4DOWA

Structure of mouse orc1 bah domain bound to h4k20me2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
157
structure length
157
Chain Sequence
TFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Origin recognition complex subunit 1
publication title The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
total genus 31
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dowA00
4DOWA 1M4ZA 4JJNK 4DOVA 4FT4A 4LD9K 4DA4A 4KUIA 1ZHIA 3TU4K 2FVUA 2FL7A 4KULA 4BB7A 4FT2A 1W4SA 4FSXA 3PT9A 1ZBXA 4KUDK 3PTAA
chains in the Genus database with same CATH superfamily
1YHQQ 1I8FA 2COZA 2FZKB 2KR3A 2DVJA 1TU0B 2EVRA 3UDCA 1QCOA 3HRTA 2OAWA 1C0MA 1PKTA 1G5VA 2V8KA 4A4EA 4KGXB 4C0DC 2MYSA 3X25B 4M7DE 3TCJA 3V8JA 4M7DG 3CC7A 2R57A 4PJOC 1IGQA 2LQNA 3OS1A 3EFOA 5KYWB 3M56A 2K5IA 1IXDA 1WLPB 1QVGA 1WXUA 1Y96A 3VRYA 3CCQQ 1T3LA 1WHMA 1JXMA 4PJOF 2IG0A 4M75D 4FW2A 1VYVA 3VS3A 2D9TA 5GJVB 4KH1B 2R5MA 1VQKT 2DPPB 4KGZB 3ME9A 2XKOC 4C92F 2YRCA 4IURA 2F2VA 1Q86C 1YJWT 1QP3A 2DJZA 4A4GA 3OYHA 1BCMA 4WCIA 5GAMg 1YJWQ 3E2UA 2J7IA 1YITT 1OEBA 3JCMh 1G8XA 1WJSA 1UUEA 1IGUA 2NLUA 2DEUA 2W0ZA 1PG5B 1KSWA 4ELZC 2EW3A 3JCMJ 3ER0A 3EG9B 3QZ9B 2A0FB 1K9MR 5M9OA 2KRMA 3CCMA 2XICA 1VQ6Q 4F04B 1VQMT 3EGDB 4PJJA 5FLXE 1Q86U 3JB9F 4OVAA 4JJBA 1VQLQ 1MMDA 1N8RR 4E7JA 2FVUA 3CCQA 3M5AA 1WJRA 1XNIA 1U5SA 1WFWA 1EX4A 2KI7A 2DFUA 1K9AA 4J8OA 1RI9A 4RKUE 3OB9A 3VYHB 1OX8A 2EBPA 4M77E 2VASA 1OX9A 2CP2A 4PFZA 3CQTA 4M77G 3E19A 2RI5A 3OSSC 2KY9A 1BB9A 2QQSA 2RK1A 2BTTA 4M7DC 1U3OA 3M0TA 2VV5A 5LJ5f 3HTRA 2YXYA 2LQ8A 8ATCB 5KYXB 2YLCA 2HBWA 4BE2A 4F7UE 2O4XA 3DLLA 1VIFA 4F7UG 3SD4A 1VQ6A 4AFSC 4C8QA 2BE9B 3I55T 2FPFA 4MMLA 1SF9A 1NLPC 2FPDA 3OA6A 3PIPA 1ZUYA 3I55Q 1VQLA 3EGUA 5FWCA 3S6WA 2E5KA 1JO8A 1ARKA 3EFRA 1I5LA 3N5BB 1QVGS 1UECA 2PVGB 3TVTA 2E65A 4IUPA 2EJFA 4RTUA 1Q82C 3QSUA 1NZ9A 3L2QA 2FZGB 5GMKi 1IHWA 1YNZA 1SKUB 2JTMA 2QEXT 3ASKA 3LH0A 4KGVB 1R0BG 2EPDA 1VQ4T 4N4GA 2O88A 4BY6C 3J80E 4M7DD 1RAHB 4RTTA 1GCQA 4LE9A 3OQ5A 1WZOA 4Z89A 4LUDA 2CZ7B 4A53A 4JZ3A 4LD9K 4ATOA 2DL4A 4NOYA 3G4ST 5LJ3f 2O9SA 3RDVA 1MMGA 2JTEA 5CK9A 1VQ9T 4IUUA 1QVGP 1UGVA 4IUQA 1I1JA 1D1AA 2L3PA 3CCSQ 1QVFA 2LQWA 4BI8B 3P8BB 2CSIA 1BI3A 2DL5A 1RAIB 4LDWA 2FRYA 4M78F 3MO8A 4M7AF 4XQ3A 4M77C 3OMCA 2DNUA 4RG2A 4EMKC 2OTJT 2E5QA 3LGFA 2FEIA 4E7LA 1WXBA 3EFOB 1VOMA 2HZYA 2PZ1A 5LJ5g 5GAOl 3CCVT 3TSZA 1Y96B 5A2QE 2M1HA 1WQ7A 2RHYA 1SHFA 3CCVQ 4JJNK 1TSFA 3DB3A 5IN1A 3EH1A 1KG1A 4CRIA 2G6FX 1NEGA 1OI1A 4BE0A 1QW1A 2OTLQ 3DB4A 4PJMA 3CC2T 4JLIA 5IHNA 2CUDA 1TXQA 3M53A 5IAYA 1KC8C 2JTFA 4BACA 1WDXA 3NMZC 3L2ZA 2AKKA 3CCSA 1X75C 1VQ8A 4Y28E 3PMIA 3JSCA 5GANh 2AHJB 3I9QA 2FHDA 2HDAA 5GAMe 2A08A 2ZCFB 1D1CA 2F5KA 2LQKA 4M77D 2M0YA 3CBPA 2QA4Q 1KQSS 3A8HB 2PU9B 2O01E 3M0UA 3MPUB 1WNLA 1VQ5T 3MP1A 4M78A 4ZTFA 2EQJA 2X9HA 4M7AA 1SRLA 2DXTA 3CCUQ 3HHTB 1KC8U 4QQGA 3ZBDA 1N8RU 2JUFA 2LJ1A 3JCMc 5LJ3g 5C0MA 1Q81U 3X26B 3CPFA 4HVWA 1LPLA 4J83A 1S72Q 1MV0B 2DBKA 3C94A 3QDRB 3CCJT 2D0QB 1UDLA 2QYZA 3KXTA 2XDPA 1X01A 3QWYA 1VQ7T 2GNCA 3CCJQ 2OTLA 3SDZA 1YWPA 4ZGDB 4XU1A 5GAOp 1KQSP 4FU6A 2MI6A 5AYFA 2KAFA 5IXBA 1PNJA 5D7UA 2X4XA 1KQ2A 2EYWA 2RQTA 4BUGA 2CZ6B 1YIJQ 4J6YA 2O4XB 2QA4A 3H0FA 1GBQA 1D3BA 3VS0A 4XTWA 2EQUA 4RTXA 3KFVA 2X51A 4RCCA 4FL6A 4C8QB 4M4ZA 3A5ZB 2ATCB 3CCUA 1BKBA 2YUPA 2K6DA 3OBWA 5GAN7 1OU8A 1RAAB 2DL3A 3F70A 5L23A 3OW2A 1S1NA 4E7SA 1RADB 2JMCA 4D6WA 2K5FA 1TG0A 3Q1JA 2GGRA 2O31A 3C0CA 3I35A 1S72A 2JVVA 2RK2A 1OQKA 2QASA 1UG1A 4LUEA 2HBPA 5IH2A 3SWNA 1M27C 4AMCA 3NFCA 3AT1B 3A8MB 1W6XA 5IHIA 1X6GA 4QQ6A 3NPFA 2BZXA 1TOVA 3VRZA 3M0QA 2YLBA 1JJ2A 3UWNA 3VJPA 3V7CA 5GAOq 1YIJA 2KROA 1LCKA 1HJDA 3UT1A 3S3OA 4QVCA 1A0NB 2RHZA 2E12A 1XTDA 1JEGA 3FJPA 2RQWA 4ORZA 2HQXA 2KXDA 3ZL7C 3OYJA 1Q86R 1HD3A 5J39A 1H8KA 4GBQA 5IT9E 1MMNA 1BYMA 1FMWA 1N9RA 4J5YA 1Y71A 1KHCA 2DO3A 2RNAA 1ZSZA 2ZPBB 5GAN5 3J81E 1OV3A 1M3AA 1YCYA 2MCNA 3H8ZA 2R58A 5I2SA 2CP6A 1U1TA 1LJOA 1OZ2A 4J9FA 3A8OB 4LNPA 4XTYA 5LJ5e 2GQIA 3JCMV 1QLYA 6AT1B 2HKQB 2VGNA 2WSEE 4XU3A 3QUIA 2RO0A 3BDLA 3CC4T 2K3XA 1BI1A 2CP7A 5KCHA 4A54A 1MNDA 5GMKe 1WIEA 2Z0WA 2FO0A 4V2SA 4EIKA 3R6NA 1R0CB 2D1XA 1O75A 3RESA 4EDUA 4EMHA 1ZBJA 2QTVA 2F2WA 5GANj 2E6ZA 3IQLA 5GAMf 2DAQA 3CC7T 3OW2S 1W1FA 2CH4A 3QWXX 1DJ7B 2J6KA 4HCCA 3M9QA 4OGEA 1H3ZA 1IREB 4N4IA 3SFMA 2GFUA 1IO6A 5CKBA 4MDWA 2MK5A 3HFOA 1OPLA 1WHLA 2BZYA 1SRMA 4C8QE 1WYXA 1Y7XA 2M02A 4C8QG 5LJ3e 1AZEA 2GTOA 4P5NA 2D0NA 4NS5A 2GCXA 2DXCA 2D8JA 2LJ3A 5D6YA 3OS2A 1JJ2S 1KD1C 1Q82R 4LDYA 2HCKA 1PSFA 4XTXA 4DBHA 2OAUA 4JJCA 1G3TA 4F16A 1W2BS 4O5VA 4CI0C 2QQRA 3G6EQ 3GP8A 2OX7A 2RJCA 1FMKA 3X20B 2AK5A 5A0DA 3RMSA 3OYMA 1D3BB 2DYIA 3CCMQ 1LVKA 3L42A 2E41A 1ZA2B 3RNJA 3JCMW 2KGTA 1Q95G 2X3XD 4MZPA 2RMOA 4OMFB 4J9HA 3LWIA 1K4US 3CCQT 1D1BA 2A37A 4AT1B 1WHJA 5HCKA 4AFQC 3LH5A 1R8OB 1JJ2P 1NG2A 4IUVA 4IUTA 2GQVA 4DA4A 3V8LA 2HNIA 2EGCA 3UA6A 2LJ0A 2NWMA 1W2BP 1M3BA 2DTHA 2JS2A 1PD1A 2V8IA 2AIRB 3SWNB 2E3IA 3CCRQ 1MV3A 2F5TX 3JCMf 4JS4A 3OYGA 2LZ6B 4QQDA 2DF6A 1TWBA 1NLOC 4M75A 1LOJA 2CS7A 5CR2A 2A3LA 2K9GA 2X4YA 1OPKA 1T0JA 4ME7A 4XK8E 3G6EA 1AEYA 2FZCB 4OMNA 5FU7C 3QDFA 2HQEA 3S3NA 1TUDA 1GXIE 2RB6A 1QWEA 4GLKA 1PSEA 1VQ6T 2QQ9A 2LC4A 1RACB 2LDMA 1GL5A 1VQOQ 2C0TA 2DIGA 4C8QC 1IHVA 1ABQA 4Q5WA 3CD6A 2DMOA 2CZ0B 3TREA 1GFDA 1NBEB 1VQLT 1QCFA 1Y07A 4EMGA 1KC8R 2GTJA 1YI2A 1RAEB 2QQAA 3VU3C 1Q81R 5GMKm 4J9DA 4R55A 1ZSZB 3PIOA 1SEMA 2X4JA 3BY7A 3HL8A 2E1HA 2RHXA 2ROTA 2YUQA 3VYGA 2OJ2A 1UEBA 3H0IA 1U8RA 1HXDA 4PJOA 1MMAA 3UPUA 1I81A 2KE9A 2ZPGB 3CCRA 1V29B 2HQHA 3X28B 2ZPFB 5FW9A 5I2MA 2CP5A 2DL8A 2C06A 3G71Q 4A4KA 2MWOA 4C92A 1RUWA 5KE2A 2DRKA 1UFFA 3TQ7P 1NJIC 5CAIA 2RA2A 2JS0A 2CT3A 1UHFA 2DL7A 5DLOA 1SHGA 4FCYA 4BDYA 3HSBA 4JRPA 4X9CA 3PE0A 2XIDA 4KH0B 3QHSA 2ED1A 4M7DF 2P0PA 2ECZA 2HMAA 4QVZA 3JCMb 3BDUA 4J7IA 4C8QD 2LCLA 1JRIA 4DBFA 1VQOA 5DY9A 2MOXA 4FIBA 3A8GB 3THKA 4ZTJA 3FB9A 1C6VX 4O6JA 1Q7YC 2DD5A 3GIBA 1OOTA 2K2MA 2DBMA 1NJIU 2PVOB 5HK0A 3MKDA 3JCMg 2YRVA 4E6RA 3QJYA 5KH6A 2BUDA 4KT0E 4KUIA 5CIUA 1M9SA 3RERA 3EG1A 3FC3A 2DRMA 3FDRA 2JMAA 2O9VA 5CKEA 3M54A 2QDLA 3OYNA 3G71A 4RUGA 3JCMP 3KBGA 2EYXA 