4DOWA

Structure of mouse orc1 bah domain bound to h4k20me2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
157
structure length
157
Chain Sequence
b'TFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Origin recognition complex subunit 1
molecule tags Replication
source organism Mus musculus
publication title The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
pubmed doi rcsb
total genus 31
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dowA00
4DOWA 4FT2A 4BB7A 1M4ZA 4JJNK 1ZBXA 4FSXA 4KUDK 3TU4K 4DA4A 3PT9A 4DOVA 4FT4A 4KUIA 3PTAA 1W4SA 2FL7A 4KULA 4LD9K 2FVUA 1ZHIA
chains in the Genus database with same CATH superfamily
1Q95G 5LJ3d 4EMHA 2EQJA 1B07A 1XTDA 1IXDA 1WIEA 2D8JA 3CCET 3V7CA 3CC2Q 5GANf 4M7DC 1Y96B 3M56A 2HQHA 1YWPA 3QJYA 4IUUA 3BFMA 2CT4A 1RLQC 2FL7A 2QEXQ 2ZZDA 1OU9A 2KE9A 5CKDA 2K6DA 3I9QA 2J7IA 2ZAEA 4F14A 1HD3A 2VC8A 2XMFA 2A3LA 2BUDA 1AZEA 4C92E 2VXEA 2CUBA 4MDXA 1WXTA 4WF2A 3FLGA 3UA7A 3OB9A 1KFZA 1TXQA 4XTUA 2ZPIB 1HSQA 3NFCA 4BI4A 1T0JA 1M1KU 5IN1A 4Y91A 1VQ7A 2E6NA 2RMOA 1XNIA 1LCKA 1OULA 4C8QG 4LDYA 2EQKA 2QQBA 3M0RA 2LCCA 4J7IA 3JRZA 2LNVA 1KG1A 1KQSA 2H3EB 3RIRA 3WXMB 1S72Q 5KYUA 3NMZC 1Y71A 5CO7A 1Q86U 4JJBA 3ASKA 2MI6A 2V1RA 1NBEB 3CC2T 1JJ2S 5GAOp 1P92A 4QVCA 4M78C 2W0ZA 1KD1C 1ABQA 2RA2A 2WSCE 2DXCA 3L2UA 1ACMB 2YWWA 2XDBA 3PT9A 4M77E 5GAOq 3CCVT 3CCSQ 2CZ6B 3S3OA 4HCZA 2X9HA 1PD0A 4M75D 2JNGA 4FL6A 4IKFA 2IG0A 4AG2C 2DILA 4ME7A 3OYGA 2O2OA 2K2VA 2HMAA 3RR6A 1BU1A 2YDLA 1MGQA 4L6V5 1VYUA 2YRCA 5D7UA 4C5EA 2DL3A 3GPLA 2M1HA 3CBMA 4A53A 2IPOB 1VQNA 2PU9B 3GNGA 1TWBA 2QYZA 3L2WA 3THKA 4MDWA 3EGXB 3A98A 5GAMf 1SRLA 3G71T 1K8AR 5FU7C 1JXOA 2CUDA 3GLXA 3NGPA 2KNBB 2QQ9A 2HD0A 3C0CA 3JAME 1VQNQ 2HSPA 3S6WA 3EH1A 3V7RA 3VKIA 4E7SA 1UEBA 1WJQA 3EFOA 4HXJA 3OYMA 2MWOA 2MK5A 2L3RA 4C0ZA 4ZN1A 2X4WA 2FPEA 1M90C 5CKEA 4OP0A 2RHXA 2YXYA 4D8DA 2RHIA 3M0PA 4JLGA 3HFOA 1M3CA 1OI1A 2PUKB 1NG2A 1VQ9Q 4DOVA 1IHWA 4XQ3A 2DLPA 2JMAA 3HTRA 4C8QD 1YIJT 2G6FX 3PMTA 3A8MB 1H3ZA 4C8QB 1VQNT 3VS1A 4M77D 3OYCA 1GL5A 1WHGA 5CVIA 2MOXA 3JCMV 3ULRB 5GMKl 4RCCA 1Y0MA 2YLCA 2KAFA 3CCJT 1SSFA 3QWXX 5FRNA 2GTOA 2M02A 4C8QC 1WHHA 3M54A 3V8KA 5KYXA 4J9GA 1FYNA 4M7AG 3JCMW 3CXCS 2COZA 4A4GA 2EYQA 1VIFA 1J3TA 4OMFB 2DTOA 5GANd 4M7DE 1R77A 2DMOA 5GAMd 1GCQA 3OS1A 5IHNA 1R0BG 1RI0A 3PMIA 3JB9I 1NEBA 3NTKA 1IO6A 2V26A 4J83A 1G8XA 2NUPA 3MEUA 3LW5E 2O88A 3QJ6A 4M78F 4C92C 3OYBA 3REAB 3I55Q 3TREA 3CD6A 2JS2A 2ATCB 5GANj 3MP1A 4PJLA 1AVZC 3P8BB 1MMGA 4FYYB 1UGPB 3ER0A 2DL4A 1KQSP 4C92B 2HEQA 4DBFA 5DLQE 1TS9A 3LLRA 3H6ZA 1GFDA 1YITQ 4LDWA 3RKWA 4F7UG 3CCJQ 5J3BA 1M3AA 3M5AA 3Q1JA 4AG1C 4LDXA 2CDTA 1D3BA 2Y4YA 3LGFA 2JT4A 3CBPA 2KMTA 2A28A 4CC2A 3X26B 1QCNA 4J9BA 4QW2A 5EG2A 3CCLQ 5IT9E 2JS0A 1KSWA 4A4FA 1M30A 4M75G 2O9SA 4E7IA 5FLXE 2ESWA 3X25B 1UGRB 4FW2A 5GAN3 2AK5A 2R58A 3M9QA 2AZSA 4DBRA 1M2VA 2R5MA 1YWOA 2GFUA 4X9CA 1F1BB 1TTHB 1PCXA 2P84A 4EPCA 1X69A 1WZOA 1KQSS 2GBQA 3QZ5B 1KHCA 1DJ7B 3URGA 1MNDA 4C0FA 4Z89A 1WGSA 2NLUA 4OB0B 3CMAQ 4XTVA 3CCST 1JEGA 1OYXA 1KC8R 1CKBA 2QGGA 3HP9A 4L59A 4JS5A 3I55A 2BIVA 2CGHA 5LJ5f 1D3BB 4X34A 4PNOA 1WJSA 4F16A 2ZPHB 1D0XA 1VQ5T 1KJWA 1RADB 2RI3A 1N9SA 2PVDB 4OGCA 4QQGA 4JLIA 3S3NA 1I81A 3O5ZA 2ED0A 1QWFA 2SRCA 5LJ5h 5KH6A 1BI1A 3FDRA 1PC0A 4PFZA 2WSFE 2RB6A 2EQIA 3CCVQ 4XTZA 3ZL7C 4J9IA 5LJ5e 1WLPB 3KBGA 1ZSZC 3LX7A 3WVDB 2RK2A 3CCRT 2DVEA 4C0DC 3G71Q 3OYJA 2RQUA 4F7UE 3G1JA 3RMSA 3CC7Q 3EG9B 3RNJA 2FEIA 2KRSA 4PJOG 4XU0A 5LJ3h 1UJ0A 2DIGA 3CCVA 4XTXA 1WX6A 3CBOA 3JCMd 1BIAA 1K76A 4C92G 5I2MA 2O4XB 1HXDA 3EGUA 4RTWA 2LT4A 4IUVA 1Q81R 1WFWA 2LCLA 5GJVB 4NL3A 1PD1A 1R0CB 1Y57A 2RHYA 1CSKA 1IGUA 1JJ2P 3L2RA 5CQXA 2XKOC 3CMAA 4PL6A 3QO3A 2X51A 1X6BA 2PVGB 1RACB 1VQ4T 2M0YA 3CCQT 1O75A 3E19A 4M75B 4NL2A 2RJEA 1UGVA 4JDSA 2F2VA 4XTWA 3M0UA 3QHSA 1JXMA 2XIDA 2VVKA 4OB3B 3MEVA 2K5IA 2CYZB 3CCMQ 1QVGP 4Z88A 3PIPA 2P0KA 3KUFA 5GJWB 1FMVA 1RUWA 3EG9A 3R6NA 1RI9A 4LUDA 4LNPA 1YI2A 1K73C 3KXTA 2K3XA 2ED1A 2MPXC 3VS0A 4BACA 2DEQA 2QDYB 1RAHB 1T3LA 2FYKA 3FC3A 2DK3A 4FYXB 3HPWA 4HVWA 3CXCA 3JB9G 2MF2A 1NYFA 3A8LB 1JRIA 1ZSZA 2OTLT 3IQLA 1ZUYA 2E5KA 3EGDB 2F5TX 1VIEA 2QEXT 2K3BA 2COWA 3MO8A 4RUGA 1KD1R 3RERA 3P8HA 2GGRA 4IIMA 2KYBA 2E41A 1K9MU 1QP3A 3EHRA 3AT1B 1YCYA 2OJ2A 2X35A 5EC7A 5KCHA 4KUIA 4N4HA 2DRMA 2O9VA 1ZLMA 2KXDA 3N5BB 4FSSA 5A0DA 1GFCA 2FVUA 4K11A 2K5FA 5I2SA 3VS5A 2X4JA 1NLPC 2HL5C 1WDXA 4AMCA 4J9CA 3P8DA 3X28B 3U23A 1VQ6A 1G2BA 2KROA 1AOJA 1KHIA 2L5QA 4EMKA 4O6JA 5LL6S 4ZGDB 4D6WA 3CEYA 3VS2A 3JB9H 3CCJA 2J6FA 3TCJA 3RKYA 5A2QE 1PG5B 5GMKh 2LJ3A 1BCMA 3CCMA 3FJPA 4BDYA 1XQHA 2EYXA 2B8AA 4N4IA 1WQ7A 5GAOl 4BD3A 4OMPA 2G3RA 1Q81U 1MMNA 5FW9A 4RTUA 1YJNT 3ZBDA 4MZPA 3VS3A 1WI7A 3JB9D 4NOYA 1ARKA 5CK9A 3ME9A 1MHNA 2K5LA 2RQVA 1M90R 1VQ7Q 2QA4A 4QKUA 1WHKA 2CP2A 1VQPT 4GY5A 3JCMh 1W1FA 1G5VA 4HVUA 3E1SA 4HT8A 5IAYA 3OW2A 1B7TA 4M78A 1PM3A 2A08A 3JSCA 1M1KC 2QQSA 2DXBA 2VV5A 2GQVA 1UECA 2ZPFB 1NLOC 2LCSA 3HL8A 3LWHA 3RMQA 2KGTA 2CT3A 3QKJA 3EG0A 3D7SB 1JB0E 3SD4A 4OGEA 2A37A 1VA7A 1QKXA 2F5KA 4OVAA 2CH4W 2LT1A 1KQ2A 3JCMf 3H41A 1WQWA 4HVVA 3SWNA 1LPLA 2EYWA 4J6WA 3OYLA 1U1TA 2MMPA 4FW1A 3RBBB 3I56A 3A8HB 5IHKA 1WNLA 2GF7A 3CMET 4ATOA 2CP0A 4JJNK 1BIBA 3TSWA 1WHJA 2VKNA 2KRNA 1WJRA 4MZTA 4JZ3A 3CC7A 3M4GA 1HK9A 1OZ3A 1RABB 3G4ST 2JOYA 1Q81C 5GMKi 4C8QA 5LJ5g 2EFIA 1N27A 3BY7A 4ORZA 1PRLC 3CQTA 2LJ1A 3PVQA 2M16A 2A0FB 4N0AA 5KYNA 3JCMJ 1OV3A 4BB7A 3J7AF 1RAGB 1B3QA 2CZ1B 4LD6A 4UC4A 1D1AA 1I8FA 4A4EA 3M0QA 3CCRA 2F69A 3LGLA 5CKBA 1EFNA 4XTYA 1UGQB 2DL8A 1Q7YR 4X9DA 3TQ7P 1VQ4Q 2YRDA 1S1NA 1YITT 4M78D 3J81E 1S72A 1LOJA 2W10A 1X27A 3JCMP 2XD0A 1WA7A 5GAN6 4QQ6A 2HSEB 2GTJA 1M9SA 4E7HA 3META 3SFMA 1SG5A 3GNFB 1Q86C 1AHJB 1YCSB 1ZSGA 1VQLA 4MZMA 3E9GA 2J05A 3GP8A 4EMGA 4PJOC 4FT2A 1N9RA 1TUCA 2ZPEB 4O5VA 4C92F 1K73R 1ZA1B 3KFVA 1IREB 1TG0A 3G4SQ 2OAUA 2EW3A 4KT0E 5M9OA 1VQMQ 2OTJA 1SKUB 1AWOA 1C0MA 4DBQA 1YI2Q 2RI5A 1U8RA 1N8RU 2DFUA 1BBZA 1M1FA 4FYWB 1T3SA 1Y96A 5FU6B 4M7DB 2E5QA 4GBQA 4RTYA 4PFPA 1BI0A 1ZBXA 3DLMA 4C8QE 3EFRA 1KC8C 1XOVA 1CKAA 3VRYA 2GNCA 3TEEA 1TH7A 4J7FA 2RHUA 2KT8A 5FRMA 4ELZC 1ZUKA 2C0TA 