4DOWA

Structure of mouse orc1 bah domain bound to h4k20me2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
157
structure length
157
Chain Sequence
b'TFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Origin recognition complex subunit 1
publication title The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
total genus 31
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dowA00
2FL7A 4FSXA 1ZBXA 4KUIA 1W4SA 4DOWA 3PTAA 4JJNK 3TU4K 4BB7A 1ZHIA 1M4ZA 4LD9K 4FT4A 4KUDK 3PT9A 2FVUA 4DA4A 4KULA 4DOVA 4FT2A
chains in the Genus database with same CATH superfamily
1X6OA 2KROA 2ZPBB 1OPKA 1OZ2A 3L2WA 3CMEQ 1QLYA 2F5KA 2KRSA 3CXCA 4LDWA 1DJ7B 3I55Q 2RPNA 2CZ1B 3EG9A 1YP5A 3RDVA 1H3ZA 2RM4A 3OS5A 4LUEA 1SHFA 1WXBA 2QA4T 4NS5A 1Q7YC 5FU7B 8ATCB 4M7DC 2LC4A 2CH4W 1D0ZA 4C0ZA 3V7SA 1HJDA 1VQ8T 3LWHA 4M7AE 3FRNA 1ZSGA 4ORZA 4KUDK 2GQIA 4AFUC 2YSQA 5KCOA 2OTLT 1TWBA 3QSUA 1WZOA 3QIIA 3EH1A 1VQKA 5LJ3e 2MPXC 1M2OA 3VS6A 2BZYA 3CC7Q 3MP1A 1M1GA 3VS7A 1WHGA 1K9MC 2DYIA 1VQLA 1OQKA 2XICA 4XTYA 3P8HA 4DBHA 3GBQA 3J80E 2PZ1A 1BI1A 1QVFA 1SG5A 2DXBA 2F2XA 1U1TA 3P8DA 3OW2P 1VQOQ 4CC4B 5I11A 2VVKA 2QGGA 2IPOB 2K57A 2L3SA 3OYCA 1Y7XA 4F17A 2WSFE 3QZ5B 1YJ9Q 1S72Q 4KRTA 1VQ9Q 4ZN1A 3HP9A 3VS3A 2KMTA 1S1NA 3A1PA 4JJNK 2RQWA 3CEYA 7AT1B 1Q81U 4JJDA 2AHJB 2JS2A 1WFWA 1M9SA 2QYZA 5GMKh 3JB9I 2JNGA 3FJPA 2DFUA 2LX7A 4A4FA 4M75A 1I0CA 4E7KA 1FXXA 1M1KC 4FM4B 4PJOC 3X20B 3JB9J 2OTJA 3ME9A 4MDXA 2V26A 2YUNA 1VA7A 3NTIA 2PU9B 1FMVA 2KY9A 3BW1A 3M56A 1D09B 1PC0A 4E2FB 4BI8B 3RUXA 1NJIU 1BBZA 3AHUA 2YUQA 4HT8A 2DL8A 3MEUA 2RI2A 1VQ7T 1ZX6A 2EYYA 2RD1A 4FCYA 4FSXA 1V1CA 3QKJA 2K5LA 1X6BA 2V1QA 2JM9A 5KYWA 2QAZA 1UB4A 2JMAA 3I9QA 1I5OB 3CMAT 2RQVA 2FHDA 3OYKA 1CSKA 1N9SA 1YJNQ 1I8FA 4KH0B 5C6SA 3JCMb 3PVLA 1XQHA 4M77F 4Z88A 1U8RA 1X75C 1MHNA 4B9WA 4ELYC 1UJYA 2XHCA 2CP7A 2JUFA 3CCUT 3JB9D 3VS2A 2YDLA 4L59A 1TSFA 1VUBA 3EGUA 4RUGA 3GF5A 1WLPB 5M9OA 1K73U 2IVWA 2E70A 1ZUUA 4BDZA 3A8HB 4EMKB 3REBB 4M7AD 2QI2A 3OBWA 1KD1C 2FO0A 1GFDA 1Q82R 2K7AA 3OB9A 1Z9ZA 3DKMA 3MEWA 3EGXB 2MCNA 3UDCA 2QEXA 4RG2A 5KYXB 2IG0A 5HK3A 4QVCA 3S3NA 3G6EQ 4MDWA 2WACA 3A8LB 2QDLA 4BE1A 2M0OA 1TH7A 4C8QD 1JO8A 1AD5A 1WX6A 4JRQA 2D8JA 2DE0X 2CZ6B 2ESWA 1IO6A 1RLQC 2K2MA 2DRMA 2F1LA 5CKFA 1GBRA 4AFSC 1WQWA 2C0OA 2CZ0B 5KE3A 2JM8A 2QQ9A 2R5MA 1VQ6A 4C92F 1Q86R 1I5LA 1W4SA 1BCOA 3TSZA 3UA7A 3UT1A 1IHVA 3V7CA 2QQSA 3PMTA 2CS7A 2EIFA 1WHKA 2ZCFB 1Y57A 2H3JA 2IIMA 2QASA 5GANj 1QVFP 2M9UA 1KQ1A 4N0AC 4RCCA 1VQPT 1KQ2A 4ANJA 2DTOA 2EKHA 4E47A 4M7AG 5GAOq 3BFMA 2AK5A 3PNWC 2FPEA 1XOVA 1JU5C 1WGSA 2K3XA 3NTHA 1O9SA 1G3YA 1W2BP 3RKYA 1N8RU 4L6V5 1Y71A 1C0MA 5CO7A 2XDBA 1R77A 4M7DF 1PKTA 2YWWA 1I07A 5GAN2 2JTMA 1C6VX 2XU8A 2GBQA 2ZAEA 4PNOA 3EG0A 1ZSZC 2KT1A 4KT0E 3SEMA 4LNPA 3RMQA 2RHIA 2L0AA 2HSEB 3NTKA 5D6XA 2FZCB 2LQ8A 1N27A 3G71Q 3L42A 2P4TA 2HCKA 2LVMA 5LJ3j 3TCJA 2DK3A 4B6MA 1HK9A 3F70A 1YCSB 2COYA 3HPWA 3TEEA 4R55A 1Y0MA 1QVGA 3CC2A 1JXOA 1M4ZA 4LD9K 1N6AA 4M7AC 3M0QA 3M57A 3I5SA 4AFQC 2WSEE 4M78D 2HQXA 1VIEA 3VJPA 3CCQA 3CCST 1VQKT 1OULA 1BU1A 2CH4A 3PIOA 2DYBA 3RKXA 1LJOA 2HSPA 1VQLT 2O2OA 4C8QC 1ACMB 2C0IA 4QVDA 2X4XA 1P92A 1GBQA 3QJ6A 4HT9A 1KHIA 3QDRB 4XU0A 4PJOF 2F2WA 1KQSS 3QZ9B 1GCQC 2CZ7B 1I81A 2EQMA 3CBMA 3OYHA 1B3QA 4J6WA 1YFNA 3QWYA 2RK2A 5KE2A 4OMPA 3RIRA 3I55A 2DXTA 4A4KA 4DA4A 3EHRA 2LT1A 2BE7D 2M1HA 4EDUA 4LDUA 3M53A 3BY7A 5FLXE 1WHJA 5EC7A 4C92D 4OMNA 4M4ZA 3CXCS 1VQMQ 1YITA 4M75E 2X3WD 4J8OA 2DO3A 3E9FA 5A0DA 4BB7A 3QUIA 2DNUA 2DTHA 3HFNA 1M3BA 2JS0A 4O6JA 1YHQQ 2W10A 2LQNA 2ZPGB 4FW2A 4YTLA 4ELZC 2BZXA 2PTKA 4XTUA 4Z02A 4J9FA 1PSFA 2XIDA 2M51A 2LMJA 2V1RA 5FRNA 2MK5A 2DJZA 1TUCA 3BE3A 1T0JA 1RUWA 4N4GA 3D7SB 3HTRA 1K9AA 4JPBW 4M77A 1CKBA 3NMZC 2FL7A 2KI7A 2CT3A 3PGGA 2B86A 2DD4A 3SHWA 2CP3A 4DEXA 5KCHA 3L2UA 2KXCA 4XTVA 1VQ9A 3LH5A 2YRVA 5GANf 2O9VA 3OS0A 2JN0A 1ZLMA 2VB6A 3MJXA 4KULA 1GXIE 5KYUA 4M78C 1PCXA 4BI4A 1Q7YU 3EFRA 2LX9A 2JT4A 1XNIA 4E7ZA 4EMKA 1K0SA 1ZBJA 4J6YA 4PJNA 2FPDA 4RKUE 3JCMf 3MP6A 2O01E 3CCEA 3BDUA 1NG2A 4F7UF 2CP5A 1VQ5T 4A4EA 1R8OB 3L2QA 1ZUYA 3QDFA 2VGMA 2KSSA 4EIKA 1VQ8Q 3EGXA 2RI3A 1YJWQ 5IHKA 2QEXT 2VYTA 5KYXA 3M0UA 4RTVA 1WI7A 3QYHB 3M4GA 1JEGA 1Y07A 1NZ9A 1K9MU 1Q81R 2ROLA 3RERA 2OTLQ 4X9CA 2V8KA 3A98A 4ESRA 8AT1B 1MV0B 3SD4A 2L5QA 2A36A 3M5AA 4XTXA 1VQ6T 3H41A 2QXFA 3FIFA 2DTIA 4C92C 3C12A 2E41A 2E6ZA 5GAMf 1K76A 2LDMA 3ZEHA 1NJIR 1BCMA 3FC3A 1I1JA 1X2QA 2X35A 1OI1A 2W0ZA 1RAEB 2K5IA 4DBQA 3H8ZA 1XJWB 1BB9A 4X9DA 1CKAA 3PE0A 2E65A 2GTJA 4N4HA 3L2ZA 9ATCB 1G5VA 5HCKA 3QBYA 3JB9F 1MUZA 1G3WA 1LVKA 4C0FA 3JCMe 1TTHB 2K9GA 1QKWA 3A5ZB 3PIPA 4M7DA 3EFOB 3CD6T 3OYLA 4QQDA 1G8XA 3CPFA 1XTDA 5IXFA 2PNIA 2CKKA 3KXTA 2EQIA 2A37A 2DJQA 5GAMd 3PTAA 4Q5WA 3V8LA 2YRCA 4M7AF 2CSQA 2YT6A 3IQLA 1VQ4Q 3G6EA 2K6DA 4FW1A 4QQ6A 1NE8A 3SFMA 2JVVA 2KGTA 3GLXA 1WQ7A 2DLPA 2DXUA 1C1AA 2JXBA 4HVUA 4JRPA 1K73R 2D1XA 4HKEA 2YLCA 2GF7A 4GLKA 3MKDA 2FRWA 2KAFA 3UPUA 3TU4K 4C8QF 2P84A 3EAEA 3WVDB 5KYYB 3CC2T 2AZSA 4O5VA 2OI3A 3KUFA 5GAMe 1UTIA 4HA8A 4M75G 3E19A 3PFSA 5CKEA 3ZBDA 4BD3A 1YN8A 4BY6C 2P4RA 1TU0B 4CC2A 5I2SA 2DVEA 3CCUQ 3CCQT 2RNAA 2HAXA 1OOTA 4HXJA 5L8RE 2FZGB 1V29B 3CBOA 4JUVA 5FU6C 2H8HA 3OYYA 4HCCA 3ER0A 3QYGB 4JS5A 2DD5A 3GP8A 4GLMA 5GANg 4ME7A 1SHGA 5IHIA 2O88A 4PJOA 2A0FB 2AZVA 4OMOA 4OMQA 1PD1A 1WJSA 5L23A 3BDLA 2KRNA 1RI0A 1W70A 4JZ3A 5LJ5f 3X28B 1D1CA 1RACB 2EYQA 3KBGA 3A8MB 4JDSA 2O4XB 3URGA 1MMGA 5GAOl 5J26A 2COWA 1SEMA 2EGCA 2ECZA 3E1SA 4A53A 4HCBA 4JJCA 1ZUKA 1AZEA 2KDSA 5GAOr 1QCFA 2MF2A 3R6NA 4M75C 2YUOA 1YITT 2LCCA 2HD0A 3G71A 3LGLA 2JMCA 2AIRB 2FG0A 5DLQE 1UG1A 2J7IA 3QG1A 1PM3A 1AVZC 4FT4A 4IUQA 3QXEB 3OS2A 3PT9A 2K4YA 5LJ3g 4M77B 1H641 3H9NA 3JB9H 4RCBA 5LJ5d 4D8KA 1PSEA 1M3CA 2RJEA 4Z89A 4EPCA 4VUBA 1G3TA 1QVGS 3OYDA 1YI2Q 3OY9A 2DBKA 3VV0A 4CC7A 1KQSP 5GAN7 4M78B 5DM7R 4OMFB 1IXDA 2PVDB 2FEIA 2GNCA 2OX7A 4M78F 4BE0A 4KGVB 5KYUB 2R5AA 4N4IA 1WPYA 3UWNA 2PVGB 1VQNT 4M77E 1RAIB 3ZL7C 5LJ5e 3CXCP 2MOXA 4J9GA 1OX9A 2A08A 1RAFB 3WXMB 5CKDA 3GIBA 3VS5A 1V76A 4DOWA 2EPDA 4X1VA 4C5GA 1IGQA 2BKDN 1UE9A 2HBWA 3SWNC 1B34A 5A0LA 4F14A 5GAOn 1SRMA 4F7UA 