4MZTA 3UF4A 1SPKA 2KQWA 2KBTA 4OB0B 1Q82U 1I5OB 3CCST 1VQ8T 4C5EA 3PT9A 2V26A 4D8DA 1UGQB 4L5GA 2BZ8A 1VQ8Q 4IIOA 5FRMA 2ZZDA 4OGCA 5GAMd 1NE8A 3C12A 2V1RA 2VUBA 1XQHA 3HFNA 2HKNA 1YFNA 5IHKA 4II1A 1KK7A 2K3BA 2NUPA 3JB9J 4XU2A 1UJYA 2JN0A 3QJ6A 1SSHA 3OYEA 2EFIA 4JUVA 4NL3A 4E7KA 4M77F 1QKXA 3WXMB 3CMAQ 5FU6C 2E10A 3VKIA 3O8VA 3EG2A 2XU8A 1KJWA 4L59A 4MDXA 2K4YA 3MP8A 1M8MA 3L2WA 1VQNA 3QKJA 2KNBB 1BIBA 2OTLT 1K73C 2EKHA 3M0PA 2CGHA 1I0CA 4F7UF 3JB9I 1GRIA 1BU1A 5GANf 4DEYA 1K0SA 1VIEA 4JLGA 3OBYA 4M75B 3G7ZA 1G3WA 3MHXA 3H6ZA 2PUOB 4CC3A 4ZNXA 2KYBA 2BIVA 3I56A 1FWZA 2QA4T 1WA7A 5EG2A 2F2XA 4EPCA 3NGPA 1D0XA 1RABB 3G4SA 3PTAA 1SSFA 3CCUT 3PFSA 1WXTA 3M58A 2WSCE 1E6HA 2DXBA 4QKUA 1AVZC 2HEQA 1O9SA 3M4GA 4OMMA 3CMAA 4PNOA 3OYIA 2HAXA 5A0GA 2XG8D 3RKWA 4IKFA 1S72T 1JU5C 4BE1A 2DXUA 4EMKA 5GAOn 2CP0A 3CMEQ 4CC4B 4L6V5 1UE9A 4PJOB 4PLIA 5KYUA 2EYQA 5GAN6 5L8RE 2ED0A 4FSSA 4K11A 2KT1A 3CXCA 1VQPA 2L5QA 4C92B 4KUDK 3QO3A 2YWWA 1RLPC 2PNIA 2RQRA 1BI0A 1X2QA 1X6BA 1YIJT 4JRQA 3FJ5A 2YUOA 5GMKl 1QVFS 1NPPA 1WQWA 1M2OA 4Z8AA 3NTKA 1BCOA 2RI3A 1WGSA 1NYGA 2W10A 1F1BB 2FB7A 2RM4A 3MEAA 3META 3X24B 3INZA 1GBRA 1U1SA 2PUKB 1PCXA 3D7SB 3OY9A 1K8AC 2QTXA 2NUZA 2J6OA 2Y90A 3QBYA 4NL2A 4OP0A 3CCEQ 3FRNA 5AT1B 2JOYA 5GANg 5GAOr 3CMEA 3GBQA 3GF5A 1PC0A 2L89A 1YBYA 2DETA 2RH2A 2QG9B 3JCMe 3CPWA 1M90C 1QVFP 4N0AA 2ZPIB 2H3JA 2J05A 2IIMA 1V76A 2YUNA 5LJ5d 2DKGA 1M8VA 3KUFA 2C0OA 4E2FB 2ROLA 4A63B 1UHCA 3JAME 2EQKA 2X35A 2JM9A 4JPBW 5CVIA 1HYOA 4YTLA 1QVPA 2AT1B 4ESRA 5C6SA 4PK4A 1WHHA 1W70A 1OU9A 1VQ7A 5KYYA 3OYDA 2K5LA 2K3YA 3I5SA 2G3RA 1RL2A 4D8KA 1WX6A 2QK0A 3VS2A 3A8LB 2C0IA 2P0QA 2AZVA 2GFAA 4LN2A 1T0HA 4C5HA 1WHKA 3S3MA 4HCKA 2NUPB 4FYXB 3CCEA 4FSXA 3VS7A 2HD0A 3CCLA 3E9GA 4J9GA 3RR6A 1ABOA 2K57A 4XTUA 1AD5A 5CKHA 1TTHB 2RI2A 4WF2A 1EIFA 3NHNA 1RI0A 1LNXA 4CC2A 1B34A 4R0KA 1WPYA 4FYVB 2KRSA 2JW4A 1M3CA 2DJQA 1JB0E 1PD0A 2VXEA 5LJ3d 4B9XA 5I11A 3RMQA 1D0YA 2X4WA 2L0AA 1XOVA 5EC7A 3CXCS 2KXCA 2D6FA 2EJGA 2QI2A 2CYZB 4RTZA 3DLMA 2QGFB 4E7IA 2KDSA 1MGQA 4Z02A 4BY6B 3TU4K 4PJOE 3PVLA 1TH7A 1AWXA 3BW1A 4AFUC 2RPNA 4PJOG 1J3TA 2Y4YA 3QIIA 4FM4B 3VUZA 4F17A 2PVDB 2LNVA 1JQQA 1H641 4JRKA 4C92E 4RG8A 1NJIR 3UA7A 3JV3A 2L8DA 2QDYB 4C92G 2JM8A 2FPEA 1AT1B 4M78B 4M7AB 1UJ0A 4JZ4A 1GCPA 2JJ9A 3PNWC 3M4YA 3QYGB 3VUBA 1Y0MA 2DZ9A 4J9IA 2KEAA 2DLPA 1W4SA 3DKMA 1OZ3A 2LP5A 1X6OA 1UTIA 2EKOA 4UC4A 3O5ZA 1AWOA 1YJNQ 2F1LA 4EMKB 3QZ5B 1ZLMA 1Q7YR 4DEXA 4ZGEB 5GAMh 5KYUB 3CBOA 2RJEA 5LL6S 1GFCA 1N27A 4OMLA 2GF7A 1B3QA 1JBMA 2YSQA 1VYUA 5KE3A 2ESWA 5CO7A 3JB9G 4BDZA 1Z9ZA 1G2BA 3OW2P 3G6ET 2DK3A 1ZUKA 3FEOA 2KSSA 2DA9A 3OS0A 2RJDA 4ELYC 2F69A 4HA8A 3CC4A 4LXCA 3M55A 3TEEA 3LLRA 3GLXA 3VV0A 3CCMT 3CD6T 2SRCA 1WJQA 1G3SA 2WSFE 5GAOm 2DE0X 1BK2A 3EG0A 2AKLA 3CD6Q 4N4HA 1UGRB 1SG5A 1YI2T 3LX7A 1KD1U 2WACA 5DLQE 4DOWA 2DD4A 1YJ9Q 2MAMA 1YI2Q 1B7TA 2I0NA 5KCOA 1R77A 4E47A 2M9UA 1YJNA 3JB9H 2EAYA 3VS5A 2HSPA 1C1AA 2VB6A 4DQ2A 4R56A 3CCRT 3L2VA 5GANe 2LX7A 1BI2A 4ZGJB 4LDVA 1D0ZA 4WTOB 2V8JA 2X3WD 5CCAA 2KYMA 4C92C 3G1JA 2CP3A 3SB2A 1HK9A 4ZN1A 9ATCB 4GY5A 3L1AA 3ULRB 2VC8A 5FWBA 1UB4A 2OI3A 1VQKQ 1VQOT 1M1KC 5KYYB 3I5RA 2JNGA 4HCBA 1AOJA 1K73R 2XD0A 4J9CA 4CC7A 3FIFA 4LDXA 2V1QA 1IRXA 1PHTA 3R6OA 3VS6A 4OMOA 1YHQA 1YJ9A 3EHRA 4OB2B 4C5GA 1YITQ 4C8QF 2A36A 3RUXA 2L2PA 1M2VA 2M0OA 4MZMA 1VUBA 2DILA 4ZN3A 2A7YA 4PJOD 4RTWA 2H3EB 2MPXC 1M1KU 1VQMQ 3LYIA 1B34B 3A98A 2CUBA 1B07A 3URGA 3G71T 2B86A 2CT4A 1ZHIA 4JDSA 1E7OA 4PKCC 4XTVA 4C0FA 4M78E 1X69A 3NTHA 4M7AE 4C92D 3J7AF 4M78G 3LGLA 1GCQC 2E64A 1D09B 4M7AG 4J9BA 4HXJA 4KRTA 2M16A 1NM7A 3TSWA 3LW5E 1ZA1B 2CDTA 2L3RA 3H41A 4VUBA 1FYNA 1VQKA 2ZGWA 1Y57A 3EAEA 4KULA 1YJWA 1OULA 2RHUA 1X27A 2DVEA 2VXFA 2MMPA 3GOXA 1VA7A 2EGEA 2NYSA 2M51A 1YITA 2NUTA 2Y4XA 5LJ5h 1P92A 5J26A 3JB9D 3H0HA 4DBQA 2VYTA 1K76A 3V7SA 3A1PA 1I07A 3AHUA 1EFNA 2EQMA 1KQSA 1VQMA 1NPRA 5GMKh 1VQNT 2P4TA 2K79A 1WHGA 2HL3A 3EFSA 2QAZA 3WVDB 1QMCA 1VQNQ 1V1CA 2LX9A 2R5AA 4C0GA 2EQIA 1Q7YU 2RN8A 3M59A 2DTOA 1MNEA 1K8AR 2EJ9A 3RKYA 3PMTA 1AWJA 1E6GA 5CQYA 2ENMA 2BKDN 1RLQC 2EWNA 3HRSA 2JT4A 3OSVA 3OYCA 5GAMj 3I56T 2QEXQ 2B8AA 2RD1A 1VQ4Q 1M90R 3GNFB 1WI7A 4M7DA 1Z9QA 3I56Q 5D6XA 5I21A 5A0LA 3RKXA 3G4SQ 2RHIA 4A4FA 5FRNA 5HK3A 1AZGB 3JRZA 1ZBXA 4M78C 5LJ3h 4M7AC 1CKBA 1VQ9Q 4FYYB 3CMAT 4RCBA 4Y91A 2K7AA 1TUGB 1H3HA 2LVMA 1M4ZA 3I55A 3CEYA 3LWHA 5I22A 4JRIA 2JXBA 1QP2A 1BIAA 2L3SA 1PWTA 4FYWB 2DM1A 3EH2A 4E7HA 2OTJQ 2LRQA 1X2KA 2HL5C 1KIKA 1CSKA 2L3QA 3WVEB 2I2LA 2DX1A 2ABLA 3HRUA 2DTIA 4X34A 1X43A 4BI3A 1VQPT 1AWWA 3OYLA 4PL6A 4Z88A 1VQPQ 2QEXA 4BI4A 1K9MC 1QWFA 2A28A 1VQ4A 2QQBA 2PQWA 2E6NA 7AT1B 2LTOA 4AFZC 1M1FA 3P8HA 4DBRA 2BE7D 3M0SA 1YWOA 4J6WA 1K73U 3QPHA 2AZSA 4M78D 2H8HA 1N8RC 3CC2Q 1IB8A 4IIMA 4M7AD 3H9NA 2P0KA 2J06A 1VQ9A 5CQXA 4C0ZA 2XI9A 3L2RA 1Q81C 4FW1A 3T9NA 4LDUA 3GPLA 4PLLA 1N6AA 4OF1A 1K9MU 3EGXA 3CMET 2RF0A 1KQ1A 4J9EA 1M2VB 1AHJB 1UGSB 4M77A 1M5Q1 2DEQA 3EG3A 2HSEB 4C0DB 1G3YA 1TS9A 5GAN4 2MF2A 3PVQA 1T3SA 2OTJA 1RAGB 3JCMd 3CBMA 2J6FA 1VQ5Q 2XDBA 3SWNC 4DOVA 1BBZA 4N0AC 3OYBA 1FXXA 2CREA 2YRDA 4JS5A 2PTKA 3CCVA 1RAFB 3QXEB 2E3HA 4F7UA 5FROA 3NTIA 3QYHB 4B9WA 1ZQ1A 1ZX6A 4HKEA 2FRWA 2QXFA 2FG0A 2KK4A 1QQJA 1YCSB 4QW2A 1VQ7Q 4RTVA 3E9FA 3CC2A 4BB7A 2CSQA 4FT2A 2JZ2A 1YP5A 3C4SA 4E7ZA 3V8KA 1NYFA 1KD1R 5HKCA 2CKKA 5FU7B 2RJFA 3CCET 1K0XA 1TUCA 2NUTB 1YN8A 4Y92A 4XAXB 2FYKA 3OYFA 3CCLT 4KBMB 3M57A 3SEMA 1ZSZC 1KFZA 2VWFA 2RQVA 4C5IA 3CCLQ 4LD6A 4QT7A 5IXFA 4OMQA 5LJ5j 2E4HA 1VQ5A 4ANJA 4OB3B 2KVQG 1FX7A 5KYWA 5J3BA 4A4HA 3FLGA 2YHTA 3E1SA 2VGMA 2VVKA 4MMKA 1EZZB 3C95A 5GMKj 1K8AU 4RMOA 2LNHB 4HVVA 3L2UA 4PFPA 2XK0A 3CCJA 2EIFA 4XTZA 4F14A 4AG1C 5GAN8 3MEUA 1N5ZA 2XMFA 1M90U 1MHNA 4M7DB 3RBBB 1PRLC 2IPOB 2D8HA 1I4K1 3EG9A 1KHIA 1W2BA 4M75E 3ZEHA 1ZSGA 4M75G 2VKNA 3UATA 2MWPA 3MEWA 2DYBA 2LT1A 1M1GA 2MIOA 3OYYA 3EGDA 5CKDA 1M1KR 1QKWA 2ZAEA 2RQUA 5LJ3j 1OYXA 4HCZA 2ZPHB 5HY6A 4OB1B 5GAN2 2KMTA 1K1ZA 5D6WA 1CKAA 2EYYA 1VYTA 1IZ6A 5KYNA 3VS1A 3P8DA 3PGGA 1ACMB 2EYZA 3MP6A 4BD3A 3BFMA 4GLMA 5ECAA 1XJWB 2GBQA 3OMGA 4PJLA 2QGGA 2DERA 4PJNA 4B6MA 1UGPB 3EHQA 3QG1A 3CC4Q 5KYXA 5GAN3 3SHWA 5GJWB 1PKSA 2K2VA 4PFOA 3HPWA 2COWA 1NEBA 1FMVA 2LCCA 4X9DA 2LT4A 3GNGA 2IVWA 2FL7A 2CZ1B 3CXCP 1M30A 4RTYA 3OYKA 2SEMA 3MJXA 2LCSA 2CH4W 2KT8A 1YJNT 3OS5A 3JCMQ 3EGXB 4AG2C 3M0RA 4HT9A 4M77B 4HVUA 3CPWS 1N9SA 2COYA 3V7RA 4J6XA 3REBB 4HT8A 1H92A 2P84A 1U06A 3CC7Q 2DZCA 5GANd 4FT4A 3ZFJA 2XDDA 5CKFA 2O2OA 3U23A 4XU0A 2YDLA 5FU6B 3OYAA 2LMJA 1HSQA 1ZUUA 3MEVA 4F7UB 4M75C 4OMPA 3BE3A 2EGAA 2KRNA 3RIRA 4X1VA 3JCMX 5DM7R 1PM3A 1MUZA 2E70A 3REAB 4M75F 1JXOA 2XHCA 4QVDA 1PRMC 2ZPEB 4JJDA 3MCAB 8AT1B 3CPWP 2P4RA 1YHQT 3HP9A 3VS4A 1QCNA 1YJ9T 4TVRA 4J7FA 2YT6A 3HKSA 1G83A 2DIQA