2LVMA 5CKFA 2RQRA 1G3YA 4IIOA 3I5SA 2BZ8A 1NJIU 1X43A 1X01A 4NS5A 2KSSA 1OX8A 1JJ2A 2V8JA 2E65A 1AD5A 2JTMA 4RCBA 3TSZA 2LX9A 4LN2A 1QKWA 3OW2P 2D0NA 3VS4A 3X20B 1Q82R 2DD4A 2LTOA 3OYFA 3EAEA 3WVEB 3MEAA 1YP5A 1OQKA 1YI2T 3HFNA 2YSQA 1D0YA 4RG8A 2NUZA 2QQRA 5DLOA 1A0NB 2LX7A 4JPBW 4BI3A 5L8RE 4BE0A 1N8RR 2RD1A 3G6EA 4J9DA 1QVPA 3A1PA 1QVGA 3PTAA 1VQLQ 1NZ9A 2RH2A 3MP6A 2X3WD 5GANg 1ZHIA 1U06A 1KIKA 3UATA 3E2UA 2VGMA 3L42A 5KYWB 2ZPGB 1Q82U 1TU0B 3HHTB 2CSIA 3FJ5A 3OBWA 5GAMg 4PFOA 4C8QF 4JRKA 3PIOA 4L5GA 2PQWA 1G3SA 2RO0A 1M1KR 1LVKA 2HKQB 4X1VA 1VQ5A 3SWNC 1PHTA 1UUEA 1VQMT 5LJ3f 1FWZA 1M5Q1 5LJ5j 2JM8A 2Z0WA 4AFZC 4B9WA 1YNZA 1X6GA 1PSFA 3SWNB 1KK7A 4J6YA 2KBTA 3CPWS 2MWPA 8ATCB 5D6XA 1ZX6A 2KY9A 1R8OB 3I5RA 2F1LA 2WACA 1VQOQ 1SF9A 1C6VX 1M4ZA 1UJYA 2M9UA 3JCMe 4E7KA 1VYVA 2DJQA 1YJ9Q 1O9SA 2LDMA 4JJDA 2QTXA 5GANe 3A8GB 2HNIA 2EVRA 3JCMb 2PVOB 4OF1A 2OTLQ 1PSEA 4AFSC 4C92A 4VUBA 3AHUA 4E7JA 2V8KA 1YJNA 4M77A 4IUPA 3RKXA 5KE2A 3DKMA 1MUZA 5LJ5d 3C95A 4CRIA 5GANh 2JZ2A 3LH5A 2DKGA 1JU5C 2BTTA 1BI3A 1RAFB 4QVZA 5D6WA 2L89A 3JB9J 4Y28E 4HCCA 2OAWA 1VQKA 1D1CA 2ZPBB 1EX4A 4E6RA 4PJOE 1K73U 1GCPA 4R55A 1PKTA 1QCFA 4M77G 4OMQA 3VUZA 4PJOD 3EH2A 4FIBA 4JRQA 2BZYA 2PZ1A 1W6XA 2FRYA 2LRQA 2RNAA 4M78E 3VU3C 1FXXA 4C0GA 2L8DA 4F7UB 3QYGB 1WYXA 1G3TA 1HJDA 1IRXA 4JUVA 1I5LA 2VYTA 4R56A 1OPKA 4OB1B 1VQ5Q 2RQTA 3NTHA 2Y4XA 3LWIA 3NHNA 4M75C 3CCUA 2MIOA 1ZUUA 3ZEHA 2DETA 2KRMA 3EFSA 1Q7YU 2CH4A 3UT1A 2C0OA 1M27C 4Q5WA 2QTVA 1FMWA 5GAN7 3CC2A 2X4XA 1VQKT 2K57A 2YUPA 2O4XA 2ROLA 1X2QA 3G4SA 5CKHA 2COYA 2FZKB 2RJDA 2XG8D 3M57A 3PNWC 2E3HA 1VYTA 2LJ0A 2D8HA 4HCBA 2CREA 4M7AD 5AT1B 2VUBA 4FU6A 2EAYA 3EFOB 4M75E 1D1BA 3UDCA 2DL5A 5KYYB 1YJNQ 2KYMA 2YT6A 4V2SA 2DM1A 3MP8A 3UWNA 2RJFA 3CCRQ 3C12A 1LNXA 1NYGA 1SSHA 2DPPB 2YHTA 2GCXA 1PRMC 5D6YA 2DA9A 5C0MA 4LDUA 1YBYA 1B34B 4WCIA 2EGAA 2EGEA 2XI9A 4KGXB 2EQUA 5GAMh 3GBQA 1TUDA 4LE9A 2ECZA 3VUBA 1I0CA 1W2BS 2F2XA 5GAOm 2A7YA 2PTKA 1K9MC 2GFAA 2EKOA 1RLPC 2LC4A 2NUTB 2DX1A 1QMCA 1N8RC 5CCAA 5KCOA 1OEBA 2OTJT 4M77B 2DF6A 1YHQT 1MNEA 3H0IA 2X4YA 1QCOA 1IZ6A 5AYFA 2XDPA 3OS0A 3BDLA 2EIFA 3QG1A 3O8VA 4M77C 4ZGJB 3CCLA 4XAXB 4J9FA 4J5YA 3M55A 2RHZA 4N4GA 1GXIE 1B34A 3M0SA 2NWMA 3CPWA 2LQNA 1Q7YC 2WSEE 2K9GA 4M77F 2LP5A 2DBMA 2LMJA 2KXCA 4KRTA 1W2BA 1X2KA 3H8ZA 1ZSZB 2HBWA 3H0FA 5KYUB 4QVDA 2E1HA 1UFFA 1VUBA 3G6ET 3E9FA 3OA6A 2KEAA 3QPHA 2HKNA 4M78B 4ANJA 1Q86R 5I22A 2DERA 2JMCA 5IHIA 2CP5A 1BI2A 3PE0A 1OOTA 2RF0A 2HAXA 2C06A 3HRSA 5GAOn 1QP2A 3OMGA 1YJ9T 2KR3A 1U1SA 3QSUA 2O01E 1IGQA 2RN8A 3OYKA 1N5ZA 1M3BA 3VJPA 3J80E 4M75A 3JCMX 3EGDA 3CD6T 3OYAA 4WTOB 2L2PA 3TVTA 2QDLA 4OMNA 1EIFA 3T9NA 1YJWQ 1H3HA 5LJ3g 1MV3A 2DNUA 1OX9A 3MKDA 3G71A 1GBQA 4R0KA 2CZ7B 3OW2S 4CC7A 2AIRB 1KD1U 3CXCP 1YHQA 4XU3A 5FU7B 4P5NA 4RMOA 3GIBA 3S3MA 4RTTA 2MYSA 1E6GA 5GAN2 4M7DA 5GAOr 2JN0A 3LH0A 2DEUA 2DVJA 4PJNA 1GRIA 2DAQA 3FRNA 5A0LA 1HYOA 2OTJQ 1VQMA 1KQ1A 1OU8A 1BK2A 4PLLA 3OQ5A 2FZCB 3EHQA 2DYBA 1AWWA 4BI8B 1Z9ZA 2J6KA 4PJOB 2AKKA 3BW1A 4JRPA 1Q82C 2H3JA 4KGZB 1TSFA 3EG2A 4OMLA 5HCKA 4C5HA 1SPKA 4F7UF 1YIJA 4JJCA 4FCYA 3SHWA 1AT1B 2EYYA 1VQ8A 3C4SA 2E10A 3MPUB 5C6SA 3OSSC 4IUQA 1UHCA 5LJ3e 4M4ZA 1QLYA 5HKCA 5LJ3j 3HRUA 1BCOA 4AT1B 1V29B 1K8AU 2ZCFB 2EQMA 1VQPQ 2JW4A 3OS5A 1YJ9A 1PNJA 1E7OA 2KVQG 2QK0A 2QG9B 3NPFA 2DTIA 2K2MA 2P0QA 3OYHA 4M78G 2CP3A 1GCQC 1TOVA 4J9EA 5J39A 1QVFP 2K3YA 2XK0A 1JBMA 1K1ZA 4PJJA 3OS2A 4LD9K 3VV0A 2R57A 3BDUA 2ABLA 1VQ6T 2MCNA 1QW1A 2I2LA 3M0TA 1D0ZA 2DXTA 3EG1A 5GAN4 2EYZA 2BKDN 2RI2A 2EGCA 3CMEQ 2CSQA 1U5SA 4C5GA 3BE3A 4GLKA 2JJ9A 2Y90A 2J06A 1BB9A 3CCQQ 3QDFA 1X75C 3PFSA 4A4HA 2JTEA 5KYXB 1UDLA 1ZQ1A 4Y92A 1NJIC 2FHDA 4JS4A 1W2BP 3OBYA 1I1JA 4J9HA 1GBRA 2JXBA 1YFNA 3GF5A 4BDZA 3UPUA 1VQ4A 4CC3A 1VQ9T 4Z8AA 2O31A 1UGSB 4M7AB 4FSXA 4LUEA 1QVGS 2E64A 1G83A 3CCUT 2L3PA 2C0IA 2KI7A 5J26A 3GOXA 4M7AA 1VQ8Q 3C94A 4BY6B 2VXFA 4J6XA 4M7AC 2XU8A 2FB7A 1WXBA 2FRWA 4ZNXA 2YUNA 2ENMA 2A36A 4N0AC 4BY6C 3H0HA 2DZ9A 4XU1A 1VQPA 2LQKA 3SEMA 5IXFA 2DRKA 5FROA 1FMKA 2KT1A 2M0OA 1H8KA 2QXFA 4E7ZA 3MEWA 2DXUA 3QZ9B 2HZYA 2DBKA 5A0GA 2F2WA 3QYHB 2IIMA 3FEOA 2OI3A 2NYSA 2GQIA 4DBHA 5DM7R 1PKSA 2HBPA 2LZ6B 2D0QB 4M7DF 2DZCA 3JCMc 1AZGB 2EKHA 1D09B 6AT1B 2X3XD 4LXCA 3PGGA 1H641 2XICA 2QA4Q 1K4US 2V1QA 4EDUA 4BE2A 3QWYA 3M58A 2K4YA 2YUOA 2LQ8A 1RAIB 3LYIA 1T0HA 2CS7A 4DEXA 3CC4T 3M59A 1M2VB 2HL3A 3R6OA 2DYIA 3CD6Q 2QASA 2JVVA 2QQAA 4M7DD 4PJOA 4AFQC 2EJFA 2AKLA 3RUXA 1K0XA 2AZVA 3I56Q 2EJGA 4JZ4A 7AT1B 3FB9A 1WHMA 1YITA 1N6AA 3CCLT 4E2FB 2DJZA 2YLBA 4A63B 1UTIA 1SEMA 2YUQA 4BE1A 3DB3A 3CCUQ 1QVFS 1VQOA 3CCEA 3RDVA 4RTXA 3UF4A 3A5ZB 4JRIA 1TUGB 4MMLA 4EMKB 2DTHA 3MJXA 4HA8A 1ZBJA 3F70A 2R5AA 3CMAT 2NUTA 1VQKQ 3EGXA 4EMKC 4PK4A 4EIKA 4XU2A 3CPFA 3DLLA 2LQWA 4KBMB 1X6OA 2BE9B 1Y07A 2J6OA 4PJMA 1Z9QA 5GMKm 2JM9A 1K9MR 5FU6C 4CI0C 5IH2A 1I07A 2PUOB 4Z02A 2FO0A 2RPNA 5KE3A 4A4KA 3QXEB 4MMKA 2VGNA 2HQXA 4IUTA 2BZXA 2JUFA 3JB9F 3L2ZA 3H9NA 1U3OA 3OYEA 2HDAA 1VQOT 4II1A 3VRZA 5FWCA 3CC4A 1FX7A 4FM4B 2RK1A 5DY9A 4C5IA 1OZ2A 2LNHB 3FIFA 5KYYA 4M75F 1IB8A 1QWEA 4E7LA 1Y7XA 4ZGEB 3V8JA 4QT7A 3UA6A 4DOWA 5CAIA 4B6MA 2OTLA 4ZTFA 2ZGWA 4TVRA 4F04B 3ZFJA 1I4K1 2QEXA 5IXBA 3CC4Q 2BE7D 3I35A 2P0PA 3CCEQ 3M53A 3EG3A 2B86A 2DD5A 1AEYA 2KDSA 5GMKe 1AWJA 3I56T 1M8MA 2FZGB 4IURA 1K0SA 1NJIR 2IVWA 3CMEA 4ESRA 1SRMA 3A8OB 3VYGA 3PVLA 2RQWA 1V76A 4PLIA 1RAEB 2QAZA 4DA4A 2E4HA 2DE0X 4RTVA 1NE8A 2JTFA 5KYWA 4FT4A 4BUGA 2FG0A 3JCMQ 4OMOA 4F7UA 4LDVA 4GLMA 1UHFA 4HKEA 1E6HA 2M51A 4KH1B 1VQLT 3REBB 1MV0B 1G3WA 3CCMT 3OYDA 2L0AA 4KUDK 3TU4K 2VWFA 4ZN3A 2H8HA 5FWBA 1PWTA 2D6FA 5GAMj 1AWXA 1S72T 2DIQA 1UE9A 4PJOF 1W4SA 4OB2B 3CCSA 1VQ9A 2FPFA 2K7AA 1NPPA 5HY6A 3I55T 2VASA 3VYHB 4FYVB 1YJWT 3QIIA 3M4YA 2QA4T 1VOMA 1QVFA 3CPWP 3OYIA 4C0DB 5CQYA 4YTLA 2MAMA 5GAN5 1MMAA 4ELYC 3G7ZA 1W70A 5I11A 1K9AA 1M90U 1WXUA 4DEYA 2AT1B 2XDDA 3JCMg 4CC4B 4HCKA 2HCKA 2RJCA 1MMDA 3VS7A 1V1CA 8AT1B 4RTZA 2E12A 2DL7A 2P4TA 4KH0B 1RAAB 3OMCA 1JO8A 2XHCA 2CP7A 2EWNA 5GMKj 5GAN8 4KGVB 4RG2A 3SDZA 2RM4A 2E6ZA 5CR2A 3QDRB 1K8AC 2KQWA 2V8IA 1C1AA 4F17A 4M7AF 2YRVA 1M8VA 5ECAA 1M1GA 1NEGA 2L3SA 4AFUC 3HKSA 4D8KA 3V8LA 4E47A 2D1XA 3RESA 2VB6A 3CC7T 1VQ6Q 2FPDA 1ZA2B 1YIJQ 1SHGA 4B9XA 2I0NA 2NUPB 9ATCB 1OPLA 4A54A 1ABOA 3JV3A 4M7DG 2KK4A 2OX7A 1H92A 1WHLA 2D9TA 1KC8U 1BYMA 3QBYA 1UB4A 3INZA 3QUIA 3SB2A 2EBPA 4M7AE 3VS6A 1LJOA 1UG1A 1IHVA 3CCQA 4QQDA 3HSBA 4C92D 3DB4A 1YHQQ 2E3IA 2QGFB 3L1AA 2EJ9A 2CKKA 5CIUA 3V7SA 4DQ2A 2L3QA 3L2QA 1VQ7T 1SHFA 4RKUE 1YJWA 4ZTJA 1XJWB 5GAMe 5I21A 1M2OA 1NPRA 1I5OB 1VQ8T 3G6EQ 3X24B 2K79A 3OY9A 2HQEA 2QI2A 1RL2A 5HK0A 4PKCC 3HRTA 2CZ0B 3OYNA 1JQQA 2P4RA 4OMMA 1BKBA 2ROTA 1NM7A 3OYYA 2DO3A 4XK8E 3MHXA 4HT9A 1EZZB 2AHJB 2EPDA 1WPYA 2PNIA 3NTIA 2CP6A 3MCAB 1QQJA 1YN8A 4J8OA 3OSVA 3L2VA 5HK3A 2E70A 4KULA 2SEMA 5L23A
