4DP2X

The 1.8 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp2X00
1XB8A 1NPJA 3NJIA 1EZLA 2IDSA 4DP0X 1NIAA 2PLTA 2PP7A 4F2EA 5B7MA 4G70B 5AFAA 1DYZA 4G7RB 3FS9A 5TK4A 1GY1A 2AZAA 5D4HA 1R1CA 4KNTA 4HIPA 3TBBA 1L9SA 2IWKA 2FT8A 2J57A 1JZEA 2CCWA 4A2HA 4QLWA 4K9JA 1J5CA 4AI7A 1ZDSA 4PCYA 4YSRA 4YVUA 2W88A 2WO3B 3IN2A 4YSAA 1E5ZA 1NIFA 3FSWA 1GY2A 2TSBA 3FSVA 1W6LA 3UGEA 1GS7A 3NJKA 2GC7C 2XLLA 4BWTA 2XXGA 4W1TA 2DWSA 3S8FB 3ZDWA 2FT7A 1ASQA 1GS6X 1AG6A 2YAFA 1ZV2A 1KGYE 2YXWA 3PAUA 4JHVA 1JXGA 7PCYA 1QHQA 3SBRA 3NJHA 3QJQB 5B1JA 1IBYA 1NWPA 2EIMB 1L9PA 2GI0A 1NIEA 4HAKA 4WTQA 1DZ0A 1N70A 1PF3A 3EH5B 1RCYA 2BP8B 4G7QB 1KV7A 4Q8BA 3HB3B 1RZPA 1SFDA 1ASOA 3AG4B 2RACA 4DPAX 2PP9A 2PCFA 1AZUA 2IWFA 1AS7A 4DP6X 2DYRB 3IN0A 2FQEA 4HCIA 3SBPA 3PLYA 2YARA 3PAVA 1BXAA 3GXUB 2UXFA 2DY2A 2HX9A 2IH8A 1SFHA 3FQYA 2TSAA 2HX8A 2FT6A 1WA1X 2N0MA 1YLBB 1PLAA 1PMYA 2BZCA 4ZK8A 5AKRA 1OCCB 1OCZB 2YAHA 3BQVA 4G71B 4WKXA 5I6LA 2XXFA 1GSKA 2JFCA 3X1NA 1L9RA 1X9RA 3T71A 1V54B 2H47C 2FQGA 2YQBA 2BZ7A 3PAZA 4GXFA 4Q89A 4DP7X 1E30A 1QLEB 3EH3B 1JOIA 5I6OA 3FT0A 3FQ2A 5B1KA 4GY4A 4BDVB 2E86A 5IY5B 1L9TA 1BAWA 3ABKB 1ET8A 1TKWA 3CG8A 2H5UA 1CUOA 2IH9A 2PPCA 1JVLA 3N2JA 3NP3A 4P5RA 1SJMA 1AZRA 2UXGA 3OMIB 1ZIAA 4KO7A 1X9UA 2XYBA 3KW8A 1ZDQA 1TEGA 4HALA 4JHUA 5F7AA 2OJ1A 3CVDA 1CYWA 2I7SA 2ZXWB 1ILSA 3AW5A 2DWTA 1CC3A 2UXVA 4F2FA 2HRHA 2PPFA 3CVCA 4GP5B 3U25A 4A66A 5F7BA 3C75A 5I6PA 1BQKA 3TU6A 2DYSB 1F56A 1NDTA 1BQRA 3UABA 1PLCA 1AAJA 3FYEB 3IE9A 1FA4A 3WIAA 3AG1B 1GR7A 1NWOA 1JZJA 1A8ZA 4AKPA 1SHWA 3QJVB 3QJTB 1GYCA 4DPBX 1KYAA 3FU8A 1IUZA 2PPDA 1PZAA 4BXVA 5I5MA 2BW5A 1GW0A 2HZHA 2AANA 4E9TA 5A7EA 1A4BA 3T6VA 1ETJA 1N68A 4A2FA 4YSOA 4YL4A 2EINB 5I28A 4A67A 2DV6A 4A2DA 3JT2A 5PAZA 1M57B 1IKOP 2XVBA 3V9EA 3TBCA 3ASOB 5I5JA 2IWEA 1BYOA 3L45A 2YXVA 2R7EB 2QPDB 4GP4B 3UAAA 1AS8A 3SBQA 1KCBA 1PNDA 3FQ1A 3T6WA 1NIDA 1PNCA 1ADWA 3DIVA 2WSDA 4KNUA 1OF0A 2CAKA 2VM4A 5I26A 3ZBMA 4KOBA 4E9QA 3X1GA 2I85A 3NYKA 4A2EA 2HX7A 2VW4A 4W9ZA 5TK2A 4F7KA 4P5SA 1JZHA 4E9YA 2Y69B 2IDUA 2MTAA 1VLXA 3QPKA 5E9NA 4BK5C 2VM3A 1ID2A 1JVOA 1PZBA 2HLEB 3NSFA 1XB6A 3OM3B 1AZBA 3NSDA 4TXVB 3OQRA 1SDDA 2VMJA 5AZUA 3AY2A 4ENZA 1OCRB 1JXFA 3ABMB 1B3IA 2GC4C 1AZNA 4BXSV 2I7OA 1E5YA 3EH4B 3H4FA 1ET7A 1I53A 2XWZA 1OCOB 3NJGA 4CSZA 4HHWA 1W8EA 3AG3B 1KBVA 3NJFA 2VSKB 2FQDA 1WA2X 1SDDB 2JKWA 2ZOOA 4FA7B 4CSPA 2PPAA 2UX7A 1T5KA 3FU7B 3NJNA 2Q9OA 2B08A 2MRYA 1NPNA 3FSZA 4KOCA 1A65A 2IDTA 2AVFA 4M3HA 4DP8X 3WI9A 2X87A 2ZONA 2WO2B 3OMNB 2BO0A 3NSYA 3TA4D 2XV3A 2LLNA 1M9WA 2J55A 2R7EA 1UATA 1BXVA 1V55B 2CJ3A 2YAQA 3S8GB 2CUAA 2J5WA 3PCYA 1V10A 2XV2A 4HCFA 3T9WA 1W6WA 3ASNB 2J56A 2CBPA 1OE3A 5B1BB 