chains in the Genus database with same CATH topology
1XTDA 1I8FA 3FJPA 3PFSA 5LJ5h 1P92A 5J26A 3JB9D 3UDCA 3HRTA 2HQXA 3M58A 2WSCE 2VYTA 3OYJA 2DXBA 5J39A 1G5VA 3V7SA 5IT9E 2V8KA 4A4EA 4C0DC 1BYMA 1O9SA 1N9RA 3X25B 3M4GA 3AHUA 4M7DE 3CMAA 4J5YA 1Y71A 3TCJA 4PNOA 1KHCA 2EQMA 3OYIA 1VQMA 1KQSA 1NPRA 2DO3A 3V8JA 2HAXA 5A0GA 3CC7A 2R57A 2XG8D 2ZPBB 5GAN5 3RKWA 5GMKh 3J81E 1S72T 4IKFA 3OS1A 1VQNT 4PJOC 2P4TA 1YCYA 4BE1A 2DXUA 4EMKA 3M56A 3H8ZA 2K5IA 3EFSA 5GAOn 1QVGA 3WVDB 2R58A 1Y96A 5I2SA 4L6V5 2LX9A 1U1TA 2R5AA 4C0GA 1Q7YU 4PJOB 3M59A 2DTOA 4PLIA 2IG0A 4M75D 4PJOF 1LJOA 1OZ2A 2EYQA 2EJ9A 3A8OB 3RKYA 4XTYA 5GAN6 3PMTA 5LJ5e 2D9TA 3JCMV 5L8RE 2VGNA 2WSEE 5CQYA 4XU3A 3QUIA 2RO0A 2R5MA 3BDLA 2BKDN 1VQKT 3CC4T 2EWNA 3CXCA 1VQPA 2DPPB 2K3XA 1BI1A 2L5QA 3HRSA 3ME9A 4C92B 2XKOC 4KUDK 3QO3A 4C92F 3OSVA 4IURA 3OYCA 5GAMj 3I56T 1Q86C 1BI0A 1YJWT 1QP3A 2B8AA 2RD1A 5KCHA 4JRQA 1YIJT 4A54A 2DJZA 5GMKe 3GNFB 4M7DA 5GMKl 4A4GA 1QVFS 1NPPA 1WQWA 3OYHA 5GAMg 5D6XA 4V2SA 3NTKA 5I21A 5A0LA 3RKXA 1YITT 2RI3A 3JCMh 1WJSA 2NLUA 1WGSA 2RHIA 4A4FA 2FB7A 4ELZC 5FRNA 1O75A 2RM4A 3MEAA 3ER0A 3META 5HK3A 3JCMJ 3QZ9B 3JRZA 1ZBXA 4M78C 3INZA 5LJ3h 3X24B 5M9OA 4M7AC 3RESA 1U1SA 2PUKB 4EDUA 4EMHA 3CCMA 3CMAT 4RCBA 2XICA 4Y91A 3OY9A 5GANj 2E6ZA 2QTXA 2Y90A 1VQMT 1K8AC 3QBYA 2DAQA 5GAMf 3CC7T 2LVMA 1M4ZA 3OW2S 5FLXE 4NL2A 3I55A 4OP0A 4M7DG 3FRNA 1Q86U 3CEYA 1DJ7B 3LWHA 3JB9F 2JOYA 4JRIA 4OVAA 5GANg 5GAOr 3CMEA 1QP2A 1BIAA 4E7JA 2FVUA 3GF5A 3CCQA 4HCCA 3M5AA 3M9QA 4OGEA 1WJRA 1H3ZA 1IREB 1XNIA 4N4IA 2L89A 1YBYA 3SFMA 2GFUA 2RH2A 5CKBA 4MDWA 3JCMe 3CPWA 4E7HA 3HFOA 1M90C 2LRQA 4N0AA 2ZPIB 2H3JA 4C8QE 4J8OA 3WVEB 2I2LA 4RKUE 3OB9A 5LJ5d 2DKGA 3HRUA 3VYHB 1M8VA 1Y7XA 4C8QG 3KUFA 2DTIA 4X34A 4BI3A 1VQPT 5LJ3e 3OYLA 4M77E 4P5NA 4NS5A 3JAME 4PL6A 2EQKA 2GCXA 2DXCA 4M77G 2QEXA 2X35A 4BI4A 1K9MC 3E19A 2RI5A 3OSSC 5D6YA 3OS2A 1VQ4A 2KY9A 5CVIA 4YTLA 1JJ2S 1KD1C 1QVPA 2PQWA 2QQBA 2QQSA 2E6NA 2LTOA 4LDYA 2RK1A 5C6SA 1PSFA 4XTXA 4M7DC 1M1FA 2OAUA 2VV5A 5LJ5f 1VQ7A 1G3TA 3OYDA 3P8HA 2K5LA 2LQ8A 1W2BS 4O5VA 2K3YA 2G3RA 1RL2A 2YLCA 4J6WA 2QQRA 4CI0C 3GP8A 1K73U 3QPHA 2RJCA 4M78D 4BE2A 1N8RC 3A8LB 2O4XA 2P0QA 4F7UE 3DLLA 4M7AD 3X20B 2P0KA 5A0DA 1VIFA 1VQ9A 4F7UG 5CQXA 4C0ZA 2XI9A 3L2RA 1Q81C 3RMSA 3SD4A 3T9NA 2GFAA 1VQ6A 3OYMA 4C8QA 1D3BB 4LDUA 4C5HA 3S3MA 3L42A 3GPLA 3I55T 2E41A 4PLLA 3JCMW 3CCEA 4FSXA 4MMLA 1N6AA 3OA6A 4MZPA 4OF1A 1K9MU 4OMFB 2HD0A 3PIPA 3CMET 3CCLA 1KQ1A 3E9GA 1VQLA 1VQ8A 1AHJB 1UGSB 2K57A 1M5Q1 2DEQA 4M77A 3LWIA 4XTUA 3CCQT 5CKHA 4C0DB 1G3YA 2RI2A 4WF2A 1EIFA 5GAN4 3S6WA 1RI0A 2MF2A 1LNXA 1R8OB 1B34A 3EFRA 1I5LA 3N5BB 1QVGS 2OTJA 2PVGB 4IUVA 3JCMd 3CBMA 2E65A 4IUPA 2EJFA 1WPYA 4IUTA 1Q82C 3QSUA 1NZ9A 2GQVA 3SWNC 4DOVA 3L2QA 2XDBA 4N0AC 3OYBA 4DA4A 3V8LA 2HNIA 1JB0E 5GMKi 1FXXA 2VXEA 2DTHA 4JS5A 5LJ3d 3CCVA 3QXEB 2V8IA 4B9XA 3SWNB 2JTMA 3RMQA 2X4WA 5FROA 4F7UA 3ASKA 3LH0A 2QEXT 1VQ4T 1XOVA 3NTIA 4N4GA 3CXCS 3QYHB 4B9WA 4BY6C 2F5TX 3JCMf 3J80E 4JS4A 2D6FA 3OYGA 2EJGA 1ZQ1A 4M7DD 2QI2A 2CYZB 3OQ5A 4QQDA 3DLMA 4HKEA 2QXFA 2CZ7B 1LOJA 4M75A 4A53A 2CS7A 5CR2A 2A3LA 4E7IA 2X4YA 2KDSA 4LD9K 2KK4A 4ATOA 4QW2A 4NOYA 3G4ST 1MGQA 4ME7A 4XK8E 4Z02A 5LJ3f 4BY6B 3G6EA 3TU4K 4PJOE 3E9FA 5FU7C 1TH7A 3CC2A 2HQEA 3BW1A 4BB7A 5CK9A 4FT2A 2JZ2A 3S3NA 2RB6A 4PJOG 4GLKA 1GXIE 1PSEA 1VQ9T 2Y4YA 4IUUA 3C4SA 3QIIA 4FM4B 3VUZA 1VQ6T 4IUQA 2PVDB 2LNVA 3V8KA 1QVFA 2QQ9A 5HKCA 4BI8B 2LC4A 2CKKA 5FU7B 1H641 2RJFA 2LDMA 3P8BB 3CCET 2DIGA 4JRKA 1BI3A 4C8QC 4C92E 4Q5WA 3CD6A 4RG8A 4LDWA 4XAXB 2CZ0B 3TREA 2FYKA 3OYFA 3CCLT 1VQLT 2L8DA 2QDYB 4KBMB 4M78B 4C92G 3M57A 4M78F 4M7AB 1Y07A 4EMGA 3MO8A 4M7AF 3PNWC 3M4YA 4C5IA 4XQ3A 3QYGB 4LD6A 4M77C 3VUBA 3OMCA 2DZ9A 1YI2A 2QQAA 4RG2A 4EMKC 2OTJT 2E5QA 1W4SA 3DKMA 3LGFA 5LJ5j 3VU3C 1OZ3A 1VQ5A 1X6OA 5GMKm 4OB3B 2KVQG 2EKOA 4R55A 1FX7A 4UC4A 3PIOA 5J3BA 4E7LA 4A4HA 3FLGA 2X4JA 3BY7A 3HL8A 4EMKB 5LJ5g 2E1HA 2RHXA 3QZ5B 3VYGA 5GAOl 2YHTA 3CCVT 3E1SA 1Y96B 5A2QE 1UEBA 2M1HA 1WQ7A 1HXDA 2RHYA 2VGMA 1U8RA 4PJOA 4MMKA 4ZGEB 3UPUA 1I81A 3C95A 4JJNK 2ZPGB 5GMKj 5GAMh 3CCRA 1V29B 3DB3A 5IN1A 1K8AU 3CBOA 2RJEA 5LL6S 4RMOA 1KG1A 4CRIA 1N27A 2GF7A 3X28B 2ZPFB 5I2MA 1JBMA 1OI1A 2C06A 3L2UA 4BE0A 2XK0A 3CCJA 4A4KA 5KE3A 1QW1A 2MWOA 4C92A 5CO7A 3JB9G 5KE2A 4BDZA 2EIFA 1NJIC 5CAIA 3DB4A 4XTZA 3G6ET 3CC2T 4JLIA 5GAN8 2DK3A 5DLOA 3MEUA 3FEOA 3M53A 5IAYA 1KC8C 2JTFA 4BACA 4BDYA 2KSSA 3OS0A 3L2ZA 2RJDA 4ELYC 4JRPA 1M90U 1MHNA 4X9CA 3HSBA 4M7DB 2XIDA 2F69A 4HA8A 3QHSA 4M7DF 3CC4A 3M55A 2P0PA 3CCSA 1X75C 3LLRA 3GLXA 4QVZA 4Y28E 3PMIA 3BDUA 4J7IA 3JSCA 3TEEA 3VV0A 3JCMb 3CCMT 4C8QD 5GANh 2AHJB 2LCLA 1JRIA 1VQOA 3CD6T 5DY9A 1WJQA 4FIBA 3A8GB 1G3SA 2FHDA 2WSFE 5GAOm 1I4K1 4ZTJA 1KHIA 5GAMe 1W2BA 2ZCFB 4M75E 3ZEHA 3FB9A 2F5KA 4N4HA 4O6JA 1Q7YC 2LQKA 4M77D 1UGRB 4M75G 2DD5A 2MWPA 3CBPA 3MEWA 3LX7A 2LT1A 1YI2T 1M1GA 1KD1U 2WACA 1KQSS 3GIBA 3A8HB 2PU9B 2O01E 3OYYA 5DLQE 4DOWA 1WNLA 2DD4A 1VQ5T 5CKDA 1NJIU 2MAMA 3MP1A 4M78A 4ZTFA 2EQJA 4M7AA 2DXTA 2PVOB 5HK0A 3JCMg 5KCOA 3HHTB 2YRVA 5LJ3j 1KC8U 4E47A 2M9UA 3QJYA 1YJNA 5KH6A 3JB9H 2BUDA 4KT0E 4QQGA 3ZBDA 1OYXA 4KUIA 5CIUA 4HCZA 1N8RU 1M9SA 3RERA 2ZPHB 5HY6A 2JUFA 2EAYA 3FC3A 3FDRA 4DQ2A 3JCMc 5LJ3g 4OB1B 5C0MA 5GAN2 2KMTA 4R56A 3X26B 3CCRT 1Q81U 3L2VA 5GANe 5CKEA 3M54A 3OYNA 1BI2A 3CPFA 5D6WA 4J83A 4ZGJB 4LDVA 1IZ6A 3C94A 3CCJT 3QDRB 2D0QB 2V8JA 3G71A 3P8DA 3KXTA 2XDPA 3JCMP 3KBGA 4MZTA 3PGGA 1X01A 1VQ7T 5CCAA 4C92C 2OTLA 3MP6A 4BD3A 3SB2A 1HK9A 3BFMA 3SDZA 