2ROTA 1M8MA 4M7DG 4GLMA 1N5ZA 3LWHA 2ZGWA 1Q7YC 2GF7A 4C8QA 3QZ9B 2Y4YA 3PMTA 3G6EA 1QCOA 3VS1A 1HSQA 2CZ1B 4X9CA 4J9BA 3ZEHA 1G83A 3EHQA 2EIFA 4XAXB 5LJ5g 5KYYA 1WLPB 4XTVA 3OW2P 1VQPQ 1D0YA 1ZSZB 4XK8E 4RTZA 2IG0A 3SD4A 2BE7D 1EFNA 1M1GA 1I1JA 2CZ0B 1ZBJA 3QG1A 2K79A 5I2SA 5IH2A 3C12A 2YUOA 4RTVA 3KUFA 2LT1A 1N8RR 3L2ZA 4M7AC 2GBQA 2VWFA 4N4IA 2DXUA 4BD3A 3LX7A 1TWBA 3HTRA 4A4EA 2MYSA 1F1BB 1HD3A 2OX7A 4NOYA 2CH4A 2JTMA 1NM7A 2EQJA 1M3BA 2JJ9A 4KT0E 5AT1B 3GIBA 2EKOA 2AT1B 3CPWA 1VQ4A 3CBOA 3GBQA 1MV0B 3M4YA 4B6MA 3OYKA 3I9QA 1WQWA 2RN8A 2YUQA 2YLCA 3CXCA 4C8QE 2O2OA 4IUPA 1ZSZA 3A8GB 1Q86U 3VKIA 4ESRA 1M4ZA 2FO0A 2P0PA 4E7JA 4BI8B 3CC7Q 2AHJB 2GQIA 1FMVA 2M51A 5GAN5 2QG9B 5EC7A 2RQWA 2WSEE 4HCZA 2WACA 2XHCA 2ZPIB 4AFUC 3G71Q 4BDZA 4WTOB 3H0FA 2HAXA 2KYBA 3O5ZA 4M77B 2CP3A 2D9TA 4IKFA 5A0GA 3JRZA 1YJ9T 1VQPA 5LJ3f 4PJMA 3JCMh 2F2VA 2K4YA 1GRIA 1YJ9A 5GMKh 5D7UA 2LVMA 5ECAA 3ZFJA 1D0XA 1VA7A 4ZN3A 4F7UF 4AFZC 1LJOA 1RADB 4TVRA 1YFNA 4J6XA 5LJ3j 2MWPA 4M7DD 1O9SA 5CR2A 1Y96B 1ZUKA 1NBEB 1MHNA 3ZL7C 4M7AA 2K3BA 4K11A 2LZ6B 1WHMA 2JW4A 1YCYA 5LJ3g 2KXDA 1K8AR 3PT9A 2LX7A 2BZ8A 4A4FA 4E7IA 2DYIA 5CQYA 1AWWA 1QW1A 1X01A 1VQLQ 4N0AA 2V8IA 4ZGDB 3JB9H 1GBRA 4XU0A 2D0QB 4DEXA 3X28B 2DKGA 2QQRA 3A8OB 2NUTB 3WXMB 4J7FA 1WXTA 2E1HA 4OGCA 3DLLA 1NZ9A 1K9MC 2XG8D 3J7AF 4QVZA 4EMKB 1SRMA 2DJQA 2DXTA 3QUIA 3L2RA 1N9RA 1H92A 1TU0B 3G71A 4HCKA 1N27A 3BE3A 1GBQA 1I5OB 3A8MB 4HT8A 1D0ZA 3OS1A 3JB9D 1AWXA 2LNHB 2XI9A 3MCAB 1YJWA 1YI2A 3EG9A 2FYKA 4OB0B 3VS3A 2YSQA 1YJWT 3RERA 1BB9A 1VQMT 1MV3A 2YRVA 4PL6A 2X9HA 4FYXB 4E47A 4BACA 4LUDA 3AHUA 2CP0A 3NMZC 4XTXA 1OPLA 2FPDA 1XTDA 2XD0A 2FL7A 1GCPA 2DTHA 2JT4A 3GLXA 2E6NA 2LDMA 3H8ZA 3U23A 4A4HA 5CAIA 2VUBA 1X75C 5GAN2 2QEXT 2BUDA 1TXQA 2DBMA 2DD4A 3MP6A 4RMOA 2EYWA 5CKBA 4A4GA 2ZAEA 3EGDA 5KCHA 2KAFA 1QP2A 1BIBA 4NL3A 1BI3A 3SEMA 4RTYA 2KT1A 5GANe 1JU5C 5HCKA 2EVRA 3QDRB 2BIVA 2HL3A 2P84A 3BDLA 4II1A 2RHXA 1NYFA 2V8KA 2ZCFB 4FSXA 1OU9A 2EPDA 4FL6A 4JJBA 4OMLA 2LCLA 4ZGJB 4C5GA 2MPXC 1WA7A 1JJ2P 3CMAQ 2D8HA 1QCNA 4X34A 2D0NA 5GMKe 2P0QA 4J9FA 4Z8AA 4OMNA 3CPFA 4D6WA 2VV5A 3FC3A 4R0KA 1VQMA 3M58A 1PNJA 4M77C 4QKUA 3PVQA 1OZ3A 4JJNK 2CREA 1IGQA 3CCVT 4OMQA 2F1LA 2XU8A 2ZPEB 1Y0MA 1IB8A 5GAMe 1QMCA 4O6JA 2AZSA 4C92D 1QVFP 2CGHA 3CCSA 1QWEA 1GFDA 3CCMQ 4QW2A 2VC8A 5CKEA 5FLXE 1X6BA 2EYZA 2F2WA 2VXEA 1VQ9T 1NEBA 4C5EA 3OS2A 2GCXA 3CCMA 1YHQQ 8AT1B 3NTIA 4LUEA 5A0DA 3QSUA 1WYXA 3E1SA 5GAOq 1J3TA 2DMOA 3CPWP 2ENMA 4VUBA 4N4GA 2MK5A 4BDYA 3VRYA 4E7LA 3JCMg 1QP3A 1UGVA 2EQMA 2MF2A 4M77G 3RMQA 1WX6A 4ELZC 2DXBA 2SEMA 1VQLT 2R5AA 3BY7A 2LC4A 3MO8A 1YJWQ 1VQ7A 4FIBA 4Q5WA 3UDCA 9ATCB 2DX1A 2EJ9A 4PJJA 2HQEA 3SWNA 2DE0X 3M57A 3H0HA 2K3XA 3I56A 3JCMd 1D1AA 2HEQA 4A54A 4ORZA 1M2VB 2RH2A 1VUBA 4OB2B 1WGSA 2HSPA 4PJOG 3KBGA 3QWYA 2F69A 2QQAA 3CCRA 2DEQA 1NPRA 4M77D 2X4JA 1TS9A 3MJXA 1JJ2A 2WSCE 3CCQT 1NLPC 4EPCA 3O8VA 3M55A 1UGQB 2LX9A 3JCMV 1SEMA 3QHSA 2PZ1A 4OMPA 2DIGA 2O4XB 2JS0A 2W10A 3M0SA 5KYUA 3VRZA 2C0TA 2CS7A 3QPHA 1OQKA 1KQSS 4M7AE 2JM8A 3CC7A 4ZNXA 5KYXB 4EMGA 3CD6A 1JO8A 2JOYA 1YI2Q 1M8VA 3CCEA 3HRUA 5J26A 3OSVA 1NE8A 3CC7T 3CC2Q 2KR3A 4OB3B 2V8JA 3RESA 4PJLA 1W70A 1LCKA 3OBYA 2FRWA 4RKUE 5D6XA 5GANd 2PVGB 1VQ8A 3X24B 1KQ1A 2RHYA 4HVWA 4F7UB 3I55A 2XDPA 3L2WA 1C0MA 3REAB 2JMCA 1Q81R 2A08A 4LD6A 3TSZA 3M54A 1Y07A 2QAZA 1ZSZC 4AMCA 4M78G 4DOWA 2RQVA 1PD1A 1AOJA 3F70A 3NPFA 1LVKA 2C06A 3M9QA 3TCJA 1YWOA 4IIOA 1CKBA 4F04B 3AT1B 5HKCA 1R0CB 2M0YA 4M75F 3LH5A 1T0JA 4C0DC 5CK9A 3S3MA 1ABQA 1GXIE 2I0NA 1HK9A 1QVFS 2LJ0A 5LJ5f 3RKYA 4BB7A 1AT1B 2JUFA 5FWCA 5HK0A 1D3BB 2BE9B 2CT3A 1SHGA 2DD5A 4EMHA 2MIOA 3GP8A 4J5YA 5KH6A 2QTXA 1W2BS 2RJFA 2CZ7B 1Q86C 2QQSA 1W1FA 2X51A 2JS2A 2KVQG 5GAOp 2AIRB 1YITA 3CCVQ 3LGLA 4E7ZA 1EX4A 1JXOA 3CCLT 4MZPA 1M30A 3EFOB 1ZBXA 5I11A 1TG0A 3CCUQ 2BZYA 3JAME 5I21A 2CSIA 2V1QA 1YITQ 3MP1A 2EQUA 4PJOD 5GAN6 2M16A 3LLRA 4Y92A 1CSKA 3WVDB 3I35A 2DO3A 3JCMW 3PVLA 2QA4Q 1KD1C 3EGXA 1H3ZA 2LQNA 1K76A 1K4US 1OI1A 3IQLA 2LQWA 1E6HA 1D3BA 3E19A 2QK0A 3QKJA 4E6RA 5DLOA 2EYQA 1BYMA 2KQWA 2CP7A 1YJNQ 3RKXA 3GOXA 4XTUA 1IZ6A 1K73U 1QKWA 1VQ7T 3FRNA 3OYMA 3GPLA 4IUVA 4M7DA 1JRIA 2E10A 1M9SA 1IXDA 4CC2A 5J3BA 2WSFE 1PRMC 2KY9A 2EAYA 3EG9B 4PFPA 4DBQA 2CYZB 1Q82R 3EGDB 1R0BG 4M78D 4E2FB 4RTXA 3HFOA 4C0DB 1UDLA 3M5AA 4JS4A 4C0GA 2DK3A 2L2PA 2JZ2A 3CCUA 2R58A 2GTJA 4P5NA 2XICA 1X69A 1W4SA 2LJ3A 1QQJA 3JCMQ 1AEYA 1KG1A 2LQ8A 3EGXB 1WHGA 4J83A 2D8JA 3VU3C 2RHZA 1K9MU 4ZTJA 4BE2A 3ME9A 4CC7A 5CVIA 5AYFA 2V26A 1VQ6A 2A37A 3PIPA 4AG1C 5J39A 4L6V5 2DL7A 3TVTA 4E7SA 2QASA 4JZ3A 1V76A 3X20B 2D1XA 4ANJA 2L3RA 3CCSQ 1ZA1B 5CO7A 4KUIA 4PJOE 4JJDA 4Y91A 4C0ZA 2FPEA 2XK0A 1KQSP 1PRLC 5IT9E 2LQKA 4ZGEB 4PFOA 4ZTFA 2X3XD 1UHCA 3FEOA 4PFZA 5FROA 2EJGA 5D6YA 1UJYA 1Y71A 4D8KA 2A3LA 1S1NA 1CKAA 1WXBA 1UE9A 3LGFA 2HZYA 2JTEA 3FJPA 4O5VA 2E12A 4C0FA 2RB6A 4BE1A 2FPFA 1VQ8Q 1HJDA 2DA9A 2PVOB 3V8LA 1BKBA 1MMAA 3A1PA 3THKA 3OYJA 3UA7A 1NEGA 5M9OA 3S3OA 2K7AA 2Z0WA 3EH2A 4J8OA 2OTLA 4M78B 2RNAA 4HA8A 5KCOA 3HKSA 5A2QE 1YIJA 1PKSA 1RAAB 1QWFA 2O01E 4M7AF 4GLKA 4PLIA 1VQ6Q 4KH1B 2JXBA 1U8RA 2CSQA 2HBPA 3SHWA 4BY6C 4M78E 2OTJQ 2YLBA 1MNDA 1LNXA 4KGXB 3CCJQ 4B9WA 2LCSA 3DKMA 4HCBA 3EGUA 3L2UA 4F16A 2J7IA 1U06A 3EG2A 4C5HA 1H8KA 3QYHB 3J80E 2LNVA 5CKHA 1FMKA 1XQHA 2L89A 2XMFA 2FZCB 5LJ5h 3H0IA 2JVVA 2RF0A 3FIFA 3EG3A 2EWNA 5KYXA 3H41A 4PJOC 2KYMA 2QDYB 2X4YA 1MMNA 4RTWA 1JQQA 4QVDA 3VUBA 4FYWB 3UATA 2DTOA 2F5TX 4KGVB 3OMCA 3PFSA 5KYYB 5KYWA 3E9GA 4Z02A 1WFWA 1WQ7A 3M0UA 1N9SA 3OS0A 5DLQE 4KGZB 4AG2C 2DXCA 4ME7A 1Z9ZA 4IUTA 3C95A 3OYEA 3I55Q 1TH7A 4OB1B 1MNEA 