2RJFA 1AWWA 2D0QB 2J6KA 3CCET 2NUPB 1VQMA 4F04B 4AG1C 3TQ7P 1G3SA 4C92B 2EQKA 2KNBB 1IREB 1UJ0A 1X43A 5FRMA 1YIJQ 4NOYA 2YUPA 3HL8A 2DERA 2QG9B 1YHQA 4MZMA 2I0NA 1YBYA 4A4GA 1A0NB 2G3RA 2LQWA 3OYJA 4JRIA 1FYNA 3CCSQ 3VS4A 4J9DA 3G7ZA 4RTTA 5GMKm 2X9HA 2DIQA 3CC4Q 1I4K1 4FYWB 1NJIC 2E10A 4NL3A 4OB3B 2RO0A 5FWBA 3L2VA 3JCMV 2EJ9A 3SB2A 3M54A 2DM1A 1WA7A 4NL2A 4OMMA 1ZBXA 4PJMA 1BI3A 3C94A 3E2UA 3HSBA 1UGVA 2YXYA 3CCJT 3M0RA 3ULRB 4IUVA 1OX8A 4LXCA 2PUKB 4Y91A 4AFZC 3OS1A 2DETA 4XK8E 2LNVA 1WXUA 4M7DB 2NUTA 1TS9A 1PD0A 4Y28E 1M8VA 1Y96B 1ARKA 2LTOA 4IKFA 3M55A 2ABLA 1M90R 3FLGA 4ZGJB 4LDYA 5CIUA 1QWFA 1RLPC 4PJJA 3CCVQ 3I56Q 1KFZA 1RABB 3EFOA 3GOXA 5GAOp 1IZ6A 1N9RA 4M7DE 2RI5A 3LW5E 1WHLA 4JLIA 5GJVB 4OB0B 2CREA 4C0DC 2HKNA 5GANh 3ZFJA 2VGNA 4JZ4A 2EYXA 1VQ8A 1YJWA 1BI2A 4CC3A 2HQHA 5GAMj 2GCXA 2RB6A 2VC8A 2MI6A 2E6NA 1IHWA 2OTLA 3G4SA 2B8AA 1M8MA 2JTFA 4IUPA 5GMKe 4FSSA 4C8QA 5CQXA 1N5ZA 2E4HA 1WJQA 1F1BB 4FYVB 1SRLA 3M58A 1WHHA 5CCAA 1SSFA 2RHYA 3U23A 1H3HA 4OGCA 5FU7C 2NUZA 1NEBA 5KYYA 4A63B 5IH2A 4IIMA 4PJOB 4C5EA 2VXFA 2Y90A 1MMDA 4WF2A 3CCLQ 3I5RA 4PJLA 1G83A 3JSCA 1UDLA 4PL6A 1K9MR 2CP2A 1D0XA 3H0FA 4IUTA 3LX7A 3H0IA 4XTWA 5LJ3h 1MV3A 3CCRQ 2GFUA 2GFAA 1VOMA 3CMEA 2O9SA 2MYSA 3QWXX 2LQKA 4RMOA 1PRLC 4PJOE 4M75F 5HKCA 1UGPB 4A54A 2HBPA 1VQ5Q 1KC8U 2LJ1A 1SKUB 2FYKA 1RAAB 2HL3A 4AMCA 2OTJT 3VRYA 1PKSA 3RESA 1NEGA 2VV5A 5DLOA 2O4XA 2HNIA 4M77G 1NYFA 1GRIA 1D3BB 1AWJA 5CK9A 5HK0A 1VQ4A 1AZGB 3LYIA 2AT1B 1AOJA 2F2VA 1PRMC 1TUDA 2A3LA 2E1HA 3P8BB 4MMKA 3CPWS 1O75A 2KXDA 4AT1B 3MEAA 3G71T 1K8AU 4MMLA 4XU1A 2DL7A 3CC7A 3TVTA 1MGQA 4ZTFA 1FX7A 1UGQB 2XD0A 2XKOC 1YNZA 4ZGDB 2E12A 1EX4A 2RJDA 1E6HA 3VUZA 4XQ3A 4EMGA 1M3AA 3CCMQ 2E3HA 5A0GA 4E7LA 1VQOA 3O8VA 5LJ5j 5I21A 4HVVA 1YJ9A 5KYNA 4GY5A 1S72A 4D8DA 1NPRA 4OP0A 3OW2A 4E7JA 4M78A 1Q82C 4OMLA 3SWNB 2QGFB 4RTUA 1OYXA 1OV3A 3DLLA 4FYYB 3H0HA 1PWTA 3S6WA 1JQQA 3META 2QTVA 1NLPC 2AKLA 3CD6Q 1B34B 3OSSC 4F7UB 4JS4A 2QA4Q 2GTOA 5DY9A 2MIOA 1VIFA 5D7UA 4KBMB 4RTXA 1WHMA 2L2PA 2F5TX 1LOJA 2LCLA 1IB8A 2R58A 1Q86C 1JRIA 3ASKA 4D6WA 4QW2A 3JCMc 2YRDA 5IXBA 4B9XA 2J05A 2ZGWA 2DA9A 4RTZA 1X2KA 2QQRA 5CQYA 2LRQA 1QVGP 2NUPA 2LT4A 4F7UE 2X4JA 2FZKB 2DBMA 4FU6A 1JB0E 4C92A 4R0KA 2HKQB 2LZ6B 2V8IA 2PQWA 1MNEA 1YHQT 2DEUA 2K5FA 1YJNA 3S3MA 3M0TA 1RADB 5GAN5 4HCKA 1BK2A 1IGUA 3GNGA 3CCQQ 4M7DG 2NUTB 3V8KA 1YI2A 5D6YA 1PHTA 2P0KA 3OMGA 1ZSZB 5AT1B 5I2MA 4M75D 5AYFA 4OB1B 1YCYA 1M1KU 1VYVA 2XI9A 1M90C 2E3IA 1QKXA 2HZYA 2MWPA 1EFNA 1W6XA 2K79A 2DL4A 1PNJA 4OGEA 3VS1A 2E5KA 2NYSA 1JXMA 3JCMJ 2E64A 3H6ZA 1TOVA 3OYEA 2A28A 1Y96A 5CKHA 2D8HA 4LUDA 2PVOB 2Y4YA 2ZPEB 3NFCA 4M7AB 3M4YA 5IN1A 4Z8AA 2EBPA 1MMNA 2X3XD 2K3YA 1U06A 2KRMA 2K3BA 5A2QE 2NWMA 5KH6A 3CPWA 3QPHA 3X25B 4BDYA 1VQ7Q 5LJ3d 3VU3C 3FJ5A 2RHZA 1YITQ 4L5GA 4DQ2A 3MHXA 1BYMA 2EQUA 2Y4XA 3EH2A 3M59A 5GMKj 4LDXA 3PVQA 1HSQA 4C8QB 3CMAQ 4OF1A 2EWNA 1YIJA 3V8JA 3V7RA 1AWOA 3MEVA 2EGEA 3OYFA 1YJWT 3I35A 1OU8A 2O31A 4PJOG 4J7IA 2LCSA 1RI9A 4MZTA 4FL6A 2EYZA 3CCSA 1M2VA 3G1JA 3CC4A 3G4ST 2JTEA 4E6RA 1JJ2S 1J3TA 2VWFA 4BACA 3C95A 4FIBA 2M16A 2X51A 1T3SA 4C8QE 1RAGB 1VQNQ 4ZGEB 4BI3A 2MAMA 4OVAA 1KD1U 2DX1A 2M02A 5CAIA 5IAYA 1ZA1B 5CR2A 1H8KA 2KQWA 1KSWA 2BTTA 1LPLA 3JRZA 1WYXA 4E7SA 1QWEA 1YWPA 3VYGA 3RKWA 1QCNA 1UUEA 3JCMg 4XAXB 1W2BA 3VUBA 3GPLA 2LJ0A 1W1FA 2HEQA 1WDXA 3X24B 1MMAA 4IIOA 5GAOm 3CMET 4WTOB 2EAYA 1JBMA 3I55T 1TXQA 3QHSA 3AT1B 3CCVA 2KYMA 3I56A 3CCEQ 1KG1A 2XMFA 1GFCA 1TG0A 2KEAA 2RQRA 1H92A 1RAHB 1QP2A 2L3PA 4LD6A 3WVEB 2COZA 2M0YA 3MO8A 4J7FA 1N8RR 4JJBA 2G6FX 3JAME 1AWXA 3L2RA 2NLUA 1D3BA 1X27A 1VQ4T 2BIVA 2HL5C 2VUBA 3EGDA 4PFOA 2RF0A 3LH0A 2ZZDA 2EKOA 2BE9B 5GAMg 1KJWA 4Y92A 1VQPQ 4IURA 1ZHIA 2EGAA 3M0PA 4UC4A 3THKA 3OYBA 3CC7T 3NPFA 3CCJQ 2OJ2A 4XU2A 1VYUA 2VKNA 1NLOC 2EYWA 2JZ2A 1BIAA 2ED1A 3PMIA 3JCMX 4F7UG 2Z0WA 2AKKA 4CRIA 1VQOT 3CCLA 1BIBA 1RL2A 1YJ9T 1ZQ1A 1S72T 1VQ9T 2VASA 2DF6A 2OAWA 4QT7A 3MP8A 3SWNA 2D9TA 4M78E 3CCRA 3J7AF 3N5BB 2DILA 3RR6A 1HYOA 2D6FA 1K1ZA 1QQJA 2CT4A 5HY6A 2EQJA 3HRSA 1Q81C 2J6FA 5IHNA 1KK7A 5J39A 3Q1JA 4J9BA 3VS0A 3JV3A 4QKUA 5GAN4 4J6XA 4V2SA 1SPKA 5GAN8 1VQ5A 1K0XA 3CPWP 2FVUA 2E5QA 2JOYA 3O5ZA 2KYBA 2L89A 3VKIA 1JJ2A 2RHUA 2P0PA 2C0TA 1Q95G 4KGXB 3MPUB 1TUGB 2DRKA 3OQ5A 4N0AA 1VQKQ 1E6GA 2XDDA 1M27C 1NPPA 1SF9A 3RNJA 1U1SA 1FMKA 2ROTA 4DEYA 1OPLA 2MWOA 1M1FA 1KIKA 1VQLQ 1D0YA 3VRZA 3OMCA 2RMOA 3JB9G 2OAUA 1ABOA 4C92E 3RBBB 1KC8R 5CVIA 2A7YA 1YJNT 5CKBA 2DL5A 4ATOA 2ZPFB 5GMKl 2K2VA 3TREA 4RTYA 3OA6A 2YHTA 3CCMA 2V8JA 2YLBA 2CUDA 2KVQG 4RG8A 4R56A 2RJCA 3SDZA 2RN8A 1YI2T 1D1BA 3UF4A 2L3QA 2H3EB 1UFFA 5LJ5g 1ZSZA 1B07A 2DIGA 1K8AR 3MCAB 4DBRA 3OW2S 3EG9B 2SRCA 5FWCA 3CD6A 4PLIA 4DBFA 2DZCA 2QA4A 4DOVA 2OTJQ 2HMAA 1K73C 2BZ8A 2DKGA 4C8QG 4QVZA 1E7OA 4M7AA 3A8OB 2QTXA 2F69A 2P0QA 4BY6B 2FRYA 3REAB 1MNDA 2JJ9A 3G6ET 5FU6B 3HHTB 3QJYA 1M2VB 2RHXA 1UGSB 1QW1A 1OU9A 2RK1A 3DB3A 2RA2A 4ZN3A 4M77D 3JCMh 3OYAA 5LL6S 1Q7YR 2CP6A 1NBEB 2KK4A 2DMOA 4PKCC 2QDYB 3OYMA 1AEYA 2DZ9A 1YIJT 3DLMA 4LE9A 1K4US 4XTZA 1Q82U 3HRTA 4PFPA 1GCQA 1LCKA 2CGHA 2BUDA 3M0SA 3J81E 3CC4T 3JCMP 4J5YA 2ZPHB 5D6WA 4BE2A 4JLGA 4XU3A 2CSIA 3JCMQ 3EHQA 4C5IA 5GMKi 4F16A 2EJGA 2CYZB 2KBTA 3INZA 2DAQA 3NGPA 4HCZA 2GQVA 1WJRA 3LLRA 4M75B 3A8GB 4C5HA 2J6OA 1UHFA 1EIFA 1ZA2B 1M30A 3X26B 2PUOB 4MZPA 3EFSA 4E7IA 1FMWA 5GAMh 2L3RA 3HRUA 1UEBA 1Q86U 5EG2A 1WNLA 2WSCE 5IT9E 1OEBA 4ZNXA 3FB9A 2QEXQ 1N8RC 2QQAA 4K11A 2KE9A 3L1AA 1IRXA 2CUBA 2DPPB 2FPFA 1VQ7A 2SEMA 3CCVT 2I2LA 4P5NA 4KUIA 3I56T 1M1KR 3EGDB 2ZPIB 1M5Q1 2LJ3A 2QQBA 5KYWB 2RQTA 2LNHB 4A4HA 1JJ2P 1YWOA 4JRKA 4M78G 3CMAA 2KT8A 1X6GA 3OSVA 2ED0A 1VQ6Q 1QMCA 2X4YA 4ZTJA 1HXDA 3EG1A 3JCMW 2RH2A 5ECAA 2EJFA 3OYGA 3OBYA 2L8DA 4J9EA 1GL5A 3LGFA 5J3BA 3T9NA 2VXEA 2DL3A 1M90U 1UECA 1ABQA 4OB2B 3LWIA 3CCUA 4E7HA 5FROA 2EFIA 1QP3A 5GAN3 4CI0C 2X4WA 1NM7A 1BKBA 2HQEA 1FWZA 1UHCA 4M7DD 3VYHB 3GNFB 1VQNA 4FYXB 1R0CB 2RQUA 3UATA 3CQTA 2ATCB 4M77C 3HKSA 1UGRB 3CCLT 3CBPA 3QO3A 1QVFS 2CP0A 1QVPA 4II1A 4J83A 4J9CA 4X34A 3RMSA 1OZ3A 1NYGA 4C92G 2HDAA 2EW3A 4KGZB 3S3OA 4LDVA 4J9HA 1G2BA 5C0MA 3M9QA 3CCRT 4EMHA 2GGRA 2QK0A 2MMPA 2R57A 4TVRA 1Z9QA 4QQGA 2DXCA 3FEOA 1W2BS 3EG2A 3EG3A 4KH1B 4C0GA 4PFZA 1KD1R 1R0BG 3DB4A 4EMKC 1VQMT 1X69A 5LJ5h 1EZZB 3UA6A 3FDRA 4FT2A 4WCIA 2XG8D 1B7TA 3CC2Q 1KC8C 1BI0A 1AT1B 1PG5B 4BUGA 1U5SA 5GANd 4AG2C 2ENMA 6AT1B 1T3LA 3G4SQ 2DEQA 5FW9A 4LN2A 3C0CA 4GBQA 2D0NA 1VQPA 2FB7A 2JW4A 5LJ3f 1WXTA 1T0HA 4IUUA 3TSWA 3R6OA 1AHJB 4PJOD 1U3OA 2CDTA 2XK0A 3E9GA 5GAN6 2C06A 3OYIA 3JCMd 2XDPA 3CCJA 3KFVA 1HD3A 1K8AC 2J06A 1KQSA 3NHNA 2KR3A 1KHCA 2EVRA 1VYTA 3CCMT 4J9IA 4PLLA 1GCPA 4PK4A 3OYNA 1WIEA 3C4SA 1SSHA 1D1AA 4C0DB 5I22A 2LP5A 1LNXA 5GANe 3HFOA 1QCOA 4HVWA 1X01A 4RTWA 5GJWB 2DVJA