4ZN1A 4ZGDB 2KQWA 4XU1A 5GAOp 4FU6A 4OB0B 4GY5A 3L1AA 1Q82U 3OMGA 2VC8A 3CCST 1VQ8T 4C5EA 2MI6A 5AYFA 2KAFA 3PT9A 1UB4A 1UGPB 1UGQB 2X4XA 4L5GA 1VQOT 3QG1A 1M1KC 1KQ2A 2JNGA 5GAN3 4HCBA 3CCUT 4BUGA 5FRMA 2XD0A 2ZZDA 4OGCA 2CZ6B 5GAMd 1NE8A 3C12A 4J6YA 2K2VA 2O4XB 3FIFA 4LDXA 2VUBA 2QA4A 3HPWA 1XQHA 3HFNA 3R6OA 1D3BA 1YHQA 4XTWA 2LCCA 2EQUA 2LT4A 4X9DA 4II1A 3GNGA 1YJ9A 4OB2B 4RCCA 2IVWA 2FL7A 2CZ1B 4FL6A 4C8QB 4C5GA 4XU2A 3JB9J 4C8QF 3A5ZB 3OYKA 3CCUA 1BKBA 3RUXA 1YJNT 2JN0A 3QJ6A 3OBWA 5GAN7 2M0OA 3OS5A 4MZMA 3JCMQ 3HKSA 1VUBA 3OYEA 2EFIA 4JUVA 3F70A 4NL3A 3OW2A 4E7KA 4HT9A 4M77B 4ZN3A 3CPWS 1N9SA 4M77F 2A7YA 4PJOD 3V7RA 4J6XA 3WXMB 5FU6C 2E10A 3VKIA 4D6WA 3O8VA 1M1KU 2XU8A 4HT8A 3LYIA 1B34B 4L59A 4MDXA 2K4YA 2K5FA 3MP8A 2DZCA 3Q1JA 5GANd 3L2WA 4FT4A 3ZFJA 2XDDA 3URGA 1S72A 5CKFA 1VQNA 2JVVA 3QKJA 3G71T 1ZHIA 2RK2A 4JDSA 4PKCC 4XTVA 4XU0A 4C0FA 4M78E 5FU6B 2HBPA 3NTHA 4M7AE 1BIBA 4C92D 2OTLT 3OYAA 3SWNA 1K73C 3J7AF 4M78G 3LGLA 2E64A 4M7AG 3MEVA 2CGHA 3NFCA 2M16A 4F7UB 4M75C 3A8MB 3LW5E 4F7UF 3JB9I 2L3RA 4QQ6A 3RIRA 3JCMX 5GANf 5DM7R 4VUBA 1VIEA 2E70A 2YLBA 2ZGWA 3OBYA 4JLGA 4M75B 3UWNA 3VJPA 1JJ2A 1VQKA 3G7ZA 4M75F 2XHCA 1G3WA 3MHXA 4QVDA 3H6ZA 2PUOB 2Y4XA 3EAEA 3V7CA 2BIVA 2ZPEB 5GAOq 3MCAB 4KULA 3I56A 1FWZA 1YJWA 1YIJA 2RHUA 2QA4T 2DVEA 5EG2A 2VXFA 3UT1A 1YHQT 2MMPA 3HP9A 4QVCA 3GOXA 4EPCA 3S3OA 1YJ9T 4TVRA 2RHZA 4J7FA 3G4SA 1YITA 2E12A 2RA2A 3PTAA 1SSFA 2DIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOW A;  1M4Z A;  4JJN K;  4DOV A;  4FT4 A;  4LD9 K;  4DA4 A;  4KUI A;  1ZHI A;  3TU4 K;  2FVU A;  2FL7 A;  4KUL A;  4BB7 A;  4FT2 A;  1W4S A;  4FSX A;  3PT9 A;  1ZBX A;  4KUD K;  3PTA A; 
#chains in the Genus database with same CATH topology
 1YHQ Q;  1I8F A;  2COZ A;  2FZK B;  2KR3 A;  2DVJ A;  1TU0 B;  2EVR A;  3UDC A;  1QCO A;  3HRT A;  2OAW A;  1C0M A;  1PKT A;  1G5V A;  2V8K A;  4A4E A;  4KGX B;  4C0D C;  2MYS A;  3X25 B;  4M7D E;  3TCJ A;  3V8J A;  4M7D G;  3CC7 A;  2R57 A;  4PJO C;  1IGQ A;  2LQN A;  3OS1 A;  3EFO A;  5KYW B;  3M56 A;  2K5I A;  1IXD A;  1WLP B;  1QVG A;  1WXU A;  1Y96 A;  3VRY A;  3CCQ Q;  1T3L A;  1WHM A;  1JXM A;  4PJO F;  2IG0 A;  4M75 D;  4FW2 A;  1VYV A;  3VS3 A;  2D9T A;  5GJV B;  4KH1 B;  2R5M A;  1VQK T;  2DPP B;  4KGZ B;  3ME9 A;  2XKO C;  4C92 F;  2YRC A;  4IUR A;  2F2V A;  1Q86 C;  1YJW T;  1QP3 A;  2DJZ A;  4A4G A;  3OYH A;  1BCM A;  4WCI A;  5GAM g;  1YJW Q;  3E2U A;  2J7I A;  1YIT T;  1OEB A;  3JCM h;  1G8X A;  1WJS A;  1UUE A;  1IGU A;  2NLU A;  2DEU A;  2W0Z A;  1PG5 B;  1KSW A;  4ELZ C;  2EW3 A;  3JCM J;  3ER0 A;  3EG9 B;  3QZ9 B;  2A0F B;  1K9M R;  5M9O A;  2KRM A;  3CCM A;  2XIC A;  1VQ6 Q;  4F04 B;  1VQM T;  3EGD B;  4PJJ A;  5FLX E;  1Q86 U;  3JB9 F;  4OVA A;  4JJB A;  1VQL Q;  1MMD A;  1N8R R;  4E7J A;  2FVU A;  3CCQ A;  3M5A A;  1WJR A;  1XNI A;  1U5S A;  1WFW A;  1EX4 A;  2KI7 A;  2DFU A;  1K9A A;  4J8O A;  1RI9 A;  4RKU E;  3OB9 A;  3VYH B;  1OX8 A;  2EBP A;  4M77 E;  2VAS A;  1OX9 A;  2CP2 A;  4PFZ A;  3CQT A;  4M77 G;  3E19 A;  2RI5 A;  3OSS C;  2KY9 A;  1BB9 A;  2QQS A;  2RK1 A;  2BTT A;  4M7D C;  1U3O A;  3M0T A;  2VV5 A;  5LJ5 f;  3HTR A;  2YXY A;  2LQ8 A;  8ATC B;  5KYX B;  2YLC A;  2HBW A;  4BE2 A;  4F7U E;  2O4X A;  3DLL A;  1VIF A;  4F7U G;  3SD4 A;  1VQ6 A;  4AFS C;  4C8Q A;  2BE9 B;  3I55 T;  2FPF A;  4MML A;  1SF9 A;  1NLP C;  2FPD A;  3OA6 A;  3PIP A;  1ZUY A;  3I55 Q;  1VQL A;  3EGU A;  5FWC A;  3S6W A;  2E5K A;  1JO8 A;  1ARK A;  3EFR A;  1I5L A;  3N5B B;  1QVG S;  1UEC A;  2PVG B;  3TVT A;  2E65 A;  4IUP A;  2EJF A;  4RTU A;  1Q82 C;  3QSU A;  1NZ9 A;  3L2Q A;  2FZG B;  5GMK i;  1IHW A;  1YNZ A;  1SKU B;  2JTM A;  2QEX T;  3ASK A;  3LH0 A;  4KGV B;  1R0B G;  2EPD A;  1VQ4 T;  4N4G A;  2O88 A;  4BY6 C;  3J80 E;  4M7D D;  1RAH B;  4RTT A;  1GCQ A;  4LE9 A;  3OQ5 A;  1WZO A;  4Z89 A;  4LUD A;  2CZ7 B;  4A53 A;  4JZ3 A;  4LD9 K;  4ATO A;  2DL4 A;  4NOY A;  3G4S T;  5LJ3 f;  2O9S A;  3RDV A;  1MMG A;  2JTE A;  5CK9 A;  1VQ9 T;  4IUU A;  1QVG P;  1UGV A;  4IUQ A;  1I1J A;  1D1A A;  2L3P A;  3CCS Q;  1QVF A;  2LQW A;  4BI8 B;  3P8B B;  2CSI A;  1BI3 A;  2DL5 A;  1RAI B;  4LDW A;  2FRY A;  4M78 F;  3MO8 A;  4M7A F;  4XQ3 A;  4M77 C;  3OMC A;  2DNU A;  4RG2 A;  4EMK C;  2OTJ T;  2E5Q A;  3LGF A;  2FEI A;  4E7L A;  1WXB A;  3EFO B;  1VOM A;  2HZY A;  2PZ1 A;  5LJ5 g;  5GAO l;  3CCV T;  3TSZ A;  1Y96 B;  5A2Q E;  2M1H A;  1WQ7 A;  2RHY A;  1SHF A;  3CCV Q;  4JJN K;  1TSF A;  3DB3 A;  5IN1 A;  3EH1 A;  1KG1 A;  4CRI A;  2G6F X;  1NEG A;  1OI1 A;  4BE0 A;  1QW1 A;  2OTL Q;  3DB4 A;  4PJM A;  3CC2 T;  4JLI A;  5IHN A;  2CUD A;  1TXQ A;  3M53 A;  5IAY A;  1KC8 C;  2JTF A;  4BAC A;  1WDX A;  3NMZ C;  3L2Z A;  2AKK A;  3CCS A;  1X75 C;  1VQ8 A;  4Y28 E;  3PMI A;  3JSC A;  5GAN h;  2AHJ B;  3I9Q A;  2FHD A;  2HDA A;  5GAM e;  2A08 A;  2ZCF B;  1D1C A;  2F5K A;  2LQK A;  4M77 D;  2M0Y A;  3CBP A;  2QA4 Q;  1KQS S;  3A8H B;  2PU9 B;  2O01 E;  3M0U A;  3MPU B;  1WNL A;  1VQ5 T;  3MP1 A;  4M78 A;  4ZTF A;  2EQJ A;  2X9H A;  4M7A A;  1SRL A;  2DXT A;  3CCU Q;  3HHT B;  1KC8 U;  4QQG A;  3ZBD A;  1N8R U;  2JUF A;  2LJ1 A;  3JCM c;  5LJ3 g;  5C0M A;  1Q81 U;  3X26 B;  3CPF A;  4HVW A;  1LPL A;  4J83 A;  1S72 Q;  1MV0 B;  2DBK A;  3C94 A;  3QDR B;  3CCJ T;  2D0Q B;  1UDL A;  2QYZ A;  3KXT A;  2XDP A;  1X01 A;  3QWY A;  1VQ7 T;  2GNC A;  3CCJ Q;  2OTL A;  3SDZ A;  1YWP A;  4ZGD B;  4XU1 A;  5GAO p;  1KQS P;  4FU6 A;  2MI6 A;  5AYF A;  2KAF A;  5IXB A;  1PNJ A;  5D7U A;  2X4X A;  1KQ2 A;  2EYW A;  2RQT A;  4BUG A;  2CZ6 B;  1YIJ Q;  4J6Y A;  2O4X B;  2QA4 A;  3H0F A;  1GBQ A;  1D3B A;  3VS0 A;  4XTW A;  2EQU A;  4RTX A;  3KFV A;  2X51 A;  4RCC A;  4FL6 A;  4C8Q B;  4M4Z A;  3A5Z B;  2ATC B;  3CCU A;  1BKB A;  2YUP A;  2K6D A;  3OBW A;  5GAN 7;  1OU8 A;  1RAA B;  2DL3 A;  3F70 A;  5L23 A;  3OW2 A;  1S1N A;  4E7S A;  1RAD B;  2JMC A;  4D6W A;  2K5F A;  1TG0 A;  3Q1J A;  2GGR A;  2O31 A;  3C0C A;  3I35 A;  1S72 A;  2JVV A;  2RK2 A;  1OQK A;  2QAS A;  1UG1 A;  4LUE A;  2HBP A;  5IH2 A;  3SWN