chains in the Genus database with same CATH topology
2FB7A 1O75A 2KY9A 3E19A 4M75B 1R8OB 5LJ3d 2WACA 4EMHA 4NL2A 2EQJA 2RJEA 1XTDA 1M4ZA 4N0AC 2M9UA 4JDSA 2DZ9A 4XTWA 4XU1A 4BY6C 3JCMe 4E7KA 1VQPA 2LQKA 3QHSA 3CCET 3V7CA 1O9SA 2LDMA 5GANf 4M7DC 2XIDA 1Y96B 2QTXA 4OB3B 3MEVA 2K5IA 3M56A 5GANe 3A8GB 2HNIA 5FROA 2CYZB 3JCMb 2PVOB 3QJYA 4IUUA 2M0OA 3BFMA 4OF1A 3PIPA 2P0KA 2QXFA 3KUFA 1PSEA 2FL7A 3MEWA 2DXUA 4C92A 4VUBA 3AHUA 2ZZDA 4E7JA 2V8KA 5CKDA 1YI2A 1YJNA 3QZ9B 4M77A 1K73C 4IUPA 3KXTA 3RKXA 2K3XA 5KE2A 3DKMA 5A0GA 5LJ5d 4BACA 2DEQA 2QDYB 3C95A 2VC8A 2FYKA 2JZ2A 3QYHB 2A3LA 2DKGA 3FEOA 4CRIA 5GANh 3FC3A 2BUDA 1BI3A 4C92E 5D6WA 2VXEA 2DK3A 2L89A 4QVZA 4MDXA 3JB9J 4WF2A 4Y28E 3HPWA 3FLGA 3CXCA 3JB9G 4HCCA 1VQKA 3OB9A 2ZPBB 2MF2A 4XTUA 2ZPIB 4PJOE 5DM7R 3NFCA 1K73U 2HBPA 3A8LB 2D0QB 4BI4A 4R55A 4M7DF 1JRIA 2DZCA 1M1KU 5IN1A 3JCMc 2OTLT 4M77G 4Y91A 1VQ7A 2E6NA 2F5TX 3PGGA 3VUZA 1VIEA 1H641 4PJOD 2XICA 2QEXT 1XNIA 4FIBA 3MO8A 4C8QG 4LDYA 4EDUA 4BE2A 2EQKA 4JRQA 3RERA 2QQBA 3P8HA 2LCCA 4J7IA 3JRZA 3M58A 2K4YA 2LRQA 2LNVA 4M78E 1KG1A 3VU3C 1FXXA 4C0GA 2LQ8A 1KQSA 3LYIA 2E41A 3RIRA 3WXMB 1K9MU 2L8DA 4F7UB 1QP3A 1YCYA 2CS7A 2X35A 3QYGB 1G3TA 5KCHA 3CC4T 4KUIA 1Y71A 3M59A 5CO7A 1Q86U 4N4HA 3R6OA 3ASKA 3N5BB 4JUVA 5A0DA 2JVVA 1I5LA 2QQAA 2FVUA 4M7DD 2MI6A 2VYTA 2K5FA 4OB1B 4R56A 3CC2T 4PJOA 3NTHA 2EJFA 2Y4XA 5I2SA 3LWIA 2X4JA 1JJ2S 3RUXA 5GAOp 1P92A 4M75C 4QVCA 4M78C 3CCUA 1KD1C 3P8DA 2EJGA 2RA2A 3ZEHA 3X28B 2WSCE 1VQ6A 2DXCA 1KHIA 3EFSA 2L5QA 3L2UA 4EMKA 1Q7YU 3FB9A 3UT1A 4O6JA 5LL6S 4ZGDB 4D6WA 4Q5WA 2XDBA 3PT9A 4M77E 5GAOq 3CCVT 1YITA 3CEYA 2CZ6B 1N6AA 3S3OA 4HCZA 5GAN7 3JB9H 3CCJA 3CCLT 3CC2A 2X4XA 2DJZA 2YLBA 4M75D 2K57A 2JNGA 1VQKT 2O4XA 4FL6A 3TCJA 4IKFA 3RKYA 5A2QE 3G4SA 5GMKh 5CKHA 2RJDA 4BE1A 3CCMA 2IG0A 3DB3A 1QVFS 4ME7A 3OYGA 1VQOA 2K2VA 3CCEA 2XG8D 3M57A 3FJPA 4BDYA 3A5ZB 4JRIA 3PNWC 1MGQA 1XQHA 4L6V5 2B8AA 4C5EA 4HCBA 4MMLA 4N4IA 4EMKB 1WQ7A 2DTHA 4BD3A 5GAOl 3GPLA 4M7AD 2G3RA 2VUBA 2M1HA 3CBMA 1Q81U 4HA8A 4A53A 1YJNT 4FU6A 2EAYA 4M75E 3F70A 2R5AA 3UDCA 3CMAT 1VQNA 3ZBDA 4MZPA 2PU9B 3GNGA 3JB9D 4NOYA 3L2WA 5CK9A 4V2SA 4MDWA 5GAMf 3MP8A 3UWNA 2RJFA 4EMKC 4XU2A 3C12A 1MHNA 3ME9A 1LNXA 3G71T 2K5LA 5FU7C 3CPFA 3GLXA 3DLLA 4KBMB 1X6OA 1Y07A 2QA4A 2DPPB 2HD0A 2QQ9A 5GMKm 2YHTA 2GCXA 5D6YA 5FU6C 4CI0C 3JAME 4GY5A 2PUOB 3JCMh 1VQPT 1G5VA 4Z02A 3E1SA 5C0MA 5KE3A 4HT8A 4A4KA 3S6WA 5IAYA 3V7RA 4LDUA 3VKIA 3OW2A 1UEBA 1WJQA 3QXEB 4M78A 1YBYA 4MMKA 2VGNA 2HQXA 3JSCA 4IUTA 1M1KC 3OYMA 1B34B 2QQSA 2MWOA 2DXBA 2VV5A 2L3RA 2GQVA 4C0ZA 2JUFA 2ZPFB 4ZN1A 3JB9F 2X4WA 2XI9A 2EQUA 5GAMh 3HL8A 3LWHA 3VUBA 3L2ZA 1M90C 3RMQA 5CKEA 4OP0A 3OYEA 2RHXA 1W2BS 3QKJA 1VQOT 1JB0E 3SD4A 5GAOm 2A7YA 4II1A 4OGEA 2RHIA 1FX7A 1K9MC 3CC4A 4FM4B 2GFAA 2F5KA 4JLGA 4OVAA 2EKOA 2RK1A 2LC4A 2LT1A 1OI1A 3HFOA 5DY9A 2PUKB 1OZ2A 4C5IA 1N8RC 3FIFA 5CCAA 5KCOA 1KQ2A 4M75F 4DOVA 3JCMf 2OTJT 4XQ3A 4E7LA 4M77B 1Y7XA 4ZGEB 1YHQT 3V8JA 4C8QD 1YIJT 1WQWA 3SWNA 4ATOA 4J6WA 3PMTA 3OYLA 3A8MB 2X4YA 1U1TA 2MMPA 1H3ZA 4DOWA 4C8QB 1IZ6A 5CAIA 3I56A 1VQNT 2OTLA 3A8HB 4M77D 4ZTFA 3OYCA 5AYFA 2XDPA 1WNLA 2GF7A 2ZGWA 4TVRA 5CVIA 3OS0A 3ZFJA 3CMET 1I4K1 3JCMV 2QEXA 3BDLA 5GMKl 4JJNK 1BIBA 4RCCA 2EIFA 3QG1A 3O8VA 4M77C 4ZGJB 2YLCA 2KAFA 2P0PA 3M53A 4XAXB 3CCJT 1SSFA 3CCLA 5FRNA 1WJRA 4J5YA 4MZTA 3M55A 2RHZA 4N4GA 1GXIE 3CC7A 1B34A 3M4GA 2DD5A 4C8QC 1HK9A 1OZ3A 3G4ST 2JOYA 3CPWA 3M54A 3V8KA 1Q7YC 1Q81C 2KDSA 5GMKi 5GMKe 3I56T 2WSEE 4C8QA 5LJ5g 2EFIA 4M7AG 4M77F 1N27A 4IURA 3BY7A 3JCMW 2IVWA 3CXCS 4A4GA 2EYQA 3CMEA 1VIFA 2M16A 1W2BA 3H8ZA 4OMFB 2DTOA 4N0AA 5GANd 3JCMJ 4M7DE 4QVDA 4BB7A 3J7AF 2E1HA 3A8OB 2CZ1B 4LD6A 4PLIA 4UC4A 3VYGA 5GAMd 3OS1A 1VUBA 3G6ET 1RI0A 3PMIA 1I8FA 3E9FA 4A4EA 3JB9I 3OA6A 2F69A 3NTKA 3LGLA 5CKBA 3CCRA 4DA4A 3QPHA 4XTYA 1UGQB 4M78B 1NE8A 2JTFA 4FT4A 4BUGA 4J83A 3JCMQ 4X9DA 1BI2A 3MEUA 1YITT 4F7UA 4M78D 4LDVA 3J81E 3LW5E 1S72A 1LOJA 3QJ6A 2C06A 2HAXA 3HRSA 4M78F 4HKEA 4C92C 3OYBA 1VQLT 5GAOn 3JCMP 1QP2A 3TREA 3CD6A 5GANj 2XD0A 3OMGA 1G3WA 3MP1A 3OYDA 3CCMT 1YJ9T 1U1SA 3P8BB 5GAN6 3QSUA 2O01E 4KUDK 3TU4K 1UGPB 3ER0A 4QQ6A 4ZN3A 3OYKA 1M9SA 4E7HA 3META 3SFMA 1Q86C 3GNFB 4C92B 2D6FA 1AHJB 5GAMj 1S72T 2DIQA 4PJOF 3VJPA 1W4SA 3J80E 4OB2B 1VQLA 4MZMA 4M75A 5DLQE 3JCMX 3CD6T 3LLRA 3H6ZA 3CCSA 3E9GA 3OYAA 3GP8A 4EMGA 4LDWA 3RKWA 4FT2A 1N9RA 4F7UG 1VQ9A 2ZPEB 4O5VA 4C92F 4PJOC 5J3BA 1NPPA 1IREB 3M5AA 1EIFA 5HY6A 3Q1JA 3T9NA 3I55T 4LDXA 2OAUA 1D3BA 5LJ3g 2Y4YA 3LGFA 3VYHB 3G71A 4KT0E 3CBPA 5M9OA 2KMTA 1YJWT 2OTJA 2CZ7B 3OW2S 1KD1U 1YHQA 4XU3A 3QIIA 3M4YA 2QA4T 2RI5A 3X26B 1QVFA 1U8RA 5FU7B 3OYIA 4C0DB 4P5NA 5CQYA 1N8RU 4RMOA 3GIBA 4YTLA 5EG2A 4QW2A 5IT9E 3S3MA 2MAMA 1M1FA 5GAN5 5GAN2 1Y96A 5FU6B 4ELYC 3G7ZA 4M7DA 4M7DB 2E5QA 4A4FA 1M90U 5GAOr 2JN0A 3LH0A 4M75G 2XDDA 3JCMg 4E7IA 5FLXE 1BI0A 1ZBXA 2DAQA 3DLMA 3FRNA 3X25B 5A0LA 4C8QE 3EFRA 1VQMA 1XOVA 1KC8C 1KQ1A 4PLLA 1UGRB 2RJCA 3TEEA 3OQ5A 5GAN3 1TH7A 2E12A 2R58A 2P4TA 4J7FA 3OMCA 3M9QA 2R5MA 2GFUA 2RHUA 2XHCA 4X9CA 4BI8B 4EPCA 1KQSS 2EWNA 5GMKj 4PJOB 5GAN8 5FRMA 4ELZC 3BW1A 3QZ5B 1KHCA 2LVMA 1DJ7B 3URGA 4JRPA 4RG2A 5CKFA 1Q82C 2H3JA 3SDZA 2RM4A 4C0FA 2E6ZA 4C5HA 4F7UF 1WGSA 2NLUA 5CR2A 3QDRB 1YIJA 1G3YA 4OB0B 1K8AC 2KQWA 3C4SA 2V8IA 4XTVA 3CCST 1NJIU 1VQ8A 1X01A 1OYXA 2E10A 4NS5A 4M7AF 2YRVA 2KSSA 1M8VA 1JJ2A 4L59A 1M1GA 2V8JA 3HP9A 3OSSC 4IUQA 5C6SA 5LJ3e 3I55A 2E65A 4JS5A 2BIVA 2CGHA 5LJ5f 2JTMA 1D3BB 