2X3WD 3H6ZA 3G4SA 4V2SA 4ZN1A 3OW2S 1PM3A 4FYVB 2ZPGB 2OTJA 1GCQA 5LJ3e 5CQXA 1WI7A 2BZXA 2QGFB 1K9AA 3NTKA 4EDUA 1K0SA 1VQPT 3NHNA 4NL2A 4J9DA 3CCST 1KIKA 3CCLQ 1WNLA 3GF5A 4YTLA 4M78C 1U3OA 1M3CA 2QTVA 1VQKQ 5L23A 3CBMA 3CC2A 4J9EA 1ZUUA 4PJOA 2EKHA 1UGSB 2J05A 4LNPA 1C1AA 4JRQA 5IXFA 1RL2A 4JDSA 3CC2T 1H641 2EW3A 3UF4A 4BY6B 5I22A 4X9DA 1Q7YU 4PLLA 2NYSA 1SRLA 5GAOr 2NUPB 4M7DB 1K73C 3QYGB 3MEVA 1P92A 4A4KA 4C92G 1VIEA 4LE9A 3EFOA 1OX9A 2O31A 1BCOA 2P4TA 4JUVA 2ZPFB 2QI2A 1VQKT 2DTIA 2E64A 4L59A 3HHTB 2YRCA 5FU7B 3X26B 3JCMX 3OYIA 4LDXA 1XJWB 2CH4W 1BK2A 3CCMT 5LJ3h 1YP5A 1VQ7Q 1A0NB 2OAWA 1MMDA 4FW1A 1C6VX 4LDWA 3D7SB 1B34A 2L0AA 1M90U 3CMEA 3OYYA 1M1KC 1WXUA 1G5VA 1AWOA 2RA2A 2YDLA 3QWXX 1YHQT 2QYZA 3CCQQ 2CP5A 3OYDA 3CCRQ 1KSWA 2L3SA 5GMKi 1VQNQ 2DL4A 5GAMd 4M78A 3MP8A 1Q81U 1YJNA 4M75E 3ZBDA 3KXTA 5A0LA 1ARKA 2HDAA 4E7HA 1JXMA 1VOMA 4J9HA 1AWJA 2ZZDA 2VGMA 4QQGA 1OEBA 3VJPA 3G7ZA 2ABLA 3CCQA 2DILA 2PU9B 2RMOA 1RI9A 2VKNA 4OVAA 3OY9A 3C94A 2RJDA 2NUPA 4RCCA 3VS0A 3M53A 2RHUA 5KYWB 2ED0A 2AKLA 1OPKA 3RNJA 3OSSC 3RIRA 3VS4A 3RR6A 1X43A 4JZ4A 3CD6T 3OYFA 2DL8A 4Z89A 4QQDA 1RABB 4XU2A 1NJIR 2ECZA 2R57A 2YUPA 3TEEA 1YITT 1ZQ1A 3MEWA 4XTZA 1Q7YR 2FVUA 5GANf 2LMJA 3P8DA 4C92C 3M0TA 3OYNA 2I2LA 1Q95G 2YT6A 4FT2A 1YNZA 2QA4T 4C8QC 3JCMP 1SG5A 1WDXA 2H3EB 3CC4Q 2DRMA 2HSEB 2YHTA 2GFUA 2YXYA 4J9IA 1YBYA 3HRTA 1KHIA 5IN1A 1KK7A 4Y28E 4M7DC 1M90R 2KT8A 4C92F 2E4HA 1U5SA 2DL5A 1W2BP 1M2VA 4M77F 1WPYA 1I07A 2ZPHB 2GFAA 2PNIA 5GANg 2G3RA 3HL8A 1WHJA 4FSSA 1VQ8T 1HYOA 4OMFB 3WVEB 4C8QD 1RAEB 3MEAA 2FB7A 3J81E 2PQWA 2A36A 2O9SA 2W0ZA 4ELYC 1RAIB 2ROLA 1N6AA 4BUGA 2KXCA 3V7SA 2YUNA 5CCAA 3PE0A 7AT1B 2KK4A 1OX8A 2DM1A 1UGRB 3JB9J 3VS6A 1KC8U 4UC4A 3HFNA 1B3QA 1UTIA 4PK4A 2CP2A 3INZA 4IIMA 1PCXA 4C92A 3SB2A 3CD6Q 2K2MA 2HKNA 1YWPA 2RO0A 2EGEA 3OYAA 2M9UA 1G8XA 1EZZB 3FJ5A 4RUGA 4WF2A 2LRQA 1SSFA 1ABOA 4XQ3A 2EYYA 2QA4A 4RCBA 2PUKB 2IIMA 1UUEA 1IHWA 2HL5C 4QVCA 1MMGA 2NUTA 1ZX6A 4B9XA 2V1RA 3R6OA 4M75D 5GMKm 3CCJA 3GNGA 2J6OA 5FU7C 3CXCP 2JTFA 3C4SA 2DEUA 3M0QA 5IHKA 2RJEA 3RUXA 3UWNA 2RPNA 3V7RA 1OOTA 2DAQA 1ZSGA 3N5BB 4MZTA 3PNWC 3UT1A 2FRYA 1D09B 1I0CA 4XU1A 1FYNA 1Q86R 3CCEQ 3LW5E 5GAOl 1WZOA 2FHDA 1ZLMA 3A5ZB 5HK3A 3G1JA 1ZA2B 1I81A 4J9GA 1VQOQ 4JRKA 5IXBA 1RAGB 3LWIA 4F7UG 4C8QF 2COZA 1VQ5T 1M5Q1 2FZKB 4F17A 1YJNT 4CC3A 1QVGA 2J06A 5CKDA 3VS5A 1UGPB 2H3JA 2CUDA 2AKKA 3TU4K 4FCYA 3V7CA 3DLMA 1VQ4T 2EGCA 4XTWA 1BI0A 4CI0C 1VIFA 3OQ5A 2K9GA 2K2VA 1QCFA 2DFUA 2COYA 3HRSA 5LJ5e 2F2XA 4EMKC 5C6SA 2RK2A 1VQ9Q 1MUZA 1TTHB 2CZ6B 3CC4T 1R77A 1JBMA 4GBQA 1PSFA 3PMIA 5CKFA 1G2BA 1T0HA 2GNCA 2L5QA 3CC4A 4N4HA 4HT9A 1M2OA 4OMOA 1VQ6T 5IAYA 2A28A 2XIDA 3OB9A 1H3HA 5KYUB 2QDLA 4PJOB 1UHFA 1Z9QA 2KGTA 2LP5A 2QQ9A 5FU6C 1X2QA 4LDYA 4M75G 2MAMA 2KBTA 4M7DF 5LJ5j 2LJ1A 1I5LA 4KUDK 1JJ2S 3OYGA 3EFSA 2RQTA 2A7YA 4LXCA 1PWTA 2L3QA 4DBHA 4NS5A 3FLGA 2ESWA 3OMGA 2VVKA 1IGUA 3META 3KFVA 4AT1B 2O88A 3S6WA 2RQUA 3M56A 3QIIA 3LH0A 2PTKA 1FX7A 2FEIA 1Q82U 4F7UE 2CP6A 2M0OA 1S72T 3MKDA 2E5QA 2KSSA 3QXEB 2MWOA 2XKOC 3VUZA 1W2BA 2ED1A 4FW2A 1Y7XA 5LL6S 5GMKl 1S72A 2DF6A 3JB9F 2K6DA 1U1TA 5GJWB 1YIJQ
chains in the Genus database with same CATH topology
2HD0A 2EQMA 1N9SA 2MF2A 4M77G 3OS0A 4MMLA 4OP0A 5DLQE 3RMQA 4ELZC 1FWZA 3DB3A 3JCMb 1QVGS 2DXBA 1VQLT 3QZ5B 2XDDA 3V8KA 2R5AA 3BY7A 2DXCA 1BIAA 2LC4A 3MO8A 3Q1JA 4ME7A 1KC8C 4FU6A 1WJSA 4KULA 1VQ7A 4FIBA 4Q5WA 4IUTA 4MDWA 3UDCA 3JB9G 2XDBA 3L1AA 3C95A 3OYEA 1TH7A 4OB1B 1G3YA 2Y90A 2EJ9A 4FM4B 4HKEA 2HQEA 3H6ZA 3RMSA 3SWNA 2RI2A 5C0MA 4M7AG 1FXXA 4PKCC 3M57A 3G4SA 4V2SA 2K3XA 2DZCA 4ZN1A 3I56A 3JCMd 3JCMe 2VGNA 3OW2S 3RKWA 2ZPGB 4EMKA 4A54A 4C5IA 5GAN8 4RG2A 2OTJA 1OZ2A 2RH2A 1VUBA 5LJ3e 1KQSA 1I8FA 4OB2B 5CQXA 5GAOm 4M78F 4JLIA 4M75C 1WGSA 4J7IA 3NTKA 1NPPA 3G71T 4MMKA 4EDUA 5KE3A 2K57A 5DM7R 5GANh 1VQPT 3PGGA 1G3WA 4NL2A 4PJOG 3KBGA 3OW2A 2F69A 2LT4A 2K5LA 1EIFA 2QQAA 2O4XA 3CEYA 2DEQA 1NPRA 1M1FA 1WNLA 2X4JA 4M77D 3UPUA 1K8AC 1KD1U 3L2QA 2OTLT 1JJ2A 3GF5A 4YTLA 2B8AA 2WSCE 4M78C 5L8RE 1I4K1 4C8QG 4C92B 4EPCA 3CCQT 3BDUA 2QQBA 3O8VA 4ATOA 3M55A 2KDSA 3SWNC 1UGQB 4BI3A 3S3NA 1WJQA 2LX9A 1VQNT 3JCMV 3QHSA 4M7DG 3CBMA 4FT4A 3CC2A 2DIGA 2O4XB 4PJOA 3G6ET 1UGSB 1UB4A 3LWHA 2ZGWA 2CS7A 3QPHA 4JRQA 1KQSS 4E7KA 1RL2A 1Q7YC 2GF7A 4C8QA 4JDSA 3QZ9B 1H641 3CC2T 4M7AE 2Y4YA 3PMTA 4BY6B 3G6EA 3V8JA 4X9DA 2E41A 2CZ1B 2EQKA 3CC7A 1Q7YU 5I2MA 4X9CA 3ZEHA 4PLLA 4EMGA 3CD6A 2JOYA 1M8VA 3CCEA 2EIFA 5GAOr 4M7DB 3HRUA 4N0AC 4XAXB 3OSVA 4XU3A 5J26A 1BI1A 1NE8A 5LJ5g 1K73C 3QYGB 3CC7T 3MEVA 1P92A 4XTVA 4A4KA 1VQOT 4C92G 4J6WA 1VIEA 4R56A 4XK8E 2IG0A 4OB3B 3SWNB 3SD4A 2V8JA 5LJ3d 3RESA 3URGA 2P4TA 3OBYA 4JUVA 1VQOA 1M1GA 2CZ0B 4RKUE 2ZPFB 3CCST 5DY9A 2RD1A 4M7AD 3QG1A 2QI2A 5D6XA 4BI4A 5GANd 2PVGB 1VQKT 2P0KA 1VQ8A 2DTIA 2E64A 2RI5A 1KQ1A 4L59A 3X24B 5I2SA 4JRIA 2RHYA 2VXFA 3HHTB 5FU7B 1R8OB 3C12A 3X26B 4F7UB 3JCMX 3OYIA 3KUFA 3I55A 4LDXA 2LT1A 2MI6A 2XDPA 3L2WA 2DVEA 4A53A 2JN0A 2GQVA 3L2ZA 4M7AC 3CCMT 5LJ3h 4N4IA 2DXUA 4PJOF 4BD3A 4J6YA 3LX7A 3P8BB 4LD6A 3BFMA 3M54A 4LDWA 1Y07A 1B34A 1KQ2A 4A4EA 3CXCS 1M90U 3ASKA 3CMEA 4OF1A 3OYYA 2MMPA 1M1KC 4NOYA 1G5VA 2JTMA 4M78G 4DOWA 4R55A 2EQJA 4IUQA 2M1HA 2RA2A 3NTHA 3F70A 1V29B 2C06A 5FRNA 2LTOA 3M9QA 3TCJA 1WJRA 1YHQT 3OYDA 4KT0E 3GIBA 5GMKi 5HKCA 2EKOA 3EFRA 5GAMd 4M78A 4M75F 3CPWA 3MP8A 1VQ4A 3CBOA 1Q81U 1YJNA 4M75E 3ZBDA 3KXTA 5A0LA 4C0DC 5CK9A 4M75A 4LD9K 3M4YA 4E7HA 3L2VA 3S3MA 3OYKA 1GXIE 2PUOB 4QQ6A 1HK9A 1VQLA 1WQWA 2IVWA 3SFMA 2ZZDA 2VGMA 1QVFS 4QQGA 5LJ5f 3RKYA 3VJPA 2YLCA 3G7ZA 4BB7A 2JUFA 3CXCA 3CCUT 4C8QE 3CCQA 4IUPA 