chains in the Genus database with same CATH topology
1X6OA 4XTUA 4Z02A 1PSFA 2BIVA 1OZ2A 2LTOA 2XIDA 2VUBA 2ZPBB 3L2WA 4IKFA 3M55A 2F5KA 3LH0A 2ZZDA 3CXCA 2EKOA 3FLGA 1DJ7B 4LDWA 5GAMg 4ZGJB 2CZ1B 5FRNA 4LDYA 4IURA 1ZHIA 5CIUA 2DJZA 4UC4A 3OYBA 1H3ZA 3CC7T 2RM4A 4N4GA 3OS5A 4XU2A 4M77A 2QA4T 3GOXA 5GAOp 1IZ6A 1N9RA 4NS5A 2JZ2A 4M7DE 2RI5A 1Q7YC 3LW5E 4JLIA 1BIAA 2FL7A 5FU7B 4OB0B 2LC4A 4C0DC 3PMIA 3JCMX 3PGGA 5GANh 3ZFJA 4M7DC 2VGNA 4F7UG 2DD4A 4CRIA 1VQOT 1VQ8A 4C0ZA 3CCLA 3V7SA 5KCHA 3L2UA 1BIBA 1BI2A 1RL2A 1YJWA 4XTVA 1VQ8T 1YJ9T 3LWHA 1VQ9A 4M7AE 1ZQ1A 3FRNA 2YRVA 5GANf 1S72T 5GAMj 1VQ9T 4KUDK 2GCXA 2RB6A 2VC8A 3OS0A 2JN0A 2MI6A 2E6NA 2OTLA 3MP8A 4KULA 3G4SA 2B8AA 3SWNA 1GXIE 5KCOA 2OTLT 3QSUA 2D9TA 4M78E 3QIIA 2JTFA 3N5BB 4IUPA 3CCRA 1VQKA 3J7AF 5LJ3e 4M78C 5GMKe 2D6FA 4BI4A 1Q7YU 3EFRA 4C8QA 5CQXA 2LX9A 3MP1A 1M1GA 1K9MC 1XNIA 1WJQA 2EQJA 3HRSA 5HY6A 4EMKA 1Q81C 1VQLA 4J6YA 3JCMf 2XICA 3Q1JA 4RKUE 5J39A 4XTYA 3MP6A 3M58A 2O01E 3P8HA 5CCAA 1SSFA 2RHYA 3CCEA 5GAN4 3BDUA 4J6XA 4OGCA 5FU7C 5GAN8 3J80E 4V2SA 1BI1A 1VQ5A 1QVFA 2DXBA 4F7UF 4PJOB 2FVUA 1U1TA 1VQ5T 3P8DA 1R8OB 2E5QA 2VXFA 2Y90A 4A4EA 4C5EA 3L2QA 2JOYA 4WF2A 2K57A 3OYCA 2VGMA 2KSSA 1Y7XA 2WSFE 3QZ5B 2RI3A 2QEXT 2VYTA 4ZN1A 3HP9A 3QYHB 2L89A 3JSCA 3M4GA 4PL6A 3VKIA 1JJ2A 2KMTA 1Y07A 1NZ9A 2RHUA 1K9MU 4JJNK 4IUTA 3LX7A 3RERA 3CEYA 2P0PA 1Q81U 2AHJB 4X9CA 2V8KA 4XTWA 5LJ3h 1M9SA 5GMKh 3OQ5A 4N0AA 3JB9I 2JNGA 2GFUA 2GFAA 3FJPA 3CMEA 2XDDA 1NPPA 1U1SA 4HCCA 3SD4A 2L5QA 2MWOA 4A4FA 2LQKA 4M75A 4RMOA 1M1FA 3M5AA 4E7KA 1FXXA 1M1KC 4XTXA 3OMCA 4PJOE 4M75F 1VQ6T 5HKCA 3JB9G 2OAUA 1UGPB 4FM4B 2HBPA 4A54A 4C92E 3X20B 3JB9J 4PJOC 5CVIA 2QXFA 2A7YA 3FIFA 2DTIA 5CKBA 4C92C 1YJNT 2FYKA 1KC8U 4ATOA 2ZPFB 3C12A 3ME9A 2OTJA 5GMKl 4MDXA 2E41A 2K2VA 3TREA 2OTJT 2E6ZA 5GAMf 3OA6A 2YHTA 3NTIA 2PU9B 2VV5A 3RESA 2LDMA 3CCMA 2KY9A 3ZEHA 5DLOA 2O4XA 2V8JA 2YLBA 3BW1A 2HNIA 2KVQG 3M56A 4M77G 4RG8A 4BI8B 3RUXA 1NJIU 3FC3A 4R56A 2X35A 1OI1A 2RJCA 3SDZA 3AHUA 1D3BB 1YI2T 4HT8A 3MEUA 5CK9A 2RI2A 5HK0A 1VQ4A 2K5IA 3H8ZA 3LYIA 1VQ7T 4X9DA 5LJ5g 2RD1A 2E65A 4FSXA 3QKJA 1D3BA 2K5LA 2A3LA 2E1HA 4N4HA 3L2ZA 2DIGA 3P8BB 4MMKA 3CPWS 1O75A 3MCAB 3MEAA 3G71T 1K8AU 3OW2S 1G5VA 4MMLA 1UB4A 3QBYA 4XU1A 3JB9F 3CMAT 1G3WA 4C0FA 2FHDA 3JCMe 3CC7A 3OYKA 1MGQA 3A5ZB 1N9SA 1FX7A 4PLIA 1UGQB 3PIPA 4ZTFA 2XKOC 2XD0A 4M7DA 2DZCA 3CD6T 2QA4A 4ZGDB 3OYLA 4QQDA 4DOVA 1I8FA 2E12A 1K73C 2RJDA 2DKGA 5C6SA 3JCMb 3VUZA 4C8QG 4QVZA 4XQ3A 3CPFA 1XTDA 4EMGA 1XQHA 4M77F 1U8RA 1X75C 2CKKA 3KXTA 4M7AA 5A0GA 1MHNA 4B9WA 5GAMd 3PTAA 4E7LA 3O8VA 1VQOA 4ELYC 5LJ5j 3A8OB 2QTXA 4Q5WA 2F69A 3V8LA 5I21A 2P0QA 2XHCA 4M7AF 4BY6B 1YJ9A 2JUFA 4GY5A 3CCUT 1S72A 3JB9D 3G6EA 4L59A 1NPRA 4OP0A 1VUBA 4QQ6A 3OW2A 4E7JA 1NE8A 3SFMA 2JVVA 4M78A 3G6ET 1Q82C 5FU6B 3GLXA 1WQ7A 3HHTB 3QJYA 2RHXA 3SWNB 2DXUA 1UGSB 4JRPA 1OYXA 1QW1A 3GF5A 5M9OA 3DLLA 2RK1A 3DB3A 4HKEA 1K73U 2IVWA 2YLCA 2RA2A 3S6WA 4M77D 2E70A 3JCMh 4ZN3A 3OYAA 5LL6S 2GF7A 4GLKA 3META 4BDZA 3A8HB 4EMKB 2HAXA 2KK4A 4PKCC 1B34B 2QDYB 2KAFA 3OYMA 3OSSC 4M7AD 3UPUA 2QI2A 2DZ9A 4F7UB 4C8QF 4JS4A 3OBWA 3TU4K 1YIJT 3DLMA 3EAEA 3WVDB 3CC2T 5DY9A 4O5VA 1KD1C 1VIFA 3KUFA 5GAMe 4HA8A 4XTZA 4M75G 3E19A 3OB9A 4KBMB 3PFSA 3DKMA 3HRTA 3MEWA 5CKEA 3ZBDA 4BD3A 1Q82U 4BY6C 5I2SA 2F5TX 1LOJA 3UDCA 2CGHA 2DVEA 2QEXA 4RG2A 2BUDA 2LCLA 3J81E 3CC4T 3CCQT 3JCMP 2IG0A 2R58A 4J5YA 1JRIA 4QVCA 2ZPHB 5HK3A 5L8RE 3S3NA 1Q86C 4MDWA 1V29B 3ASKA 3CBOA 4JUVA 5FU6C 2WACA 3OYYA 5D6WA 3A8LB 4QW2A 3JCMc 4D6WA 3OS2A 3ER0A 4JLGA 4BE1A 3QYGB 4JS5A 2M0OA 4BE2A 4XU3A 2DD5A 1TH7A 4C8QD 3JCMQ 3GP8A 4C5IA 5GMKi 4B9XA 2ZGWA 5GANg 4ME7A 4JRQA 2EJGA 2CYZB 3INZA 2CZ6B 2DAQA 2QQRA 5CQYA 2LRQA 4HCZA 2GQVA 5CKFA 2LT4A 1WJRA 4F7UE 3LLRA 2X4JA 4PJOA 1WQWA 4M75B 3A8GB 4FU6A 2CZ0B 4C5HA 1JB0E 4C92A 5KE3A 1EIFA 2V8IA 3X26B 1WJSA 2PUOB 2PQWA 2QQ9A 4MZPA 3BDLA 2R5MA 3EFSA 4E7IA 1VQ6A 4C92F 1RI0A 5GAMh 1YHQT 2L3RA 3HRUA 1UEBA 5LJ5f 1I5LA 1W4SA 3X28B 2K5FA 1Q86U 1YJNA 5EG2A 3UT1A 3S3MA 3V7CA 2QQSA 1WNLA 2EYQA 5GAN5 2WSCE 5IT9E 3PMTA 3KBGA 2CS7A 3A8MB 3GNGA 4JDSA 2O4XB 2EIFA 2ZCFB 3URGA 4M7DG 3FB9A 1N8RC 2H3JA 5GAOl 5J26A 2QQAA 5GANj 3L1AA 3V8KA 2M9UA 5D6YA 1YI2A 1KQ1A 4N0AC 4RCCA 1VQPT 1KQ2A 2DPPB 2P0KA 2DTOA 1VQ7A 4E47A 3OMGA 3E1SA 4M7AG 5GAOq 4A53A 3BFMA 4HCBA 5I2MA 2I2LA 4P5NA 4KUIA 4M75D 3I56T 5AYFA 3CCVT 4OB1B 1YCYA 1M5Q1 2ZPIB 1M1KU 2KDSA 2XI9A 5GAOr 2MF2A 2QQBA 1M90C 4M75C 1YITT 2LCCA 2HD0A 2MWPA 3PNWC 4A4HA 3G71A 3LGLA 1XOVA 2K3XA 1WGSA 5DLQE 4JRKA 3NTHA 4M78G 1O9SA 1G3YA 3QG1A 3CMAA 3OSVA 4OGEA 4FT4A 2X4YA 3RKYA 3JCMJ 4IUQA 1N8RU 3QXEB 2E64A 1HXDA 3PT9A 3H6ZA 2RH2A 4L6V5 2K4YA 1Y71A 2EJFA 5LJ3g 3JCMW 4M77B 3OYGA 1H641 3OYEA 5CO7A 3JB9H 3OBYA 2XDBA 4RCBA 5LJ5d 4M7DF 1Y96A 5CKHA 2L8DA 2PVOB 2Y4YA 2ZPEB 3NFCA 1PSEA 4M7AB 2RJEA 3M4YA 5IN1A 5GAN2 3LGFA 5J3BA 3T9NA 2JTMA 4EPCA 2VXEA 4VUBA 1G3TA 2K3YA 2XU8A 1M90U 1QVGS 3OYDA 5A2QE 3OY9A 4OB2B 4PNOA 3LWIA 3CCUA 3VV0A 5KH6A 5GAN7 3CPWA 3QPHA 4KT0E 4M78B 3X25B 4BDYA 5LJ3d 4E7HA 5FROA 2EFIA 1QP3A 2RHIA 4OMFB 3RMQA 3VU3C 5DM7R 5GAN3 2RHZA 4L5GA 2X4WA 4CI0C 1BKBA 2HQEA 2PVDB 4DQ2A 3MHXA 1BYMA 1FWZA 3NTKA 5D6XA 4M78F 2LQ8A 2EQUA 4BE0A 1N27A 2Y4XA 3VYHB 4M7DD 3L42A 2P4TA 2LVMA 3GNFB 5LJ3j 3M59A 1VQNA 5GMKj 3TCJA 4LDXA 2DK3A 2R5AA 4N4IA 4C8QB 1WPYA 3UWNA 2PVGB 1VQNT 4M77E 4OF1A 1HK9A 2EWNA 4M77C 3F70A 3HKSA 1YIJA 3V8JA 3V7RA 5LJ5e 3HPWA 3TEEA 1UGRB 3CCLT 3MEVA 3OYFA 3CBPA 3QO3A 4R55A 1QVFS 1QVGA 1YJWT 3CC2A 1M4ZA 4LD9K 1N6AA 4M7AC 