4RCBA 5HKCA 3HRUA 3HKSA 4PNOA 4X34A 5LJ3j 1V29B 1WJSA 3V8LA 2LX9A 2ZPHB 4E47A 1VQ5T 3RESA 1K8AU 2ZCFB 2RI3A 1N9SA 2PVDB 4OGCA 3CC7T 2EQMA 4QQGA 4JLIA 3X20B 2DD4A 2LTOA 3OS5A 3OYFA 3EAEA 1YJ9A 3S3NA 3WVEB 4B9XA 3MEAA 2KVQG 1I81A 4A54A 5LJ5h 1YI2T 3HFNA 5KH6A 1BI1A 3FDRA 4M7DG 2DTIA 2KK4A 2WSFE 4RG8A 2D9TA 2RB6A 2QQRA 2P0QA 3QBYA 5DLOA 3OYHA 1UB4A 4XTZA 1KC8U 1BYMA 4M78G 4BI3A 3INZA 3QUIA 5L8RE 3SB2A 3KBGA 5LJ5e 4BE0A 2RD1A 4M7AE 3LX7A 3G6EA 1LJOA 5J39A 1QVPA 1QVGA 2K3YA 3WVDB 3CCQA 2RK2A 2XK0A 4QQDA 3PTAA 2DVEA 1NZ9A 2RH2A 4C0DC 3CCRT 1JBMA 3HSBA 4C92D 3OYJA 3DB4A 4F7UE 3MP6A 3OS2A 4LD9K 5GANg 1ZHIA 3RMSA 3VV0A 2R57A 3BDUA 1VQ6T 3L1AA 2EJ9A 2CKKA 5CIUA 3V7SA 4DQ2A 1QW1A 2I2LA 3L2QA 2VGMA 2DXTA 4RKUE 1YJWA 5GAN4 1VQ7T 4PJOG 3L42A 4ZTJA 4XU0A 2BKDN 2RI2A 5LJ3h 2ZPGB 1Q82U 2DIGA 5GAMe 1NPRA 3HHTB 5I21A 3CCVA 4XTXA 3CBOA 4C5GA 3JCMd 1BIAA 3OBWA 1VQ8T 4GLKA 5GAMg 2Y90A 3X24B 4C92G 5I2MA 3OY9A 2HQEA 2O4XB 4C8QF 1HXDA 2QI2A 1RL2A 1X75C 5HK0A 3PFSA 4JRKA 4PKCC 3PIOA 2LT4A 4IUVA 3HRTA 2CZ0B 4A4HA 3OYNA 4L5GA 2PQWA 1G3SA 1BKBA 2LCLA 1ZQ1A 2RO0A 1NJIC 2FHDA 3OYYA 4JS4A 1VQ5A 2DO3A 3OBYA 3SWNC 4XK8E 4NL3A 1VQMT 5LJ3f 3GF5A 1FWZA 4BDZA 1M5Q1 3MHXA 5LJ5j 3UPUA 1VQ4A 4HT9A 1VQ9T 2AHJB 1UGSB 4M7AB 4FSXA 2RHYA 1QVGS 2E64A 1WPYA 3CCUT 5J26A 3NTIA 3L2RA 3MCAB 5CQXA 3GOXA 4M7AA 2XKOC 3CMAA 4PL6A 3QO3A 4B9WA 4J8OA 3OSVA 3L2VA 1PSFA 3SWNB 3C94A 4J6YA 4BY6B 2PVGB 5HK3A 2VXFA 4J6XA 3CPWS 2E70A 2MWPA 5D6XA 4M7AC 4KULA 1VQ4T 3CCQT 2XU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOW A;  4FT2 A;  4BB7 A;  1M4Z A;  4JJN K;  1ZBX A;  4FSX A;  4KUD K;  3TU4 K;  4DA4 A;  3PT9 A;  4DOV A;  4FT4 A;  4KUI A;  3PTA A;  1W4S A;  2FL7 A;  4KUL A;  4LD9 K;  2FVU A;  1ZHI A; 
#chains in the Genus database with same CATH topology
 1Q95 G;  5LJ3 d;  4EMH A;  2EQJ A;  1B07 A;  1XTD A;  1IXD A;  1WIE A;  2D8J A;  3CCE T;  3V7C A;  3CC2 Q;  5GAN f;  4M7D C;  1Y96 B;  3M56 A;  2HQH A;  1YWP A;  3QJY A;  4IUU A;  3BFM A;  2CT4 A;  1RLQ C;  2FL7 A;  2QEX Q;  2ZZD A;  1OU9 A;  2KE9 A;  5CKD A;  2K6D A;  3I9Q A;  2J7I A;  2ZAE A;  4F14 A;  1HD3 A;  2VC8 A;  2XMF A;  2A3L A;  2BUD A;  1AZE A;  4C92 E;  2VXE A;  2CUB A;  4MDX A;  1WXT A;  4WF2 A;  3FLG A;  3UA7 A;  3OB9 A;  1KFZ A;  1TXQ A;  4XTU A;  2ZPI B;  1HSQ A;  3NFC A;  4BI4 A;  1T0J A;  1M1K U;  5IN1 A;  4Y91 A;  1VQ7 A;  2E6N A;  2RMO A;  1XNI A;  1LCK A;  1OUL A;  4C8Q G;  4LDY A;  2EQK A;  2QQB A;  3M0R A;  2LCC A;  4J7I A;  3JRZ A;  2LNV A;  1KG1 A;  1KQS A;  2H3E B;  3RIR A;  3WXM B;  1S72 Q;  5KYU A;  3NMZ C;  1Y71 A;  5CO7 A;  1Q86 U;  4JJB A;  3ASK A;  2MI6 A;  2V1R A;  1NBE B;  3CC2 T;  1JJ2 S;  5GAO p;  1P92 A;  4QVC A;  4M78 C;  2W0Z A;  1KD1 C;  1ABQ A;  2RA2 A;  2WSC E;  2DXC A;  3L2U A;  1ACM B;  2YWW A;  2XDB A;  3PT9 A;  4M77 E;  5GAO q;  3CCV T;  3CCS Q;  2CZ6 B;  3S3O A;  4HCZ A;  2X9H A;  1PD0 A;  4M75 D;  2JNG A;  4FL6 A;  4IKF A;  2IG0 A;  4AG2 C;  2DIL A;  4ME7 A;  3OYG A;  2O2O A;  2K2V A;  2HMA A;  3RR6 A;  1BU1 A;  2YDL A;  1MGQ A;  4L6V 5;  1VYU A;  2YRC A;  5D7U A;  4C5E A;  2DL3 A;  3GPL A;  2M1H A;  3CBM A;  4A53 A;  2IPO B;  1VQN A;  2PU9 B;  3GNG A;  1TWB A;  2QYZ A;  3L2W A;  3THK A;  4MDW A;  3EGX B;  3A98 A;  5GAM f;  1SRL A;  3G71 T;  1K8A R;  5FU7 C;  1JXO A;  2CUD A;  3GLX A;  3NGP A;  2KNB B;  2QQ9 A;  2HD0 A;  3C0C A;  3JAM E;  1VQN Q;  2HSP A;  3S6W A;  3EH1 A;  3V7R A;  3VKI A;  4E7S A;  1UEB A;  1WJQ A;  3EFO A;  4HXJ A;  3OYM A;  2MWO A;  2MK5 A;  2L3R A;  4C0Z A;  4ZN1 A;  2X4W A;  2FPE A;  1M90 C;  5CKE A;  4OP0 A;  2RHX A;  2YXY A;  4D8D A;  2RHI A;  3M0P A;  4JLG A;  3HFO A;  1M3C A;  1OI1 A;  2PUK B;  1NG2 A;  1VQ9 Q;  4DOV A;  1IHW A;  4XQ3 A;  2DLP A;  2JMA A;  3HTR A;  4C8Q D;  1YIJ T;  2G6F X;  3PMT A;  3A8M B;  1H3Z A;  4C8Q B;  1VQN T;  3VS1 A;  4M77 D;  3OYC A;  1GL5 A;  1WHG A;  5CVI A;  2MOX A;  3JCM V;  3ULR B;  5GMK l;  4RCC A;  1Y0M A;  2YLC A;  2KAF A;  3CCJ T;  1SSF A;  3QWX X;  5FRN A;  2GTO A;  2M02 A;  4C8Q C;  1WHH A;  3M54 A;  3V8K A;  5KYX A;  4J9G A;  1FYN A;  4M7A G;  3JCM W;  3CXC S;  2COZ A;  4A4G A;  2EYQ A;  1VIF A;  1J3T A;  4OMF B;  2DTO A;  5GAN d;  4M7D E;  1R77 A;  2DMO A;  5GAM d;  1GCQ A;  3OS1 A;  5IHN A;  1R0B G;  1RI0 A;  3PMI A;  3JB9 I;  1NEB A;  3NTK A;  1IO6 A;  2V26 A;  4J83 A;  1G8X A;  2NUP A;  3MEU A;  3LW5 E;  2O88 A;  3QJ6 A;  4M78 F;  4C92 C;  3OYB A;  3REA B;  3I55 Q;  3TRE A;  3CD6 A;  2JS2 A;  2ATC B;  5GAN j;  3MP1 A;  4PJL A;  1AVZ C;  3P8B B;  1MMG A;  4FYY B;  1UGP B;  3ER0 A;  2DL4 A;  1KQS P;  4C92 B;  2HEQ A;  4DBF A;  5DLQ E;  1TS9 A;  3LLR A;  3H6Z A;  1GFD A;  1YIT Q;  4LDW A;  3RKW A;  4F7U G;  3CCJ Q;  5J3B A;  1M3A A;  3M5A A;  3Q1J A;  4AG1 C;  4LDX A;  2CDT A;  1D3B A;  2Y4Y A;  3LGF A;  2JT4 A;  3CBP A;  2KMT A;  2A28 A;  4CC2 A;  3X26 B;  1QCN A;  4J9B A;  4QW2 A;  5EG2 A;  3CCL Q;  5IT9 E;  2JS0 A;  1KSW A;  4A4F A;  1M30 A;  4M75 G;  2O9S A;  4E7I A;  5FLX E;  2ESW A;  3X25 B;  1UGR B;  4FW2 A;  5GAN 3;  2AK5 A;  2R58 A;  3M9Q A;  2AZS A;  4DBR A;  1M2V A;  2R5M A;  1YWO A;  2GFU A;  4X9C A;  1F1B B;  1TTH B;  1PCX A;  2P84 A;  4EPC A;  1X69 A;  1WZO A;  1KQS S;  2GBQ A;  3QZ5 B;  1KHC A;  1DJ7 B;  3URG A;  1MND A;  4C0F A;  4Z89 A;  1WGS A;  2NLU A;  4OB0 B;  3CMA Q;  4XTV A;  3CCS T;  1JEG A;  1OYX A;  1KC8 R;  1CKB A;  2QGG A;  3HP9 A;  4L59 A;  4JS5 A;  3I55 A;  2BIV A;  2CGH A;  5LJ5 f;  1D3B B;  4X34 A;  4PNO A;  1WJS A;  4F16 A;  2ZPH B;  1D0X A;  1VQ5 T;  1KJW A;  1RAD B;  2RI3 A;  1N9S A;  2PVD B;  4OGC A;  4QQG A;  4JLI A;  3S3N A;  1I81 A;  3O5Z A;  2ED0 A;  1QWF A;  2SRC A;  5LJ5 h;  5KH6 A;  1BI1 A;  3FDR A;  1PC0 A;  4PFZ A;  2WSF E;  2RB6 A;  2EQI A;  3CCV Q;  4XTZ A;  3ZL7 C;  4J9I A;  5LJ5 e;  1WLP B;  3KBG A;  1ZSZ C;  3LX7 A;  3WVD B;  2RK2 A;  3CCR T;  2DVE A;  4C0D C;  3G71 Q;  3OYJ A;  2RQU A;  4F7U E;  3G1J A;  3RMS A;  3CC7 Q;  3EG9 B;  3RNJ A;  2FEI A;  2KRS A;  4PJO G;  4XU0 A;  5LJ3 h;  1UJ0 A;  2DIG A;  3CCV A;  4XTX A;  1WX6 A;  3CBO A;  3JCM d;  1BIA A;  1K76 A;  4C92 G;  5I2M A;  2O4X