1G3TA 1D3BB 3A8GB 5HK0A 1Q82C 1Q86U 2PU9B 3VKIA 1M4ZA 1VQNA 2P0PA 4OVAA 2DPPB 4E7JA 4BI8B 3ER0A 3OY9A 2AHJB 2RJDA 3C94A 2DD5A 4IURA 4EMHA 3G4ST 2F5KA 3GP8A 5GAN5 4J5YA 3SDZA 5KH6A 1BI2A 4RCCA 2QTXA 3M53A 1W2BS 2RHUA 2WSEE 2WACA 2DIQA 3M59A 2RJFA 2XHCA 4HCZA 1LOJA 1JB0E 2CZ7B 2ZPIB 2QQSA 4DOVA 1Q86C 4BDZA 3OSSC 3RIRA 3DB4A 5LJ5d 2HAXA 2KVQG 5GAOp 3CD6T 3OYFA 1YITA 4M77B 1UEBA 3LGLA 2D9TA 4QQDA 5KE2A 4XU2A 4IKFA 5A0GA 3JRZA 2R57A 3TEEA 3CCLT 1YJ9T 1YI2T 1IREB 4MZPA 1VQPA 5LJ3f 1YITT 1ZQ1A 3MEWA 3JCMh 5HY6A 4M75B 1ZBXA 2K4YA 4XTZA 1YJ9A 2FVUA 2OAUA 5GMKh 5GANf 3P8DA 4C92C 3JCMc 3JAME 2LVMA 3ZFJA 4ZN3A 3QBYA 2I2LA 5I21A 3OYNA 4F7UF 3CCRA 4FT2A 1LJOA 1Y96A 1MGQA 1ZHIA 3OYHA 1DJ7B 4TVRA 4C8QC 2QA4T 3MP1A 4BE0A 3JCMP 2E65A 4KBMB 2EQUA 4J6XA 5LJ3j 4PJOD 5GAN6 2M16A 3LLRA 1RI0A 2MWPA 3P8HA 3WVDB 4M7DD 2DO3A 1O9SA 2RK1A 3JCMW 5CR2A 1Y96B 2YHTA 1KD1C 2GFUA 1H3ZA 3JCMJ 1MHNA 3CCET 1YBYA 2E70A 1KHIA 1OI1A 3FB9A 3HRTA 5IN1A 4M7AA 4Y28E 3GOXA 4M7DC 4C92F 3CMET 1YCYA 1D3BA 4JS5A 3E19A 1N8RC 3E9FA 5LJ3g 4C92E 3QKJA 4M77F 1WPYA 3PT9A 2ZPHB 5DLOA 2GFAA 4GY5A 4A4FA 5GANg 2G3RA 3HL8A 5CQYA 4E7IA 1QW1A 1X01A 1QVFA 4N0AA 2V8IA 2EYQA 4ZGDB 3JB9H 1BYMA 3BW1A 4XU0A 5FRMA 2KQWA 2D0QB 1VQ8T 3RKXA 4OMFB 3WVEB 4LDUA 3MEUA 4XTUA 3X28B 1U1SA 2DKGA 1IZ6A 4C8QD 2QQRA 3A8OB 3I55T 1K73U 1VQ7T 3WXMB 4J7FA 3GNFB 3MEAA 2FB7A 2E1HA 2BKDN 4OGCA 3FRNA 3DLLA 1NZ9A 1G3SA 3OYMA 5GAMj 1K9MC 3GPLA 4IUVA 3J81E 2XG8D 2PQWA 4M7DA 3J7AF 1JRIA 2E10A 1YIJT 4QVZA 3NFCA 4ELYC 1AHJB 5D6WA 1M9SA 1B34B 1N6AA 3VYHB 4BUGA 4DQ2A 4EMKB 3V7SA 5J3BA 5CCAA 2WSFE 2D6FA 3CCVA 2KK4A 2L8DA 2DXTA 3QUIA 4MZMA 3L2RA 1UGRB 3JB9I 1QVPA 2KY9A 1N9RA 5CIUA 2EAYA 3JB9J 1KC8U 4UC4A 3G71A 1N27A 3HFNA 3I56T 3A8MB 2CYZB 4HT8A 3OS5A 3OS1A 3JB9D 3INZA 4C92A 2XI9A 4M78D 3SB2A 5GAN4 2K3YA 5GAN3 1M90C 3MCAB 1YJWA 1YI2A 3HFOA 4C0DB 5GANj 3FDRA 4JRPA 3VYGA 4JLGA 3M5AA 4JS4A 2FYKA 2RO0A 4OB0B 4C0GA 3OYAA 2DK3A 1YJWT 3RERA 2JZ2A 2M9UA 3CCUA 2R58A 3CMAA 1VQMT 4P5NA 2XICA 3CBPA 3CCRT 1W4SA 4WF2A 2LRQA 1SSFA 2YRVA 3JCMQ 2RJCA 4XQ3A 2LQ8A 1KG1A 2QA4A 2RM4A 4PL6A 4RCBA 3TREA 4J83A 2PUKB 3VU3C 2RHZA 4E47A 1XOVA 2VYTA 1VQ9A 4BACA 1K9MU 2RHIA 2K5IA 4ZTJA 3AHUA 4QVCA 2CKKA 4BE2A 3ME9A 5GAMh 4XTXA 5CVIA 5AYFA 4B9XA 1VQ6A 3R6OA 4IUUA 4M75D 5GMKm 3CCJA 1XTDA 3GNGA 4OGEA 3PIPA 2XD0A 5J39A 4L6V5 2FL7A 5FU7C 2DTHA 4CRIA 3GLXA 3X20B 3HSBA 2QEXA 2JTFA 2E6NA 2LDMA 2L3RA 3EAEA 3C4SA 3H8ZA 4XTYA 5CO7A 4A4HA 5CAIA 2VUBA 1X75C 4KUIA 1VQKA 5GAN2 2QEXT 4PJOE 2BUDA 2RJEA 2DD4A 2K5FA 3RUXA 3UWNA 3MP6A 4Y91A 3V7RA 4RMOA 3OYBA 5CKBA 4A4GA 4C0ZA 2DAQA 3N5BB 3PNWC 4MZTA 2XK0A 3UT1A 3QO3A 4L5GA 5IT9E 5KCHA 2KAFA 2LQKA 4XU1A 1QP2A 4ZGEB 2JNGA 2HNIA 1BIBA 3M4GA 4NL3A 4ZTFA 1BI3A 3FEOA 4LDVA 1N8RU 3OA6A 3LW5E 5GAOl 3HPWA 2DZ9A 3VV0A 5FROA 2EJGA 2FHDA 5D6YA 5GANe 1Y71A 3A5ZB 1NJIC 3QJ6A 2KMTA 2A3LA 2NLUA 4MDXA 5HK3A 3QDRB 2BIVA 3JSCA 3BDLA 4II1A 1I81A 3LGFA 4JRKA 2RHXA 3FJPA 3LWIA 4O5VA 2E12A 2V8KA 2ZCFB 4FSXA 4C0FA 4C8QF 1OYXA 4F7UG 1M5Q1 1VQ5T 2RB6A 2X4WA 4FL6A 2OTJT 4BE1A 1NJIU 1KHCA 1YJNT 1QVGA 2PVOB 3V8LA 2LCLA 5CKDA 1BKBA 2R5MA 1UGPB 2H3JA 5GAN7 4ZGJB 4C5GA 3OYJA 3TU4K 4X34A 5GMKe 3V7CA 3DLMA 5M9OA 3S3OA 1K8AU 2P0QA 1VQ4T 3OYCA 4XTWA 4J8OA 1O75A 3CPFA 2VV5A 2PVDB 4D6WA 2OTLA 4M78B 3FC3A 1BI0A 4HA8A 4CI0C 5KCOA 5FU6B 2X4XA 1VIFA 3HKSA 1VQMA 3CMAT 1XNIA 3OQ5A 5A2QE 1YIJA 2X35A 3M58A 2K2VA 3QJYA 4M77C 2ZPBB 2O01E 4M7AF 3HRSA 5LJ5e 4GLKA 4PLIA 4EMKC 3PIOA 5C6SA 2RK2A 1OZ3A 4JJNK 3CCVT 2CZ6B 5GMKj 3CC4T 1U8RA 1JBMA 2HBPA 1PSFA 4M77A 4BY6C 3OBWA 3PMIA 3MHXA 4M78E 3JCMf 5CKFA 1HXDA 2YLBA 2L5QA 3CPWS 4N4HA 3CC4A 4HT9A 1LNXA 1Q81C 2XU8A 2ZPEB 3OYLA 1VQ6T 5IAYA 4B9WA 3DKMA 3OB9A 2XIDA 5GAMe 4O6JA 2LCCA 4C92D 4PJOB 2CGHA 5GAMg 2QQ9A 5FU6C 3L2UA 3CCSA 2E6ZA 4LDYA 4PNOA 4M75G 2EFIA 3CCLA 2MAMA 4QW2A 4C5HA 1M1KU 3A8HB 4M7DF 2VC8A 5LJ5j 5CKEA 5FLXE 1I5LA 4KUDK 4M77E 1JJ2S 4M7DE 3QYHB 3J80E 2LNVA 3OYGA 3EFSA 1PSEA 2VXEA 4F7UA 5EG2A 2A7YA 5CKHA 1VQ9T 1XQHA 4HCCA 2L89A 4C5EA 5LJ5h 3OS2A 4M7AB 5GAOn 4NS5A 2GCXA 3FLGA 3CCMA 2JVVA 2QXFA 3FIFA 3OMGA 2EWNA 2EJFA 3PTAA 4PJOC 3CCJT 2QDYB 3L42A 3T9NA 3NTIA 3LYIA 3META 4DA4A 3S6WA 2X4YA 3A8LB 3M56A 4RG8A 4C8QB 5A0DA 4QVDA 3QSUA 5GAMf 3VUBA 3E1SA 3QIIA 2RI3A 3LH0A 5GAOq 1FX7A 2DJZA 2DTOA 2F5TX 4F7UE 1Q82U 1VQ5A 2M0OA 2Y4XA 3HP9A 1S72T 2E5QA 2KSSA 3OMCA 3QXEB 1X6OA 1YHQA 2MWOA 2XKOC 3PFSA 3VUZA 3X25B 4VUBA 4N4GA 1W2BA 2HQXA 1Y7XA 5LL6S 5GMKl 4BDYA 3E9GA 1S72A 3JB9F 4Z02A 1U1TA 3JCMg 4E7LA 1QP3A 1WQ7A 4HCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOW A;  3PTA A;  4FSX A;  1M4Z A;  1ZBX A;  4DA4 A;  2FVU A;  4KUL A;  4JJN K;  4KUD K;  4FT2 A;  1ZHI A;  3PT9 A;  4DOV A;  2FL7 A;  3TU4 K;  4LD9 K;  1W4S A;  4FT4 A;  4BB7 A;  4KUI A; 
#chains in the Genus database with same CATH topology