3NP4A 4M4RB 1OE2A 3S3BB 2GBAA 2FJSA 1OE1A 1FFTB 1BQ5A 4DPCX 1EHKB 1NICA 3IEAA 2BP0A 2P80D 2YAEA 3PPSA 1JXDA 4YSDA 4YSPA 4A68A 1A4CA 1FWXA 4YSTA 2CALA 5B7FA 1MDAA 2H3XC 1SF5A 3FSAA 2Y1AA 1L9QA 1KCWA 4E9RA 3ABGA 3D12B 3FU9A 3T6ZA 1BEXA 2QDWA 2XUWA 4YSQA 4N4YB 4BWWA 2GHZA 1AANA 4L0PB 1KDIA 2IAAC 9PCYA 1QNIA 3CVBA 2W8CA 2AFNA 1JERA 3QJRB 2QT6A 4DP1X 1PLBA 3NJJA 1BXUA 1J5DA 3QJSB 2FWLB 2XX0A 7PAZA 5I6NA 5I6MA 1WAEA 2FNWA 2EIKB 3WNIA 1TEFA 3H4HA 3RYMA 1CURA 2PCYA 3WKPA 1ILUA 3QQXA 2BHFA 2XV0A 3JTBA 2GB2A 3G5WA 5I6KA 1NIBA 3HEIB 4UANA 8PAZA 3X2QB 3ABLB 2VW6A 2ZWNA 1CYXA 1RKRA 4BWUA 4UAHA 1HFUA 3DTUB 4YSUA 6PAZA 5D4JA 2VW7A 2EIJB 2VSMB 2BWIA 4AKOA 3X1BA 1MZYA 3UACA 1J9SA 4GP8B 1WS7A 4BDVA 1AIZA 4X4KA 2IDQA 4JKNA 3QJUB 3NSCA 4AKQA 1BYPA 1GS8A 3IBOA 1E65A 2X88A 3NJLA 4E9WA 4E9SA 2IDFA 1PZCA 1AG0A 3EHBB 2HRGA 1ASPA 4G7SB 2PP8A 2BP0B 2GSMB 3FU7A 4YSEA 3FPYA 5LDUA 3OMAB 3WNJA 4E9XA 5B7EA 1J9RA 2XX1A 1XB3A 3PXLA 3H56A 4AX3A 2YAMA 1AZCA 1OV8A 4GYBA 2Q5BA 5B3SB 5FC9A 1XMEB 2NRDA 2EILB 3EF4A 1OOWA 3ZIYA 1AQ8A 4FAAB 5EHFA 1IBZA 5PCYA 4MFHA 2UXTA 3SQRA 1JZGA 1NTDA 4YSCA 2YAOA 1E67A 1SNRA 1ET5A 3N55A 1J9QA 1PY0A 2BWDA 3NJMA 1AACA 4QKTA 1JZIA 1MZZA 3AG2B 3GDCA 4DP5X 3KW7A 1HAUA 3ZX1A 2B3IA 4HHGA 1PAZA 3ERXA 3BVDB 3TASA 3AZUA 2OV0A 4UF7C 3T6XA 4E9VA 1RZQA 1HAWA 3X1EA 2BW4A 1SF3A 2A3TA 4HZ1A 4G72B 3WG7B 1AOZA 4KO5A 1A4AA 4HCGA 1NINA 3NT0A 2P80A 1A3ZA 4DP2X 3OD3A 1AS6A 4AZUA 4KO6A 2QDVA 4KO9A 1KBWA 4YVNA 3UADA 3CDZB 1AR1B 2BP8A 1JZFA 1IC0A 3FYIB 1KDJA 2HXAA 1WS8A 4NERA 3MBWB 2FTAA 4A2GA 3S3DB 6PCYA 5I5IA 1ZPUA 1WA0X 3CDZA 4EF3A 4DP4X 1NZRA 3S3CB 1L9OA 1PCSA 4YSSA 5ANHA 3FPXA 4N8UA 2GIMA 4KNSA 4NB7A 5B1JC 2OCCB 3DKHA 1SHXA 4NAJA 4RH4A 3WKQA 5B1AB 2QPEB 2VN3A 1M56B 2AZUA 3V9CA 3MX0B 1MG2C 3GYRA 1MG3C 2YAPA 2JXMA 1TU2A 3CZUB 1URIA 3UAEA 4PAZA 2XU9A 1J9TA 5D4IA 4DP9X 2UX6A 2PPEA 1ZIBA 3X1FA 2FQFA
chains in the Genus database with same CATH superfamily
3FB5A 1I9RH 3C08L 3OKOB 4DQOH 1MEXL 1AD0A 1SY6A 3N6YA 1CLCA 3H9ZA 3P3SA 4OTXL 4WSGA 1EDYA 4MZRA 4X98B 5AVXB 3II1A 4XBMA 3PGFL 3GMMB 2WVSA 1CLZH 4JB9L 4R90H 3FFCD 4X99B 4E5XB 4XCNB 4J3OC 1IZJA 2D7OA 2GVYA 3ARPA 3REVB 4AK1A 2I9TA 1L9SA 1D7CA 5CNHA 5TDOB 4NZ8A 2ED7A 1A6AA 2FT8A 3WCYA 2ESVA 2J1KA 2LAGB 1HC1A 1QVOB 4X6DB 3LPFA 5IP4A 3CLWA 5LKNA 2X41A 1MRCH 5LAPA 3UYPA 4Q6IC 4M29A 4UV4L 5C71A 5I76B 4QRRD 25C8L 1KFAL 3VSQA 2VDLH 2EKJA 3WFCH 3KLDA 4OBRA 4X7TA 2XXGA 1WAAF 3KBPA 5IBLC 3TO4B 4P2OB 4OQ1A 3RZCD 3P4LA 1IKFL 2V8LA 1EUUA 3PAUA 2RHEA 4P48A 3SBRA 5C0BA 4LLDA 2B0SH 4F33A 4IGBC 4XOEA 5DUML 5A2IH 2WXGA 2XKUA 3TOPA 1T6BX 4WTQA 3U46A 4UM9B 1BA9A 5AB9A 1H15A 4X7TB 3DGGA 2X42A 4Q9CA 3QDGE 4YDIH 1X5FA 2VKWA 3PGCA 1RCYA 3ZDYB 