A;  1M27 C;  4AMC A;  3NFC A;  3AT1 B;  3A8M B;  1W6X A;  5IHI A;  1X6G A;  4QQ6 A;  3NPF A;  2BZX A;  1TOV A;  3VRZ A;  3M0Q A;  2YLB A;  1JJ2 A;  3UWN A;  3VJP A;  3V7C A;  5GAO q;  1YIJ A;  2KRO A;  1LCK A;  1HJD A;  3UT1 A;  3S3O A;  4QVC A;  1A0N B;  2RHZ A;  2E12 A;  1XTD A;  1JEG A;  3FJP A;  2RQW A;  4ORZ A;  2HQX A;  2KXD A;  3ZL7 C;  3OYJ A;  1Q86 R;  1HD3 A;  5J39 A;  1H8K A;  4GBQ A;  5IT9 E;  1MMN A;  1BYM A;  1FMW A;  1N9R A;  4J5Y A;  1Y71 A;  1KHC A;  2DO3 A;  2RNA A;  1ZSZ A;  2ZPB B;  5GAN 5;  3J81 E;  1OV3 A;  1M3A A;  1YCY A;  2MCN A;  3H8Z A;  2R58 A;  5I2S A;  2CP6 A;  1U1T A;  1LJO A;  1OZ2 A;  4J9F A;  3A8O B;  4LNP A;  4XTY A;  5LJ5 e;  2GQI A;  3JCM V;  1QLY A;  6AT1 B;  2HKQ B;  2VGN A;  2WSE E;  4XU3 A;  3QUI A;  2RO0 A;  3BDL A;  3CC4 T;  2K3X A;  1BI1 A;  2CP7 A;  5KCH A;  4A54 A;  1MND A;  5GMK e;  1WIE A;  2Z0W A;  2FO0 A;  4V2S A;  4EIK A;  3R6N A;  1R0C B;  2D1X A;  1O75 A;  3RES A;  4EDU A;  4EMH A;  1ZBJ A;  2QTV A;  2F2W A;  5GAN j;  2E6Z A;  3IQL A;  5GAM f;  2DAQ A;  3CC7 T;  3OW2 S;  1W1F A;  2CH4 A;  3QWX X;  1DJ7 B;  2J6K A;  4HCC A;  3M9Q A;  4OGE A;  1H3Z A;  1IRE B;  4N4I A;  3SFM A;  2GFU A;  1IO6 A;  5CKB A;  4MDW A;  2MK5 A;  3HFO A;  1OPL A;  1WHL A;  2BZY A;  1SRM A;  4C8Q E;  1WYX A;  1Y7X A;  2M02 A;  4C8Q G;  5LJ3 e;  1AZE A;  2GTO A;  4P5N A;  2D0N A;  4NS5 A;  2GCX A;  2DXC A;  2D8J A;  2LJ3 A;  5D6Y A;  3OS2 A;  1JJ2 S;  1KD1 C;  1Q82 R;  4LDY A;  2HCK A;  1PSF A;  4XTX A;  4DBH A;  2OAU A;  4JJC A;  1G3T A;  4F16 A;  1W2B S;  4O5V A;  4CI0 C;  2QQR A;  3G6E Q;  3GP8 A;  2OX7 A;  2RJC A;  1FMK A;  3X20 B;  2AK5 A;  5A0D A;  3RMS A;  3OYM A;  1D3B B;  2DYI A;  3CCM Q;  1LVK A;  3L42 A;  2E41 A;  1ZA2 B;  3RNJ A;  3JCM W;  2KGT A;  1Q95 G;  2X3X D;  4MZP A;  2RMO A;  4OMF B;  4J9H A;  3LWI A;  1K4U S;  3CCQ T;  1D1B A;  2A37 A;  4AT1 B;  1WHJ A;  5HCK A;  4AFQ C;  3LH5 A;  1R8O B;  1JJ2 P;  1NG2 A;  4IUV A;  4IUT A;  2GQV A;  4DA4 A;  3V8L A;  2HNI A;  2EGC A;  3UA6 A;  2LJ0 A;  2NWM A;  1W2B P;  1M3B A;  2DTH A;  2JS2 A;  1PD1 A;  2V8I A;  2AIR B;  3SWN B;  2E3I A;  3CCR Q;  1MV3 A;  2F5T X;  3JCM f;  4JS4 A;  3OYG A;  2LZ6 B;  4QQD A;  2DF6 A;  1TWB A;  1NLO C;  4M75 A;  1LOJ A;  2CS7 A;  5CR2 A;  2A3L A;  2K9G A;  2X4Y A;  1OPK A;  1T0J A;  4ME7 A;  4XK8 E;  3G6E A;  1AEY A;  2FZC B;  4OMN A;  5FU7 C;  3QDF A;  2HQE A;  3S3N A;  1TUD A;  1GXI E;  2RB6 A;  1QWE A;  4GLK A;  1PSE A;  1VQ6 T;  2QQ9 A;  2LC4 A;  1RAC B;  2LDM A;  1GL5 A;  1VQO Q;  2C0T A;  2DIG A;  4C8Q C;  1IHV A;  1ABQ A;  4Q5W A;  3CD6 A;  2DMO A;  2CZ0 B;  3TRE A;  1GFD A;  1NBE B;  1VQL T;  1QCF A;  1Y07 A;  4EMG A;  1KC8 R;  2GTJ A;  1YI2 A;  1RAE B;  2QQA A;  3VU3 C;  1Q81 R;  5GMK m;  4J9D A;  4R55 A;  1ZSZ B;  3PIO A;  1SEM A;  2X4J A;  3BY7 A;  3HL8 A;  2E1H A;  2RHX A;  2ROT A;  2YUQ A;  3VYG A;  2OJ2 A;  1UEB A;  3H0I A;  1U8R A;  1HXD A;  4PJO A;  1MMA A;  3UPU A;  1I81 A;  2KE9 A;  2ZPG B;  3CCR A;  1V29 B;  2HQH A;  3X28 B;  2ZPF B;  5FW9 A;  5I2M A;  2CP5 A;  2DL8 A;  2C06 A;  3G71 Q;  4A4K A;  2MWO A;  4C92 A;  1RUW A;  5KE2 A;  2DRK A;  1UFF A;  3TQ7 P;  1NJI C;  5CAI A;  2RA2 A;  2JS0 A;  2CT3 A;  1UHF A;  2DL7 A;  5DLO A;  1SHG A;  4FCY A;  4BDY A;  3HSB A;  4JRP A;  4X9C A;  3PE0 A;  2XID A;  4KH0 B;  3QHS A;  2ED1 A;  4M7D F;  2P0P A;  2ECZ A;  2HMA A;  4QVZ A;  3JCM b;  3BDU A;  4J7I A;  4C8Q D;  2LCL A;  1JRI A;  4DBF A;  1VQO A;  5DY9 A;  2MOX A;  4FIB A;  3A8G B;  3THK A;  4ZTJ A;  3FB9 A;  1C6V X;  4O6J A;  1Q7Y C;  2DD5 A;  3GIB A;  1OOT A;  2K2M A;  2DBM A;  1NJI U;  2PVO B;  5HK0 A;  3MKD A;  3JCM g;  2YRV A;  4E6R A;  3QJY A;  5KH6 A;  2BUD A;  4KT0 E;  4KUI A;  5CIU A;  1M9S A;  3RER A;  3EG1 A;  3FC3 A;  2DRM A;  3FDR A;  2JMA A;  2O9V A;  5CKE A;  3M54 A;  2QDL A;  3OYN A;  3G71 A;  4RUG A;  3JCM P;  3KBG A;  2EYX A;  4MZT A;  3UF4 A;  1SPK A;  2KQW A;  2KBT A;  4OB0 B;  1Q82 U;  1I5O B;  3CCS T;  1VQ8 T;  4C5E A;  3PT9 A;  2V26 A;  4D8D A;  1UGQ B;  4L5G A;  2BZ8 A;  1VQ8 Q;  4IIO A;  5FRM A;  2ZZD A;  4OGC A;  5GAM d;  1NE8 A;  3C12 A;  2V1R A;  2VUB A;  1XQH A;  3HFN A;  2HKN A;  1YFN A;  5IHK A;  4II1 A;  1KK7 A;  2K3B A;  2NUP A;  3JB9 J;  4XU2 A;  1UJY A;  2JN0 A;  3QJ6 A;  1SSH A;  3OYE A;  2EFI A;  4JUV A;  4NL3 A;  4E7K A;  4M77 F;  1QKX A;  3WXM B;  3CMA Q;  5FU6 C;  2E10 A;  3VKI A;  3O8V A;  3EG2 A;  2XU8 A;  1KJW A;  4L59 A;  4MDX A;  2K4Y A;  3MP8 A;  1M8M A;  3L2W A;  1VQN A;  3QKJ A;  2KNB B;  1BIB A;  2OTL T;  1K73 C;  2EKH A;  3M0P A;  2CGH A;  1I0C A;  4F7U F;  3JB9 I;  1GRI A;  1BU1 A;  5GAN f;  4DEY A;  1K0S A;  1VIE A;  4JLG A;  3OBY A;  4M75 B;  3G7Z A;  1G3W A;  3MHX A;  3H6Z A;  2PUO B;  4CC3 A;  4ZNX A;  2KYB A;  2BIV A;  3I56 A;  1FWZ A;  2QA4 T;  1WA7 A;  5EG2 A;  2F2X A;  4EPC A;  3NGP A;  1D0X A;  1RAB B;  3G4S A;  3PTA A;  1SSF A;  3CCU T;  3PFS A;  1WXT A;  3M58 A;  2WSC E;  1E6H A;  2DXB A;  4QKU A;  1AVZ C;  2HEQ A;  1O9S A;  3M4G A;  4OMM A;  3CMA A;  4PNO A;  3OYI A;  2HAX A;  5A0G A;  2XG8 D;  3RKW A;  4IKF A;  1S72 T;  1JU5 C;  4BE1 A;  2DXU A;  4EMK A;  5GAO n;  2CP0 A;  3CME Q;  4CC4 B;  4L6V 5;  1UE9 A;  4PJO B;  4PLI A;  5KYU A;  2EYQ A;  5GAN 6;  5L8R E;  2ED0 A;  4FSS A;  4K11 A;  2KT1 A;  3CXC A;  1VQP A;  2L5Q A;  4C92 B;  4KUD K;  3QO3 A;  2YWW A;  1RLP C;  2PNI A;  2RQR A;  1BI0 A;  1X2Q A;  1X6B A;  1YIJ T;  4JRQ A;  3FJ5 A;  2YUO A;  5GMK l;  1QVF S;  1NPP A;  1WQW A;  1M2O A;  4Z8A A;  3NTK A;  1BCO A;  2RI3 A;  1WGS A;  1NYG A;  2W10 A;  1F1B B;  2FB7 A;  2RM4 A;  3MEA A;  3MET A;  3X24 B;  3INZ A;  1GBR A;  1U1S A;  2PUK B;  1PCX A;  3D7S B;  3OY9 A;  1K8A C;  2QTX A;  2NUZ A;  2J6O A;  2Y90 A;  3QBY A;  4NL2 A;  4OP0 A;  3CCE Q;  3FRN A;  5AT1 B;  2JOY A;  5GAN g;  5GAO r;  3CME A;  3GBQ A;  3GF5 A;  1PC0 A;  2L89 A;  1YBY A;  2DET A;  2RH2 A;  2QG9 B;  3JCM e;  3CPW A;  1M90 C;  1QVF P;  4N0A A;  2ZPI B;  2H3J A;  2J05 A;  2IIM A;  1V76 A;  2YUN A;  5LJ5 d;  2DKG A;  1M8V A;  3KUF A;  2C0O A;  4E2F B;  2ROL A;  4A63 B;  1UHC A;  