B;  1HXD A;  3EGU A;  4RTW A;  2LT4 A;  4IUV A;  1Q81 R;  1WFW A;  2LCL A;  5GJV B;  4NL3 A;  1PD1 A;  1R0C B;  1Y57 A;  2RHY A;  1CSK A;  1IGU A;  1JJ2 P;  3L2R A;  5CQX A;  2XKO C;  3CMA A;  4PL6 A;  3QO3 A;  2X51 A;  1X6B A;  2PVG B;  1RAC B;  1VQ4 T;  2M0Y A;  3CCQ T;  1O75 A;  3E19 A;  4M75 B;  4NL2 A;  2RJE A;  1UGV A;  4JDS A;  2F2V A;  4XTW A;  3M0U A;  3QHS A;  1JXM A;  2XID A;  2VVK A;  4OB3 B;  3MEV A;  2K5I A;  2CYZ B;  3CCM Q;  1QVG P;  4Z88 A;  3PIP A;  2P0K A;  3KUF A;  5GJW B;  1FMV A;  1RUW A;  3EG9 A;  3R6N A;  1RI9 A;  4LUD A;  4LNP A;  1YI2 A;  1K73 C;  3KXT A;  2K3X A;  2ED1 A;  2MPX C;  3VS0 A;  4BAC A;  2DEQ A;  2QDY B;  1RAH B;  1T3L A;  2FYK A;  3FC3 A;  2DK3 A;  4FYX B;  3HPW A;  4HVW A;  3CXC A;  3JB9 G;  2MF2 A;  1NYF A;  3A8L B;  1JRI A;  1ZSZ A;  2OTL T;  3IQL A;  1ZUY A;  2E5K A;  3EGD B;  2F5T X;  1VIE A;  2QEX T;  2K3B A;  2COW A;  3MO8 A;  4RUG A;  1KD1 R;  3RER A;  3P8H A;  2GGR A;  4IIM A;  2KYB A;  2E41 A;  1K9M U;  1QP3 A;  3EHR A;  3AT1 B;  1YCY A;  2OJ2 A;  2X35 A;  5EC7 A;  5KCH A;  4KUI A;  4N4H A;  2DRM A;  2O9V A;  1ZLM A;  2KXD A;  3N5B B;  4FSS A;  5A0D A;  1GFC A;  2FVU A;  4K11 A;  2K5F A;  5I2S A;  3VS5 A;  2X4J A;  1NLP C;  2HL5 C;  1WDX A;  4AMC A;  4J9C A;  3P8D A;  3X28 B;  3U23 A;  1VQ6 A;  1G2B A;  2KRO A;  1AOJ A;  1KHI A;  2L5Q A;  4EMK A;  4O6J A;  5LL6 S;  4ZGD B;  4D6W A;  3CEY A;  3VS2 A;  3JB9 H;  3CCJ A;  2J6F A;  3TCJ A;  3RKY A;  5A2Q E;  1PG5 B;  5GMK h;  2LJ3 A;  1BCM A;  3CCM A;  3FJP A;  4BDY A;  1XQH A;  2EYX A;  2B8A A;  4N4I A;  1WQ7 A;  5GAO l;  4BD3 A;  4OMP A;  2G3R A;  1Q81 U;  1MMN A;  5FW9 A;  4RTU A;  1YJN T;  3ZBD A;  4MZP A;  3VS3 A;  1WI7 A;  3JB9 D;  4NOY A;  1ARK A;  5CK9 A;  3ME9 A;  1MHN A;  2K5L A;  2RQV A;  1M90 R;  1VQ7 Q;  2QA4 A;  4QKU A;  1WHK A;  2CP2 A;  1VQP T;  4GY5 A;  3JCM h;  1W1F A;  1G5V A;  4HVU A;  3E1S A;  4HT8 A;  5IAY A;  3OW2 A;  1B7T A;  4M78 A;  1PM3 A;  2A08 A;  3JSC A;  1M1K C;  2QQS A;  2DXB A;  2VV5 A;  2GQV A;  1UEC A;  2ZPF B;  1NLO C;  2LCS A;  3HL8 A;  3LWH A;  3RMQ A;  2KGT A;  2CT3 A;  3QKJ A;  3EG0 A;  3D7S B;  1JB0 E;  3SD4 A;  4OGE A;  2A37 A;  1VA7 A;  1QKX A;  2F5K A;  4OVA A;  2CH4 W;  2LT1 A;  1KQ2 A;  3JCM f;  3H41 A;  1WQW A;  4HVV A;  3SWN A;  1LPL A;  2EYW A;  4J6W A;  3OYL A;  1U1T A;  2MMP A;  4FW1 A;  3RBB B;  3I56 A;  3A8H B;  5IHK A;  1WNL A;  2GF7 A;  3CME T;  4ATO A;  2CP0 A;  4JJN K;  1BIB A;  3TSW A;  1WHJ A;  2VKN A;  2KRN A;  1WJR A;  4MZT A;  4JZ3 A;  3CC7 A;  3M4G A;  1HK9 A;  1OZ3 A;  1RAB B;  3G4S T;  2JOY A;  1Q81 C;  5GMK i;  4C8Q A;  5LJ5 g;  2EFI A;  1N27 A;  3BY7 A;  4ORZ A;  1PRL C;  3CQT A;  2LJ1 A;  3PVQ A;  2M16 A;  2A0F B;  4N0A A;  5KYN A;  3JCM J;  1OV3 A;  4BB7 A;  3J7A F;  1RAG B;  1B3Q A;  2CZ1 B;  4LD6 A;  4UC4 A;  1D1A A;  1I8F A;  4A4E A;  3M0Q A;  3CCR A;  2F69 A;  3LGL A;  5CKB A;  1EFN A;  4XTY A;  1UGQ B;  2DL8 A;  1Q7Y R;  4X9D A;  3TQ7 P;  1VQ4 Q;  2YRD A;  1S1N A;  1YIT T;  4M78 D;  3J81 E;  1S72 A;  1LOJ A;  2W10 A;  1X27 A;  3JCM P;  2XD0 A;  1WA7 A;  5GAN 6;  4QQ6 A;  2HSE B;  2GTJ A;  1M9S A;  4E7H A;  3MET A;  3SFM A;  1SG5 A;  3GNF B;  1Q86 C;  1AHJ B;  1YCS B;  1ZSG A;  1VQL A;  4MZM A;  3E9G A;  2J05 A;  3GP8 A;  4EMG A;  4PJO C;  4FT2 A;  1N9R A;  1TUC A;  2ZPE B;  4O5V A;  4C92 F;  1K73 R;  1ZA1 B;  3KFV A;  1IRE B;  1TG0 A;  3G4S Q;  2OAU A;  2EW3 A;  4KT0 E;  5M9O A;  1VQM Q;  2OTJ A;  1SKU B;  1AWO A;  1C0M A;  4DBQ A;  1YI2 Q;  2RI5 A;  1U8R A;  1N8R U;  2DFU A;  1BBZ A;  1M1F A;  4FYW B;  1T3S A;  1Y96 A;  5FU6 B;  4M7D B;  2E5Q A;  4GBQ A;  4RTY A;  4PFP A;  1BI0 A;  1ZBX A;  3DLM A;  4C8Q E;  3EFR A;  1KC8 C;  1XOV A;  1CKA A;  3VRY A;  2GNC A;  3TEE A;  1TH7 A;  4J7F A;  2RHU A;  2KT8 A;  5FRM A;  4ELZ C;  1ZUK A;  2C0T A;  2LVM A;  5CKF A;  2RQR A;  1G3Y A;  4IIO A;  3I5S A;  2BZ8 A;  1NJI U;  1X43 A;  1X01 A;  4NS5 A;  2KSS A;  1OX8 A;  1JJ2 A;  2V8J A;  2E65 A;  1AD5 A;  2JTM A;  4RCB A;  3TSZ A;  2LX9 A;  4LN2 A;  1QKW A;  3OW2 P;  2D0N A;  3VS4 A;  3X20 B;  1Q82 R;  2DD4 A;  2LTO A;  3OYF A;  3EAE A;  3WVE B;  3MEA A;  1YP5 A;  1OQK A;  1YI2 T;  3HFN A;  2YSQ A;  1D0Y A;  4RG8 A;  2NUZ A;  2QQR A;  5DLO A;  1A0N B;  2LX7 A;  4JPB W;  4BI3 A;  5L8R E;  4BE0 A;  1N8R R;  2RD1 A;  3G6E A;  4J9D A;  1QVP A;  3A1P A;  1QVG A;  3PTA A;  1VQL Q;  1NZ9 A;  2RH2 A;  3MP6 A;  2X3W D;  5GAN g;  1ZHI A;  1U06 A;  1KIK A;  3UAT A;  3E2U A;  2VGM A;  3L42 A;  5KYW B;  2ZPG B;  1Q82 U;  1TU0 B;  3HHT B;  2CSI A;  3FJ5 A;  3OBW A;  5GAM g;  4PFO A;  4C8Q F;  4JRK A;  3PIO A;  4L5G A;  2PQW A;  1G3S A;  2RO0 A;  1M1K R;  1LVK A;  2HKQ B;  4X1V A;  1VQ5 A;  3SWN C;  1PHT A;  1UUE A;  1VQM T;  5LJ3 f;  1FWZ A;  1M5Q 1;  5LJ5 j;  2JM8 A;  2Z0W A;  4AFZ C;  4B9W A;  1YNZ A;  1X6G A;  1PSF A;  3SWN B;  1KK7 A;  4J6Y A;  2KBT A;  3CPW S;  2MWP A;  8ATC B;  5D6X A;  1ZX6 A;  2KY9 A;  1R8O B;  3I5R A;  2F1L A;  2WAC A;  1VQO Q;  1SF9 A;  1C6V X;  1M4Z A;  1UJY A;  2M9U A;  3JCM e;  4E7K A;  1VYV A;  2DJQ A;  1YJ9 Q;  1O9S A;  2LDM A;  4JJD A;  2QTX A;  5GAN e;  3A8G B;  2HNI A;  2EVR A;  3JCM b;  2PVO B;  4OF1 A;  2OTL Q;  1PSE A;  4AFS C;  4C92 A;  4VUB A;  3AHU A;  4E7J A;  2V8K A;  1YJN A;  4M77 A;  4IUP A;  3RKX A;  5KE2 A;  3DKM A;  1MUZ A;  5LJ5 d;  3C95 A;  4CRI A;  5GAN h;  2JZ2 A;  3LH5 A;  2DKG A;  1JU5 C;  2BTT A;  1BI3 A;  1RAF B;  4QVZ A;  5D6W A;  2L89 A;  3JB9 J;  4Y28 E;  4HCC A;  2OAW A;  1VQK A;  1D1C A;  2ZPB B;  1EX4 A;  4E6R A;  4PJO E;  1K73 U;  1GCP A;  4R55 A;  1PKT A;  1QCF A;  4M77 G;  4OMQ A;  3VUZ A;  4PJO D;  3EH2 A;  4FIB A;  4JRQ A;  2BZY A;  2PZ1 A;  1W6X A;  2FRY A;  2LRQ A;  2RNA A;  4M78 E;  3VU3 C;  1FXX A;  4C0G A;  2L8D A;  4F7U B;  3QYG B;  1WYX A;  1G3T A;  1HJD A;  1IRX A;  4JUV A;  1I5L A;  2VYT A;  4R56 A;  1OPK A;  4OB1 B;  1VQ5 Q;  2RQT A;  3NTH A;  2Y4X A;  3LWI A;  3NHN A;  4M75 C;  3CCU A;  2MIO A;  1ZUU A;  3ZEH A;  2DET A;  2KRM A;  3EFS A;  1Q7Y U;  2CH4 A;  3UT1 A;  2C0O A;  1M27 C;  4Q5W A;  2QTV A;  1FMW A;  5GAN 7;  3CC2 A;  