4F24A 2BP8B 5SV4A 2DQUH 4Y0GA 3GBMH 5BZDA 4PJXE 3RVTD 4BV1A 3QYNA 3O0RH 3TS8A 3WNLA 4GRLB 3I84A 2OR8A 1O9WA 1WPCA 4E42A 3DSFL 5DJ8A 5FO9A 1WFMA 1MCOL 4GO6B 4BGLA 5C8JA 4PGBB 1H0DA 3SBPA 1WZ1H 2CWRA 4N2CA 5CIPB 4JK0D 2AJZA 3QRGH 2J1YA 1RXLA 3WY1A 4FXLA 5E56A 1XF2A 5IFAH 1Z9NA 4QGTA 5T1LD 3WDHA 5AYUH 3JV4B 3V6FA 1OCWH 2PCXA 2GPZA 3SE6A 2YHGA 3E1F1 5DMYA 3OKOA 4EXKA 4FEIA 3BQVA 5A2LH 3JWDC 3D07A 1ECZA 2J1WA 2JFCA 3IMTA 1P9MA 1QBAA 4QXWA 1LK2A 5DZAA 1MFUA 2VDMB 1G7MB 1A5FH 3GWJA 3HR5B 5J9PB 4OBSA 1FG2A 2ZWYA 3C6EA 4M4RA 4GXFA 4Q89A 1EEUA 1EGJA 3GRWH 4K8RL 1VGKB 3GSQB 3WHE0 1JOIA 3KXFA 2NSQA 1Q72H 3BVNA 4PJAB 3AXIA 4YBQC 2E86A 4YHZH 5IG7A 5LNGA 3V4PH 3EOYG 3FT1A 1AOHA 5JW3L 4JANA 2DQJH 1HHIB 5DRNA 4P5RA 2HMID 2VZUA 5TQ2L 1HJBC 3ATBA 1DJXA 3IDIA 2AV1A 4XB3A 3QEHB 4ZUTB 4D0DB 3PP3H 4AVJA 5EDSA 5IHWA 3V8OA 3ATAA 3AW5A 4NQEA 2VDRB 3CFBA 2HPTA 2FX8H 4HEMA 4V1DA 1E5AA 2GG1A 3S3PA 3B9DA 1I85A 2BS9A 1ULVA 3PQYA 3SDAA 4LSUL 5F7NC 4QRAA 2DQ6A 4X4MA 4JZJC 5E24E 1G9NL 1MI5E 3C75A 4WWKA 4X6CA 4UQ2A 1U3HB 2CO7B 4TUJA 4AJWA 1I9RL 3U79A 5DRXB 5C7ZA 3MJ9H 4X5WA 4K7FB 1ACXA 4ODVL 1WAAE 1GR7A 4AV5A 2IFGA 2P24B 1CQKA 4OLVL 3G04B 4WENB 2WLZA 1F1GA 3CMGA 4NFCA 1K8IB 2B4CL 4MAYC 4KTYA 1Y6MR 3TEZA 3WE6A 4Y9FA 3EYSH 4ODTH 4D9QE 4NQCE 1JMXA 1NJ9A 1KN4L 2R2CA 4MJ5A 5DEFA 2EH8L 2RH0A 1CICB 5A7EA 1I1YA 2EDMA 4GBXD 5CWSB 4NAMA 1FVEA 5H37G 5KSVB 4Z7AA 3GRWL 5D1QB 2MQGA 5A2JH 3TBTA 2CHZA 1FSKC 1RZGB 3TYFB 3QIWA 1UWGH 1R3IH 3VA6A 2KZ1B 2OMZA 3PHQA 4F1ZA 5I1CL 4LCYA 2XRAL 3BAKA 1I1AB 3P73B 1A6VL 1MFAH 5E6IB 2ZQKA 3V4VL 3RBSA 1KCBA 4PJ7B 2YPLE 3ARRA 5GRUH 5KBDA 5F0JB 4U6VL 3DDGA 4DGYL 1QWHA 2VM4A 4MDRA 3K6FA 5JLZB 3ZE0F 4E9QA 5I1DB 4U3CA 5TK2A 2B0SL 1IGYB 3LXUX 3WHXA 4Z7VF 4U0RB 3NRQA 2Z64C 2LLGA 2AK4E 3CSYA 4PJ5A 2HLEB 3MXVH 1Q94A 3K81A 3IS1X 1UOKA 3VXRE 4MMZB 3H54A 3ARED 4XMTA 4AEFA 4AYBA 4FZEL 5DDHB 3L1EA 2FGWL 3W9DA 5I1GH 1T21A 4MXVF 1LNUB 2G4EA 3HI1B 1L7IH 3U48A 2PYED 3U0WH 1TCRA 1QKZL 3F5WB 3GRWA 5E8NB 3L3IB 4N6RB 2MOQA 3E80A 3G6JF 2QKIC 2GAZA 4TVPH 1VEPA 4G6ML 2CSPA 5CJ5A 3GIVB 3KPNB 2EJ1A 2BRRL 1MCPH 3EFFB 5I18H 2R0WH 3IDMA 1VIWA 5EU7E 5FYJU 4M3HA 2Z1PA 4JM2F 4QYAA 4ELME 3NSJA 5DJXB 3ESUF 5G4OA 5SWZE 5LQBH 4NO0A 1RSYA 4NRXA 5BS0A 4FNTA 1OARL 5GRYA 3DOSB 3J27A 3UROR 5EUKB 4C55A 4EQ2A 4IMLB 3SDCD 1OW0C 3M46A 3IFLH 2APTA 1TQSA 4KQ4H 3W37A 4E5XG 5JXEC 3KYKH 3R18A 4KXAA 4Y4HB 3I9GL 3UAJC 3BSZL 1AO7E 1YUHA 2BOCB 4CSSA 4DN4H 5JIQA 3FT4B 2KMWA 2VYRE 3ALWA 2D3NA 4K5PA 1DSFH 1G84A 4Y16A 2EYSB 1MI5D 4Y2OB 1RMFH 5I1JH 4LAQL 5JPNA 3MKGA 4PJ9B 2AQ2A 1ZVNA 1JXDA 2AI0H 5F21B 5ALBL 1NLBL 3UTPD 3NDYE 4FXGC 3KPOA 3CJJA 2VR6A 4L8CB 5DS8B 4TSBH 3CH1B 4UQDA 5E7FA 4GRLD 3T6QC 4G2AA 