3JAM E;  2EQK A;  2X35 A;  2JM9 A;  4JPB W;  5CVI A;  1HYO A;  4YTL A;  1QVP A;  2AT1 B;  4ESR A;  5C6S A;  4PK4 A;  1WHH A;  1W70 A;  1OU9 A;  1VQ7 A;  5KYY A;  3OYD A;  2K5L A;  2K3Y A;  3I5S A;  2G3R A;  1RL2 A;  4D8K A;  1WX6 A;  2QK0 A;  3VS2 A;  3A8L B;  2C0I A;  2P0Q A;  2AZV A;  2GFA A;  4LN2 A;  1T0H A;  4C5H A;  1WHK A;  3S3M A;  4HCK A;  2NUP B;  4FYX B;  3CCE A;  4FSX A;  3VS7 A;  2HD0 A;  3CCL A;  3E9G A;  4J9G A;  3RR6 A;  1ABO A;  2K57 A;  4XTU A;  1AD5 A;  5CKH A;  1TTH B;  2RI2 A;  4WF2 A;  1EIF A;  3NHN A;  1RI0 A;  1LNX A;  4CC2 A;  1B34 A;  4R0K A;  1WPY A;  4FYV B;  2KRS A;  2JW4 A;  1M3C A;  2DJQ A;  1JB0 E;  1PD0 A;  2VXE A;  5LJ3 d;  4B9X A;  5I11 A;  3RMQ A;  1D0Y A;  2X4W A;  2L0A A;  1XOV A;  5EC7 A;  3CXC S;  2KXC A;  2D6F A;  2EJG A;  2QI2 A;  2CYZ B;  4RTZ A;  3DLM A;  2QGF B;  4E7I A;  2KDS A;  1MGQ A;  4Z02 A;  4BY6 B;  3TU4 K;  4PJO E;  3PVL A;  1TH7 A;  1AWX A;  3BW1 A;  4AFU C;  2RPN A;  4PJO G;  1J3T A;  2Y4Y A;  3QII A;  4FM4 B;  3VUZ A;  4F17 A;  2PVD B;  2LNV A;  1JQQ A;  1H64 1;  4JRK A;  4C92 E;  4RG8 A;  1NJI R;  3UA7 A;  3JV3 A;  2L8D A;  2QDY B;  4C92 G;  2JM8 A;  2FPE A;  1AT1 B;  4M78 B;  4M7A B;  1UJ0 A;  4JZ4 A;  1GCP A;  2JJ9 A;  3PNW C;  3M4Y A;  3QYG B;  3VUB A;  1Y0M A;  2DZ9 A;  4J9I A;  2KEA A;  2DLP A;  1W4S A;  3DKM A;  1OZ3 A;  2LP5 A;  1X6O A;  1UTI A;  2EKO A;  4UC4 A;  3O5Z A;  1AWO A;  1YJN Q;  2F1L A;  4EMK B;  3QZ5 B;  1ZLM A;  1Q7Y R;  4DEX A;  4ZGE B;  5GAM h;  5KYU B;  3CBO A;  2RJE A;  5LL6 S;  1GFC A;  1N27 A;  4OML A;  2GF7 A;  1B3Q A;  1JBM A;  2YSQ A;  1VYU A;  5KE3 A;  2ESW A;  5CO7 A;  3JB9 G;  4BDZ A;  1Z9Z A;  1G2B A;  3OW2 P;  3G6E T;  2DK3 A;  1ZUK A;  3FEO A;  2KSS A;  2DA9 A;  3OS0 A;  2RJD A;  4ELY C;  2F69 A;  4HA8 A;  3CC4 A;  4LXC A;  3M55 A;  3TEE A;  3LLR A;  3GLX A;  3VV0 A;  3CCM T;  3CD6 T;  2SRC A;  1WJQ A;  1G3S A;  2WSF E;  5GAO m;  2DE0 X;  1BK2 A;  3EG0 A;  2AKL A;  3CD6 Q;  4N4H A;  1UGR B;  1SG5 A;  1YI2 T;  3LX7 A;  1KD1 U;  2WAC A;  5DLQ E;  4DOW A;  2DD4 A;  1YJ9 Q;  2MAM A;  1YI2 Q;  1B7T A;  2I0N A;  5KCO A;  1R77 A;  4E47 A;  2M9U A;  1YJN A;  3JB9 H;  2EAY A;  3VS5 A;  2HSP A;  1C1A A;  2VB6 A;  4DQ2 A;  4R56 A;  3CCR T;  3L2V A;  5GAN e;  2LX7 A;  1BI2 A;  4ZGJ B;  4LDV A;  1D0Z A;  4WTO B;  2V8J A;  2X3W D;  5CCA A;  2KYM A;  4C92 C;  3G1J A;  2CP3 A;  3SB2 A;  1HK9 A;  4ZN1 A;  9ATC B;  4GY5 A;  3L1A A;  3ULR B;  2VC8 A;  5FWB A;  1UB4 A;  2OI3 A;  1VQK Q;  1VQO T;  1M1K C;  5KYY B;  3I5R A;  2JNG A;  4HCB A;  1AOJ A;  1K73 R;  2XD0 A;  4J9C A;  4CC7 A;  3FIF A;  4LDX A;  2V1Q A;  1IRX A;  1PHT A;  3R6O A;  3VS6 A;  4OMO A;  1YHQ A;  1YJ9 A;  3EHR A;  4OB2 B;  4C5G A;  1YIT Q;  4C8Q F;  2A36 A;  3RUX A;  2L2P A;  1M2V A;  2M0O A;  4MZM A;  1VUB A;  2DIL A;  4ZN3 A;  2A7Y A;  4PJO D;  4RTW A;  2H3E B;  2MPX C;  1M1K U;  1VQM Q;  3LYI A;  1B34 B;  3A98 A;  2CUB A;  1B07 A;  3URG A;  3G71 T;  2B86 A;  2CT4 A;  1ZHI A;  4JDS A;  1E7O A;  4PKC C;  4XTV A;  4C0F A;  4M78 E;  1X69 A;  3NTH A;  4M7A E;  4C92 D;  3J7A F;  4M78 G;  3LGL A;  1GCQ C;  2E64 A;  1D09 B;  4M7A G;  4J9B A;  4HXJ A;  4KRT A;  2M16 A;  1NM7 A;  3TSW A;  3LW5 E;  1ZA1 B;  2CDT A;  2L3R A;  3H41 A;  4VUB A;  1FYN A;  1VQK A;  2ZGW A;  1Y57 A;  3EAE A;  4KUL A;  1YJW A;  1OUL A;  2RHU A;  1X27 A;  2DVE A;  2VXF A;  2MMP A;  3GOX A;  1VA7 A;  2EGE A;  2NYS A;  2M51 A;  1YIT A;  2NUT A;  2Y4X A;  5LJ5 h;  1P92 A;  5J26 A;  3JB9 D;  3H0H A;  4DBQ A;  2VYT A;  1K76 A;  3V7S A;  3A1P A;  1I07 A;  3AHU A;  1EFN A;  2EQM A;  1KQS A;  1VQM A;  1NPR A;  5GMK h;  1VQN T;  2P4T A;  2K79 A;  1WHG A;  2HL3 A;  3EFS A;  2QAZ A;  3WVD B;  1QMC A;  1VQN Q;  1V1C A;  2LX9 A;  2R5A A;  4C0G A;  2EQI A;  1Q7Y U;  2RN8 A;  3M59 A;  2DTO A;  1MNE A;  1K8A R;  2EJ9 A;  3RKY A;  3PMT A;  1AWJ A;  1E6G A;  5CQY A;  2ENM A;  2BKD N;  1RLQ C;  2EWN A;  3HRS A;  2JT4 A;  3OSV A;  3OYC A;  5GAM j;  3I56 T;  2QEX Q;  2B8A A;  2RD1 A;  1VQ4 Q;  1M90 R;  3GNF B;  1WI7 A;  4M7D A;  1Z9Q A;  3I56 Q;  5D6X A;  5I21 A;  5A0L A;  3RKX A;  3G4S Q;  2RHI A;  4A4F A;  5FRN A;  5HK3 A;  1AZG B;  3JRZ A;  1ZBX A;  4M78 C;  5LJ3 h;  4M7A C;  1CKB A;  1VQ9 Q;  4FYY B;  3CMA T;  4RCB A;  4Y91 A;  2K7A A;  1TUG B;  1H3H A;  2LVM A;  1M4Z A;  3I55 A;  3CEY A;  3LWH A;  5I22 A;  4JRI A;  2JXB A;  1QP2 A;  1BIA A;  2L3S A;  1PWT A;  4FYW B;  2DM1 A;  3EH2 A;  4E7H A;  2OTJ Q;  2LRQ A;  1X2K A;  2HL5 C;  1KIK A;  1CSK A;  2L3Q A;  3WVE B;  2I2L A;  2DX1 A;  2ABL A;  3HRU A;  2DTI A;  4X34 A;  1X43 A;  4BI3 A;  1VQP T;  1AWW A;  3OYL A;  4PL6 A;  4Z88 A;  1VQP Q;  2QEX A;  4BI4 A;  1K9M C;  1QWF A;  2A28 A;  1VQ4 A;  2QQB A;  2PQW A;  2E6N A;  7AT1 B;  2LTO A;  4AFZ C;  1M1F A;  3P8H A;  4DBR A;  2BE7 D;  3M0S A;  1YWO A;  4J6W A;  1K73 U;  3QPH A;  2AZS A;  4M78 D;  2H8H A;  1N8R C;  3CC2 Q;  1IB8 A;  4IIM A;  4M7A D;  3H9N A;  2P0K A;  2J06 A;  1VQ9 A;  5CQX A;  4C0Z A;  2XI9 A;  3L2R A;  1Q81 C;  4FW1 A;  3T9N A;  4LDU A;  3GPL A;  4PLL A;  1N6A A;  4OF1 A;  1K9M U;  3EGX A;  3CME T;  2RF0 A;  1KQ1 A;  4J9E A;  1M2V B;  1AHJ B;  1UGS B;  4M77 A;  1M5Q 1;  2DEQ A;  3EG3 A;  2HSE B;  4C0D B;  1G3Y A;  1TS9 A;  5GAN 4;  2MF2 A;  3PVQ A;  1T3S A;  2OTJ A;  1RAG B;  3JCM d;  3CBM A;  2J6F A;  1VQ5 Q;  2XDB A;  3SWN C;  4DOV A;  1BBZ A;  4N0A C;  3OYB A;  1FXX A;  2CRE A;  2YRD A;  4JS5 A;  2PTK A;  3CCV A;  1RAF B;  3QXE B;  2E3H A;  4F7U A;  5FRO A;  3NTI A;  3QYH B;  4B9W A;  1ZQ1 A;  1ZX6 A;  4HKE A;  2FRW A;  2QXF A;  2FG0 A;  2KK4 A;  1QQJ A;  1YCS B;  4QW2 A;  1VQ7 Q;  4RTV A;  3E9F A;  3CC2 A;  4BB7 A;  2CSQ A;  4FT2 A;  2JZ2 A;  1YP5 A;  3C4S A;  4E7Z A;  3V8K A;  1NYF A;  1KD1 R;  5HKC A;  2CKK A;  5FU7 B;  2RJF A;  3CCE T;  1K0X A;  1TUC A;  2NUT B;  1YN8 A;  4Y92 A;  4XAX B;  2FYK A;  3OYF A;  3CCL T;  4KBM B;  3M57 A;  3SEM A;  1ZSZ C;  1KFZ A;  2VWF A;  2RQV A;  4C5I A;  3CCL Q;  4LD6 A;  4QT7 A;  5IXF A;  4OMQ A;  5LJ5 j;  2E4H A;  1VQ5 A;  4ANJ A;  4OB3 B;  2KVQ G;  1FX7 A;  5KYW A;  5J3B A;  4A4H A;  3FLG