 2HD0 A;  4MML A;  4OP0 A;  2NUZ A;  3JCM b;  1LPL A;  1TUG B;  3Q1J A;  4CC4 B;  1WJS A;  1PHT A;  2XDB A;  3L1A A;  2Y90 A;  4FM4 B;  1NYG A;  3RMS A;  5C0M A;  2RI2 A;  1FXX A;  4PKC C;  3JCM e;  3RKW A;  4EMK A;  1I8F A;  4M78 F;  3TQ7 P;  4M75 C;  2DL3 A;  2KRM A;  1OV3 A;  4J7I A;  3G71 T;  2C0I A;  5KE3 A;  1K1Z A;  2K57 A;  5GAN h;  2O9V A;  3OW2 A;  2A0F B;  4PJN A;  4A53 A;  2LT4 A;  1E7O A;  1K8A C;  2QEX Q;  2B8A A;  5L8R E;  1I4K 1;  4C8Q G;  1VYV A;  2QQB A;  2KDS A;  1BCM A;  3S3N A;  1VQN T;  2E3H A;  1SF9 A;  4FT4 A;  3VS7 A;  5KYN A;  3G6E T;  1UB4 A;  2FZG B;  4E7K A;  1RAC B;  3V8J A;  4HVV A;  2E41 A;  2EQK A;  1AVZ C;  1X2K A;  2M02 A;  1UJ0 A;  5I2M A;  3NGP A;  4X1V A;  4N0A C;  4XU3 A;  1BI1 A;  1NG2 A;  1Y57 A;  2E5K A;  1VQO T;  2J6F A;  2JMA A;  1SSH A;  2CUB A;  4J6W A;  4R56 A;  1VQ5 Q;  3SWN B;  2KEA A;  3URG A;  5LJ3 d;  1VQO A;  4JPB W;  4A63 B;  3H9N A;  5DY9 A;  2RD1 A;  1S72 Q;  4M7A D;  2DYB A;  4BI4 A;  2P0K A;  2RI5 A;  4BE0 A;  4JRI A;  2VXF A;  1R8O B;  2MI6 A;  2DVE A;  2OI3 A;  2JN0 A;  2GQV A;  1SHF A;  2DVJ A;  4PJO F;  3I5R A;  1D1C A;  1E6G A;  4J6Y A;  1IHV A;  1VYT A;  2KRS A;  3P8B B;  3BFM A;  1OU8 A;  1KQ2 A;  3CXC S;  4DEY A;  3M0R A;  3ASK A;  2COW A;  4OF1 A;  3G4S Q;  2MMP A;  4R55 A;  2YRD A;  4IUQ A;  2M1H A;  3NTH A;  2NWM A;  1V29 B;  1KC8 R;  5FRN A;  3TSW A;  2LTO A;  1WJR A;  3EH1 A;  3EFR A;  4D8D A;  4LD9 K;  4M75 A;  1K73 R;  3L2V A;  1AD5 A;  2DNU A;  2PUO B;  4QQ6 A;  1VQL A;  2IVW A;  3SFM A;  1PG5 B;  2MCN A;  3CCU T;  1Q82 C;  1G3T A;  3RDV A;  1VQN A;  2DPP B;  1VQ4 Q;  3ER0 A;  3G4S T;  1IO6 A;  4IUR A;  1QKX A;  2F5K A;  1PD0 A;  2FG0 A;  3SDZ A;  1BI2 A;  1YJ9 Q;  3G6E Q;  2DIQ A;  3M59 A;  1X27 A;  4DOV A;  1LOJ A;  1JB0 E;  5GJV B;  3MPU B;  1KFZ A;  3DB4 A;  5LJ5 d;  1UEB A;  2YWW A;  5KE2 A;  2KE9 A;  1YI2 T;  1IRE B;  1V1C A;  2DET A;  4J9C A;  4RTT A;  5HY6 A;  1K9M R;  4M75 B;  2G6F X;  2OAU A;  3JCM c;  3QBY A;  4DBR A;  1Y96 A;  1UFF A;  1MGQ A;  1ZHI A;  3OYH A;  1DJ7 B;  2E65 A;  4KBM B;  1UEC A;  2VAS A;  3P8H A;  1RI0 A;  1JEG A;  1WHH A;  5FW9 A;  2RK1 A;  3JCM J;  3EG0 A;  1ACM B;  3CCE T;  2E70 A;  3FB9 A;  3A98 A;  3CME T;  4JS5 A;  1N8R C;  2CDT A;  3E9F A;  4C92 E;  2KI7 A;  4GY5 A;  3I56 Q;  2EGA A;  1QVF A;  2AK5 A;  3BW1 A;  2ATC B;  2L3P A;  1TSF A;  4HVU A;  5FRM A;  1AZE A;  4LDU A;  3MEU A;  3I55 T;  1U1S A;  4WCI A;  3GNF B;  3VS2 A;  2BKD N;  2EBP A;  1G3S A;  3E2U A;  5GAM j;  2QGG A;  2EQI A;  1YIJ T;  2EYX A;  3NFC A;  2H8H A;  1AHJ B;  5D6W A;  4DQ2 A;  1B34 B;  3VYH B;  1BU1 A;  4AFS C;  4LN2 A;  2D6F A;  3CCV A;  1PKT A;  2L8D A;  4MZM A;  3JB9 I;  1QVP A;  5CIU A;  1TUC A;  1WIE A;  4AFQ C;  3I56 T;  1B07 A;  3EG1 A;  1M3A A;  1T3S A;  3OS5 A;  1D1B A;  2OJ2 A;  5GAN 4;  1FMW A;  2K3Y A;  1QVG P;  5GAN 3;  1M90 C;  5GAN j;  3FDR A;  4JRP A;  3VYG A;  4JLG A;  2HKQ B;  3CMA A;  3CBP A;  3CCR T;  3I5S A;  1SKU B;  1GFC A;  2RJC A;  2MOX A;  2RM4 A;  3TRE A;  1XOV A;  1BBZ A;  2VYT A;  1VQ9 A;  2RHI A;  1WHL A;  2K5I A;  2CKK A;  3M0P A;  5GAM h;  2KRO A;  1AZG B;  4IUU A;  2C0O A;  2HMA A;  4OGE A;  4CRI A;  1SPK A;  3HSB A;  1GL5 A;  2QEX A;  1IRX A;  3CME Q;  2GTO A;  3EAE A;  4XTY A;  1ZUY A;  1VQK A;  1W6X A;  1RAH B;  1KD1 R;  2K5F A;  3OYB A;  2HCK A;  3CQT A;  4KRT A;  2KNB B;  3QO3 A;  1RAF B;  4L5G A;  4KH0 B;  1VYU A;  2VB6 A;  2JNG A;  2DRK A;  2HNI A;  3M4G A;  1OUL A;  4LDV A;  4EIK A;  1N8R U;  3OA6 A;  3HPW A;  2DZ9 A;  3VV0 A;  1NJI C;  3QJ6 A;  2KMT A;  2NLU A;  4MDX A;  3JSC A;  5FWB A;  2CT4 A;  1OYX A;  2X4W A;  2JM9 A;  3REB B;  2OTJ T;  1NJI U;  1KHC A;  1VQM Q;  1PC0 A;  2R5M A;  1GCQ C;  5GAN 7;  1X6G A;  2E3I A;  1K8A U;  3OYC A;  1O75 A;  2PVD B;  5FU6 B;  2X4X A;  3CMA T;  1XNI A;  2X35 A;  3QJY A;  2ZPB B;  4QT7 A;  3PIO A;  2DLP A;  3R6N A;  5GMK j;  4M77 A;  3OBW A;  3MHX A;  3JCM f;  1HXD A;  3CPW S;  1Q81 C;  3OYL A;  1B7T A;  2LCC A;  1YCS B;  3QDF A;  5IHI A;  3EHR A;  5GAM g;  1WHK A;  4F14 A;  2E6Z A;  1UG1 A;  4PNO A;  2EFI A;  3CCL A;  2B86 A;  1M1K U;  3A8H B;  2IPO B;  2HQH A;  4M77 E;  4M7D E;  1PSE A;  4F7U A;  5EG2 A;  4HCC A;  2DBK A;  4M7A B;  5GAO n;  2P4R A;  4Z88 A;  2HBW A;  5IHN A;  2QXF A;  1T3L A;  2EJF A;  3PTA A;  3CCJ T;  3T9N A;  3L42 A;  1RUW A;  3LYI A;  4DA4 A;  2J6K A;  3A8L B;  4RG8 A;  4C8Q B;  5GAM f;  2RI3 A;  1RLP C;  3JV3 A;  2DJZ A;  2SRC A;  1VQ5 A;  2Y4X A;  4FYY B;  3HP9 A;  1K0X A;  1YHQ A;  1X6O A;  1TOV A;  1RLQ C;  2AZV A;  4OMM A;  6AT1 B;  3X25 B;  8ATC B;  3RBB B;  2HQX A;  2KRN A;  1M27 C;  1M1K R;  3C0C A;  1FWZ A;  3DB3 A;  1QVG S;  3QZ5 B;  2XDD A;  3V8K A;  2OTL Q;  4JJC A;  1BIA A;  1KJW A;  1KC8 C;  4FU6 A;  4KUL A;  4MDW A;  3JB9 G;  1NLO C;  1G3Y A;  2GGR A;  4HKE A;  4HXJ A;  4M7A G;  2DZC A;  4DBF A;  2VGN A;  3ULR B;  4C5I A;  5GAN 8;  4RG2 A;  1OZ2 A;  1KQS A;  5GAO m;  4JLI A;  1TUD A;  1YN8 A;  4RTU A;  3UA6 A;  1NPP A;  1QLY A;  2BTT A;  4MMK A;  5DM7 R;  3PGG A;  1G3W A;  2K5L A;  1EIF A;  3CEY A;  2O4X A;  4M4Z A;  3UPU A;  1KD1 U;  1M1F A;  2OTL T;  3L2Q A;  4C92 B;  2DER A;  4ATO A;  3BDU A;  3SWN C;  4BI3 A;  2RQR A;  1WJQ A;  2ROT A;  1M8M A;  4M7D G;  4GLM A;  1N5Z A;  3LWH A;  2ZGW A;  1Q7Y C;  2GF7 A;  4C8Q A;  3QZ9 B;  2Y4Y A;  3PMT A;  3G6E A;  1QCO A;  3VS1 A;  1HSQ A;  2CZ1 B;  4X9C A;  4J9B A;  3ZEH A;  1G83 A;  3EHQ A;  2EIF A;  4XAX B;  5LJ5 g;  5KYY A;  1WLP B;  4XTV A;  3OW2 P;  1VQP Q;  1D0Y A;  1ZSZ B;  4XK8 E;  4RTZ A;  2IG0 A;  3SD4 A;  2BE7 D;  1EFN A;  1M1G A;  1I1J A;  2CZ0 B;  1ZBJ A;  3QG1 A;  2K79 A;  5I2S A;  5IH2 A;  3C12 A;  2YUO A;  4RTV A;  3KUF A;  2LT1 A;  1N8R R;  3L2Z A;  4M7A C;  2GBQ A;  2VWF A;  4N4I A;  2DXU A;  4BD3 A;  3LX7 A;  1TWB A;  3HTR A;  4A4E A;  2MYS A;  1F1B B;  1HD3 A;  2OX7 A;  4NOY A;  2CH4 A;  2JTM A;  1NM7 A;  2EQJ A;  1M3B A;  2JJ9 A;  4KT0 E;  5AT1 B;  3GIB A;  2EKO A;  2AT1 B;  3CPW A;  1VQ4 A;  3CBO A;  3GBQ A;  1MV0 B;  3M4Y A;  4B6M A;  3OYK A;  3I9Q A;  1WQW A;  2RN8 A;  2YUQ A;  2YLC A;  3CXC A;  4C8Q E;  2O2O A;  4IUP A;  1ZSZ A;  3A8G B;  1Q86 U;  3VKI A;  4ESR A;  1M4Z A;  2FO0 A;  2P0P A;  4E7J A;  4BI8 B;  3CC7 Q;  2AHJ B;  2GQI A;  1FMV A;  2M51 A;  5GAN 5;  2QG9 B;  5EC7 A;  2RQW A;  2WSE E;  4HCZ A;  2WAC A;  2XHC A;  2ZPI B;  4AFU C;  3G71 Q;  