5DLML 4E9RA 1DQML 4XPTL 4GKZB 5T1JA 3AGWA 5L0QC 1S7WB 2F15A 4JPSA 3KDMB 5AVVB 1H6UA 2GHZA 1T0NB 3W81A 1JWUA 4B0MM 4MB4A 1CU4L 1R46A 3ZO9A 5IMMB 2QHRH 3FTGB 2OZ4H 5I6NA 3DVGA 5JA9A 4HF5L 4JRXB 4NQCA 3ROLA 4TULL 5C08D 5HXMA 2IANA 3QEGL 4RWYH 3TVMA 2C1PA 2VKXA 3KPRE 4GAJL 3V0HA 2XPGB 3C6LC 3QWOB 2WINB 4LXFA 4U1GB 3REWB 3VFTA 2YPLD 1KTLA 3HZMB 4RBPH 3TO4D 1HXYB 3V5DA 1GSMA 2NQCA 4WI3A 3RTQD 1BXXA 1QA9B 2WTOA 4F20A 4M03A 2VSMB 1EK3A 2ILLA 5E94A 3EDJA 3MNWB 3F7VA 4HPOL 4EZKA 1IEBB 4A7GA 4BDVA 2YD8A 3WUWA 4APXA 5DHVB 2KH2B 1NMBH 3HLAA 5LN8A 3L5HA 1NANI 2EACA 4PRIA 4UBDC 4WV1B 5B39G 3F83A 3FFCB 3MR9B 5KSAC 3UTSD 4PY8J 3GPSA 1KPRA 3PQYE 1KY7A 4MNGE 4YHKH 4HS6B 1HIML 1G9NH 1HU8A 4ORGB 1Q4NX 1CTMA 2E3VA 4TV3A 2VDQB 4ZFZB 2ZOKA 2DQTL 5KVDL 3PWPA 3VI4E 1XCWA 4JEGB 5B3SB 5FGBA 4RMQA 2OMYB 1XR8B 2DQEH 3DUUB 3HB3D 4JHZA 2HFEA 2WZPA 3DYMA 4PGEA 3ZE1F 1JZDC 3JXAA 4WCYL 3T1FA 1W0VB 4UIKL 1MCSA 1NTDA 2VLRD 3F7LA 3TO4C 5ACZB 2CIKB 4Q9RH 2OA9A 4L5FH 2LW3A 5AKVA 5I1EH 2VZOA 1UM5H 5EF3A 3I6KA 4JJHA 4QHLA 5JTWA 1M2OA 4KY1H 4XGZB 3BPCA 1AR2A 1H19A 1ZVYA 3MNMA 2NTSP 3D25B 3EDFA 3P9MA 3GMRB 3BVDB 3BT2L 4WO4C 3MLVL 2IH1B 1HAWA 1RUMH 2ZX9A 3DUHA 5INCB 5DJ6B 5ICZB 3G5XA 3GD1C 1IILE 2YMTA 4I3RL 3BCFA 4EJ1C 3MFGB 1EHNA 1MAMH 1NCUA 1FH2A 2O26U 2Z9TA 4FFYL 4H1LB 4HDIA 2P80A 4P5TA 3RL1A 1XD1A 2CDEB 1AO7A 4BCXA 4OFIA 5EU3A 3BZ4B 2KLTA 4FLSA 1BAFL 1M7XA 1ORSB 5IIEA 4QO1A 5L8LB 3MCLL 1EHLL 1DBBH 1JZFA 3HMXL 3NIDE 3IYLW 3BSZH 4K5MA 4WUUA 3INOA 4YBHA 5IQ7L 2WZAA 4JO8A 3OZLA 1V3JA 1DSFL 1T7XA 5DUPH 4CADA 1UXSA 1BFSA 5J3HC 1RJZB 2FATH 2EDLA 4ANVA 1F3JA 1WA0X 1NCTA 5DZVA 1JPSH 4OR1A 1OGTB 4LLWA 1L9OA 3IF1A 1XF5A 3T0EB 4HMDA 5A1AA 5IROD 3D0VA 4N8UA 2YPKA 2ZZUT 2DM3A 1C08B 3V4UH 5IKCA 1XL6A 4L1TA 2OMWB 1ZLEA 4J8RB 4KK5C 2BSTB 3AT9A 5IROA 3EBAA 5JDSA 5IHHA 3CFUA 4H20L 1G6RL 1CT8A 4N2KA 5D1ZD 1CTOA 5LCVL 2UYLA 5I18L 1Q1JL 3SDAD 3SDDB 2AQRA 2DW5A 3OF6D 4L05A 3L7EA 2P47B 4JMNA 4KVCH 4HA1A 3HG1A 4MJHA 1JWMB 4W9FC 2Y06H 5E6ID 1W72A 3I74A 5JPMA 1HILB 5L8JB 1O7DC 1ZEAL 4F3FB 5TQ0H 1UCBL 4HT1L 1EZLA 1OSEA 1VZIA 5E6ZA 4M1GH 1CXFA 2JCCB 1CDIA 2KERA 4GS7C 1DYZA 4GO8A 1XWVA 4G7RB 3L2NA 1U8LB 5TK4A 3JTSA 1CICD 1J1XL 3T0BA 1TETL 2VLJD 3CBRA 3P9LA 3STZA 4A6YH 1JZ2A 2EDBA 3FB7B 4X7EC 1UD8A 4ZDHB 3WSQH 3F85A 2V5TA 3LQAH 3IJYB 4QLWA 1J5CA 5TFSL 3HI5L 3TFBA 3ZL4L 4JE4B 4PJGF 3SDDA 1NGWB 4YE4H 3FQRA 2X9XA 3QIBA 5FS5A 2VOTA 2UZXA 5C0IA 4F3FA 3NJKA 4JFOA 1HILA 3RX8A 5CD3A 2V2TB 4BSJA 3BDXA 1ASQA 3S36H 5C9JB 4M1CC 3F12B 3A4EA 4O02A 3QUYD 3IF1B 3SE4A 2UYLB 4FL4B 4MJID 1IC1A 3T0EC 1JXGA 1U2YA 2X0WA 3CVHL 2ADGA 3EG9B 3SBWA 3MLSH 3R19A 5BPPA 1XFPA 2BSTA 2CM6A 2GI0A 1L9PA 1IIKA 1QMUA 1N67A 1NIEA 3QHZL 3AREA 