1QVPA 4II1A 4J83A 4PJOG 4J7IA 4X34A 3RMSA 1OZ3A 4MZTA 4C92G 3M57A 4FL6A 2WSEE 3CCSA 3S3OA 4LDVA 4M78D 3WXMB 2HQXA 1VIEA 3VJPA 3G4ST 3CCQA 3CCST 5C0MA 3CC4A 5CKDA 3M9QA 3CCRT 1VQKT 1JJ2S 3GIBA 4EMHA 4BACA 2MMPA 2R57A 4C5GA 4DOWA 4TVRA 2BKDN 4QQGA 3C95A 3PIOA 2DXCA 3FEOA 4FIBA 1B34A 3RKXA 3SWNC 5A0LA 4ZTJA 5GAOn 1W2BS 1LJOA 2M16A 1VQLT 4F7UA 2RJFA 4C8QE 4C0GA 2D0QB 3CCET 4C8QC 1VQMA 4QVDA 2X4XA 1P92A 4ZGEB 4BI3A 2MAMA 3DB4A 4EMKC 1VQMT 4OVAA 3QJ6A 1KD1U 1G3SA 4C92B 5CAIA 5IAYA 2EQKA 5LJ5h 4HT9A 5CR2A 1KHIA 3QDRB 1IREB 2KQWA 5FRMA 3FDRA 4FT2A 4NOYA 3HL8A 2XG8D 3JRZA 4XU0A 4PJOF 1YHQA 4MZMA 1KC8C 1BI0A 1YBYA 3VYGA 1KQSS 3RKWA 4A4GA 2G3RA 3QZ9B 2CZ7B 4JRIA 4BUGA 3OYJA 1I81A 3JCMg 5GANd 4XAXB 2EQMA 3CBMA 3OYHA 3G7ZA 3VUBA 1W2BA 4J6WA 3GPLA 5GMKm 2DIQA 1I4K1 2DEQA 1NJIC 2RK2A 3X24B 2E10A 5GAOm 5KE2A 4OB3B 4NL3A 3RIRA 3CMET 2RO0A 3I55A 2EAYA 1JBMA 2DXTA 4A4KA 3L2VA 3JCMV 4DA4A 1VQPA 2FB7A 2LT1A 2EJ9A 5LJ3f 3I55T 2M1HA 4IUUA 3SB2A 3M54A 4EDUA 3R6OA 3QHSA 1AHJB 4LDUA 4PJOD 3M53A 2XK0A 3BY7A 5FLXE 3I56A 3CCVA 3E9GA 4NL2A 5GAN6 4C92D 2C06A 3OYIA 1ZBXA 1KG1A 3JCMd 1BI3A 2XDPA 3C94A 3CXCS 3CCJA 4M75E 1YITA 3HSBA 1K8AC 3CCJT 4J8OA 1KQSA 2DO3A 4IUVA 2PUKB 1KHCA 3E9FA 4Y91A 4BB7A 5A0DA 3OS1A 3QUIA 2DTHA 3WVEB 1QP2A 3HFNA 4LD6A 4O6JA 4XK8E 2LNVA 3CCMT 4PLLA 3OYNA 3C4SA 3MO8A 4J7FA 4M7DB 2ZPGB 4C0DB 1LNXA 5GANe 3HFOA 4YTLA 4Y28E 3JAME 1X01A 3L2RA 1M8VA 1Y96B 4ELZC 2NLUA 3CD6A 1VQ4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FL7 A;  4FSX A;  1ZBX A;  4KUI A;  1W4S A;  4DOW A;  3PTA A;  4JJN K;  3TU4 K;  4BB7 A;  1ZHI A;  1M4Z A;  4LD9 K;  4FT4 A;  4KUD K;  3PT9 A;  2FVU A;  4DA4 A;  4KUL A;  4DOV A;  4FT2 A; 
#chains in the Genus database with same CATH topology
 1X6O A;  2KRO A;  2ZPB B;  1OPK A;  1OZ2 A;  3L2W A;  3CME Q;  1QLY A;  2F5K A;  2KRS A;  3CXC A;  4LDW A;  1DJ7 B;  3I55 Q;  2RPN A;  2CZ1 B;  3EG9 A;  1YP5 A;  3RDV A;  1H3Z A;  2RM4 A;  3OS5 A;  4LUE A;  1SHF A;  1WXB A;  2QA4 T;  4NS5 A;  1Q7Y C;  5FU7 B;  8ATC B;  4M7D C;  2LC4 A;  2CH4 W;  1D0Z A;  4C0Z A;  3V7S A;  1HJD A;  1VQ8 T;  3LWH A;  4M7A E;  3FRN A;  1ZSG A;  4ORZ A;  4KUD K;  2GQI A;  4AFU C;  2YSQ A;  5KCO A;  2OTL T;  1TWB A;  3QSU A;  1WZO A;  3QII A;  3EH1 A;  1VQK A;  5LJ3 e;  2MPX C;  1M2O A;  3VS6 A;  2BZY A;  3CC7 Q;  3MP1 A;  1M1G A;  3VS7 A;  1WHG A;  1K9M C;  2DYI A;  1VQL A;  1OQK A;  2XIC A;  4XTY A;  3P8H A;  4DBH A;  3GBQ A;  3J80 E;  2PZ1 A;  1BI1 A;  1QVF A;  1SG5 A;  2DXB A;  2F2X A;  1U1T A;  3P8D A;  3OW2 P;  1VQO Q;  4CC4 B;  5I11 A;  2VVK A;  2QGG A;  2IPO B;  2K57 A;  2L3S A;  3OYC A;  1Y7X A;  4F17 A;  2WSF E;  3QZ5 B;  1YJ9 Q;  1S72 Q;  4KRT A;  1VQ9 Q;  4ZN1 A;  3HP9 A;  3VS3 A;  2KMT A;  1S1N A;  3A1P A;  4JJN K;  2RQW A;  3CEY A;  7AT1 B;  1Q81 U;  4JJD A;  2AHJ B;  2JS2 A;  1WFW A;  1M9S A;  2QYZ A;  5GMK h;  3JB9 I;  2JNG A;  3FJP A;  2DFU A;  2LX7 A;  4A4F A;  4M75 A;  1I0C A;  4E7K A;  1FXX A;  1M1K C;  4FM4 B;  4PJO C;  3X20 B;  3JB9 J;  2OTJ A;  3ME9 A;  4MDX A;  2V26 A;  2YUN A;  1VA7 A;  3NTI A;  2PU9 B;  1FMV A;  2KY9 A;  3BW1 A;  3M56 A;  1D09 B;  1PC0 A;  4E2F B;  4BI8 B;  3RUX A;  1NJI U;  1BBZ A;  3AHU A;  2YUQ A;  4HT8 A;  2DL8 A;  3MEU A;  2RI2 A;  1VQ7 T;  1ZX6 A;  2EYY A;  2RD1 A;  4FCY A;  4FSX A;  1V1C A;  3QKJ A;  2K5L A;  1X6B A;  2V1Q A;  2JM9 A;  5KYW A;  2QAZ A;  1UB4 A;  2JMA A;  3I9Q A;  1I5O B;  3CMA T;  2RQV A;  2FHD A;  3OYK A;  1CSK A;  1N9S A;  1YJN Q;  1I8F A;  4KH0 B;  5C6S A;  3JCM b;  3PVL A;  1XQH A;  4M77 F;  4Z88 A;  1U8R A;  1X75 C;  1MHN A;  4B9W A;  4ELY C;  1UJY A;  2XHC A;  2CP7 A;  2JUF A;  3CCU T;  3JB9 D;  3VS2 A;  2YDL A;  4L59 A;  1TSF A;  1VUB A;  3EGU A;  4RUG A;  3GF5 A;  1WLP B;  5M9O A;  1K73 U;  2IVW A;  2E70 A;  1ZUU A;  4BDZ A;  3A8H B;  4EMK B;  3REB B;  4M7A D;  2QI2 A;  3OBW A;  1KD1 C;  2FO0 A;  1GFD A;  1Q82 R;  2K7A A;  3OB9 A;  1Z9Z A;  3DKM A;  3MEW A;  3EGX B;  2MCN A;  3UDC A;  2QEX A;  4RG2 A;  5KYX B;  2IG0 A;  5HK3 A;  4QVC A;  3S3N A;  3G6E Q;  4MDW A;  2WAC A;  3A8L B;  2QDL A;  4BE1 A;  2M0O A;  1TH7 A;  4C8Q D;  1JO8 A;  1AD5 A;  1WX6 A;  4JRQ A;  2D8J A;  2DE0 X;  2CZ6 B;  2ESW A;  1IO6 A;  1RLQ C;  2K2M A;  2DRM A;  2F1L A;  5CKF A;  1GBR A;  4AFS C;  1WQW A;  2C0O A;  2CZ0 B;  5KE3 A;  2JM8 A;  2QQ9 A;  2R5M A;  1VQ6 A;  4C92 F;  1Q86 R;  1I5L A;  1W4S A;  1BCO A;  3TSZ A;  3UA7 A;  3UT1 A;  1IHV A;  3V7C A;  2QQS A;  3PMT A;  2CS7 A;  2EIF A;  1WHK A;  2ZCF B;  1Y57 A;  2H3J A;  2IIM A;  2QAS A;  5GAN j;  1QVF P;  2M9U A;  1KQ1 A;  4N0A C;  4RCC A;  1VQP T;  1KQ2 A;  4ANJ A;  2DTO A;  2EKH A;  4E47 A;  4M7A G;  5GAO q;  3BFM A;  2AK5 A;  3PNW C;  2FPE A;  1XOV A;  1JU5 C;  1WGS A;  2K3X A;  3NTH A;  1O9S A;  1G3Y A;  1W2B P;  3RKY A;  1N8R U;  4L6V 5;  1Y71 A;  1C0M A;  5CO7 A;  2XDB A;  1R77 A;  4M7D F;  1PKT A;  2YWW A;  1I07 A;  5GAN 2;  2JTM A;  1C6V X;  2XU8 A;  2GBQ A;  2ZAE A;  4PNO A;  3EG0 A;  1ZSZ C;  2KT1 A;  4KT0 E;  3SEM A;  4LNP A;  3RMQ A;  2RHI A;  2L0A A;  2HSE B;  3NTK A;  5D6X A;  2FZC B;  2LQ8 A;  1N27 A;  3G71 Q;  3L42 A;  2P4T A;  2HCK A;  2LVM A;  5LJ3 j;  3TCJ A;  2DK3 A;  4B6M A;  1HK9 A;  3F70 A;  1YCS B;  2COY A;  3HPW A;  3TEE A;  4R55 A;  1Y0M A;  1QVG A;  3CC2 A;  1JXO A;  1M4Z A;  4LD9 K;  1N6A A;  4M7A C;  3M0Q A;  3M57 A;  3I5S A;  4AFQ C;  2WSE E;  4M78 D;  2HQX A;  1VIE A;  3VJP A;  3CCQ A;  3CCS T;  1VQK T;  1OUL A;  1BU1 A;  2CH4 A;  3PIO A;  2DYB A;  3RKX A;  1LJO A;  2HSP A;  1VQL T;  2O2O A;  4C8Q C;  1ACM B;  2C0I A;  4QVD A;  2X4X A;  1P92 A;  1GBQ A;  3QJ6 A;  4HT9 A;  1KHI A;  3QDR B;  4XU0 A;  4PJO F;  2F2W A;  1KQS S;  3QZ9 B;  1GCQ C;  2CZ7 B;  1I81 A;  2EQM A;  3CBM A;  3OYH A;  1B3Q A;  4J6W A;  1YFN A;  3QWY A;  2RK2 A;  5KE2 A;  4OMP A;  3RIR A;  3I55 A;  2DXT A;  4A4K A;  4DA4 A;  3EHR A;  2LT1 A;  2BE7 D;  2M1H A;  4EDU A;  4LDU A;  3M53 A;  3BY7 A;  5FLX E;  1WHJ A;  5EC7 A;  4C92 D;  4OMN A;  4M4Z A;  3CXC S;  1VQM Q;  1YIT A;  4M75 E;  2X3W D;  4J8O A;  2DO3 A;  3E9F A;  5A0D A;  4BB7 A;  3QUI A;  2DNU A;  2DTH