2X4X A;  1VQK T;  2K57 A;  2YUP A;  2O4X A;  2ROL A;  1X2Q A;  3G4S A;  5CKH A;  2COY A;  2FZK B;  2RJD A;  2XG8 D;  3M57 A;  3PNW C;  2E3H A;  1VYT A;  2LJ0 A;  2D8H A;  4HCB A;  2CRE A;  4M7A D;  5AT1 B;  2VUB A;  4FU6 A;  2EAY A;  3EFO B;  4M75 E;  1D1B A;  3UDC A;  2DL5 A;  5KYY B;  1YJN Q;  2KYM A;  2YT6 A;  4V2S A;  2DM1 A;  3MP8 A;  3UWN A;  2RJF A;  3CCR Q;  3C12 A;  1LNX A;  1NYG A;  1SSH A;  2DPP B;  2YHT A;  2GCX A;  1PRM C;  5D6Y A;  2DA9 A;  5C0M A;  4LDU A;  1YBY A;  1B34 B;  4WCI A;  2EGA A;  2EGE A;  2XI9 A;  4KGX B;  2EQU A;  5GAM h;  3GBQ A;  1TUD A;  4LE9 A;  2ECZ A;  3VUB A;  1I0C A;  1W2B S;  2F2X A;  5GAO m;  2A7Y A;  2PTK A;  1K9M C;  2GFA A;  2EKO A;  1RLP C;  2LC4 A;  2NUT B;  2DX1 A;  1QMC A;  1N8R C;  5CCA A;  5KCO A;  1OEB A;  2OTJ T;  4M77 B;  2DF6 A;  1YHQ T;  1MNE A;  3H0I A;  2X4Y A;  1QCO A;  1IZ6 A;  5AYF A;  2XDP A;  3OS0 A;  3BDL A;  2EIF A;  3QG1 A;  3O8V A;  4M77 C;  4ZGJ B;  3CCL A;  4XAX B;  4J9F A;  4J5Y A;  3M55 A;  2RHZ A;  4N4G A;  1GXI E;  1B34 A;  3M0S A;  2NWM A;  3CPW A;  2LQN A;  1Q7Y C;  2WSE E;  2K9G A;  4M77 F;  2LP5 A;  2DBM A;  2LMJ A;  2KXC A;  4KRT A;  1W2B A;  1X2K A;  3H8Z A;  1ZSZ B;  2HBW A;  3H0F A;  5KYU B;  4QVD A;  2E1H A;  1UFF A;  1VUB A;  3G6E T;  3E9F A;  3OA6 A;  2KEA A;  3QPH A;  2HKN A;  4M78 B;  4ANJ A;  1Q86 R;  5I22 A;  2DER A;  2JMC A;  5IHI A;  2CP5 A;  1BI2 A;  3PE0 A;  1OOT A;  2RF0 A;  2HAX A;  2C06 A;  3HRS A;  5GAO n;  1QP2 A;  3OMG A;  1YJ9 T;  2KR3 A;  1U1S A;  3QSU A;  2O01 E;  1IGQ A;  2RN8 A;  3OYK A;  1N5Z A;  1M3B A;  3VJP A;  3J80 E;  4M75 A;  3JCM X;  3EGD A;  3CD6 T;  3OYA A;  4WTO B;  2L2P A;  3TVT A;  2QDL A;  4OMN A;  1EIF A;  3T9N A;  1YJW Q;  1H3H A;  5LJ3 g;  1MV3 A;  2DNU A;  1OX9 A;  3MKD A;  3G71 A;  1GBQ A;  4R0K A;  2CZ7 B;  3OW2 S;  4CC7 A;  2AIR B;  1KD1 U;  3CXC P;  1YHQ A;  4XU3 A;  5FU7 B;  4P5N A;  4RMO A;  3GIB A;  3S3M A;  4RTT A;  2MYS A;  1E6G A;  5GAN 2;  4M7D A;  5GAO r;  2JN0 A;  3LH0 A;  2DEU A;  2DVJ A;  4PJN A;  1GRI A;  2DAQ A;  3FRN A;  5A0L A;  1HYO A;  2OTJ Q;  1VQM A;  1KQ1 A;  1OU8 A;  1BK2 A;  4PLL A;  3OQ5 A;  2FZC B;  3EHQ A;  2DYB A;  1AWW A;  4BI8 B;  1Z9Z A;  2J6K A;  4PJO B;  2AKK A;  3BW1 A;  4JRP A;  1Q82 C;  2H3J A;  4KGZ B;  1TSF A;  3EG2 A;  4OML A;  5HCK A;  4C5H A;  1SPK A;  4F7U F;  1YIJ A;  4JJC A;  4FCY A;  3SHW A;  1AT1 B;  2EYY A;  1VQ8 A;  3C4S A;  2E10 A;  3MPU B;  5C6S A;  3OSS C;  4IUQ A;  1UHC A;  5LJ3 e;  4M4Z A;  1QLY A;  5HKC A;  5LJ3 j;  3HRU A;  1BCO A;  4AT1 B;  1V29 B;  1K8A U;  2ZCF B;  2EQM A;  1VQP Q;  2JW4 A;  3OS5 A;  1YJ9 A;  1PNJ A;  1E7O A;  2KVQ G;  2QK0 A;  2QG9 B;  3NPF A;  2DTI A;  2K2M A;  2P0Q A;  3OYH A;  4M78 G;  2CP3 A;  1GCQ C;  1TOV A;  4J9E A;  5J39 A;  1QVF P;  2K3Y A;  2XK0 A;  1JBM A;  1K1Z A;  4PJJ A;  3OS2 A;  4LD9 K;  3VV0 A;  2R57 A;  3BDU A;  2ABL A;  1VQ6 T;  2MCN A;  1QW1 A;  2I2L A;  3M0T A;  1D0Z A;  2DXT A;  3EG1 A;  5GAN 4;  2EYZ A;  2BKD N;  2RI2 A;  2EGC A;  3CME Q;  2CSQ A;  1U5S A;  4C5G A;  3BE3 A;  4GLK A;  2JJ9 A;  2Y90 A;  2J06 A;  1BB9 A;  3CCQ Q;  3QDF A;  1X75 C;  3PFS A;  4A4H A;  2JTE A;  5KYX B;  1UDL A;  1ZQ1 A;  4Y92 A;  1NJI C;  2FHD A;  4JS4 A;  1W2B P;  3OBY A;  1I1J A;  4J9H A;  1GBR A;  2JXB A;  1YFN A;  3GF5 A;  4BDZ A;  3UPU A;  1VQ4 A;  4CC3 A;  1VQ9 T;  4Z8A A;  2O31 A;  1UGS B;  4M7A B;  4FSX A;  4LUE A;  1QVG S;  2E64 A;  1G83 A;  3CCU T;  2L3P A;  2C0I A;  2KI7 A;  5J26 A;  3GOX A;  4M7A A;  1VQ8 Q;  3C94 A;  4BY6 B;  2VXF A;  4J6X A;  4M7A C;  2XU8 A;  2FB7 A;  1WXB A;  2FRW A;  4ZNX A;  2YUN A;  2ENM A;  2A36 A;  4N0A C;  4BY6 C;  3H0H A;  2DZ9 A;  4XU1 A;  1VQP A;  2LQK A;  3SEM A;  5IXF A;  2DRK A;  5FRO A;  1FMK A;  2KT1 A;  2M0O A;  1H8K A;  2QXF A;  4E7Z A;  3MEW A;  2DXU A;  3QZ9 B;  2HZY A;  2DBK A;  5A0G A;  2F2W A;  3QYH B;  2IIM A;  3FEO A;  2OI3 A;  2NYS A;  2GQI A;  4DBH A;  5DM7 R;  1PKS A;  2HBP A;  2LZ6 B;  2D0Q B;  4M7D F;  2DZC A;  3JCM c;  1AZG B;  2EKH A;  1D09 B;  6AT1 B;  2X3X D;  4LXC A;  3PGG A;  1H64 1;  2XIC A;  2QA4 Q;  1K4U S;  2V1Q A;  4EDU A;  4BE2 A;  3QWY A;  3M58 A;  2K4Y A;  2YUO A;  2LQ8 A;  1RAI B;  3LYI A;  1T0H A;  2CS7 A;  4DEX A;  3CC4 T;  3M59 A;  1M2V B;  2HL3 A;  3R6O A;  2DYI A;  3CD6 Q;  2QAS A;  2JVV A;  2QQA A;  4M7D D;  4PJO A;  4AFQ C;  2EJF A;  2AKL A;  3RUX A;  1K0X A;  2AZV A;  3I56 Q;  2EJG A;  4JZ4 A;  7AT1 B;  3FB9 A;  1WHM A;  1YIT A;  1N6A A;  3CCL T;  4E2F B;  2DJZ A;  2YLB A;  4A63 B;  1UTI A;  1SEM A;  2YUQ A;  4BE1 A;  3DB3 A;  3CCU Q;  1QVF S;  1VQO A;  3CCE A;  3RDV A;  4RTX A;  3UF4 A;  3A5Z B;  4JRI A;  1TUG B;  4MML A;  4EMK B;  2DTH A;  3MJX A;  4HA8 A;  1ZBJ A;  3F70 A;  2R5A A;  3CMA T;  2NUT A;  1VQK Q;  3EGX A;  4EMK C;  4PK4 A;  4EIK A;  4XU2 A;  3CPF A;  3DLL A;  2LQW A;  4KBM B;  1X6O A;  2BE9 B;  1Y07 A;  2J6O A;  4PJM A;  1Z9Q A;  5GMK m;  2JM9 A;  1K9M R;  5FU6 C;  4CI0 C;  5IH2 A;  1I07 A;  2PUO B;  4Z02 A;  2FO0 A;  2RPN A;  5KE3 A;  4A4K A;  3QXE B;  4MMK A;  2VGN A;  2HQX A;  4IUT A;  2BZX A;  2JUF A;  3JB9 F;  3L2Z A;  3H9N A;  1U3O A;  3OYE A;  2HDA A;  1VQO T;  4II1 A;  3VRZ A;  5FWC A;  3CC4 A;  1FX7 A;  4FM4 B;  2RK1 A;  5DY9 A;  4C5I A;  1OZ2 A;  2LNH B;  3FIF A;  5KYY A;  4M75 F;  1IB8 A;  1QWE A;  4E7L A;  1Y7X A;  4ZGE B;  3V8J A;  4QT7 A;  3UA6 A;  4DOW A;  5CAI A;  4B6M A;  2OTL A;  4ZTF A;  2ZGW A;  4TVR A;  4F04 B;  3ZFJ A;  1I4K 1;  2QEX A;  5IXB A;  3CC4 Q;  2BE7 D;  3I35 A;  2P0P A;  3CCE Q;  3M53 A;  3EG3 A;  2B86 A;  2DD5 A;  1AEY A;  2KDS A;  5GMK e;  1AWJ A;  3I56 T;  1M8M A;  2FZG B;  4IUR A;  1K0S A;  1NJI R;  2IVW A;  3CME A;  4ESR A;  1SRM A;  3A8O B;  3VYG A;  3PVL A;  2RQW A;  1V76 A;  4PLI A;  1RAE B;  2QAZ A;  4DA4 A;  2E4H A;  2DE0 X;  4RTV A;  1NE8 A;  2JTF A;  5KYW A;  4FT4 A;  4BUG A;  2FG0 A;  3JCM Q;  4OMO A;  4F7U A;  4LDV A;  4GLM A;  1UHF A;  4HKE A;  1E6H A;  2M51 A;  4KH1 B;  1VQL T;  3REB B;  1MV0 B;  1G3W A;  3CCM T;  3OYD A;  2L0A A;  4KUD K;  3TU4 K;  2VWF A;  4ZN3 A;  2H8H A;  5FWB A;  1PWT A;  2D6F A;  5GAM