1ONQA 1A4KA 2B9BA 5D6CA 3CZNA 5JHLL 3BEWB 4FG0A 1JL8A 3D0VB 3QNXA 3ZIMA 2XT1B 3LRHA 5SX5K 2YC1A 1PZ2A 4LEXL 1FZJB 1S5IL 2XA3A 4P46B 2BNQA 2OI9B 3AG4B 5FUZL 4HJUA 1GGIH 4XP9L 4DP6X 1GAFH 3ASWA 3NIDF 4Q97A 5FGCE 4LRIA 2VRKA 4FQLL 4AUJA 3C60C 5CEZH 4NN5C 4DEPC 2UXFA 2VRQA 4KV5E 3RWCB 4AT6B 4KRMB 5FECB 4P2QB 2Q0ZX 4J5VA 3FQYA 4WHTA 3BZ4A 3LQAL 2FT6A 1D9KB 5JR1H 3D5OF 2W0KA 5BOPA 2ZUSA 4U7KA 3P9MB 1NCHA 4YE4L 5I0ZA 2XQ0A 4G11A 1FQ9C 4OQTA 3DX2A 4WK4B 4L9LB 5FK9B 4F7MB 1IQWH 1UH4A 4OSUL 4AITA 2YXFA 3IM1A 3OR7A 4Y4HC 4FHBD 4HEME 1H9DA 2CXGA 1FJ1B 1OGAB 2BZ7A 3EZJB 3QA3A 3ZHDA 4OJDH 4B9CA 2OI9C 1ID5I 3WELA 3D0LB 3CDCA 5IW3A 1TTAA 4OM1H 1CLOH 2ARJQ 4LF3A 5AOJA 2IAND 4F15C 2VISA 5HVHC 5FO2A 1W72H 3BWUF 1BAWA 4KMQA 2KPNA 2YUVA 2XWTA 5LG1A 4ZFZA 2X4RA 3ZR6A 1EGJL 4OCRH 1G1CA 2HFEB 4YHYB 1RV6X 1T2QH 3KLAA 1U8HA 2E6JA 5E95B 3W0WA 3BN9C 4KKRA 5TE6L 4IRZA 4ZOCA 1C1EL 3HG1E 3EHBC 1UUSA 3IDXL 5DRWA 4P9HL 1RZFH 1ZVSA 2Y36L 2JI2A 4NT6A 4MVBC 5L2KD 3ARTA 3GTVA 4YBLC 2NY5L 3H9SA 4PJGE 4UV4H 3VGHA 1INDL 1JYWA 4P2OD 1EEQA 3V4PL 4KPHL 4V33A 2DS4A 1QA9A 4RGND 4DN3H 4WHTB 3LNDA 5TQ0L 4NZUL 5GQBA 5FECA 4AMWA 2VUOA 1FC2D 2O93L 4X5XB 5C0RH 3DRTB 4YNYB 1SOXA 2FH6A 4UU9A 5DD0L 4JR9L 4I3SH 2XPGA 1SHWA 3BKJH 4BINA 2D31B 2UV3A 4JMXA 1ZVHA 3ROLB 3RI5F 5DYOB 1NUFA 1D9KD 3MBEC 3EGSA 1QBMH 4HXBL 4ZOAA 4A04A 2FDBP 5I8OH 1IAOA 2CNYA 4GKLA 4UQBA 3GXMA 5I28A 3DV4A 2YZ8A 4GG6B 3MJ9L 1RZJL 4PCTA 4RIRB 1BD2E 3ZDXF 4PREA 2VAAB 1Q38A 2DBLH 1TJHL 3H1ZA 4RQQB 2J1ZA 1Z9MA 2CXKA 3LCYA 3FQ1A 3KPOB 5T5NF 1OM3H 5TGBB 1P1ZA 2APSA 2L8AA 2OX5B 3KE0A 3VXSB 2V2TA 5K9JL 3LMJL 4NKDB 3RDTA 4Z7OF 1AKPA 1OL0A 4OZFG 1RHHA 3B7SA 1I9JL 1R0AH 2J12B 4GQQA 2IDUA 4PJXB 5D1XE 3S9DB 1BCIA 3VXOA 1S9XA 1UCBH 4PS4H 3MV7A 1QO3B 1XB6A 1YUHB 2HRPH 2A6IA 1FZKB 4CGUB 4L0YA 1N2RA 3TBVA 3N1PC 3GHBL 4TXVB 4UT9A 4UINH 2FB4L 4HFWB 4QF1B 1TZIA 4H8WH 3TNMB 2H1LM 1AZNA 4IIZA 2EYTA 4JPWL 5ISZA 5EZOL 1Z0MA 1T04B 4KUCD 3OAYH 1FC1A 5EMYA 1BHGA 1FNEA 2XZQH 3NEEA 1ZLSH 3U36A 4BH8A 1TCMA 4PIBA 1QW9A 5AAMC 2FQDA 2WQ8A 1ORQB 5E23A 4IK7A 5KOVC 3R4DA 4ZZKA 4UT7L 4N6RA 5E2TH 3FU7B 3FUEA 2IBGA 2EE2A 4NWUL 4IIQB 3MLTB 2R29L 2KDYA 4Y5XC 3IBEA 1XZ0B 4PHZA 4Y2NA 4JPVH 2EDTA 4QHNA 3QI9A 4OVVA 3BWZA 4GBXA 3SZ6A 5DDHA 1A3RH 1WJ3A 2ATKA 1H6EA 4KXCA 4NS0A 1E4WH 1E50A 4R7NA 4AV4A 1MFEL 2J56A 35C8H 3CFDB 4K3JL 4EN3C 1QZNA 5DTFB 4WWKD 2JJTC 1KZQA 4FP8L 4E41E 1JPFA 2EC9U 4KK6C 1BVNT 3LKOA 4W9LC 1KIPA 1RULL 4RMUA 5JW4M 4UQAA 2OSLA 4OCRL 3RWIA 3GIZH 1KY6A 3HUJE 5AKTA 1OSZB 3RLSA 3NIGB 1VERA 2B1AL 1H3XA 2AJUL 4LLMA 3L5WA 5B7FA 2FYYA 5B3JE 5E03A 1IGFH 1XGUA 1QG3A 2I9LB 3WTXA 1HINL 3T6ZA 4HDIB 3IMSA 2QQKL 3RL1B 1P6FA 2ZCHL 4BH7B 2B14A 3JZ7A 3BQUD 4JFUA 