4BDZ A;  4WTO B;  3H0F A;  2HAX A;  2KYB A;  3O5Z A;  4M77 B;  2CP3 A;  2D9T A;  4IKF A;  5A0G A;  3JRZ A;  1YJ9 T;  1VQP A;  5LJ3 f;  4PJM A;  3JCM h;  2F2V A;  2K4Y A;  1GRI A;  1YJ9 A;  5GMK h;  5D7U A;  2LVM A;  5ECA A;  3ZFJ A;  1D0X A;  1VA7 A;  4ZN3 A;  4F7U F;  4AFZ C;  1LJO A;  1RAD B;  4TVR A;  1YFN A;  4J6X A;  5LJ3 j;  2MWP A;  4M7D D;  1O9S A;  5CR2 A;  1Y96 B;  1ZUK A;  1NBE B;  1MHN A;  3ZL7 C;  4M7A A;  2K3B A;  4K11 A;  2LZ6 B;  1WHM A;  2JW4 A;  1YCY A;  5LJ3 g;  2KXD A;  1K8A R;  3PT9 A;  2LX7 A;  2BZ8 A;  4A4F A;  4E7I A;  2DYI A;  5CQY A;  1AWW A;  1QW1 A;  1X01 A;  1VQL Q;  4N0A A;  2V8I A;  4ZGD B;  3JB9 H;  1GBR A;  4XU0 A;  2D0Q B;  4DEX A;  3X28 B;  2DKG A;  2QQR A;  3A8O B;  2NUT B;  3WXM B;  4J7F A;  1WXT A;  2E1H A;  4OGC A;  3DLL A;  1NZ9 A;  1K9M C;  2XG8 D;  3J7A F;  4QVZ A;  4EMK B;  1SRM A;  2DJQ A;  2DXT A;  3QUI A;  3L2R A;  1N9R A;  1H92 A;  1TU0 B;  3G71 A;  4HCK A;  1N27 A;  3BE3 A;  1GBQ A;  1I5O B;  3A8M B;  4HT8 A;  1D0Z A;  3OS1 A;  3JB9 D;  1AWX A;  2LNH B;  2XI9 A;  3MCA B;  1YJW A;  1YI2 A;  3EG9 A;  2FYK A;  4OB0 B;  3VS3 A;  2YSQ A;  1YJW T;  3RER A;  1BB9 A;  1VQM T;  1MV3 A;  2YRV A;  4PL6 A;  2X9H A;  4FYX B;  4E47 A;  4BAC A;  4LUD A;  3AHU A;  2CP0 A;  3NMZ C;  4XTX A;  1OPL A;  2FPD A;  1XTD A;  2XD0 A;  2FL7 A;  1GCP A;  2DTH A;  2JT4 A;  3GLX A;  2E6N A;  2LDM A;  3H8Z A;  3U23 A;  4A4H A;  5CAI A;  2VUB A;  1X75 C;  5GAN 2;  2QEX T;  2BUD A;  1TXQ A;  2DBM A;  2DD4 A;  3MP6 A;  4RMO A;  2EYW A;  5CKB A;  4A4G A;  2ZAE A;  3EGD A;  5KCH A;  2KAF A;  1QP2 A;  1BIB A;  4NL3 A;  1BI3 A;  3SEM A;  4RTY A;  2KT1 A;  5GAN e;  1JU5 C;  5HCK A;  2EVR A;  3QDR B;  2BIV A;  2HL3 A;  2P84 A;  3BDL A;  4II1 A;  2RHX A;  1NYF A;  2V8K A;  2ZCF B;  4FSX A;  1OU9 A;  2EPD A;  4FL6 A;  4JJB A;  4OML A;  2LCL A;  4ZGJ B;  4C5G A;  2MPX C;  1WA7 A;  1JJ2 P;  3CMA Q;  2D8H A;  1QCN A;  4X34 A;  2D0N A;  5GMK e;  2P0Q A;  4J9F A;  4Z8A A;  4OMN A;  3CPF A;  4D6W A;  2VV5 A;  3FC3 A;  4R0K A;  1VQM A;  3M58 A;  1PNJ A;  4M77 C;  4QKU A;  3PVQ A;  1OZ3 A;  4JJN K;  2CRE A;  1IGQ A;  3CCV T;  4OMQ A;  2F1L A;  2XU8 A;  2ZPE B;  1Y0M A;  1IB8 A;  5GAM e;  1QMC A;  4O6J A;  2AZS A;  4C92 D;  1QVF P;  2CGH A;  3CCS A;  1QWE A;  1GFD A;  3CCM Q;  4QW2 A;  2VC8 A;  5CKE A;  5FLX E;  1X6B A;  2EYZ A;  2F2W A;  2VXE A;  1VQ9 T;  1NEB A;  4C5E A;  3OS2 A;  2GCX A;  3CCM A;  1YHQ Q;  8AT1 B;  3NTI A;  4LUE A;  5A0D A;  3QSU A;  1WYX A;  3E1S A;  5GAO q;  1J3T A;  2DMO A;  3CPW P;  2ENM A;  4VUB A;  4N4G A;  2MK5 A;  4BDY A;  3VRY A;  4E7L A;  3JCM g;  1QP3 A;  1UGV A;  2EQM A;  2MF2 A;  4M77 G;  3RMQ A;  1WX6 A;  4ELZ C;  2DXB A;  2SEM A;  1VQL T;  2R5A A;  3BY7 A;  2LC4 A;  3MO8 A;  1YJW Q;  1VQ7 A;  4FIB A;  4Q5W A;  3UDC A;  9ATC B;  2DX1 A;  2EJ9 A;  4PJJ A;  2HQE A;  3SWN A;  2DE0 X;  3M57 A;  3H0H A;  2K3X A;  3I56 A;  3JCM d;  1D1A A;  2HEQ A;  4A54 A;  4ORZ A;  1M2V B;  2RH2 A;  1VUB A;  4OB2 B;  1WGS A;  2HSP A;  4PJO G;  3KBG A;  3QWY A;  2F69 A;  2QQA A;  3CCR A;  2DEQ A;  1NPR A;  4M77 D;  2X4J A;  1TS9 A;  3MJX A;  1JJ2 A;  2WSC E;  3CCQ T;  1NLP C;  4EPC A;  3O8V A;  3M55 A;  1UGQ B;  2LX9 A;  3JCM V;  1SEM A;  3QHS A;  2PZ1 A;  4OMP A;  2DIG A;  2O4X B;  2JS0 A;  2W10 A;  3M0S A;  5KYU A;  3VRZ A;  2C0T A;  2CS7 A;  3QPH A;  1OQK A;  1KQS S;  4M7A E;  2JM8 A;  3CC7 A;  4ZNX A;  5KYX B;  4EMG A;  3CD6 A;  1JO8 A;  2JOY A;  1YI2 Q;  1M8V A;  3CCE A;  3HRU A;  5J26 A;  3OSV A;  1NE8 A;  3CC7 T;  3CC2 Q;  2KR3 A;  4OB3 B;  2V8J A;  3RES A;  4PJL A;  1W70 A;  1LCK A;  3OBY A;  2FRW A;  4RKU E;  5D6X A;  5GAN d;  2PVG B;  1VQ8 A;  3X24 B;  1KQ1 A;  2RHY A;  4HVW A;  4F7U B;  3I55 A;  2XDP A;  3L2W A;  1C0M A;  3REA B;  2JMC A;  1Q81 R;  2A08 A;  4LD6 A;  3TSZ A;  3M54 A;  1Y07 A;  2QAZ A;  1ZSZ C;  4AMC A;  4M78 G;  4DOW A;  2RQV A;  1PD1 A;  1AOJ A;  3F70 A;  3NPF A;  1LVK A;  2C06 A;  3M9Q A;  3TCJ A;  1YWO A;  4IIO A;  1CKB A;  4F04 B;  3AT1 B;  5HKC A;  1R0C B;  2M0Y A;  4M75 F;  3LH5 A;  1T0J A;  4C0D C;  5CK9 A;  3S3M A;  1ABQ A;  1GXI E;  2I0N A;  1HK9 A;  1QVF S;  2LJ0 A;  5LJ5 f;  3RKY A;  4BB7 A;  1AT1 B;  2JUF A;  5FWC A;  5HK0 A;  1D3B B;  2BE9 B;  2CT3 A;  1SHG A;  2DD5 A;  4EMH A;  2MIO A;  3GP8 A;  4J5Y A;  5KH6 A;  2QTX A;  1W2B S;  2RJF A;  2CZ7 B;  1Q86 C;  2QQS A;  1W1F A;  2X51 A;  2JS2 A;  2KVQ G;  5GAO p;  2AIR B;  1YIT A;  3CCV Q;  3LGL A;  4E7Z A;  1EX4 A;  1JXO A;  3CCL T;  4MZP A;  1M30 A;  3EFO B;  1ZBX A;  5I11 A;  1TG0 A;  3CCU Q;  2BZY A;  3JAM E;  5I21 A;  2CSI A;  2V1Q A;  1YIT Q;  3MP1 A;  2EQU A;  4PJO D;  5GAN 6;  2M16 A;  3LLR A;  4Y92 A;  1CSK A;  3WVD B;  3I35 A;  2DO3 A;  3JCM W;  3PVL A;  2QA4 Q;  1KD1 C;  3EGX A;  1H3Z A;  2LQN A;  1K76 A;  1K4U S;  1OI1 A;  3IQL A;  2LQW A;  1E6H A;  1D3B A;  3E19 A;  2QK0 A;  3QKJ A;  4E6R A;  5DLO A;  2EYQ A;  1BYM A;  2KQW A;  2CP7 A;  1YJN Q;  3RKX A;  3GOX A;  4XTU A;  1IZ6 A;  1K73 U;  1QKW A;  1VQ7 T;  3FRN A;  3OYM A;  3GPL A;  4IUV A;  4M7D A;  1JRI A;  2E10 A;  1M9S A;  1IXD A;  4CC2 A;  5J3B A;  2WSF E;  1PRM C;  2KY9 A;  2EAY A;  3EG9 B;  4PFP A;  4DBQ A;  2CYZ B;  1Q82 R;  3EGD B;  1R0B G;  4M78 D;  4E2F B;  4RTX A;  3HFO A;  4C0D B;  1UDL A;  3M5A A;  4JS4 A;  4C0G A;  2DK3 A;  2L2P A;  2JZ2 A;  3CCU A;  2R58 A;  2GTJ A;  4P5N A;  2XIC A;  1X69 A;  1W4S A;  2LJ3 A;  1QQJ A;  3JCM Q;  1AEY A;  1KG1 A;  2LQ8 A;  3EGX B;  1WHG A;  4J83 A;  2D8J A;  3VU3 C;  2RHZ A;  1K9M U;  4ZTJ A;  4BE2 A;  3ME9 A;  4CC7 A;  5CVI A;  5AYF A;  2V26 A;  