A;  2YHT A;  3E1S A;  2VGM A;  2VVK A;  4MMK A;  1EZZ B;  3C95 A;  5GMK j;  1K8A U;  4RMO A;  2LNH B;  4HVV A;  3L2U A;  4PFP A;  2XK0 A;  3CCJ A;  2EIF A;  4XTZ A;  4F14 A;  4AG1 C;  5GAN 8;  3MEU A;  1N5Z A;  2XMF A;  1M90 U;  1MHN A;  4M7D B;  3RBB B;  1PRL C;  2IPO B;  2D8H A;  1I4K 1;  3EG9 A;  1KHI A;  1W2B A;  4M75 E;  3ZEH A;  1ZSG A;  4M75 G;  2VKN A;  3UAT A;  2MWP A;  3MEW A;  2DYB A;  2LT1 A;  1M1G A;  2MIO A;  3OYY A;  3EGD A;  5CKD A;  1M1K R;  1QKW A;  2ZAE A;  2RQU A;  5LJ3 j;  1OYX A;  4HCZ A;  2ZPH B;  5HY6 A;  4OB1 B;  5GAN 2;  2KMT A;  1K1Z A;  5D6W A;  1CKA A;  2EYY A;  1VYT A;  1IZ6 A;  5KYN A;  3VS1 A;  3P8D A;  3PGG A;  1ACM B;  2EYZ A;  3MP6 A;  4BD3 A;  3BFM A;  4GLM A;  5ECA A;  1XJW B;  2GBQ A;  3OMG A;  4PJL A;  2QGG A;  2DER A;  4PJN A;  4B6M A;  1UGP B;  3EHQ A;  3QG1 A;  3CC4 Q;  5KYX A;  5GAN 3;  3SHW A;  5GJW B;  1PKS A;  2K2V A;  4PFO A;  3HPW A;  2COW A;  1NEB A;  1FMV A;  2LCC A;  4X9D A;  2LT4 A;  3GNG A;  2IVW A;  2FL7 A;  2CZ1 B;  3CXC P;  1M30 A;  4RTY A;  3OYK A;  2SEM A;  3MJX A;  2LCS A;  2CH4 W;  2KT8 A;  1YJN T;  3OS5 A;  3JCM Q;  3EGX B;  4AG2 C;  3M0R A;  4HT9 A;  4M77 B;  4HVU A;  3CPW S;  1N9S A;  2COY A;  3V7R A;  4J6X A;  3REB B;  4HT8 A;  1H92 A;  2P84 A;  1U06 A;  3CC7 Q;  2DZC A;  5GAN d;  4FT4 A;  3ZFJ A;  2XDD A;  5CKF A;  2O2O A;  3U23 A;  4XU0 A;  2YDL A;  5FU6 B;  3OYA A;  2LMJ A;  1HSQ A;  1ZUU A;  3MEV A;  4F7U B;  4M75 C;  4OMP A;  3BE3 A;  2EGA A;  2KRN A;  3RIR A;  4X1V A;  3JCM X;  5DM7 R;  1PM3 A;  1MUZ A;  2E70 A;  3REA B;  4M75 F;  1JXO A;  2XHC A;  4QVD A;  1PRM C;  2ZPE B;  4JJD A;  3MCA B;  8AT1 B;  3CPW P;  2P4R A;  1YHQ T;  3HP9 A;  3VS4 A;  1QCN A;  1YJ9 T;  4TVR A;  4J7F A;  2YT6 A;  3HKS A;  1G83 A;  2DIQ A; 
#chains in the Genus database with same CATH homology
 1XTD A;  1I8F A;  3FJP A;  3PFS A;  5LJ5 h;  1P92 A;  5J26 A;  3JB9 D;  3UDC A;  3HRT A;  2HQX A;  3M58 A;  2WSC E;  2VYT A;  3OYJ A;  2DXB A;  5J39 A;  1G5V A;  3V7S A;  5IT9 E;  2V8K A;  4A4E A;  4C0D C;  1BYM A;  1O9S A;  1N9R A;  3X25 B;  3M4G A;  3AHU A;  4M7D E;  3CMA A;  4J5Y A;  1Y71 A;  3TCJ A;  4PNO A;  1KHC A;  2EQM A;  3OYI A;  1VQM A;  1KQS A;  1NPR A;  2DO3 A;  3V8J A;  2HAX A;  5A0G A;  3CC7 A;  2R57 A;  2XG8 D;  2ZPB B;  5GAN 5;  3RKW A;  5GMK h;  3J81 E;  1S72 T;  4IKF A;  3OS1 A;  1VQN T;  4PJO C;  2P4T A;  1YCY A;  4BE1 A;  2DXU A;  4EMK A;  3M56 A;  3H8Z A;  2K5I A;  3EFS A;  5GAO n;  1QVG A;  3WVD B;  2R58 A;  1Y96 A;  5I2S A;  4L6V 5;  2LX9 A;  1U1T A;  2R5A A;  4C0G A;  1Q7Y U;  4PJO B;  3M59 A;  2DTO A;  4PLI A;  2IG0 A;  4M75 D;  4PJO F;  1LJO A;  1OZ2 A;  2EYQ A;  2EJ9 A;  3A8O B;  3RKY A;  4XTY A;  5GAN 6;  3PMT A;  5LJ5 e;  2D9T A;  3JCM V;  5L8R E;  2VGN A;  2WSE E;  5CQY A;  4XU3 A;  3QUI A;  2RO0 A;  2R5M A;  3BDL A;  2BKD N;  1VQK T;  3CC4 T;  2EWN A;  3CXC A;  1VQP A;  2DPP B;  2K3X A;  1BI1 A;  2L5Q A;  3HRS A;  3ME9 A;  4C92 B;  2XKO C;  4KUD K;  3QO3 A;  4C92 F;  3OSV A;  4IUR A;  3OYC A;  5GAM j;  3I56 T;  1Q86 C;  1BI0 A;  1YJW T;  1QP3 A;  2B8A A;  2RD1 A;  5KCH A;  4JRQ A;  1YIJ T;  4A54 A;  2DJZ A;  5GMK e;  3GNF B;  4M7D A;  5GMK l;  4A4G A;  1QVF S;  1NPP A;  1WQW A;  3OYH A;  5GAM g;  5D6X A;  4V2S A;  3NTK A;  5I21 A;  5A0L A;  3RKX A;  1YIT T;  2RI3 A;  3JCM h;  1WJS A;  2NLU A;  1WGS A;  2RHI A;  4A4F A;  2FB7 A;  4ELZ C;  5FRN A;  1O75 A;  2RM4 A;  3MEA A;  3ER0 A;  3MET A;  5HK3 A;  3JCM J;  3QZ9 B;  3JRZ A;  1ZBX A;  4M78 C;  3INZ A;  5LJ3 h;  3X24 B;  5M9O A;  4M7A C;  3RES A;  1U1S A;  2PUK B;  4EDU A;  4EMH A;  3CCM A;  3CMA T;  4RCB A;  2XIC A;  4Y91 A;  3OY9 A;  5GAN j;  2E6Z A;  2QTX A;  2Y90 A;  1VQM T;  1K8A C;  3QBY A;  2DAQ A;  5GAM f;  3CC7 T;  2LVM A;  1M4Z A;  3OW2 S;  5FLX E;  4NL2 A;  3I55 A;  4OP0 A;  4M7D G;  3FRN A;  1Q86 U;  3CEY A;  1DJ7 B;  3LWH A;  3JB9 F;  2JOY A;  4JRI A;  4OVA A;  5GAN g;  5GAO r;  3CME A;  1QP2 A;  1BIA A;  4E7J A;  2FVU A;  3GF5 A;  3CCQ A;  4HCC A;  3M5A A;  3M9Q A;  4OGE A;  1WJR A;  1H3Z A;  1IRE B;  1XNI A;  4N4I A;  2L89 A;  1YBY A;  3SFM A;  2GFU A;  2RH2 A;  5CKB A;  4MDW A;  3JCM e;  3CPW A;  4E7H A;  3HFO A;  1M90 C;  2LRQ A;  4N0A A;  2ZPI B;  2H3J A;  4C8Q E;  4J8O A;  3WVE B;  2I2L A;  4RKU E;  3OB9 A;  5LJ5 d;  2DKG A;  3HRU A;  3VYH B;  1M8V A;  1Y7X A;  4C8Q G;  3KUF A;  2DTI A;  4X34 A;  4BI3 A;  1VQP T;  5LJ3 e;  3OYL A;  4M77 E;  4P5N A;  4NS5 A;  3JAM E;  4PL6 A;  2EQK A;  2GCX A;  2DXC A;  4M77 G;  2QEX A;  2X35 A;  4BI4 A;  1K9M C;  3E19 A;  2RI5 A;  3OSS C;  5D6Y A;  3OS2 A;  1VQ4 A;  2KY9 A;  5CVI A;  4YTL A;  1JJ2 S;  1KD1 C;  1QVP A;  2PQW A;  2QQB A;  2QQS A;  2E6N A;  2LTO A;  4LDY A;  2RK1 A;  5C6S A;  1PSF A;  4XTX A;  4M7D C;  1M1F A;  2OAU A;  2VV5 A;  5LJ5 f;  1VQ7 A;  1G3T A;  3OYD A;  3P8H A;  2K5L A;  2LQ8 A;  1W2B S;  4O5V A;  2K3Y A;  2G3R A;  1RL2 A;  2YLC A;  4J6W A;  2QQR A;  4CI0 C;  3GP8 A;  1K73 U;  3QPH A;  2RJC A;  4M78 D;  4BE2 A;  1N8R C;  3A8L B;  2O4X A;  2P0Q A;  4F7U E;  3DLL A;  4M7A D;  3X20 B;  2P0K A;  5A0D A;  1VIF A;  1VQ9 A;  4F7U G;  5CQX A;  4C0Z A;  2XI9 A;  3L2R A;  1Q81 C;  3RMS A;  3SD4 A;  3T9N A;  2GFA A;  1VQ6 A;  3OYM A;  4C8Q A;  1D3B B;  4LDU A;  4C5H A;  3S3M A;  3L42 A;  3GPL A;  3I55 T;  2E41 A;  4PLL A;  3JCM W;  3CCE A;  4FSX A;  4MML A;  1N6A A;  3OA6 A;  4MZP A;  4OF1 A;  1K9M U;  4OMF B;  2HD0 A;  3PIP A;  3CME T;  3CCL A;  1KQ1 A;  3E9G A;  1VQL A;  1VQ8 A;  1AHJ B;  1UGS B;  2K57 A;  1M5Q 1;  2DEQ A;  4M77 A;  3LWI A;  4XTU A;  3CCQ T;  5CKH A;  4C0D B;  1G3Y A;  2RI2 A;  4WF2 A;  1EIF A;  5GAN 4;  3S6W A;  1RI0 A;  2MF2 A;  1LNX A;  1R8O B;  1B34 A;  3EFR A;  1I5L A;  3N5B B;  1QVG S;  2OTJ A;  2PVG B;  4IUV A;  3JCM d;  3CBM A;  2E65 A;  4IUP A;  2EJF A;  1WPY A;  4IUT A;  1Q82 C;  3QSU A;  1NZ9 A;  2GQV A;  3SWN C;  4DOV A;  3L2Q A;  2XDB A;  4N0A C;  3OYB A;  4DA4 A;  3V8L A;  2HNI A;  1JB0 E;  5GMK i;  1FXX A;  2VXE A;  2DTH A;  4JS5 A;  5LJ3 d;  3CCV A;  3QXE B;  2V8I A;  4B9X A;  3SWN B;  2JTM A;  3RMQ A;  2X4W A;  5FRO A;  