4LDCA 2AQQA 2IAAC 5D1QA 3ULUC 3A22A 1AP2B 4JFEA 5EOCJ 3ZDXE 3L17A 4NZUH 1UB6B 3SDXF 4GUQA 2UZIH 1VFUA 3HS8A 4XNQA 2IH1A 3QJSB 4ZPTB 3KPMB 5A6IA 4DKDC 2DIJA 1YJDL 4L3AA 3FOLB 4P5TD 1NANH 3RYMA 4QXVA 4PRPE 5E4AA 5J8OA 4S1QH 4C56A 4P3DA 2GB2A 2IPUK 3G04A 4M56A 1FVEB 5I6KA 5KSVA 4MQSB 2PNDA 2H0FA 4HLZH 1YQ2A 2JQAA 4AIEA 2ZWNA 2QSTA 4OCSL 1D5BA 3NEXA 1T66C 2A83A 4IS6A 4CC1A 1QWNA 3S37L 3GJEB 5AVZB 4N8VG 3X1BA 1CDUA 4M8UA 4RZCB 1WK0A 3KWTA 2NNFA 1CD0A 2LE9A 2P24A 1MN4A 4OU3A 4IM8A 4N0CC 3O6MH 1I7ZA 3QNYB 5JHAA 1F8TL 1GS8A 4GXUM 1DBAH 4B3VA 1QX1A 3AXLB 1TU2B 3OC5A 3H85A 4D0DA 1MAKA 4W9EC 3IDIB 2NNAB 3NIFE 4LGSB 1HHIA 3P2TA 5DRNB 2XX1A 1XIWD 1OPGH 1SJEB 1CFSB 2QSCH 2YAMA 3ROOB 1WEJH 3WJLC 2ZCHH 4R4BA 4Z3FA 2NQ3A 4ONOA 5LQBL 5F9OH 5PCYA 1N0XH 3CAFA 1I7UA 1FHNA 3HC4L 5CJQL 4HQQL 4M8RA 5ICUA 4UM9D 4QI3A 1S3KL 4EOWH 4Y4FB 2OULB 1KTLB 3HZMA 4YDNA 3ZSTA 4CDGC 3ES6A 4GG8A 2BSBA 2VDOL 4TTGA 3VACA 3M1OA 4PB9H 2DAVA 3ZE1B 3DO3A 4ZYKB 3UZQB 4OCMC 2PXYB 1T5WB 4Y19E 3S0PA 1BZEA 3ILDA 1LK2B 5JXAH 1MVFA 2DOCA 5CILL 1XCQA 5F7EL 5JMRA 4QTHB 4PLNC 4H5SA 4HZAA 1IGCL 2DF3A 1FL6B 3B5HA 3N43B 3GUTB 4LLYB 4Q9RL 3L3HA 2K6WA 1SMAA 3BMWA 3I75A 3VWJC 4NUQA 1MKFA 3QEUA 3OLDA 1V8HA 3C5SA 4AZUA 4X6BB 3EJTA 3BRDA 5I15L 4E41A 4ONHA 3WLBA 3UADA 3BN3B 3PWVA 4MA3B 3W57A 4R9HA 2P8PB 2BP8A 1EPFA 3GI8H 2H41A 1R24A 3FH8A 3KLQA 4N8PA 3P4OB 3UDWC 2G75A 3P3UA 1RIHH 1OAJA 3WL9B 3ESNA 4GRLA 1JCVA 3IETA 2AK4B 4GAAA 1IKNC 4LLDB 3U4BH 3J07A 5BRZD 6PCYA 4L8SC 4ZFOB 4DFHA 1IEAB 5IFHH 1NZRA 3MRMB 1M7IB 5ANHA 3RTLA 3UTTB 4YPGB 1S8DB 3LRLA 4PLJD 3BAYA 1A6UH 4MKTA 1DN0B 4F33B 1KTBA 1XR9B 1TG8A 4N2EA 3V5HA 5T5FH 3DTXA 4TPRL 1JNLH 4G80A 4DK3A 4RAUB 1HZKA 4PG9A 1F90H 3NJXA 4WFHE 1RZIB 2WV3A 3V6BR 4D8PB 2XXMB 4JHAL 2PABA 4PV8A 4C83B 4LRNH 2K6ZA 3QORC 3ZO0A 4DP9X 4S1SH 5EF2A 1NPJA 2VE6B 4Z0XB 3RDTD 3WFZA 1MCWW 4GW4B 3QFGA 2JV6A 3DUSB 1A1OA 5E4OA 3PDOA 3B3BA 3TYGL 2LU4A 3KLLA 1MELA 4G70B 4LP4A 3B2PA 2P44B 3HRZB 3HRZA 3MLWH 1CFNB 1U30A 3O2WH 3NVQA 3FB5B 4LASL 1FF5A 3UX9B 3S2CA 3S37H 1BM3L 4PRID 2IWKA 3ETBF 1UEMA 1YN6A 3ZYIA 2VE6A 3CIAA 1M3JA 5I9QB 1A25A 4YSRA 2H8PA 2JXMB 2APXA 2K9UA 5IB1A 2YGVA 4ZOEA 3LZFL 5B4MC 1SOQA 2H2PD 4PV8B 4C83A 4HOXA 3BW9A 2X6BA 2ZX5A 3FRPG 1OF2A 1BFOB 4EI6B 3VU1A 1WISA 4JFQB 4PGCA 2CBMA 3M6DA 2HUEA 3SYOA 1EZVY 3H9YA 3I9IA 1KCUH 5GXBB 5D6DC 1NA8A 1U0QA 2X2IA 1ZGLP 3C9NA 4X4ZA 4YHZL 2VAJA 5ESVB 4JM4L 3ZDXB 4Y1AB 2EUVA 3JWNG 1K2DB 3O8XD 1KEML 5DHMC 3M1CA 4MDIA 1HDMA 2CJTA 4YK4C 3K2UH 2PO6C 1ADQA 1I82A 4L29A 1BEYL 2WNKA 2JI3A 4WEBL 2P5EB 4ODSH 3K2KA 3QFJA 5ICXB 2XIIA 1KIRB 4QUOA 3I3DA 4BIKA 3RUGE 4EKXA 2HB0A 4LEOA 2DTML 4ABWA 4JKKA 1Q90A 4Z9KB 3B6SA 4LSUH 2NY7L 1XT5A 1FYHB 