A;  3HFN A;  1M3B A;  2JS0 A;  4O6J A;  1YHQ Q;  2W10 A;  2LQN A;  2ZPG B;  4FW2 A;  4YTL A;  4ELZ C;  2BZX A;  2PTK A;  4XTU A;  4Z02 A;  4J9F A;  1PSF A;  2XID A;  2M51 A;  2LMJ A;  2V1R A;  5FRN A;  2MK5 A;  2DJZ A;  1TUC A;  3BE3 A;  1T0J A;  1RUW A;  4N4G A;  3D7S B;  3HTR A;  1K9A A;  4JPB W;  4M77 A;  1CKB A;  3NMZ C;  2FL7 A;  2KI7 A;  2CT3 A;  3PGG A;  2B86 A;  2DD4 A;  3SHW A;  2CP3 A;  4DEX A;  5KCH A;  3L2U A;  2KXC A;  4XTV A;  1VQ9 A;  3LH5 A;  2YRV A;  5GAN f;  2O9V A;  3OS0 A;  2JN0 A;  1ZLM A;  2VB6 A;  3MJX A;  4KUL A;  1GXI E;  5KYU A;  4M78 C;  1PCX A;  4BI4 A;  1Q7Y U;  3EFR A;  2LX9 A;  2JT4 A;  1XNI A;  4E7Z A;  4EMK A;  1K0S A;  1ZBJ A;  4J6Y A;  4PJN A;  2FPD A;  4RKU E;  3JCM f;  3MP6 A;  2O01 E;  3CCE A;  3BDU A;  1NG2 A;  4F7U F;  2CP5 A;  1VQ5 T;  4A4E A;  1R8O B;  3L2Q A;  1ZUY A;  3QDF A;  2VGM A;  2KSS A;  4EIK A;  1VQ8 Q;  3EGX A;  2RI3 A;  1YJW Q;  5IHK A;  2QEX T;  2VYT A;  5KYX A;  3M0U A;  4RTV A;  1WI7 A;  3QYH B;  3M4G A;  1JEG A;  1Y07 A;  1NZ9 A;  1K9M U;  1Q81 R;  2ROL A;  3RER A;  2OTL Q;  4X9C A;  2V8K A;  3A98 A;  4ESR A;  8AT1 B;  1MV0 B;  3SD4 A;  2L5Q A;  2A36 A;  3M5A A;  4XTX A;  1VQ6 T;  3H41 A;  2QXF A;  3FIF A;  2DTI A;  4C92 C;  3C12 A;  2E41 A;  2E6Z A;  5GAM f;  1K76 A;  2LDM A;  3ZEH A;  1NJI R;  1BCM A;  3FC3 A;  1I1J A;  1X2Q A;  2X35 A;  1OI1 A;  2W0Z A;  1RAE B;  2K5I A;  4DBQ A;  3H8Z A;  1XJW B;  1BB9 A;  4X9D A;  1CKA A;  3PE0 A;  2E65 A;  2GTJ A;  4N4H A;  3L2Z A;  9ATC B;  1G5V A;  5HCK A;  3QBY A;  3JB9 F;  1MUZ A;  1G3W A;  1LVK A;  4C0F A;  3JCM e;  1TTH B;  2K9G A;  1QKW A;  3A5Z B;  3PIP A;  4M7D A;  3EFO B;  3CD6 T;  3OYL A;  4QQD A;  1G8X A;  3CPF A;  1XTD A;  5IXF A;  2PNI A;  2CKK A;  3KXT A;  2EQI A;  2A37 A;  2DJQ A;  5GAM d;  3PTA A;  4Q5W A;  3V8L A;  2YRC A;  4M7A F;  2CSQ A;  2YT6 A;  3IQL A;  1VQ4 Q;  3G6E A;  2K6D A;  4FW1 A;  4QQ6 A;  1NE8 A;  3SFM A;  2JVV A;  2KGT A;  3GLX A;  1WQ7 A;  2DLP A;  2DXU A;  1C1A A;  2JXB A;  4HVU A;  4JRP A;  1K73 R;  2D1X A;  4HKE A;  2YLC A;  2GF7 A;  4GLK A;  3MKD A;  2FRW A;  2KAF A;  3UPU A;  3TU4 K;  4C8Q F;  2P84 A;  3EAE A;  3WVD B;  5KYY B;  3CC2 T;  2AZS A;  4O5V A;  2OI3 A;  3KUF A;  5GAM e;  1UTI A;  4HA8 A;  4M75 G;  3E19 A;  3PFS A;  5CKE A;  3ZBD A;  4BD3 A;  1YN8 A;  4BY6 C;  2P4R A;  1TU0 B;  4CC2 A;  5I2S A;  2DVE A;  3CCU Q;  3CCQ T;  2RNA A;  2HAX A;  1OOT A;  4HXJ A;  5L8R E;  2FZG B;  1V29 B;  3CBO A;  4JUV A;  5FU6 C;  2H8H A;  3OYY A;  4HCC A;  3ER0 A;  3QYG B;  4JS5 A;  2DD5 A;  3GP8 A;  4GLM A;  5GAN g;  4ME7 A;  1SHG A;  5IHI A;  2O88 A;  4PJO A;  2A0F B;  2AZV A;  4OMO A;  4OMQ A;  1PD1 A;  1WJS A;  5L23 A;  3BDL A;  2KRN A;  1RI0 A;  1W70 A;  4JZ3 A;  5LJ5 f;  3X28 B;  1D1C A;  1RAC B;  2EYQ A;  3KBG A;  3A8M B;  4JDS A;  2O4X B;  3URG A;  1MMG A;  5GAO l;  5J26 A;  2COW A;  1SEM A;  2EGC A;  2ECZ A;  3E1S A;  4A53 A;  4HCB A;  4JJC A;  1ZUK A;  1AZE A;  2KDS A;  5GAO r;  1QCF A;  2MF2 A;  3R6N A;  4M75 C;  2YUO A;  1YIT T;  2LCC A;  2HD0 A;  3G71 A;  3LGL A;  2JMC A;  2AIR B;  2FG0 A;  5DLQ E;  1UG1 A;  2J7I A;  3QG1 A;  1PM3 A;  1AVZ C;  4FT4 A;  4IUQ A;  3QXE B;  3OS2 A;  3PT9 A;  2K4Y A;  5LJ3 g;  4M77 B;  1H64 1;  3H9N A;  3JB9 H;  4RCB A;  5LJ5 d;  4D8K A;  1PSE A;  1M3C A;  2RJE A;  4Z89 A;  4EPC A;  4VUB A;  1G3T A;  1QVG S;  3OYD A;  1YI2 Q;  3OY9 A;  2DBK A;  3VV0 A;  4CC7 A;  1KQS P;  5GAN 7;  4M78 B;  5DM7 R;  4OMF B;  1IXD A;  2PVD B;  2FEI A;  2GNC A;  2OX7 A;  4M78 F;  4BE0 A;  4KGV B;  5KYU B;  2R5A A;  4N4I A;  1WPY A;  3UWN A;  2PVG B;  1VQN T;  4M77 E;  1RAI B;  3ZL7 C;  5LJ5 e;  3CXC P;  2MOX A;  4J9G A;  1OX9 A;  2A08 A;  1RAF B;  3WXM B;  5CKD A;  3GIB A;  3VS5 A;  1V76 A;  4DOW A;  2EPD A;  4X1V A;  4C5G A;  1IGQ A;  2BKD N;  1UE9 A;  2HBW A;  3SWN C;  1B34 A;  5A0L A;  4F14 A;  5GAO n;  1SRM A;  4F7U A;  2RJF A;  1AWW A;  2D0Q B;  2J6K A;  3CCE T;  2NUP B;  1VQM A;  4F04 B;  4AG1 C;  3TQ7 P;  1G3S A;  4C92 B;  2EQK A;  2KNB B;  1IRE B;  1UJ0 A;  1X43 A;  5FRM A;  1YIJ Q;  4NOY A;  2YUP A;  3HL8 A;  2DER A;  2QG9 B;  1YHQ A;  4MZM A;  2I0N A;  1YBY A;  4A4G A;  1A0N B;  2G3R A;  2LQW A;  3OYJ A;  4JRI A;  1FYN A;  3CCS Q;  3VS4 A;  4J9D A;  3G7Z A;  4RTT A;  5GMK m;  2X9H A;  2DIQ A;  3CC4 Q;  1I4K 1;  4FYW B;  1NJI C;  2E10 A;  4NL3 A;  4OB3 B;  2RO0 A;  5FWB A;  3L2V A;  3JCM V;  2EJ9 A;  3SB2 A;  3M54 A;  2DM1 A;  1WA7 A;  4NL2 A;  4OMM A;  1ZBX A;  4PJM A;  1BI3 A;  3C94 A;  3E2U A;  3HSB A;  1UGV A;  2YXY A;  3CCJ T;  3M0R A;  3ULR B;  4IUV A;  1OX8 A;  4LXC A;  2PUK B;  4Y91 A;  4AFZ C;  3OS1 A;  2DET A;  4XK8 E;  2LNV A;  1WXU A;  4M7D B;  2NUT A;  1TS9 A;  1PD0 A;  4Y28 E;  1M8V A;  1Y96 B;  1ARK A;  2LTO A;  4IKF A;  3M55 A;  2ABL A;  1M90 R;  3FLG A;  4ZGJ B;  4LDY A;  5CIU A;  1QWF A;  1RLP C;  4PJJ A;  3CCV Q;  3I56 Q;  1KFZ A;  1RAB B;  3EFO A;  3GOX A;  5GAO p;  1IZ6 A;  1N9R A;  4M7D E;  2RI5 A;  3LW5 E;  1WHL A;  4JLI A;  5GJV B;  4OB0 B;  2CRE A;  4C0D C;  2HKN A;  5GAN h;  3ZFJ A;  2VGN A;  4JZ4 A;  2EYX A;  1VQ8 A;  1YJW A;  1BI2 A;  4CC3 A;  2HQH A;  5GAM j;  2GCX A;  2RB6 A;  2VC8 A;  2MI6 A;  2E6N A;  1IHW A;  2OTL A;  3G4S A;  2B8A A;  1M8M A;  2JTF A;  4IUP A;  5GMK e;  4FSS A;  4C8Q A;  5CQX A;  1N5Z A;  2E4H A;  1WJQ A;  1F1B B;  4FYV B;  1SRL A;  3M58 A;  1WHH A;  5CCA A;  1SSF A;  2RHY A;  3U23 A;  1H3H A;  4OGC A;  5FU7 C;  2NUZ A;  1NEB A;  5KYY A;  4A63 B;  5IH2 A;  4IIM A;  4PJO B;  4C5E A;  2VXF A;  2Y90 A;  1MMD A;  4WF2 A;  3CCL Q;  3I5R A;  4PJL A;  1G83 A;  3JSC A;  1UDL A;  4PL6 A;  1K9M R;  2CP2 A;  1D0X A;  3H0F A;  4IUT A;  3LX7 A;  3H0I A;  4XTW A;  5LJ3 h;  1MV3 A;  3CCR Q;  2GFU A;  2GFA A;  1VOM A;  3CME A;  2O9S A;  2MYS A;  3QWX X;  2LQK A;  4RMO A;  1PRL C;  4PJO E;  4M75 F;  5HKC A;  1UGP B;  4A54 A;  2HBP A;  1VQ5 Q;  1KC8 U;  2LJ1 A;  1SKU B;  2FYK A;  1RAA B;  2HL3 A;  4AMC A;  2OTJ T;  3VRY A;  1PKS A;  3RES A;  1NEG A;  2VV5 A;  5DLO A;  2O4X A;  2HNI A;  4M77 G;  1NYF A;  1GRI A;  1D3B B;  1AWJ A;  5CK9 A;  5HK0 A;  