4F7U A;  3ASK A;  3LH0 A;  2QEX T;  1VQ4 T;  1XOV A;  3NTI A;  4N4G A;  3CXC S;  3QYH B;  4B9W A;  4BY6 C;  2F5T X;  3JCM f;  3J80 E;  4JS4 A;  2D6F A;  3OYG A;  2EJG A;  1ZQ1 A;  4M7D D;  2QI2 A;  2CYZ B;  3OQ5 A;  4QQD A;  3DLM A;  4HKE A;  2QXF A;  2CZ7 B;  1LOJ A;  4M75 A;  4A53 A;  2CS7 A;  5CR2 A;  2A3L A;  4E7I A;  2X4Y A;  2KDS A;  4LD9 K;  2KK4 A;  4ATO A;  4QW2 A;  4NOY A;  3G4S T;  1MGQ A;  4ME7 A;  4XK8 E;  4Z02 A;  5LJ3 f;  4BY6 B;  3G6E A;  3TU4 K;  4PJO E;  3E9F A;  5FU7 C;  1TH7 A;  3CC2 A;  2HQE A;  3BW1 A;  4BB7 A;  5CK9 A;  4FT2 A;  2JZ2 A;  3S3N A;  2RB6 A;  4PJO G;  4GLK A;  1GXI E;  1PSE A;  1VQ9 T;  2Y4Y A;  4IUU A;  3C4S A;  3QII A;  4FM4 B;  3VUZ A;  1VQ6 T;  4IUQ A;  2PVD B;  2LNV A;  3V8K A;  1QVF A;  2QQ9 A;  5HKC A;  4BI8 B;  2LC4 A;  2CKK A;  5FU7 B;  1H64 1;  2RJF A;  2LDM A;  3P8B B;  3CCE T;  2DIG A;  4JRK A;  1BI3 A;  4C8Q C;  4C92 E;  4Q5W A;  3CD6 A;  4RG8 A;  4LDW A;  4XAX B;  2CZ0 B;  3TRE A;  2FYK A;  3OYF A;  3CCL T;  1VQL T;  2L8D A;  2QDY B;  4KBM B;  4M78 B;  4C92 G;  3M57 A;  4M78 F;  4M7A B;  1Y07 A;  4EMG A;  3MO8 A;  4M7A F;  3PNW C;  3M4Y A;  4C5I A;  4XQ3 A;  3QYG B;  4LD6 A;  4M77 C;  3VUB A;  3OMC A;  2DZ9 A;  1YI2 A;  2QQA A;  4RG2 A;  4EMK C;  2OTJ T;  2E5Q A;  1W4S A;  3DKM A;  3LGF A;  5LJ5 j;  3VU3 C;  1OZ3 A;  1VQ5 A;  1X6O A;  5GMK m;  4OB3 B;  2KVQ G;  2EKO A;  4R55 A;  1FX7 A;  4UC4 A;  3PIO A;  5J3B A;  4E7L A;  4A4H A;  3FLG A;  2X4J A;  3BY7 A;  3HL8 A;  4EMK B;  5LJ5 g;  2E1H A;  2RHX A;  3QZ5 B;  3VYG A;  5GAO l;  2YHT A;  3CCV T;  3E1S A;  1Y96 B;  5A2Q E;  1UEB A;  2M1H A;  1WQ7 A;  1HXD A;  2RHY A;  2VGM A;  1U8R A;  4PJO A;  4MMK A;  4ZGE B;  3UPU A;  1I81 A;  3C95 A;  4JJN K;  2ZPG B;  5GMK j;  5GAM h;  3CCR A;  1V29 B;  3DB3 A;  5IN1 A;  1K8A U;  3CBO A;  2RJE A;  5LL6 S;  4RMO A;  1KG1 A;  4CRI A;  1N27 A;  2GF7 A;  3X28 B;  2ZPF B;  5I2M A;  1JBM A;  1OI1 A;  2C06 A;  3L2U A;  4BE0 A;  2XK0 A;  3CCJ A;  4A4K A;  5KE3 A;  1QW1 A;  2MWO A;  4C92 A;  5CO7 A;  3JB9 G;  5KE2 A;  4BDZ A;  2EIF A;  1NJI C;  5CAI A;  3DB4 A;  4XTZ A;  3G6E T;  3CC2 T;  4JLI A;  5GAN 8;  2DK3 A;  5DLO A;  3MEU A;  3FEO A;  3M53 A;  5IAY A;  1KC8 C;  2JTF A;  4BAC A;  4BDY A;  2KSS A;  3OS0 A;  3L2Z A;  2RJD A;  4ELY C;  4JRP A;  1M90 U;  1MHN A;  4X9C A;  3HSB A;  4M7D B;  2XID A;  2F69 A;  4HA8 A;  3QHS A;  4M7D F;  3CC4 A;  3M55 A;  2P0P A;  3CCS A;  1X75 C;  3LLR A;  3GLX A;  4QVZ A;  4Y28 E;  3PMI A;  3BDU A;  4J7I A;  3JSC A;  3TEE A;  3VV0 A;  3JCM b;  3CCM T;  4C8Q D;  5GAN h;  2AHJ B;  2LCL A;  1JRI A;  1VQO A;  3CD6 T;  5DY9 A;  1WJQ A;  4FIB A;  3A8G B;  1G3S A;  2FHD A;  2WSF E;  5GAO m;  1I4K 1;  4ZTJ A;  1KHI A;  5GAM e;  1W2B A;  2ZCF B;  4M75 E;  3ZEH A;  3FB9 A;  2F5K A;  4N4H A;  4O6J A;  1Q7Y C;  2LQK A;  4M77 D;  1UGR B;  4M75 G;  2DD5 A;  2MWP A;  3CBP A;  3MEW A;  3LX7 A;  2LT1 A;  1YI2 T;  1M1G A;  1KD1 U;  2WAC A;  1KQS S;  3GIB A;  3A8H B;  2PU9 B;  2O01 E;  3OYY A;  5DLQ E;  4DOW A;  1WNL A;  2DD4 A;  1VQ5 T;  5CKD A;  1NJI U;  2MAM A;  3MP1 A;  4M78 A;  4ZTF A;  2EQJ A;  4M7A A;  2DXT A;  2PVO B;  5HK0 A;  3JCM g;  5KCO A;  3HHT B;  2YRV A;  5LJ3 j;  1KC8 U;  4E47 A;  2M9U A;  3QJY A;  1YJN A;  5KH6 A;  3JB9 H;  2BUD A;  4KT0 E;  4QQG A;  3ZBD A;  1OYX A;  4KUI A;  5CIU A;  4HCZ A;  1N8R U;  1M9S A;  3RER A;  2ZPH B;  5HY6 A;  2JUF A;  2EAY A;  3FC3 A;  3FDR A;  4DQ2 A;  3JCM c;  5LJ3 g;  4OB1 B;  5C0M A;  5GAN 2;  2KMT A;  4R56 A;  3X26 B;  3CCR T;  1Q81 U;  3L2V A;  5GAN e;  5CKE A;  3M54 A;  3OYN A;  1BI2 A;  3CPF A;  5D6W A;  4J83 A;  4ZGJ B;  4LDV A;  1IZ6 A;  3C94 A;  3CCJ T;  3QDR B;  2D0Q B;  2V8J A;  3G71 A;  3P8D A;  3KXT A;  2XDP A;  3JCM P;  3KBG A;  4MZT A;  3PGG A;  1X01 A;  1VQ7 T;  5CCA A;  4C92 C;  2OTL A;  3MP6 A;  4BD3 A;  3SB2 A;  1HK9 A;  3BFM A;  3SDZ A;  4ZN1 A;  4ZGD B;  2KQW A;  4XU1 A;  5GAO p;  4FU6 A;  4OB0 B;  4GY5 A;  3L1A A;  1Q82 U;  3OMG A;  2VC8 A;  3CCS T;  1VQ8 T;  4C5E A;  2MI6 A;  5AYF A;  2KAF A;  3PT9 A;  1UB4 A;  1UGP B;  1UGQ B;  2X4X A;  4L5G A;  1VQO T;  3QG1 A;  1M1K C;  1KQ2 A;  2JNG A;  5GAN 3;  4HCB A;  3CCU T;  4BUG A;  5FRM A;  2XD0 A;  2ZZD A;  4OGC A;  2CZ6 B;  5GAM d;  1NE8 A;  3C12 A;  4J6Y A;  2K2V A;  2O4X B;  3FIF A;  4LDX A;  2VUB A;  2QA4 A;  3HPW A;  1XQH A;  3HFN A;  3R6O A;  1D3B A;  1YHQ A;  4XTW A;  2LCC A;  2EQU A;  2LT4 A;  4X9D A;  4II1 A;  3GNG A;  1YJ9 A;  4OB2 B;  4RCC A;  2IVW A;  2FL7 A;  2CZ1 B;  4FL6 A;  4C8Q B;  4C5G A;  4XU2 A;  3JB9 J;  4C8Q F;  3A5Z B;  3OYK A;  3CCU A;  1BKB A;  3RUX A;  1YJN T;  2JN0 A;  3QJ6 A;  3OBW A;  5GAN 7;  2M0O A;  3OS5 A;  4MZM A;  3JCM Q;  3HKS A;  1VUB A;  3OYE A;  2EFI A;  4JUV A;  3F70 A;  4NL3 A;  3OW2 A;  4E7K A;  4HT9 A;  4M77 B;  4ZN3 A;  3CPW S;  1N9S A;  4M77 F;  2A7Y A;  4PJO D;  3V7R A;  4J6X A;  3WXM B;  5FU6 C;  2E10 A;  3VKI A;  4D6W A;  3O8V A;  1M1K U;  2XU8 A;  4HT8 A;  3LYI A;  1B34 B;  4L59 A;  4MDX A;  2K4Y A;  2K5F A;  3MP8 A;  2DZC A;  3Q1J A;  5GAN d;  3L2W A;  4FT4 A;  3ZFJ A;  2XDD A;  3URG A;  1S72 A;  5CKF A;  1VQN A;  2JVV A;  3QKJ A;  3G71 T;  1ZHI A;  2RK2 A;  4JDS A;  4PKC C;  4XTV A;  4XU0 A;  4C0F A;  4M78 E;  5FU6 B;  2HBP A;  3NTH A;  4M7A E;  1BIB A;  4C92 D;  2OTL T;  3OYA A;  3SWN A;  1K73 C;  3J7A F;  4M78 G;  3LGL A;  2E64 A;  4M7A G;  3MEV A;  2CGH A;  3NFC A;  2M16 A;  4F7U B;  4M75 C;  3A8M B;  3LW5 E;  4F7U F;  3JB9 I;  2L3R A;  4QQ6 A;  3RIR A;  3JCM X;  5GAN f;  5DM7 R;  4VUB A;  1VIE A;  2E70 A;  2YLB A;  2ZGW A;  3OBY A;  4JLG A;  4M75 B;  3UWN A;  3VJP A;  1JJ2 A;  1VQK A;  3G7Z A;  4M75 F;  2XHC A;  1G3W A;  3MHX A;  4QVD A;  3H6Z A;  2PUO B;  2Y4X A;  3EAE A;  3V7C A;  2BIV A;  2ZPE B;  5GAO q;  3MCA B;  4KUL A;  3I56 A;  1FWZ A;  1YJW A;  1YIJ A;  2RHU A;  2QA4 T;  2DVE A;  5EG2 A;  2VXF A;  3UT1 A;  1YHQ T;  2MMP A;  3HP9 A;  4QVC A;  3GOX A;  4EPC A;  3S3O A;  1YJ9 T;  4TVR A;  2RHZ A;  4J7F A;  3G4S A;  1YIT A;  2E12 A;  2RA2 A;  3PTA A;  1SSF A;  2DIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...