1B0GB 3FOMA 3HVDA 1FNLA 4FQHA 5G4NA 1FIGL 1KG0B 4JFHD 3CQFA 2FX8L 4LPXA 4F57L 5F3HA 5CD5D 5DUPL 2HG5B 2FD6H 2YARA 4G3YL 1E40A 3RFZB 1JYXA 4HUMB 2NNRA 1OAXL 1PW3A 2HLFC 4D94A 5CILH 1BZ7A 3FH7A 2YFOA 1UM4H 4WK0B 2HUHA 4IRSC 4JO1L 1SY6L 2N0MA 4JY5L 1ERNA 5FYJH 3ZQ9A 3II3A 3MHZA 4JL1A 1V5JA 5DJ2B 3WBDA 1MCCA 1OCZB 5CGYD 4FXGA 4K2UH 5GGSB 3TPUA 1BLIA 4Y9CA 5E51A 1Y1DA 3TZVA 3U6RA 1JTTA 3B9KC 4ZFGL 4ZYKA 3PABB 4NQEB 3ESPA 3WIHH 2C9VA 2J4WH 1AQKH 1HHKB 1D5ZA 2ADFL 3HFML 4ZX6A 1CBVH 5E00B 4KHXH 4P5MA 1DANU 1GGTA 3S2AA 3P0YL 4KVCL 2BSED 2VABB 2PCPA 1OAQH 5F9OL 5DJCA 1NCGA 4PWFA 2XKNB 3MRFB 3DJZA 3TNNA 4G6KL 1WZLA 2CO2A 3AWEA 2DLIA 2E59A 5DK0A 4PJ8B 4U6VH 3S4SB 1BD2B 4NIYE 4ODSL 4P5KA 5ICXA 4XWOC 4YAQA 3QP3A 3JVGA 3IMWA 1JZ6A 4QOKD 1WFIA 2UVFA 3KYOA 3PP4L 4CL7A 4FQXD 1K2DA 1HXKA 1HI6A 4PVMA 3BVVA 3PXHA 3WTWA 1XGZA 5GS3A 2C3WA 4IRJD 5HJ3B 4OJCA 3VX0A 1DVYA 5BMFL 2OMXB 1EZSA 1MCLA 4A2LA 3M88A 5EBLA 2QZQA 2AK1H 4AQ1C 4PGCB 3WIFB 3MX0A 2DI8A 4ODWB 4RGMC 2W9EL 5BZZA 3SDDC 5F7BA 2HJKB 3MRKB 2KYIA 2QQQA 1DL7L 1BQRA 1OHQA 4HAFA 5KZCB 3ATFA 5LGHH 3IE9A 1XF2B 3HC3H 1FA4A 4PJBE 4DGVL 1XBDA 3QIBD 3DJ9A 3N1FC 4LBEA 4GW1B 4PUBL 2GJ6B 5CZRA 4AW4A 4YFLF 1A14H 5HSFA 4H4NA 4BQ8A 4NQQA 4Q58C 3SODB 4Z6AT 2K3HA 5EEXA 2IMNA 3QXVA 4LSQH 4P2RA 3ZPDA 3BFOA 5BUGA 1ETJA 3FB6A 3KYMA 2BOBB 3N85L 4NKIL 3TONA 4HUVA 3EJSA 2QFRA 4ODTL 5JUEL 1UB6A 5PAZA 2Y6TE 4XCEB 2J8OA 4XNMA 4TLSA 5C0RL 2OFQA 5I5JA 4PG9B 4OLZH 2Z6FA 3KYKL 1BQHG 5T5FL 1FG9C 1T3FA 2WUCH 2ZP8A 1PNCA 5IK3A 2DEWX 2WSDA 3PV7A 3P11L 4P2OA 2X4PA 4PRHE 3LV3B 1GYVA 4M00A 4HHAB 4ZUSB 3KWUA 4F7EA 2EEXA 2DJSA 1GL4B 2K4AA 1QQDB 3BQUA 3BWAB 4WI2A 5E9NA 1FV1A 3T5WA 3QQ4A 5IJKC 5EO0B 3W0WD 1ZT1A 2DTMH 3ZY7A 2COVD 4E68A 1VZHA 3T2PA 3S36X 1CR9H 5TDOA 5HGDB 3TBWB 5SX4H 3U6XS 4RDQF 4XCNA 1G7JA 4MD5B 2YRBA 1N6UA 3ZSSA 4ZNCD 2P26A 1LP9B 5L88L 3GMMA 4H25A 2P45B 3KEDA 4TKWA 1WZAA 3IGLA 4J12A 2R1WB 4KJWD 3H2QA 3MLXH 4NM8H 3ZHFA 1T83A 1AD0B 4P04A 1RU9L 1WITA 2W92A 2X2YA 3NJFA 3KS0J 2L04A 5CJXA 1SDDB 2ZOOA 4H5SB 1OGAE 1HL4A 4HJ1A 1GOHA 2D9CA 4F8LA 3CFKA 2WLIB 5DCCA 3UO1H 4GMSL 2FBOJ 1OARH 5D7IE 5A2CA 3VVVA 3GMQB 1E6JH 4UMGA 1HN1A 1QOKA 4NKQB 3KJ6H 1HYSC 2NCEA 3U0TA 5ADPL 1BG1A 2R7EA 3B7RL 1ZTXL 4YLQT 2R0WL 4FXKA 3TH2T 4AE1A 2H4EA 4NFDA 1HQ4A 2ADFH 3HFMH 3ILQD 5IGXL 2DL2A 1J8HD 3T1WA 2DN7A 1K3IA 4TNWK 1SQMA 2WK2A 4AZ8B 4EPSA 4R83A 3CFJB 2GTZA 5GGTH 2X4TA 1CFVH 4LPUA 4F7TA 4LSSL 1A4JA 5HI3C 2LU7A 5MENB 2FL5A 2V3DA 4CMMA 4R4BB 1MHEB 3BH9A 3BI9X 4DPCX 5HYJA 1S7VA 4MXQD 2CJUH 2P80D 2XZCL 2VLLA 2C9RA 5CR1A 3NZHH 2CNZA 1N3NA 1RK0B 4GSDH 3GZPA 4UB0H 5TH2B 2Y25A 5HGBB 4G3YH 4P0DA 5C0FA 1A3RL 3RVWC 2ZSVB 4LAQH 1LWRA 3VFPA 4F2MA 3WKMH 4JFDB 5C1MB 