1VQ4 A;  1AZG B;  3LYI A;  2AT1 B;  1AOJ A;  2F2V A;  1PRM C;  1TUD A;  2A3L A;  2E1H A;  3P8B B;  4MMK A;  3CPW S;  1O75 A;  2KXD A;  4AT1 B;  3MEA A;  3G71 T;  1K8A U;  4MML A;  4XU1 A;  2DL7 A;  3CC7 A;  3TVT A;  1MGQ A;  4ZTF A;  1FX7 A;  1UGQ B;  2XD0 A;  2XKO C;  1YNZ A;  4ZGD B;  2E12 A;  1EX4 A;  2RJD A;  1E6H A;  3VUZ A;  4XQ3 A;  4EMG A;  1M3A A;  3CCM Q;  2E3H A;  5A0G A;  4E7L A;  1VQO A;  3O8V A;  5LJ5 j;  5I21 A;  4HVV A;  1YJ9 A;  5KYN A;  4GY5 A;  1S72 A;  4D8D A;  1NPR A;  4OP0 A;  3OW2 A;  4E7J A;  4M78 A;  1Q82 C;  4OML A;  3SWN B;  2QGF B;  4RTU A;  1OYX A;  1OV3 A;  3DLL A;  4FYY B;  3H0H A;  1PWT A;  3S6W A;  1JQQ A;  3MET A;  2QTV A;  1NLP C;  2AKL A;  3CD6 Q;  1B34 B;  3OSS C;  4F7U B;  4JS4 A;  2QA4 Q;  2GTO A;  5DY9 A;  2MIO A;  1VIF A;  5D7U A;  4KBM B;  4RTX A;  1WHM A;  2L2P A;  2F5T X;  1LOJ A;  2LCL A;  1IB8 A;  2R58 A;  1Q86 C;  1JRI A;  3ASK A;  4D6W A;  4QW2 A;  3JCM c;  2YRD A;  5IXB A;  4B9X A;  2J05 A;  2ZGW A;  2DA9 A;  4RTZ A;  1X2K A;  2QQR A;  5CQY A;  2LRQ A;  1QVG P;  2NUP A;  2LT4 A;  4F7U E;  2X4J A;  2FZK B;  2DBM A;  4FU6 A;  1JB0 E;  4C92 A;  4R0K A;  2HKQ B;  2LZ6 B;  2V8I A;  2PQW A;  1MNE A;  1YHQ T;  2DEU A;  2K5F A;  1YJN A;  3S3M A;  3M0T A;  1RAD B;  5GAN 5;  4HCK A;  1BK2 A;  1IGU A;  3GNG A;  3CCQ Q;  4M7D G;  2NUT B;  3V8K A;  1YI2 A;  5D6Y A;  1PHT A;  2P0K A;  3OMG A;  1ZSZ B;  5AT1 B;  5I2M A;  4M75 D;  5AYF A;  4OB1 B;  1YCY A;  1M1K U;  1VYV A;  2XI9 A;  1M90 C;  2E3I A;  1QKX A;  2HZY A;  2MWP A;  1EFN A;  1W6X A;  2K79 A;  2DL4 A;  1PNJ A;  4OGE A;  3VS1 A;  2E5K A;  2NYS A;  1JXM A;  3JCM J;  2E64 A;  3H6Z A;  1TOV A;  3OYE A;  2A28 A;  1Y96 A;  5CKH A;  2D8H A;  4LUD A;  2PVO B;  2Y4Y A;  2ZPE B;  3NFC A;  4M7A B;  3M4Y A;  5IN1 A;  4Z8A A;  2EBP A;  1MMN A;  2X3X D;  2K3Y A;  1U06 A;  2KRM A;  2K3B A;  5A2Q E;  2NWM A;  5KH6 A;  3CPW A;  3QPH A;  3X25 B;  4BDY A;  1VQ7 Q;  5LJ3 d;  3VU3 C;  3FJ5 A;  2RHZ A;  1YIT Q;  4L5G A;  4DQ2 A;  3MHX A;  1BYM A;  2EQU A;  2Y4X A;  3EH2 A;  3M59 A;  5GMK j;  4LDX A;  3PVQ A;  1HSQ A;  4C8Q B;  3CMA Q;  4OF1 A;  2EWN A;  1YIJ A;  3V8J A;  3V7R A;  1AWO A;  3MEV A;  2EGE A;  3OYF A;  1YJW T;  3I35 A;  1OU8 A;  2O31 A;  4PJO G;  4J7I A;  2LCS A;  1RI9 A;  4MZT A;  4FL6 A;  2EYZ A;  3CCS A;  1M2V A;  3G1J A;  3CC4 A;  3G4S T;  2JTE A;  4E6R A;  1JJ2 S;  1J3T A;  2VWF A;  4BAC A;  3C95 A;  4FIB A;  2M16 A;  2X51 A;  1T3S A;  4C8Q E;  1RAG B;  1VQN Q;  4ZGE B;  4BI3 A;  2MAM A;  4OVA A;  1KD1 U;  2DX1 A;  2M02 A;  5CAI A;  5IAY A;  1ZA1 B;  5CR2 A;  1H8K A;  2KQW A;  1KSW A;  2BTT A;  1LPL A;  3JRZ A;  1WYX A;  4E7S A;  1QWE A;  1YWP A;  3VYG A;  3RKW A;  1QCN A;  1UUE A;  3JCM g;  4XAX B;  1W2B A;  3VUB A;  3GPL A;  2LJ0 A;  1W1F A;  2HEQ A;  1WDX A;  3X24 B;  1MMA A;  4IIO A;  5GAO m;  3CME T;  4WTO B;  2EAY A;  1JBM A;  3I55 T;  1TXQ A;  3QHS A;  3AT1 B;  3CCV A;  2KYM A;  3I56 A;  3CCE Q;  1KG1 A;  2XMF A;  1GFC A;  1TG0 A;  2KEA A;  2RQR A;  1H92 A;  1RAH B;  1QP2 A;  2L3P A;  4LD6 A;  3WVE B;  2COZ A;  2M0Y A;  3MO8 A;  4J7F A;  1N8R R;  4JJB A;  2G6F X;  3JAM E;  1AWX A;  3L2R A;  2NLU A;  1D3B A;  1X27 A;  1VQ4 T;  2BIV A;  2HL5 C;  2VUB A;  3EGD A;  4PFO A;  2RF0 A;  3LH0 A;  2ZZD A;  2EKO A;  2BE9 B;  5GAM g;  1KJW A;  4Y92 A;  1VQP Q;  4IUR A;  1ZHI A;  2EGA A;  3M0P A;  4UC4 A;  3THK A;  3OYB A;  3CC7 T;  3NPF A;  3CCJ Q;  2OJ2 A;  4XU2 A;  1VYU A;  2VKN A;  1NLO C;  2EYW A;  2JZ2 A;  1BIA A;  2ED1 A;  3PMI A;  3JCM X;  4F7U G;  2Z0W A;  2AKK A;  4CRI A;  1VQO T;  3CCL A;  1BIB A;  1RL2 A;  1YJ9 T;  1ZQ1 A;  1S72 T;  1VQ9 T;  2VAS A;  2DF6 A;  2OAW A;  4QT7 A;  3MP8 A;  3SWN A;  2D9T A;  4M78 E;  3CCR A;  3J7A F;  3N5B B;  2DIL A;  3RR6 A;  1HYO A;  2D6F A;  1K1Z A;  1QQJ A;  2CT4 A;  5HY6 A;  2EQJ A;  3HRS A;  1Q81 C;  2J6F A;  5IHN A;  1KK7 A;  5J39 A;  3Q1J A;  4J9B A;  3VS0 A;  3JV3 A;  4QKU A;  5GAN 4;  4J6X A;  4V2S A;  1SPK A;  5GAN 8;  1VQ5 A;  1K0X A;  3CPW P;  2FVU A;  2E5Q A;  2JOY A;  3O5Z A;  2KYB A;  2L89 A;  3VKI A;  1JJ2 A;  2RHU A;  2P0P A;  2C0T A;  1Q95 G;  4KGX B;  3MPU B;  1TUG B;  2DRK A;  3OQ5 A;  4N0A A;  1VQK Q;  1E6G A;  2XDD A;  1M27 C;  1NPP A;  1SF9 A;  3RNJ A;  1U1S A;  1FMK A;  2ROT A;  4DEY A;  1OPL A;  2MWO A;  1M1F A;  1KIK A;  1VQL Q;  1D0Y A;  3VRZ A;  3OMC A;  2RMO A;  3JB9 G;  2OAU A;  1ABO A;  4C92 E;  3RBB B;  1KC8 R;  5CVI A;  2A7Y A;  1YJN T;  5CKB A;  2DL5 A;  4ATO A;  2ZPF B;  5GMK l;  2K2V A;  3TRE A;  4RTY A;  3OA6 A;  2YHT A;  3CCM A;  2V8J A;  2YLB A;  2CUD A;  2KVQ G;  4RG8 A;  4R56 A;  2RJC A;  3SDZ A;  2RN8 A;  1YI2 T;  1D1B A;  3UF4 A;  2L3Q A;  2H3E B;  1UFF A;  5LJ5 g;  1ZSZ A;  1B07 A;  2DIG A;  1K8A R;  3MCA B;  4DBR A;  3OW2 S;  3EG9 B;  2SRC A;  5FWC A;  3CD6 A;  4PLI A;  4DBF A;  2DZC A;  2QA4 A;  4DOV A;  2OTJ Q;  2HMA A;  1K73 C;  2BZ8 A;  2DKG A;  4C8Q G;  4QVZ A;  1E7O A;  4M7A A;  3A8O B;  2QTX A;  2F69 A;  2P0Q A;  4BY6 B;  2FRY A;  3REA B;  1MND A;  2JJ9 A;  3G6E T;  5FU6 B;  3HHT B;  3QJY A;  1M2V B;  2RHX A;  1UGS B;  1QW1 A;  1OU9 A;  2RK1 A;  3DB3 A;  2RA2 A;  4ZN3 A;  4M77 D;  3JCM h;  3OYA A;  5LL6 S;  1Q7Y R;  2CP6 A;  1NBE B;  2KK4 A;  2DMO A;  4PKC C;  2QDY B;  3OYM A;  1AEY A;  2DZ9 A;  1YIJ T;  3DLM A;  4LE9 A;  1K4U S;  4XTZ A;  1Q82 U;  3HRT A;  4PFP A;  1GCQ A;  1LCK A;  2CGH A;  2BUD A;  3M0S A;  3J81 E;  3CC4 T;  3JCM P;  4J5Y A;  2ZPH B;  5D6W A;  4BE2 A;  4JLG A;  4XU3 A;  2CSI A;  3JCM Q;  3EHQ A;  4C5I A;  5GMK i;  4F16 A;  2EJG A;  2CYZ B;  2KBT A;  3INZ A;  2DAQ A;  3NGP A;  4HCZ A;  2GQV A;  1WJR A;  3LLR A;  4M75 B;  3A8G B;  4C5H A;  2J6O A;  1UHF A;  1EIF A;  1ZA2 B;  1M30 A;  3X26 B;  2PUO B;  4MZP A;  3EFS A;  4E7I A;  1FMW A;  5GAM h;  2L3R A;  3HRU A;  1UEB A;  1Q86 U;  5EG2 A;  1WNL A;  2WSC E;  5IT9 E;  1OEB A;  4ZNX A;  3FB9 A;  2QEX Q;  1N8R C;  2QQA A;  4K11 A;  2KE9 A;  3L1A A;  1IRX A;  2CUB A;  2DPP B;  2FPF A;  1VQ7 A;  2SEM A;  3CCV T;  2I2L A;  4P5N A;  4KUI A;  3I56 T;  1M1K R;  3EGD B;  2ZPI B;  1M5Q 1;  2LJ3 A;  2QQB