1VQ6 A;  2A37 A;  3PIP A;  4AG1 C;  5J39 A;  4L6V 5;  2DL7 A;  3TVT A;  4E7S A;  2QAS A;  4JZ3 A;  1V76 A;  3X20 B;  2D1X A;  4ANJ A;  2L3R A;  3CCS Q;  1ZA1 B;  5CO7 A;  4KUI A;  4PJO E;  4JJD A;  4Y91 A;  4C0Z A;  2FPE A;  2XK0 A;  1KQS P;  1PRL C;  5IT9 E;  2LQK A;  4ZGE B;  4PFO A;  4ZTF A;  2X3X D;  1UHC A;  3FEO A;  4PFZ A;  5FRO A;  2EJG A;  5D6Y A;  1UJY A;  1Y71 A;  4D8K A;  2A3L A;  1S1N A;  1CKA A;  1WXB A;  1UE9 A;  3LGF A;  2HZY A;  2JTE A;  3FJP A;  4O5V A;  2E12 A;  4C0F A;  2RB6 A;  4BE1 A;  2FPF A;  1VQ8 Q;  1HJD A;  2DA9 A;  2PVO B;  3V8L A;  1BKB A;  1MMA A;  3A1P A;  3THK A;  3OYJ A;  3UA7 A;  1NEG A;  5M9O A;  3S3O A;  2K7A A;  2Z0W A;  3EH2 A;  4J8O A;  2OTL A;  4M78 B;  2RNA A;  4HA8 A;  5KCO A;  3HKS A;  5A2Q E;  1YIJ A;  1PKS A;  1RAA B;  1QWF A;  2O01 E;  4M7A F;  4GLK A;  4PLI A;  1VQ6 Q;  4KH1 B;  2JXB A;  1U8R A;  2CSQ A;  2HBP A;  3SHW A;  4BY6 C;  4M78 E;  2OTJ Q;  2YLB A;  1MND A;  1LNX A;  4KGX B;  3CCJ Q;  4B9W A;  2LCS A;  3DKM A;  4HCB A;  3EGU A;  3L2U A;  4F16 A;  2J7I A;  1U06 A;  3EG2 A;  4C5H A;  1H8K A;  3QYH B;  3J80 E;  2LNV A;  5CKH A;  1FMK A;  1XQH A;  2L89 A;  2XMF A;  2FZC B;  5LJ5 h;  3H0I A;  2JVV A;  2RF0 A;  3FIF A;  3EG3 A;  2EWN A;  5KYX A;  3H41 A;  4PJO C;  2KYM A;  2QDY B;  2X4Y A;  1MMN A;  4RTW A;  1JQQ A;  4QVD A;  3VUB A;  4FYW B;  3UAT A;  2DTO A;  2F5T X;  4KGV B;  3OMC A;  3PFS A;  5KYY B;  5KYW A;  3E9G A;  4Z02 A;  1WFW A;  1WQ7 A;  3M0U A;  1N9S A;  3OS0 A;  5DLQ E;  4KGZ B;  4AG2 C;  2DXC A;  4ME7 A;  1Z9Z A;  4IUT A;  3C95 A;  3OYE A;  3I55 Q;  1TH7 A;  4OB1 B;  1MNE A;  2X3W D;  3H6Z A;  3G4S A;  4V2S A;  4ZN1 A;  3OW2 S;  1PM3 A;  4FYV B;  2ZPG B;  2OTJ A;  1GCQ A;  5LJ3 e;  5CQX A;  1WI7 A;  2BZX A;  2QGF B;  1K9A A;  3NTK A;  4EDU A;  1K0S A;  1VQP T;  3NHN A;  4NL2 A;  4J9D A;  3CCS T;  1KIK A;  3CCL Q;  1WNL A;  3GF5 A;  4YTL A;  4M78 C;  1U3O A;  1M3C A;  2QTV A;  1VQK Q;  5L23 A;  3CBM A;  3CC2 A;  4J9E A;  1ZUU A;  4PJO A;  2EKH A;  1UGS B;  2J05 A;  4LNP A;  1C1A A;  4JRQ A;  5IXF A;  1RL2 A;  4JDS A;  3CC2 T;  1H64 1;  2EW3 A;  3UF4 A;  4BY6 B;  5I22 A;  4X9D A;  1Q7Y U;  4PLL A;  2NYS A;  1SRL A;  5GAO r;  2NUP B;  4M7D B;  1K73 C;  3QYG B;  3MEV A;  1P92 A;  4A4K A;  4C92 G;  1VIE A;  4LE9 A;  3EFO A;  1OX9 A;  2O31 A;  1BCO A;  2P4T A;  4JUV A;  2ZPF B;  2QI2 A;  1VQK T;  2DTI A;  2E64 A;  4L59 A;  3HHT B;  2YRC A;  5FU7 B;  3X26 B;  3JCM X;  3OYI A;  4LDX A;  1XJW B;  2CH4 W;  1BK2 A;  3CCM T;  5LJ3 h;  1YP5 A;  1VQ7 Q;  1A0N B;  2OAW A;  1MMD A;  4FW1 A;  1C6V X;  4LDW A;  3D7S B;  1B34 A;  2L0A A;  1M90 U;  3CME A;  3OYY A;  1M1K C;  1WXU A;  1G5V A;  1AWO A;  2RA2 A;  2YDL A;  3QWX X;  1YHQ T;  2QYZ A;  3CCQ Q;  2CP5 A;  3OYD A;  3CCR Q;  1KSW A;  2L3S A;  5GMK i;  1VQN Q;  2DL4 A;  5GAM d;  4M78 A;  3MP8 A;  1Q81 U;  1YJN A;  4M75 E;  3ZBD A;  3KXT A;  5A0L A;  1ARK A;  2HDA A;  4E7H A;  1JXM A;  1VOM A;  4J9H A;  1AWJ A;  2ZZD A;  2VGM A;  4QQG A;  1OEB A;  3VJP A;  3G7Z A;  2ABL A;  3CCQ A;  2DIL A;  2PU9 B;  2RMO A;  1RI9 A;  2VKN A;  4OVA A;  3OY9 A;  3C94 A;  2RJD A;  2NUP A;  4RCC A;  3VS0 A;  3M53 A;  2RHU A;  5KYW B;  2ED0 A;  2AKL A;  1OPK A;  3RNJ A;  3OSS C;  3RIR A;  3VS4 A;  3RR6 A;  1X43 A;  4JZ4 A;  3CD6 T;  3OYF A;  2DL8 A;  4Z89 A;  4QQD A;  1RAB B;  4XU2 A;  1NJI R;  2ECZ A;  2R57 A;  2YUP A;  3TEE A;  1YIT T;  1ZQ1 A;  3MEW A;  4XTZ A;  1Q7Y R;  2FVU A;  5GAN f;  2LMJ A;  3P8D A;  4C92 C;  3M0T A;  3OYN A;  2I2L A;  1Q95 G;  2YT6 A;  4FT2 A;  1YNZ A;  2QA4 T;  4C8Q C;  3JCM P;  1SG5 A;  1WDX A;  2H3E B;  3CC4 Q;  2DRM A;  2HSE B;  2YHT A;  2GFU A;  2YXY A;  4J9I A;  1YBY A;  3HRT A;  1KHI A;  5IN1 A;  1KK7 A;  4Y28 E;  4M7D C;  1M90 R;  2KT8 A;  4C92 F;  2E4H A;  1U5S A;  2DL5 A;  1W2B P;  1M2V A;  4M77 F;  1WPY A;  1I07 A;  2ZPH B;  2GFA A;  2PNI A;  5GAN g;  2G3R A;  3HL8 A;  1WHJ A;  4FSS A;  1VQ8 T;  1HYO A;  4OMF B;  3WVE B;  4C8Q D;  1RAE B;  3MEA A;  2FB7 A;  3J81 E;  2PQW A;  2A36 A;  2O9S A;  2W0Z A;  4ELY C;  1RAI B;  2ROL A;  1N6A A;  4BUG A;  2KXC A;  3V7S A;  2YUN A;  5CCA A;  3PE0 A;  7AT1 B;  2KK4 A;  1OX8 A;  2DM1 A;  1UGR B;  3JB9 J;  3VS6 A;  1KC8 U;  4UC4 A;  3HFN A;  1B3Q A;  1UTI A;  4PK4 A;  2CP2 A;  3INZ A;  4IIM A;  1PCX A;  4C92 A;  3SB2 A;  3CD6 Q;  2K2M A;  2HKN A;  1YWP A;  2RO0 A;  2EGE A;  3OYA A;  2M9U A;  1G8X A;  1EZZ B;  3FJ5 A;  4RUG A;  4WF2 A;  2LRQ A;  1SSF A;  1ABO A;  4XQ3 A;  2EYY A;  2QA4 A;  4RCB A;  2PUK B;  2IIM A;  1UUE A;  1IHW A;  2HL5 C;  4QVC A;  1MMG A;  2NUT A;  1ZX6 A;  4B9X A;  2V1R A;  3R6O A;  4M75 D;  5GMK m;  3CCJ A;  3GNG A;  2J6O A;  5FU7 C;  3CXC P;  2JTF A;  3C4S A;  2DEU A;  3M0Q A;  5IHK A;  2RJE A;  3RUX A;  3UWN A;  2RPN A;  3V7R A;  1OOT A;  2DAQ A;  1ZSG A;  3N5B B;  4MZT A;  3PNW C;  3UT1 A;  2FRY A;  1D09 B;  1I0C A;  4XU1 A;  1FYN A;  1Q86 R;  3CCE Q;  3LW5 E;  5GAO l;  1WZO A;  2FHD A;  1ZLM A;  3A5Z B;  5HK3 A;  3G1J A;  1ZA2 B;  1I81 A;  4J9G A;  1VQO Q;  4JRK A;  5IXB A;  1RAG B;  3LWI A;  4F7U G;  4C8Q F;  2COZ A;  1VQ5 T;  1M5Q 1;  2FZK B;  4F17 A;  1YJN T;  4CC3 A;  1QVG A;  2J06 A;  5CKD A;  3VS5 A;  1UGP B;  2H3J A;  2CUD A;  2AKK A;  3TU4 K;  4FCY A;  3V7C A;  3DLM A;  1VQ4 T;  2EGC A;  4XTW A;  1BI0 A;  4CI0 C;  1VIF A;  3OQ5 A;  2K9G A;  2K2V A;  1QCF A;  2DFU A;  2COY A;  3HRS A;  5LJ5 e;  2F2X A;  4EMK C;  5C6S A;  2RK2 A;  1VQ9 Q;  1MUZ A;  1TTH B;  2CZ6 B;  3CC4 T;  1R77 A;  1JBM A;  4GBQ A;  1PSF A;  3PMI A;  5CKF A;  1G2B A;  1T0H A;  2GNC A;  2L5Q A;  3CC4 A;  4N4H A;  4HT9 A;  1M2O A;  4OMO A;  1VQ6 T;  5IAY A;  2A28 A;  2XID A;  3OB9 A;  1H3H A;  5KYU B;  2QDL A;  4PJO B;  1UHF A;  1Z9Q A;  2KGT A;  2LP5 A;  2QQ9 A;  5FU6 C;  1X2Q A;  4LDY A;  4M75 G;  2MAM A;  2KBT A;  4M7D F;  5LJ5 j;  2LJ1 A;  1I5L A;  4KUD K;  1JJ2 S;  3OYG A;  3EFS A;  2RQT A;  2A7Y A;  4LXC A;  1PWT A;  2L3Q A;  4DBH A;  4NS5 A;  3FLG A;  2ESW A;  3OMG A;  2VVK A;  1IGU A;  3MET A;  3KFV A;  4AT1 B;  2O88 A;  3S6W A;  2RQU A;  3M56 A;  3QII A;  3LH0 A;  2PTK A;  1FX7 A;  2FEI A;  1Q82 U;  4F7U E;  2CP6 A;  2M0O A;  1S72 T;  3MKD A;  2E5Q A;  2KSS A;  3QXE B;  2MWO A;  2XKO C;  3VUZ A;  1W2B A;  2ED1 A;  4FW2 A;  1Y7X A;  5LL6 S;  5GMK l;  1S72 A;  2DF6 A;  3JB9 F;  2K6D A;  1U1T A;  5GJW B;  1YIJ Q; 