j;  1AWX A;  1S72 T;  2DIQ A;  1UE9 A;  4PJO F;  1W4S A;  4OB2 B;  3CCS A;  1VQ9 A;  2FPF A;  2K7A A;  1NPP A;  5HY6 A;  3I55 T;  2VAS A;  3VYH B;  4FYV B;  1YJW T;  3QII A;  3M4Y A;  2QA4 T;  1VOM A;  1QVF A;  3CPW P;  3OYI A;  4C0D B;  5CQY A;  4YTL A;  2MAM A;  5GAN 5;  1MMA A;  4ELY C;  3G7Z A;  1W70 A;  5I11 A;  1K9A A;  1M90 U;  1WXU A;  4DEY A;  2AT1 B;  2XDD A;  3JCM g;  4CC4 B;  4HCK A;  2HCK A;  2RJC A;  1MMD A;  3VS7 A;  1V1C A;  8AT1 B;  4RTZ A;  2E12 A;  2DL7 A;  2P4T A;  4KH0 B;  1RAA B;  3OMC A;  1JO8 A;  2XHC A;  2CP7 A;  2EWN A;  5GMK j;  5GAN 8;  4KGV B;  4RG2 A;  3SDZ A;  2RM4 A;  2E6Z A;  5CR2 A;  3QDR B;  1K8A C;  2KQW A;  2V8I A;  1C1A A;  4F17 A;  4M7A F;  2YRV A;  1M8V A;  5ECA A;  1M1G A;  1NEG A;  2L3S A;  4AFU C;  3HKS A;  4D8K A;  3V8L A;  4E47 A;  2D1X A;  3RES A;  2VB6 A;  3CC7 T;  1VQ6 Q;  2FPD A;  1ZA2 B;  1YIJ Q;  1SHG A;  4B9X A;  2I0N A;  2NUP B;  9ATC B;  1OPL A;  4A54 A;  1ABO A;  3JV3 A;  4M7D G;  2KK4 A;  2OX7 A;  1H92 A;  1WHL A;  2D9T A;  1KC8 U;  1BYM A;  3QBY A;  1UB4 A;  3INZ A;  3QUI A;  3SB2 A;  2EBP A;  4M7A E;  3VS6 A;  1LJO A;  1UG1 A;  1IHV A;  3CCQ A;  4QQD A;  3HSB A;  4C92 D;  3DB4 A;  1YHQ Q;  2E3I A;  2QGF B;  3L1A A;  2EJ9 A;  2CKK A;  5CIU A;  3V7S A;  4DQ2 A;  2L3Q A;  3L2Q A;  1VQ7 T;  1SHF A;  4RKU E;  1YJW A;  4ZTJ A;  1XJW B;  5GAM e;  5I21 A;  1M2O A;  1NPR A;  1I5O B;  1VQ8 T;  3G6E Q;  3X24 B;  2K79 A;  3OY9 A;  2HQE A;  2QI2 A;  1RL2 A;  5HK0 A;  4PKC C;  3HRT A;  2CZ0 B;  3OYN A;  1JQQ A;  2P4R A;  4OMM A;  1BKB A;  2ROT A;  1NM7 A;  3OYY A;  2DO3 A;  4XK8 E;  3MHX A;  4HT9 A;  1EZZ B;  2AHJ B;  2EPD A;  1WPY A;  2PNI A;  3NTI A;  2CP6 A;  3MCA B;  1QQJ A;  1YN8 A;  4J8O A;  3OSV A;  3L2V A;  5HK3 A;  2E70 A;  4KUL A;  2SEM A;  5L23 A; 
#chains in the Genus database with same CATH homology
 2FB7 A;  1O75 A;  2KY9 A;  3E19 A;  4M75 B;  1R8O B;  5LJ3 d;  2WAC A;  4EMH A;  4NL2 A;  2EQJ A;  2RJE A;  1XTD A;  1M4Z A;  4N0A C;  2M9U A;  4JDS A;  2DZ9 A;  4XTW A;  4XU1 A;  4BY6 C;  3JCM e;  4E7K A;  1VQP A;  2LQK A;  3QHS A;  3CCE T;  3V7C A;  1O9S A;  2LDM A;  5GAN f;  4M7D C;  2XID A;  1Y96 B;  2QTX A;  4OB3 B;  3MEV A;  2K5I A;  3M56 A;  5GAN e;  3A8G B;  2HNI A;  5FRO A;  2CYZ B;  3JCM b;  2PVO B;  3QJY A;  4IUU A;  2M0O A;  3BFM A;  4OF1 A;  3PIP A;  2P0K A;  2QXF A;  3KUF A;  1PSE A;  2FL7 A;  3MEW A;  2DXU A;  4C92 A;  4VUB A;  3AHU A;  2ZZD A;  4E7J A;  2V8K A;  5CKD A;  1YI2 A;  1YJN A;  3QZ9 B;  4M77 A;  1K73 C;  4IUP A;  3KXT A;  3RKX A;  2K3X A;  5KE2 A;  3DKM A;  5A0G A;  5LJ5 d;  4BAC A;  2DEQ A;  2QDY B;  3C95 A;  2VC8 A;  2FYK A;  2JZ2 A;  3QYH B;  2A3L A;  2DKG A;  3FEO A;  4CRI A;  5GAN h;  3FC3 A;  2BUD A;  1BI3 A;  4C92 E;  5D6W A;  2VXE A;  2DK3 A;  2L89 A;  4QVZ A;  4MDX A;  3JB9 J;  4WF2 A;  4Y28 E;  3HPW A;  3FLG A;  3CXC A;  3JB9 G;  4HCC A;  1VQK A;  3OB9 A;  2ZPB B;  2MF2 A;  4XTU A;  2ZPI B;  4PJO E;  5DM7 R;  3NFC A;  1K73 U;  2HBP A;  3A8L B;  2D0Q B;  4BI4 A;  4R55 A;  4M7D F;  1JRI A;  2DZC A;  1M1K U;  5IN1 A;  3JCM c;  2OTL T;  4M77 G;  4Y91 A;  1VQ7 A;  2E6N A;  2F5T X;  3PGG A;  3VUZ A;  1VIE A;  1H64 1;  4PJO D;  2XIC A;  2QEX T;  1XNI A;  4FIB A;  3MO8 A;  4C8Q G;  4LDY A;  4EDU A;  4BE2 A;  2EQK A;  4JRQ A;  3RER A;  2QQB A;  3P8H A;  2LCC A;  4J7I A;  3JRZ A;  3M58 A;  2K4Y A;  2LRQ A;  2LNV A;  4M78 E;  1KG1 A;  3VU3 C;  1FXX A;  4C0G A;  2LQ8 A;  1KQS A;  3LYI A;  2E41 A;  3RIR A;  3WXM B;  1K9M U;  2L8D A;  4F7U B;  1QP3 A;  1YCY A;  2CS7 A;  2X35 A;  3QYG B;  1G3T A;  5KCH A;  3CC4 T;  4KUI A;  1Y71 A;  3M59 A;  5CO7 A;  1Q86 U;  4N4H A;  3R6O A;  3ASK A;  3N5B B;  4JUV A;  5A0D A;  2JVV A;  1I5L A;  2QQA A;  2FVU A;  4M7D D;  2MI6 A;  2VYT A;  2K5F A;  4OB1 B;  4R56 A;  3CC2 T;  4PJO A;  3NTH A;  2EJF A;  2Y4X A;  5I2S A;  3LWI A;  2X4J A;  1JJ2 S;  3RUX A;  5GAO p;  1P92 A;  4M75 C;  4QVC A;  4M78 C;  3CCU A;  1KD1 C;  3P8D A;  2EJG A;  2RA2 A;  3ZEH A;  3X28 B;  2WSC E;  1VQ6 A;  2DXC A;  1KHI A;  3EFS A;  2L5Q A;  3L2U A;  4EMK A;  1Q7Y U;  3FB9 A;  3UT1 A;  4O6J A;  5LL6 S;  4ZGD B;  4D6W A;  4Q5W A;  2XDB A;  3PT9 A;  4M77 E;  5GAO q;  3CCV T;  1YIT A;  3CEY A;  2CZ6 B;  1N6A A;  3S3O A;  4HCZ A;  5GAN 7;  3JB9 H;  3CCJ A;  3CCL T;  3CC2 A;  2X4X A;  2DJZ A;  2YLB A;  4M75 D;  2K57 A;  2JNG A;  1VQK T;  2O4X A;  4FL6 A;  3TCJ A;  4IKF A;  3RKY A;  5A2Q E;  3G4S A;  5GMK h;  5CKH A;  2RJD A;  4BE1 A;  3CCM A;  2IG0 A;  3DB3 A;  1QVF S;  4ME7 A;  3OYG A;  1VQO A;  2K2V A;  3CCE A;  2XG8 D;  3M57 A;  3FJP A;  4BDY A;  3A5Z B;  4JRI A;  3PNW C;  1MGQ A;  1XQH A;  4L6V 5;  2B8A A;  4C5E A;  4HCB A;  4MML A;  4N4I A;  4EMK B;  1WQ7 A;  2DTH A;  4BD3 A;  5GAO l;  3GPL A;  4M7A D;  2G3R A;  2VUB A;  2M1H A;  3CBM A;  1Q81 U;  4HA8 A;  4A53 A;  1YJN T;  4FU6 A;  2EAY A;  4M75 E;  3F70 A;  2R5A A;  3UDC A;  3CMA T;  1VQN A;  3ZBD A;  4MZP A;  2PU9 B;  3GNG A;  3JB9 D;  4NOY A;  3L2W A;  5CK9 A;  4V2S A;  4MDW A;  5GAM f;  3MP8 A;  3UWN A;  2RJF A;  4EMK C;  4XU2 A;  3C12 A;  1MHN A;  3ME9 A;  1LNX A;  3G71 T;  2K5L A;  5FU7 C;  3CPF A;  3GLX A;  3DLL A;  4KBM B;  1X6O A;  1Y07 A;  2QA4 A;  2DPP B;  2HD0 A;  2QQ9 A;  5GMK m;  2YHT A;  2GCX A;  5D6Y A;  5FU6 C;  4CI0 C;  3JAM E;  4GY5 A;  2PUO B;  3JCM h;  1VQP T;  1G5V A;  4Z02 A;  3E1S A;  5C0M A;  5KE3 A;  4HT8 A;  4A4K A;  3S6W A;  5IAY A;  3V7R A;  4LDU A;  3VKI A;  3OW2 A;  1UEB A;  1WJQ A;  3QXE B;  4M78 A;  1YBY A;  4MMK A;  2VGN A;  2HQX A;  3JSC A;  4IUT A;  1M1K C;  3OYM A;  1B34 B;  2QQS A;  2MWO A;  2DXB A;  2VV5 A;  2L3R A;  2GQV A;  4C0Z A;  2JUF A;  2ZPF B;  4ZN1 A;  3JB9 F;  2X4W A;  2XI9 A;  2EQU A;  5GAM h;  3HL8 A;  3LWH A;  3VUB A;  3L2Z A;  1M90 C;  3RMQ A;  5CKE A;  4OP0 A;  3OYE A;  2RHX A;  1W2B S;  3QKJ A;  1VQO T;  1JB0 E;  3SD4 A;  5GAO m;  2A7Y A;  4II1 A;  4OGE A;  2RHI A;  1FX7 A;  1K9M C;  3CC4 A;  4FM4 B;  2GFA A;  2F5K A;  4JLG A;  4OVA A;  2EKO A;  2RK1 A;  2LC4 A;  2LT1 A;  1OI1 A;  3HFO A;  5DY9 A;  2PUK B;  1OZ2 A;  4C5I A;  1N8R C;  3FIF A;  5CCA A;  5KCO A;  