A;  5KYW B;  2RQT A;  2LNH B;  4A4H A;  1JJ2 P;  1YWO A;  4JRK A;  4M78 G;  3CMA A;  2KT8 A;  1X6G A;  3OSV A;  2ED0 A;  1VQ6 Q;  1QMC A;  2X4Y A;  4ZTJ A;  1HXD A;  3EG1 A;  3JCM W;  2RH2 A;  5ECA A;  2EJF A;  3OYG A;  3OBY A;  2L8D A;  4J9E A;  1GL5 A;  3LGF A;  5J3B A;  3T9N A;  2VXE A;  2DL3 A;  1M90 U;  1UEC A;  1ABQ A;  4OB2 B;  3LWI A;  3CCU A;  4E7H A;  5FRO A;  2EFI A;  1QP3 A;  5GAN 3;  4CI0 C;  2X4W A;  1NM7 A;  1BKB A;  2HQE A;  1FWZ A;  1UHC A;  4M7D D;  3VYH B;  3GNF B;  1VQN A;  4FYX B;  1R0C B;  2RQU A;  3UAT A;  3CQT A;  2ATC B;  4M77 C;  3HKS A;  1UGR B;  3CCL T;  3CBP A;  3QO3 A;  1QVF S;  2CP0 A;  1QVP A;  4II1 A;  4J83 A;  4J9C A;  4X34 A;  3RMS A;  1OZ3 A;  1NYG A;  4C92 G;  2HDA A;  2EW3 A;  4KGZ B;  3S3O A;  4LDV A;  4J9H A;  1G2B A;  5C0M A;  3M9Q A;  3CCR T;  4EMH A;  2GGR A;  2QK0 A;  2MMP A;  2R57 A;  4TVR A;  1Z9Q A;  4QQG A;  2DXC A;  3FEO A;  1W2B S;  3EG2 A;  3EG3 A;  4KH1 B;  4C0G A;  4PFZ A;  1KD1 R;  1R0B G;  3DB4 A;  4EMK C;  1VQM T;  1X69 A;  5LJ5 h;  1EZZ B;  3UA6 A;  3FDR A;  4FT2 A;  4WCI A;  2XG8 D;  1B7T A;  3CC2 Q;  1KC8 C;  1BI0 A;  1AT1 B;  1PG5 B;  4BUG A;  1U5S A;  5GAN d;  4AG2 C;  2ENM A;  6AT1 B;  1T3L A;  3G4S Q;  2DEQ A;  5FW9 A;  4LN2 A;  3C0C A;  4GBQ A;  2D0N A;  1VQP A;  2FB7 A;  2JW4 A;  5LJ3 f;  1WXT A;  1T0H A;  4IUU A;  3TSW A;  3R6O A;  1AHJ B;  4PJO D;  1U3O A;  2CDT A;  2XK0 A;  3E9G A;  5GAN 6;  2C06 A;  3OYI A;  3JCM d;  2XDP A;  3CCJ A;  3KFV A;  1HD3 A;  1K8A C;  2J06 A;  1KQS A;  3NHN A;  2KR3 A;  1KHC A;  2EVR A;  1VYT A;  3CCM T;  4J9I A;  4PLL A;  1GCP A;  4PK4 A;  3OYN A;  1WIE A;  3C4S A;  1SSH A;  1D1A A;  4C0D B;  5I22 A;  2LP5 A;  1LNX A;  5GAN e;  3HFO A;  1QCO A;  4HVW A;  1X01 A;  4RTW A;  5GJW B;  2DVJ A; 
#chains in the Genus database with same CATH homology
 1X6O A;  4XTU A;  4Z02 A;  1PSF A;  2BIV A;  1OZ2 A;  2LTO A;  2XID A;  2VUB A;  2ZPB B;  3L2W A;  4IKF A;  3M55 A;  2F5K A;  3LH0 A;  2ZZD A;  3CXC A;  2EKO A;  3FLG A;  1DJ7 B;  4LDW A;  5GAM g;  4ZGJ B;  2CZ1 B;  5FRN A;  4LDY A;  4IUR A;  1ZHI A;  5CIU A;  2DJZ A;  4UC4 A;  3OYB A;  1H3Z A;  3CC7 T;  2RM4 A;  4N4G A;  3OS5 A;  4XU2 A;  4M77 A;  2QA4 T;  3GOX A;  5GAO p;  1IZ6 A;  1N9R A;  4NS5 A;  2JZ2 A;  4M7D E;  2RI5 A;  1Q7Y C;  3LW5 E;  4JLI A;  1BIA A;  2FL7 A;  5FU7 B;  4OB0 B;  2LC4 A;  4C0D C;  3PMI A;  3JCM X;  3PGG A;  5GAN h;  3ZFJ A;  4M7D C;  2VGN A;  4F7U G;  2DD4 A;  4CRI A;  1VQO T;  1VQ8 A;  4C0Z A;  3CCL A;  3V7S A;  5KCH A;  3L2U A;  1BIB A;  1BI2 A;  1RL2 A;  1YJW A;  4XTV A;  1VQ8 T;  1YJ9 T;  3LWH A;  1VQ9 A;  4M7A E;  1ZQ1 A;  3FRN A;  2YRV A;  5GAN f;  1S72 T;  5GAM j;  1VQ9 T;  4KUD K;  2GCX A;  2RB6 A;  2VC8 A;  3OS0 A;  2JN0 A;  2MI6 A;  2E6N A;  2OTL A;  3MP8 A;  4KUL A;  3G4S A;  2B8A A;  3SWN A;  1GXI E;  5KCO A;  2OTL T;  3QSU A;  2D9T A;  4M78 E;  3QII A;  2JTF A;  3N5B B;  4IUP A;  3CCR A;  1VQK A;  3J7A F;  5LJ3 e;  4M78 C;  5GMK e;  2D6F A;  4BI4 A;  1Q7Y U;  3EFR A;  4C8Q A;  5CQX A;  2LX9 A;  3MP1 A;  1M1G A;  1K9M C;  1XNI A;  1WJQ A;  2EQJ A;  3HRS A;  5HY6 A;  4EMK A;  1Q81 C;  1VQL A;  4J6Y A;  3JCM f;  2XIC A;  3Q1J A;  4RKU E;  5J39 A;  4XTY A;  3MP6 A;  3M58 A;  2O01 E;  3P8H A;  5CCA A;  1SSF A;  2RHY A;  3CCE A;  5GAN 4;  3BDU A;  4J6X A;  4OGC A;  5FU7 C;  5GAN 8;  3J80 E;  4V2S A;  1BI1 A;  1VQ5 A;  1QVF A;  2DXB A;  4F7U F;  4PJO B;  2FVU A;  1U1T A;  1VQ5 T;  3P8D A;  1R8O B;  2E5Q A;  2VXF A;  2Y90 A;  4A4E A;  4C5E A;  3L2Q A;  2JOY A;  4WF2 A;  2K57 A;  3OYC A;  2VGM A;  2KSS A;  1Y7X A;  2WSF E;  3QZ5 B;  2RI3 A;  2QEX T;  2VYT A;  4ZN1 A;  3HP9 A;  3QYH B;  2L89 A;  3JSC A;  3M4G A;  4PL6 A;  3VKI A;  1JJ2 A;  2KMT A;  1Y07 A;  1NZ9 A;  2RHU A;  1K9M U;  4JJN K;  4IUT A;  3LX7 A;  3RER A;  3CEY A;  2P0P A;  1Q81 U;  2AHJ B;  4X9C A;  2V8K A;  4XTW A;  5LJ3 h;  1M9S A;  5GMK h;  3OQ5 A;  4N0A A;  3JB9 I;  2JNG A;  2GFU A;  2GFA A;  3FJP A;  3CME A;  2XDD A;  1NPP A;  1U1S A;  4HCC A;  3SD4 A;  2L5Q A;  2MWO A;  4A4F A;  2LQK A;  4M75 A;  4RMO A;  1M1F A;  3M5A A;  4E7K A;  1FXX A;  1M1K C;  4XTX A;  3OMC A;  4PJO E;  4M75 F;  1VQ6 T;  5HKC A;  3JB9 G;  2OAU A;  1UGP B;  4FM4 B;  2HBP A;  4A54 A;  4C92 E;  3X20 B;  3JB9 J;  4PJO C;  5CVI A;  2QXF A;  2A7Y A;  3FIF A;  2DTI A;  5CKB A;  4C92 C;  1YJN T;  2FYK A;  1KC8 U;  4ATO A;  2ZPF B;  3C12 A;  3ME9 A;  2OTJ A;  5GMK l;  4MDX A;  2E41 A;  2K2V A;  3TRE A;  2OTJ T;  2E6Z A;  5GAM f;  3OA6 A;  2YHT A;  3NTI A;  2PU9 B;  2VV5 A;  3RES A;  2LDM A;  3CCM A;  2KY9 A;  3ZEH A;  5DLO A;  2O4X A;  2V8J A;  2YLB A;  3BW1 A;  2HNI A;  2KVQ G;  3M56 A;  4M77 G;  4RG8 A;  4BI8 B;  3RUX A;  1NJI U;  3FC3 A;  4R56 A;  2X35 A;  1OI1 A;  2RJC A;  3SDZ A;  3AHU A;  1D3B B;  1YI2 T;  4HT8 A;  3MEU A;  5CK9 A;  2RI2 A;  5HK0 A;  1VQ4 A;  2K5I A;  3H8Z A;  3LYI A;  1VQ7 T;  4X9D A;  5LJ5 g;  2RD1 A;  2E65 A;  4FSX A;  3QKJ A;  1D3B A;  2K5L A;  2A3L A;  2E1H A;  4N4H A;  3L2Z A;  2DIG A;  3P8B B;  4MMK A;  3CPW S;  1O75 A;  3MCA B;  3MEA A;  3G71 T;  1K8A U;  3OW2 S;  1G5V A;  4MML A;  1UB4 A;  3QBY A;  4XU1 A;  3JB9 F;  3CMA T;  1G3W A;  4C0F A;  2FHD A;  3JCM e;  3CC7 A;  3OYK A;  1MGQ A;  3A5Z B;  1N9S A;  1FX7 A;  4PLI A;  1UGQ B;  3PIP A;  4ZTF A;  2XKO C;  2XD0 A;  4M7D A;  2DZC A;  3CD6 T;  2QA4 A;  4ZGD B;  3OYL A;  4QQD A;  4DOV A;  1I8F A;  2E12 A;  1K73 C;  2RJD A;  2DKG A;  5C6S A;  3JCM b;  3VUZ A;  4C8Q G;  4QVZ A;  4XQ3 A;  3CPF A;  1XTD A;  4EMG A;  1XQH A;  4M77 F;  1U8R A;  1X75 C;  2CKK A;  3KXT A;  4M7A A;  5A0G A;  1MHN A;  4B9W A;  5GAM d;  3PTA A;  4E7L A;  3O8V A;  1VQO A;  4ELY C;  5LJ5 j;  3A8O B;  2QTX A;  4Q5W A;  2F69 A;  3V8L A;  5I21 A;  2P0Q A;  2XHC A;  4M7A F;  4BY6 B;  1YJ9 A;  2JUF A;  4GY5 A;  3CCU T;  1S72 A;  3JB9 D;  3G6E A;  4L59 A;  1NPR A;  4OP0 A;  1VUB A;  4QQ6 A;  3OW2 A;  4E7J A;  1NE8 A;  3SFM A;  2JVV A;  4M78 A;  3G6E T;  1Q82 C;  5FU6 B;  3GLX A;  1WQ7 A;  3HHT B;  3QJY A;  2RHX A;  3SWN B;  2DXU A;  1UGS B;  4JRP A;  1OYX A;  1QW1 A;  3GF5 A;  5M9O A;  3DLL A;  