#chains in the Genus database with same CATH homology
 2HD0 A;  2EQM A;  1N9S A;  2MF2 A;  4M77 G;  3OS0 A;  4MML A;  4OP0 A;  5DLQ E;  3RMQ A;  4ELZ C;  1FWZ A;  3DB3 A;  3JCM b;  1QVG S;  2DXB A;  1VQL T;  3QZ5 B;  2XDD A;  3V8K A;  2R5A A;  3BY7 A;  2DXC A;  1BIA A;  2LC4 A;  3MO8 A;  3Q1J A;  4ME7 A;  1KC8 C;  4FU6 A;  1WJS A;  4KUL A;  1VQ7 A;  4FIB A;  4Q5W A;  4IUT A;  4MDW A;  3UDC A;  3JB9 G;  2XDB A;  3L1A A;  3C95 A;  3OYE A;  1TH7 A;  4OB1 B;  1G3Y A;  2Y90 A;  2EJ9 A;  4FM4 B;  4HKE A;  2HQE A;  3H6Z A;  3RMS A;  3SWN A;  2RI2 A;  5C0M A;  4M7A G;  1FXX A;  4PKC C;  3M57 A;  3G4S A;  4V2S A;  2K3X A;  2DZC A;  4ZN1 A;  3I56 A;  3JCM d;  3JCM e;  2VGN A;  3OW2 S;  3RKW A;  2ZPG B;  4EMK A;  4A54 A;  4C5I A;  5GAN 8;  4RG2 A;  2OTJ A;  1OZ2 A;  2RH2 A;  1VUB A;  5LJ3 e;  1KQS A;  1I8F A;  4OB2 B;  5CQX A;  5GAO m;  4M78 F;  4JLI A;  4M75 C;  1WGS A;  4J7I A;  3NTK A;  1NPP A;  3G71 T;  4MMK A;  4EDU A;  5KE3 A;  2K57 A;  5DM7 R;  5GAN h;  1VQP T;  3PGG A;  1G3W A;  4NL2 A;  4PJO G;  3KBG A;  3OW2 A;  2F69 A;  2LT4 A;  2K5L A;  1EIF A;  2QQA A;  2O4X A;  3CEY A;  2DEQ A;  1NPR A;  1M1F A;  1WNL A;  2X4J A;  4M77 D;  3UPU A;  1K8A C;  1KD1 U;  3L2Q A;  2OTL T;  1JJ2 A;  3GF5 A;  4YTL A;  2B8A A;  2WSC E;  4M78 C;  5L8R E;  1I4K 1;  4C8Q G;  4C92 B;  4EPC A;  3CCQ T;  3BDU A;  2QQB A;  3O8V A;  4ATO A;  3M55 A;  2KDS A;  3SWN C;  1UGQ B;  4BI3 A;  3S3N A;  1WJQ A;  2LX9 A;  1VQN T;  3JCM V;  3QHS A;  4M7D G;  3CBM A;  4FT4 A;  3CC2 A;  2DIG A;  2O4X B;  4PJO A;  3G6E T;  1UGS B;  1UB4 A;  3LWH A;  2ZGW A;  2CS7 A;  3QPH A;  4JRQ A;  1KQS S;  4E7K A;  1RL2 A;  1Q7Y C;  2GF7 A;  4C8Q A;  4JDS A;  3QZ9 B;  1H64 1;  3CC2 T;  4M7A E;  2Y4Y A;  3PMT A;  4BY6 B;  3G6E A;  3V8J A;  4X9D A;  2E41 A;  2CZ1 B;  2EQK A;  3CC7 A;  1Q7Y U;  5I2M A;  4X9C A;  3ZEH A;  4PLL A;  4EMG A;  3CD6 A;  2JOY A;  1M8V A;  3CCE A;  2EIF A;  5GAO r;  4M7D B;  3HRU A;  4N0A C;  4XAX B;  3OSV A;  4XU3 A;  5J26 A;  1BI1 A;  1NE8 A;  5LJ5 g;  1K73 C;  3QYG B;  3CC7 T;  3MEV A;  1P92 A;  4XTV A;  4A4K A;  1VQO T;  4C92 G;  4J6W A;  1VIE A;  4R56 A;  4XK8 E;  2IG0 A;  4OB3 B;  3SWN B;  3SD4 A;  2V8J A;  5LJ3 d;  3RES A;  3URG A;  2P4T A;  3OBY A;  4JUV A;  1VQO A;  1M1G A;  2CZ0 B;  4RKU E;  2ZPF B;  3CCS T;  5DY9 A;  2RD1 A;  4M7A D;  3QG1 A;  2QI2 A;  5D6X A;  4BI4 A;  5GAN d;  2PVG B;  1VQK T;  2P0K A;  1VQ8 A;  2DTI A;  2E64 A;  2RI5 A;  1KQ1 A;  4L59 A;  3X24 B;  5I2S A;  4JRI A;  2RHY A;  2VXF A;  3HHT B;  5FU7 B;  1R8O B;  3C12 A;  3X26 B;  4F7U B;  3JCM X;  3OYI A;  3KUF A;  3I55 A;  4LDX A;  2LT1 A;  2MI6 A;  2XDP A;  3L2W A;  2DVE A;  4A53 A;  2JN0 A;  2GQV A;  3L2Z A;  4M7A C;  3CCM T;  5LJ3 h;  4N4I A;  2DXU A;  4PJO F;  4BD3 A;  4J6Y A;  3LX7 A;  3P8B B;  4LD6 A;  3BFM A;  3M54 A;  4LDW A;  1Y07 A;  1B34 A;  1KQ2 A;  4A4E A;  3CXC S;  1M90 U;  3ASK A;  3CME A;  4OF1 A;  3OYY A;  2MMP A;  1M1K C;  4NOY A;  1G5V A;  2JTM A;  4M78 G;  4DOW A;  4R55 A;  2EQJ A;  4IUQ A;  2M1H A;  2RA2 A;  3NTH A;  3F70 A;  1V29 B;  2C06 A;  5FRN A;  2LTO A;  3M9Q A;  3TCJ A;  1WJR A;  1YHQ T;  3OYD A;  4KT0 E;  3GIB A;  5GMK i;  5HKC A;  2EKO A;  3EFR A;  5GAM d;  4M78 A;  4M75 F;  3CPW A;  3MP8 A;  1VQ4 A;  3CBO A;  1Q81 U;  1YJN A;  4M75 E;  3ZBD A;  3KXT A;  5A0L A;  4C0D C;  5CK9 A;  4M75 A;  4LD9 K;  3M4Y A;  4E7H A;  3L2V A;  3S3M A;  3OYK A;  1GXI E;  2PUO B;  4QQ6 A;  1HK9 A;  1VQL A;  1WQW A;  2IVW A;  3SFM A;  2ZZD A;  2VGM A;  1QVF S;  4QQG A;  5LJ5 f;  3RKY A;  3VJP A;  2YLC A;  3G7Z A;  4BB7 A;  2JUF A;  3CXC A;  3CCU T;  4C8Q E;  3CCQ A;  4IUP A;  1G3T A;  1D3B B;  3A8G B;  5HK0 A;  1Q82 C;  1Q86 U;  2PU9 B;  3VKI A;  1M4Z A;  1VQN A;  2P0P A;  4OVA A;  2DPP B;  4E7J A;  4BI8 B;  3ER0 A;  3OY9 A;  2AHJ B;  2RJD A;  3C94 A;  2DD5 A;  4IUR A;  4EMH A;  3G4S T;  2F5K A;  3GP8 A;  5GAN 5;  4J5Y A;  3SDZ A;  5KH6 A;  1BI2 A;  4RCC A;  2QTX A;  3M53 A;  1W2B S;  2RHU A;  2WSE E;  2WAC A;  2DIQ A;  3M59 A;  2RJF A;  2XHC A;  4HCZ A;  1LOJ A;  1JB0 E;  2CZ7 B;  2ZPI B;  2QQS A;  4DOV A;  1Q86 C;  4BDZ A;  3OSS C;  3RIR A;  3DB4 A;  5LJ5 d;  2HAX A;  2KVQ G;  5GAO p;  3CD6 T;  3OYF A;  1YIT A;  4M77 B;  1UEB A;  3LGL A;  2D9T A;  4QQD A;  5KE2 A;  4XU2 A;  4IKF A;  5A0G A;  3JRZ A;  2R57 A;  3TEE A;  3CCL T;  1YJ9 T;  1YI2 T;  1IRE B;  4MZP A;  1VQP A;  5LJ3 f;  1YIT T;  1ZQ1 A;  3MEW A;  3JCM h;  5HY6 A;  4M75 B;  1ZBX A;  2K4Y A;  4XTZ A;  1YJ9 A;  2FVU A;  2OAU A;  5GMK h;  5GAN f;  3P8D A;  4C92 C;  3JCM c;  3JAM E;  2LVM A;  3ZFJ A;  4ZN3 A;  3QBY A;  2I2L A;  5I21 A;  3OYN A;  4F7U F;  3CCR A;  4FT2 A;  1LJO A;  1Y96 A;  1MGQ A;  1ZHI A;  3OYH A;  1DJ7 B;  4TVR A;  4C8Q C;  2QA4 T;  3MP1 A;  4BE0 A;  3JCM P;  2E65 A;  4KBM B;  2EQU A;  4J6X A;  5LJ3 j;  4PJO