1KQ2 A;  4M75 F;  4DOV A;  3JCM f;  2OTJ T;  4XQ3 A;  4E7L A;  4M77 B;  1Y7X A;  4ZGE B;  1YHQ T;  3V8J A;  4C8Q D;  1YIJ T;  1WQW A;  3SWN A;  4ATO A;  4J6W A;  3PMT A;  3OYL A;  3A8M B;  2X4Y A;  1U1T A;  2MMP A;  1H3Z A;  4DOW A;  4C8Q B;  1IZ6 A;  5CAI A;  3I56 A;  1VQN T;  2OTL A;  3A8H B;  4M77 D;  4ZTF A;  3OYC A;  5AYF A;  2XDP A;  1WNL A;  2GF7 A;  2ZGW A;  4TVR A;  5CVI A;  3OS0 A;  3ZFJ A;  3CME T;  1I4K 1;  3JCM V;  2QEX A;  3BDL A;  5GMK l;  4JJN K;  1BIB A;  4RCC A;  2EIF A;  3QG1 A;  3O8V A;  4M77 C;  4ZGJ B;  2YLC A;  2KAF A;  2P0P A;  3M53 A;  4XAX B;  3CCJ T;  1SSF A;  3CCL A;  5FRN A;  1WJR A;  4J5Y A;  4MZT A;  3M55 A;  2RHZ A;  4N4G A;  1GXI E;  3CC7 A;  1B34 A;  3M4G A;  2DD5 A;  4C8Q C;  1HK9 A;  1OZ3 A;  3G4S T;  2JOY A;  3CPW A;  3M54 A;  3V8K A;  1Q7Y C;  1Q81 C;  2KDS A;  5GMK i;  5GMK e;  3I56 T;  2WSE E;  4C8Q A;  5LJ5 g;  2EFI A;  4M7A G;  4M77 F;  1N27 A;  4IUR A;  3BY7 A;  3JCM W;  2IVW A;  3CXC S;  4A4G A;  2EYQ A;  3CME A;  1VIF A;  2M16 A;  1W2B A;  3H8Z A;  4OMF B;  2DTO A;  4N0A A;  5GAN d;  3JCM J;  4M7D E;  4QVD A;  4BB7 A;  3J7A F;  2E1H A;  3A8O B;  2CZ1 B;  4LD6 A;  4PLI A;  4UC4 A;  3VYG A;  5GAM d;  3OS1 A;  1VUB A;  3G6E T;  1RI0 A;  3PMI A;  1I8F A;  3E9F A;  4A4E A;  3JB9 I;  3OA6 A;  2F69 A;  3NTK A;  3LGL A;  5CKB A;  3CCR A;  4DA4 A;  3QPH A;  4XTY A;  1UGQ B;  4M78 B;  1NE8 A;  2JTF A;  4FT4 A;  4BUG A;  4J83 A;  3JCM Q;  4X9D A;  1BI2 A;  3MEU A;  1YIT T;  4F7U A;  4M78 D;  4LDV A;  3J81 E;  3LW5 E;  1S72 A;  1LOJ A;  3QJ6 A;  2C06 A;  2HAX A;  3HRS A;  4M78 F;  4HKE A;  4C92 C;  3OYB A;  1VQL T;  5GAO n;  3JCM P;  1QP2 A;  3TRE A;  3CD6 A;  5GAN j;  2XD0 A;  3OMG A;  1G3W A;  3MP1 A;  3OYD A;  3CCM T;  1YJ9 T;  1U1S A;  3P8B B;  5GAN 6;  3QSU A;  2O01 E;  4KUD K;  3TU4 K;  1UGP B;  3ER0 A;  4QQ6 A;  4ZN3 A;  3OYK A;  1M9S A;  4E7H A;  3MET A;  3SFM A;  1Q86 C;  3GNF B;  4C92 B;  2D6F A;  1AHJ B;  5GAM j;  1S72 T;  2DIQ A;  4PJO F;  3VJP A;  1W4S A;  3J80 E;  4OB2 B;  1VQL A;  4MZM A;  4M75 A;  5DLQ E;  3JCM X;  3CD6 T;  3LLR A;  3H6Z A;  3CCS A;  3E9G A;  3OYA A;  3GP8 A;  4EMG A;  4LDW A;  3RKW A;  4FT2 A;  1N9R A;  4F7U G;  1VQ9 A;  2ZPE B;  4O5V A;  4C92 F;  4PJO C;  5J3B A;  1NPP A;  1IRE B;  3M5A A;  1EIF A;  5HY6 A;  3Q1J A;  3T9N A;  3I55 T;  4LDX A;  2OAU A;  1D3B A;  5LJ3 g;  2Y4Y A;  3LGF A;  3VYH B;  3G71 A;  4KT0 E;  3CBP A;  5M9O A;  2KMT A;  1YJW T;  2OTJ A;  2CZ7 B;  3OW2 S;  1KD1 U;  1YHQ A;  4XU3 A;  3QII A;  3M4Y A;  2QA4 T;  2RI5 A;  3X26 B;  1QVF A;  1U8R A;  5FU7 B;  3OYI A;  4C0D B;  4P5N A;  5CQY A;  1N8R U;  4RMO A;  3GIB A;  4YTL A;  5EG2 A;  4QW2 A;  5IT9 E;  3S3M A;  2MAM A;  1M1F A;  5GAN 5;  5GAN 2;  1Y96 A;  5FU6 B;  4ELY C;  3G7Z A;  4M7D A;  4M7D B;  2E5Q A;  4A4F A;  1M90 U;  5GAO r;  2JN0 A;  3LH0 A;  4M75 G;  2XDD A;  3JCM g;  4E7I A;  5FLX E;  1BI0 A;  1ZBX A;  2DAQ A;  3DLM A;  3FRN A;  3X25 B;  5A0L A;  4C8Q E;  3EFR A;  1VQM A;  1XOV A;  1KC8 C;  1KQ1 A;  4PLL A;  1UGR B;  2RJC A;  3TEE A;  3OQ5 A;  5GAN 3;  1TH7 A;  2E12 A;  2R58 A;  2P4T A;  4J7F A;  3OMC A;  3M9Q A;  2R5M A;  2GFU A;  2RHU A;  2XHC A;  4X9C A;  4BI8 B;  4EPC A;  1KQS S;  2EWN A;  5GMK j;  4PJO B;  5GAN 8;  5FRM A;  4ELZ C;  3BW1 A;  3QZ5 B;  1KHC A;  2LVM A;  1DJ7 B;  3URG A;  4JRP A;  4RG2 A;  5CKF A;  1Q82 C;  2H3J A;  3SDZ A;  2RM4 A;  4C0F A;  2E6Z A;  4C5H A;  4F7U F;  1WGS A;  2NLU A;  5CR2 A;  3QDR B;  1YIJ A;  1G3Y A;  4OB0 B;  1K8A C;  2KQW A;  3C4S A;  2V8I A;  4XTV A;  3CCS T;  1NJI U;  1VQ8 A;  1X01 A;  1OYX A;  2E10 A;  4NS5 A;  4M7A F;  2YRV A;  2KSS A;  1M8V A;  1JJ2 A;  4L59 A;  1M1G A;  2V8J A;  3HP9 A;  3OSS C;  4IUQ A;  5C6S A;  5LJ3 e;  3I55 A;  2E65 A;  4JS5 A;  2BIV A;  2CGH A;  5LJ5 f;  2JTM A;  1D3B B;  4RCB A;  5HKC A;  3HRU A;  3HKS A;  4PNO A;  4X34 A;  5LJ3 j;  1V29 B;  1WJS A;  3V8L A;  2LX9 A;  2ZPH B;  4E47 A;  1VQ5 T;  3RES A;  1K8A U;  2ZCF B;  2RI3 A;  1N9S A;  2PVD B;  4OGC A;  3CC7 T;  2EQM A;  4QQG A;  4JLI A;  3X20 B;  2DD4 A;  2LTO A;  3OS5 A;  3OYF A;  3EAE A;  1YJ9 A;  3S3N A;  3WVE B;  4B9X A;  3MEA A;  2KVQ G;  1I81 A;  4A54 A;  5LJ5 h;  1YI2 T;  3HFN A;  5KH6 A;  1BI1 A;  3FDR A;  4M7D G;  2DTI A;  2KK4 A;  2WSF E;  4RG8 A;  2D9T A;  2RB6 A;  2QQR A;  2P0Q A;  3QBY A;  5DLO A;  3OYH A;  1UB4 A;  4XTZ A;  1KC8 U;  1BYM A;  4M78 G;  4BI3 A;  3INZ A;  3QUI A;  5L8R E;  3SB2 A;  3KBG A;  5LJ5 e;  4BE0 A;  2RD1 A;  4M7A E;  3LX7 A;  3G6E A;  1LJO A;  5J39 A;  1QVP A;  1QVG A;  2K3Y A;  3WVD B;  3CCQ A;  2RK2 A;  2XK0 A;  4QQD A;  3PTA A;  2DVE A;  1NZ9 A;  2RH2 A;  4C0D C;  3CCR T;  1JBM A;  3HSB A;  4C92 D;  3OYJ A;  3DB4 A;  4F7U E;  3MP6 A;  3OS2 A;  4LD9 K;  5GAN g;  1ZHI A;  3RMS A;  3VV0 A;  2R57 A;  3BDU A;  1VQ6 T;  3L1A A;  2EJ9 A;  2CKK A;  5CIU A;  3V7S A;  4DQ2 A;  1QW1 A;  2I2L A;  3L2Q A;  2VGM A;  2DXT A;  4RKU E;  1YJW A;  5GAN 4;  1VQ7 T;  4PJO G;  3L42 A;  4ZTJ A;  4XU0 A;  2BKD N;  2RI2 A;  5LJ3 h;  2ZPG B;  1Q82 U;  2DIG A;  5GAM e;  1NPR A;  3HHT B;  5I21 A;  3CCV A;  4XTX A;  3CBO A;  4C5G A;  3JCM d;  1BIA A;  3OBW A;  1VQ8 T;  4GLK A;  5GAM g;  2Y90 A;  3X24 B;  4C92 G;  5I2M A;  3OY9 A;  2HQE A;  2O4X B;  4C8Q F;  1HXD A;  2QI2 A;  1RL2 A;  1X75 C;  5HK0 A;  3PFS A;  4JRK A;  4PKC C;  3PIO A;  2LT4 A;  4IUV A;  3HRT A;  2CZ0 B;  4A4H A;  3OYN A;  4L5G A;  2PQW A;  1G3S A;  1BKB A;  2LCL A;  1ZQ1 A;  2RO0 A;  1NJI C;  2FHD A;  3OYY A;  4JS4 A;  1VQ5 A;  2DO3 A;  3OBY A;  3SWN C;  4XK8 E;  4NL3 A;  1VQM T;  5LJ3 f;  3GF5 A;  1FWZ A;  4BDZ A;  1M5Q 1;  3MHX A;  5LJ5 j;  3UPU A;  1VQ4 A;  4HT9 A;  1VQ9 T;  2AHJ B;  1UGS B;  4M7A B;  4FSX A;  2RHY A;  1QVG S;  2E64 A;  1WPY A;  3CCU T;  5J26 A;  3NTI A;  3L2R A;  3MCA B;  5CQX A;  3GOX A;  4M7A A;  2XKO C;  3CMA A;  4PL6 A;  3QO3 A;  4B9W A;  4J8O A;  3OSV A;  3L2V A;  1PSF A;  3SWN B;  3C94 A;  4J6Y A;  4BY6 B;  2PVG B;  5HK3 A;  2VXF A;  4J6X A;  3CPW S;  2E70 A;  2MWP A;  5D6X A;  4M7A C;  4KUL A;  1VQ4 T;  3CCQ T;  2XU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...