2RK1 A;  3DB3 A;  4HKE A;  1K73 U;  2IVW A;  2YLC A;  2RA2 A;  3S6W A;  4M77 D;  2E70 A;  3JCM h;  4ZN3 A;  3OYA A;  5LL6 S;  2GF7 A;  4GLK A;  3MET A;  4BDZ A;  3A8H B;  4EMK B;  2HAX A;  2KK4 A;  4PKC C;  1B34 B;  2QDY B;  2KAF A;  3OYM A;  3OSS C;  4M7A D;  3UPU A;  2QI2 A;  2DZ9 A;  4F7U B;  4C8Q F;  4JS4 A;  3OBW A;  3TU4 K;  1YIJ T;  3DLM A;  3EAE A;  3WVD B;  3CC2 T;  5DY9 A;  4O5V A;  1KD1 C;  1VIF A;  3KUF A;  5GAM e;  4HA8 A;  4XTZ A;  4M75 G;  3E19 A;  3OB9 A;  4KBM B;  3PFS A;  3DKM A;  3HRT A;  3MEW A;  5CKE A;  3ZBD A;  4BD3 A;  1Q82 U;  4BY6 C;  5I2S A;  2F5T X;  1LOJ A;  3UDC A;  2CGH A;  2DVE A;  2QEX A;  4RG2 A;  2BUD A;  2LCL A;  3J81 E;  3CC4 T;  3CCQ T;  3JCM P;  2IG0 A;  2R58 A;  4J5Y A;  1JRI A;  4QVC A;  2ZPH B;  5HK3 A;  5L8R E;  3S3N A;  1Q86 C;  4MDW A;  1V29 B;  3ASK A;  3CBO A;  4JUV A;  5FU6 C;  2WAC A;  3OYY A;  5D6W A;  3A8L B;  4QW2 A;  3JCM c;  4D6W A;  3OS2 A;  3ER0 A;  4JLG A;  4BE1 A;  3QYG B;  4JS5 A;  2M0O A;  4BE2 A;  4XU3 A;  2DD5 A;  1TH7 A;  4C8Q D;  3JCM Q;  3GP8 A;  4C5I A;  5GMK i;  4B9X A;  2ZGW A;  5GAN g;  4ME7 A;  4JRQ A;  2EJG A;  2CYZ B;  3INZ A;  2CZ6 B;  2DAQ A;  2QQR A;  5CQY A;  2LRQ A;  4HCZ A;  2GQV A;  5CKF A;  2LT4 A;  1WJR A;  4F7U E;  3LLR A;  2X4J A;  4PJO A;  1WQW A;  4M75 B;  3A8G B;  4FU6 A;  2CZ0 B;  4C5H A;  1JB0 E;  4C92 A;  5KE3 A;  1EIF A;  2V8I A;  3X26 B;  1WJS A;  2PUO B;  2PQW A;  2QQ9 A;  4MZP A;  3BDL A;  2R5M A;  3EFS A;  4E7I A;  1VQ6 A;  4C92 F;  1RI0 A;  5GAM h;  1YHQ T;  2L3R A;  3HRU A;  1UEB A;  5LJ5 f;  1I5L A;  1W4S A;  3X28 B;  2K5F A;  1Q86 U;  1YJN A;  5EG2 A;  3UT1 A;  3S3M A;  3V7C A;  2QQS A;  1WNL A;  2EYQ A;  5GAN 5;  2WSC E;  5IT9 E;  3PMT A;  3KBG A;  2CS7 A;  3A8M B;  3GNG A;  4JDS A;  2O4X B;  2EIF A;  2ZCF B;  3URG A;  4M7D G;  3FB9 A;  1N8R C;  2H3J A;  5GAO l;  5J26 A;  2QQA A;  5GAN j;  3L1A A;  3V8K A;  2M9U A;  5D6Y A;  1YI2 A;  1KQ1 A;  4N0A C;  4RCC A;  1VQP T;  1KQ2 A;  2DPP B;  2P0K A;  2DTO A;  1VQ7 A;  4E47 A;  3OMG A;  3E1S A;  4M7A G;  5GAO q;  4A53 A;  3BFM A;  4HCB A;  5I2M A;  2I2L A;  4P5N A;  4KUI A;  4M75 D;  3I56 T;  5AYF A;  3CCV T;  4OB1 B;  1YCY A;  1M5Q 1;  2ZPI B;  1M1K U;  2KDS A;  2XI9 A;  5GAO r;  2MF2 A;  2QQB A;  1M90 C;  4M75 C;  1YIT T;  2LCC A;  2HD0 A;  2MWP A;  3PNW C;  4A4H A;  3G71 A;  3LGL A;  1XOV A;  2K3X A;  1WGS A;  5DLQ E;  4JRK A;  3NTH A;  4M78 G;  1O9S A;  1G3Y A;  3QG1 A;  3CMA A;  3OSV A;  4OGE A;  4FT4 A;  2X4Y A;  3RKY A;  3JCM J;  4IUQ A;  1N8R U;  3QXE B;  2E64 A;  1HXD A;  3PT9 A;  3H6Z A;  2RH2 A;  4L6V 5;  2K4Y A;  1Y71 A;  2EJF A;  5LJ3 g;  3JCM W;  4M77 B;  3OYG A;  1H64 1;  3OYE A;  5CO7 A;  3JB9 H;  3OBY A;  2XDB A;  4RCB A;  5LJ5 d;  4M7D F;  1Y96 A;  5CKH A;  2L8D A;  2PVO B;  2Y4Y A;  2ZPE B;  3NFC A;  1PSE A;  4M7A B;  2RJE A;  3M4Y A;  5IN1 A;  5GAN 2;  3LGF A;  5J3B A;  3T9N A;  2JTM A;  4EPC A;  2VXE A;  4VUB A;  1G3T A;  2K3Y A;  2XU8 A;  1M90 U;  1QVG S;  3OYD A;  5A2Q E;  3OY9 A;  4OB2 B;  4PNO A;  3LWI A;  3CCU A;  3VV0 A;  5KH6 A;  5GAN 7;  3CPW A;  3QPH A;  4KT0 E;  4M78 B;  3X25 B;  4BDY A;  5LJ3 d;  4E7H A;  5FRO A;  2EFI A;  1QP3 A;  2RHI A;  4OMF B;  3RMQ A;  3VU3 C;  5DM7 R;  5GAN 3;  2RHZ A;  4L5G A;  2X4W A;  4CI0 C;  1BKB A;  2HQE A;  2PVD B;  4DQ2 A;  3MHX A;  1BYM A;  1FWZ A;  3NTK A;  5D6X A;  4M78 F;  2LQ8 A;  2EQU A;  4BE0 A;  1N27 A;  2Y4X A;  3VYH B;  4M7D D;  3L42 A;  2P4T A;  2LVM A;  3GNF B;  5LJ3 j;  3M59 A;  1VQN A;  5GMK j;  3TCJ A;  4LDX A;  2DK3 A;  2R5A A;  4N4I A;  4C8Q B;  1WPY A;  3UWN A;  2PVG B;  1VQN T;  4M77 E;  4OF1 A;  1HK9 A;  2EWN A;  4M77 C;  3F70 A;  3HKS A;  1YIJ A;  3V8J A;  3V7R A;  5LJ5 e;  3HPW A;  3TEE A;  1UGR B;  3CCL T;  3MEV A;  3OYF A;  3CBP A;  3QO3 A;  4R55 A;  1QVF S;  1QVG A;  1YJW T;  3CC2 A;  1M4Z A;  4LD9 K;  1N6A A;  4M7A C;  1QVP A;  4II1 A;  4J83 A;  4PJO G;  4J7I A;  4X34 A;  3RMS A;  1OZ3 A;  4MZT A;  4C92 G;  3M57 A;  4FL6 A;  2WSE E;  3CCS A;  3S3O A;  4LDV A;  4M78 D;  3WXM B;  2HQX A;  1VIE A;  3VJP A;  3G4S T;  3CCQ A;  3CCS T;  5C0M A;  3CC4 A;  5CKD A;  3M9Q A;  3CCR T;  1VQK T;  1JJ2 S;  3GIB A;  4EMH A;  4BAC A;  2MMP A;  2R57 A;  4C5G A;  4DOW A;  4TVR A;  2BKD N;  4QQG A;  3C95 A;  3PIO A;  2DXC A;  3FEO A;  4FIB A;  1B34 A;  3RKX A;  3SWN C;  5A0L A;  4ZTJ A;  5GAO n;  1W2B S;  1LJO A;  2M16 A;  1VQL T;  4F7U A;  2RJF A;  4C8Q E;  4C0G A;  2D0Q B;  3CCE T;  4C8Q C;  1VQM A;  4QVD A;  2X4X A;  1P92 A;  4ZGE B;  4BI3 A;  2MAM A;  3DB4 A;  4EMK C;  1VQM T;  4OVA A;  3QJ6 A;  1KD1 U;  1G3S A;  4C92 B;  5CAI A;  5IAY A;  2EQK A;  5LJ5 h;  4HT9 A;  5CR2 A;  1KHI A;  3QDR B;  1IRE B;  2KQW A;  5FRM A;  3FDR A;  4FT2 A;  4NOY A;  3HL8 A;  2XG8 D;  3JRZ A;  4XU0 A;  4PJO F;  1YHQ A;  4MZM A;  1KC8 C;  1BI0 A;  1YBY A;  3VYG A;  1KQS S;  3RKW A;  4A4G A;  2G3R A;  3QZ9 B;  2CZ7 B;  4JRI A;  4BUG A;  3OYJ A;  1I81 A;  3JCM g;  5GAN d;  4XAX B;  2EQM A;  3CBM A;  3OYH A;  3G7Z A;  3VUB A;  1W2B A;  4J6W A;  3GPL A;  5GMK m;  2DIQ A;  1I4K 1;  2DEQ A;  1NJI C;  2RK2 A;  3X24 B;  2E10 A;  5GAO m;  5KE2 A;  4OB3 B;  4NL3 A;  3RIR A;  3CME T;  2RO0 A;  3I55 A;  2EAY A;  1JBM A;  2DXT A;  4A4K A;  3L2V A;  3JCM V;  4DA4 A;  1VQP A;  2FB7 A;  2LT1 A;  2EJ9 A;  5LJ3 f;  3I55 T;  2M1H A;  4IUU A;  3SB2 A;  3M54 A;  4EDU A;  3R6O A;  3QHS A;  1AHJ B;  4LDU A;  4PJO D;  3M53 A;  2XK0 A;  3BY7 A;  5FLX E;  3I56 A;  3CCV A;  3E9G A;  4NL2 A;  5GAN 6;  4C92 D;  2C06 A;  3OYI A;  1ZBX A;  1KG1 A;  3JCM d;  1BI3 A;  2XDP A;  3C94 A;  3CXC S;  3CCJ A;  4M75 E;  1YIT A;  3HSB A;  1K8A C;  3CCJ T;  4J8O A;  1KQS A;  2DO3 A;  4IUV A;  2PUK B;  1KHC A;  3E9F A;  4Y91 A;  4BB7 A;  5A0D A;  3OS1 A;  3QUI A;  2DTH A;  3WVE B;  1QP2 A;  3HFN A;  4LD6 A;  4O6J A;  4XK8 E;  2LNV A;  3CCM T;  4PLL A;  3OYN A;  3C4S A;  3MO8 A;  4J7F A;  4M7D B;  2ZPG B;  4C0D B;  1LNX A;  5GAN e;  3HFO A;  4YTL A;  4Y28 E;  3JAM E;  1X01 A;  3L2R A;  1M8V A;  1Y96 B;  4ELZ C;  2NLU A;  3CD6 A;  1VQ4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...