D;  5GAN 6;  2M16 A;  3LLR A;  1RI0 A;  2MWP A;  3P8H A;  3WVD B;  4M7D D;  2DO3 A;  1O9S A;  2RK1 A;  3JCM W;  5CR2 A;  1Y96 B;  2YHT A;  1KD1 C;  2GFU A;  1H3Z A;  3JCM J;  1MHN A;  3CCE T;  1YBY A;  2E70 A;  1KHI A;  1OI1 A;  3FB9 A;  3HRT A;  5IN1 A;  4M7A A;  4Y28 E;  3GOX A;  4M7D C;  4C92 F;  3CME T;  1YCY A;  1D3B A;  4JS5 A;  3E19 A;  1N8R C;  3E9F A;  5LJ3 g;  4C92 E;  3QKJ A;  4M77 F;  1WPY A;  3PT9 A;  2ZPH B;  5DLO A;  2GFA A;  4GY5 A;  4A4F A;  5GAN g;  2G3R A;  3HL8 A;  5CQY A;  4E7I A;  1QW1 A;  1X01 A;  1QVF A;  4N0A A;  2V8I A;  2EYQ A;  4ZGD B;  3JB9 H;  1BYM A;  3BW1 A;  4XU0 A;  5FRM A;  2KQW A;  2D0Q B;  1VQ8 T;  3RKX A;  4OMF B;  3WVE B;  4LDU A;  3MEU A;  4XTU A;  3X28 B;  1U1S A;  2DKG A;  1IZ6 A;  4C8Q D;  2QQR A;  3A8O B;  3I55 T;  1K73 U;  1VQ7 T;  3WXM B;  4J7F A;  3GNF B;  3MEA A;  2FB7 A;  2E1H A;  2BKD N;  4OGC A;  3FRN A;  3DLL A;  1NZ9 A;  1G3S A;  3OYM A;  5GAM j;  1K9M C;  3GPL A;  4IUV A;  3J81 E;  2XG8 D;  2PQW A;  4M7D A;  3J7A F;  1JRI A;  2E10 A;  1YIJ T;  4QVZ A;  3NFC A;  4ELY C;  1AHJ B;  5D6W A;  1M9S A;  1B34 B;  1N6A A;  3VYH B;  4BUG A;  4DQ2 A;  4EMK B;  3V7S A;  5J3B A;  5CCA A;  2WSF E;  2D6F A;  3CCV A;  2KK4 A;  2L8D A;  2DXT A;  3QUI A;  4MZM A;  3L2R A;  1UGR B;  3JB9 I;  1QVP A;  2KY9 A;  1N9R A;  5CIU A;  2EAY A;  3JB9 J;  1KC8 U;  4UC4 A;  3G71 A;  1N27 A;  3HFN A;  3I56 T;  3A8M B;  2CYZ B;  4HT8 A;  3OS5 A;  3OS1 A;  3JB9 D;  3INZ A;  4C92 A;  2XI9 A;  4M78 D;  3SB2 A;  5GAN 4;  2K3Y A;  5GAN 3;  1M90 C;  3MCA B;  1YJW A;  1YI2 A;  3HFO A;  4C0D B;  5GAN j;  3FDR A;  4JRP A;  3VYG A;  4JLG A;  3M5A A;  4JS4 A;  2FYK A;  2RO0 A;  4OB0 B;  4C0G A;  3OYA A;  2DK3 A;  1YJW T;  3RER A;  2JZ2 A;  2M9U A;  3CCU A;  2R58 A;  3CMA A;  1VQM T;  4P5N A;  2XIC A;  3CBP A;  3CCR T;  1W4S A;  4WF2 A;  2LRQ A;  1SSF A;  2YRV A;  3JCM Q;  2RJC A;  4XQ3 A;  2LQ8 A;  1KG1 A;  2QA4 A;  2RM4 A;  4PL6 A;  4RCB A;  3TRE A;  4J83 A;  2PUK B;  3VU3 C;  2RHZ A;  4E47 A;  1XOV A;  2VYT A;  1VQ9 A;  4BAC A;  1K9M U;  2RHI A;  2K5I A;  4ZTJ A;  3AHU A;  4QVC A;  2CKK A;  4BE2 A;  3ME9 A;  5GAM h;  4XTX A;  5CVI A;  5AYF A;  4B9X A;  1VQ6 A;  3R6O A;  4IUU A;  4M75 D;  5GMK m;  3CCJ A;  1XTD A;  3GNG A;  4OGE A;  3PIP A;  2XD0 A;  5J39 A;  4L6V 5;  2FL7 A;  5FU7 C;  2DTH A;  4CRI A;  3GLX A;  3X20 B;  3HSB A;  2QEX A;  2JTF A;  2E6N A;  2LDM A;  2L3R A;  3EAE A;  3C4S A;  3H8Z A;  4XTY A;  5CO7 A;  4A4H A;  5CAI A;  2VUB A;  1X75 C;  4KUI A;  1VQK A;  5GAN 2;  2QEX T;  4PJO E;  2BUD A;  2RJE A;  2DD4 A;  2K5F A;  3RUX A;  3UWN A;  3MP6 A;  4Y91 A;  3V7R A;  4RMO A;  3OYB A;  5CKB A;  4A4G A;  4C0Z A;  2DAQ A;  3N5B B;  3PNW C;  4MZT A;  2XK0 A;  3UT1 A;  3QO3 A;  4L5G A;  5IT9 E;  5KCH A;  2KAF A;  2LQK A;  4XU1 A;  1QP2 A;  4ZGE B;  2JNG A;  2HNI A;  1BIB A;  3M4G A;  4NL3 A;  4ZTF A;  1BI3 A;  3FEO A;  4LDV A;  1N8R U;  3OA6 A;  3LW5 E;  5GAO l;  3HPW A;  2DZ9 A;  3VV0 A;  5FRO A;  2EJG A;  2FHD A;  5D6Y A;  5GAN e;  1Y71 A;  3A5Z B;  1NJI C;  3QJ6 A;  2KMT A;  2A3L A;  2NLU A;  4MDX A;  5HK3 A;  3QDR B;  2BIV A;  3JSC A;  3BDL A;  4II1 A;  1I81 A;  3LGF A;  4JRK A;  2RHX A;  3FJP A;  3LWI A;  4O5V A;  2E12 A;  2V8K A;  2ZCF B;  4FSX A;  4C0F A;  4C8Q F;  1OYX A;  4F7U G;  1M5Q 1;  1VQ5 T;  2RB6 A;  2X4W A;  4FL6 A;  2OTJ T;  4BE1 A;  1NJI U;  1KHC A;  1YJN T;  1QVG A;  2PVO B;  3V8L A;  2LCL A;  5CKD A;  1BKB A;  2R5M A;  1UGP B;  2H3J A;  5GAN 7;  4ZGJ B;  4C5G A;  3OYJ A;  3TU4 K;  4X34 A;  5GMK e;  3V7C A;  3DLM A;  5M9O A;  3S3O A;  1K8A U;  2P0Q A;  1VQ4 T;  3OYC A;  4XTW A;  4J8O A;  1O75 A;  3CPF A;  2VV5 A;  2PVD B;  4D6W A;  2OTL A;  4M78 B;  3FC3 A;  1BI0 A;  4HA8 A;  4CI0 C;  5KCO A;  5FU6 B;  2X4X A;  1VIF A;  3HKS A;  1VQM A;  3CMA T;  1XNI A;  3OQ5 A;  5A2Q E;  1YIJ A;  2X35 A;  3M58 A;  2K2V A;  3QJY A;  4M77 C;  2ZPB B;  2O01 E;  4M7A F;  3HRS A;  5LJ5 e;  4GLK A;  4PLI A;  4EMK C;  3PIO A;  5C6S A;  2RK2 A;  1OZ3 A;  4JJN K;  3CCV T;  2CZ6 B;  5GMK j;  3CC4 T;  1U8R A;  1JBM A;  2HBP A;  1PSF A;  4M77 A;  4BY6 C;  3OBW A;  3PMI A;  3MHX A;  4M78 E;  3JCM f;  5CKF A;  1HXD A;  2YLB A;  2L5Q A;  3CPW S;  4N4H A;  3CC4 A;  4HT9 A;  1LNX A;  1Q81 C;  2XU8 A;  2ZPE B;  3OYL A;  1VQ6 T;  5IAY A;  4B9W A;  3DKM A;  3OB9 A;  2XID A;  5GAM e;  4O6J A;  2LCC A;  4C92 D;  4PJO B;  2CGH A;  5GAM g;  2QQ9 A;  5FU6 C;  3L2U A;  3CCS A;  2E6Z A;  4LDY A;  4PNO A;  4M75 G;  2EFI A;  3CCL A;  2MAM A;  4QW2 A;  4C5H A;  1M1K U;  3A8H B;  4M7D F;  2VC8 A;  5LJ5 j;  5CKE A;  5FLX E;  1I5L A;  4KUD K;  4M77 E;  1JJ2 S;  4M7D E;  3QYH B;  3J80 E;  2LNV A;  3OYG A;  3EFS A;  1PSE A;  2VXE A;  4F7U A;  5EG2 A;  2A7Y A;  5CKH A;  1VQ9 T;  1XQH A;  4HCC A;  2L89 A;  4C5E A;  5LJ5 h;  3OS2 A;  4M7A B;  5GAO n;  4NS5 A;  2GCX A;  3FLG A;  3CCM A;  2JVV A;  2QXF A;  3FIF A;  3OMG A;  2EWN A;  2EJF A;  3PTA A;  4PJO C;  3CCJ T;  2QDY B;  3L42 A;  3T9N A;  3NTI A;  3LYI A;  3MET A;  4DA4 A;  3S6W A;  2X4Y A;  3A8L B;  3M56 A;  4RG8 A;  4C8Q B;  5A0D A;  4QVD A;  3QSU A;  5GAM f;  3VUB A;  3E1S A;  3QII A;  2RI3 A;  3LH0 A;  5GAO q;  1FX7 A;  2DJZ A;  2DTO A;  2F5T X;  4F7U E;  1Q82 U;  1VQ5 A;  2M0O A;  2Y4X A;  3HP9 A;  1S72 T;  2E5Q A;  2KSS A;  3OMC A;  3QXE B;  1X6O A;  1YHQ A;  2MWO A;  2XKO C;  3PFS A;  3VUZ A;  3X25 B;  4VUB A;  4N4G A;  1W2B A;  2HQX A;  1Y7X A;  5LL6 S;  5GMK l;  4BDY A;  3E9G A;  1S72 A;  3JB9 F;  4Z02 A;  1U1T A;  3JCM g;  4E7L A;  1QP3 A;  1WQ7 A;  4HCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...