2NZ1A 4WNJA 4Y5YB 2OL3L 3D12B 1JGVL 3FU9A 1BEXA 2GJJA 4ZMYA 4YIQA 5BXFA 2VR4A 4Y89A 3CVBA 3GK8L 3QCTH 4KUZH 1JERA 3T65A 4DP1X 4JBSA 1PLBA 7PAZA 4BBWA 4QNPE 3NIGE 4WW2C 2EIKB 3SEPA 3T3ME 5KAQF 1UWXK 3O2DL 4FCAA 5C09E 1M42A 1J8RA 5D9SA 4AM0B 5DJ0A 2FO4A 1M3IA 2ZD0A 1T1ZB 1BQSA 1T22B 1A6WH 2C34A 1T0OA 4MS6A 4UOW1 5DD5L 5I73B 5L4FA 4NQDD 3F58L 2D31A 2J3SA 1FGVL 4DTGL 2EKSA 3QUYC 4JHWL 4CDHA 5IFJB 1Z5HA 3FN0L 1RK1A 2TRHA 4R26L 3SE9L 3OAUH 5DD3L 4Q0XH 1LQBC 3OAZH 3MGTA 4Z7WA 5DSCB 1OT1A 3CHQA 2ZJSL 4JZNA 3VXQB 5FOJA 2QHLA 4JX0A 2X28A 2PW2A 3ARFB 5D2NA 1AC6A 4K71B 1FFPA 1JF5A 3QJHA 4NRYA 4P05A 3S5YA 1R3KB 1ZVSB 5T1MB 3UPRB 3OHXA 2GSMB 3T0AA 1SN2A 2CLZA 2V6HA 5HYIA 4L8DA 1OSZA 4E9XA 1JDCA 4YDMA 4AGMA 1HZHH 4FZ8H 4P23C 4J2QA 1FLTX 4GIPD 1CZ8L 1XMEB 1KF9B 1KIPB 4U1IB 4YK4B 1EUTA 3JWDH 5D7IF 4JO4L 1RLWA 3V4UL 2F53E 2X12A 4W4NA 3ZIYA 3MRRA 2V17H 2WWKO 4ERSL 4ZMOA 3OKKA 5I1EL 2BHZA 3UOAB 1I8AA 5IW6B 3CXHJ 2ICWJ 1QBBA 5E2UL 1EFXA 2JB6B 3U2SB 3LB6C 3CPLA 2I5YH 2F8IA 4DVRL 1E4WL 1A7PL 1JZ3A 5LGKA 4YDJB 3APNA 1BFTA 1JNJA 3N44B 2DWDA 4KZDH 1ZEAH 1HAUA 3FAWA 2WQRA 3SKOB 1NGZA 3ZX1A 4HC1A 4Y19B 2JKIS 4UT6H 4URKA 5IMLA 3T6XA 5E1IA 4F7MA 4IIQA 4C4KO 2ZOLB 1OAYL 5CBAB 3RA7H 1JF1A 5KUKA 3BVTA 3PJSA 5DS1A 1WWWX 2Y07H 4P9HC 2IXQA 3FL7A 4HZ1A 1X9QA 5E2JA 1NMCC 5J6SA 4P2QA 1JGDA 3LH9A 1E4JA 2A0LD 3RWCA 1QFHA 2MCG1 4HKBB 3FB8A 1CDJA 5DJYA 2F9BT 4LCVA 2MHAA 1KBWA 1MRFL 2ZAIA 1YNKH 2BXZA 2G0LA 1AR1B 5AOIA 3FFCE 1BECA 3LNIA 4HKZA 2XETA 4GT7A 1FZJA 1JD7A 3PP3K 3PNRB 5F1NA 4NJ9H 3SGJA 3DETD 5EDXA 4JRLA 3OPUA 4LQFH 4RRPM 3GMLB 3V7AE 2VERN 4G8EA 2XZCH 2Y1YA 3NCEB 3S3CB 2OP4L 5IR1A 5EOQL 4GSUA 3WS3A 1EAPB 4KMLB 4XTRC 2G2RA 1SXSA 2OX5A 3NQKA 3NA4A 4W70A 3VXSA 3ULVH 4N1CA 4HU8A 4Q56A 4ZUUA 2PWGA 4XP5L 1YVLA 2QR0A 1CD9B 1FPTL 4U1NB 2B59B 1MCPL 3BIBX 4LLQB 2QLVB 3VXSD 2PYEA 4PREB 3BAJA 3U4BL 2BIIA 4NZJA 4X8JB 1T20A 2OR9L 5D4IA 1EVTC 1IQDB 2IEPA 4JN1L 2BFVL 4Q4IA 3IGKA 3ZK0A 2Y07L 3O2DH 4X7SH 4BK8A 3L4CA 2CDFB 3O4LD 3BT2H 3HIZA 2IDSA 5E0FA 3RVWD 4HAGA 4X6DF 3IXAA 2KZKA 4GO9A 4PJ5D 5B8CC 5KS9B 1NC2B 1TVBA 4TPRH 5CM1A 3WY3A 5FHBL 2P8MA 3O45B 3RVTC 5J06A 5E5RB 4J6RL 2DICA 4G9FD 1CCZA 2CKBB 3RB7A 1KNOB 4HX1A 4Z7OB 4K9JA 1P5UB 3LRGA 4RFOH 1ZDSA 4DCQB 2W0FA 4ENED 1BWWA 2W88A 5IOKA 3KL5A 4BQCA 2YWZA 1F86A 2A4CA 3NK3A 3HUJB 3MROB 4RMRA 3MBEB 4PB9L 5AOKA 1MLCA 4JO5A 4YLCA 3L54A 3B2UD 3BSHA 1I7RA 2YAFA 1CE1L 5K1NA 2NZ9D 1X7TA 3KLAB 4K9EL 3N42F 3W0WB 3WFDH 2O61A 3J7HA 3MRGB 4OFYD 3UCRA 5D5MF 4MMXA 2FEEL 4FFVD 2VLME 5B39B 1WCQA 3QZOA 3NJHA 5DFVD 1FPTH 5B1JA 2XWTB 1NWPA 2NUTA 2WUBH 3GBDA 2EABA 1N70A 3KJ4C 3LEVH 1WTGT 4QIRA 1U8QA 1XH2A 3DBSA 4JZJA 4LP8A 3WO4B 1Q9LA 4R7XA 1KUMA 2F8XC 4FQ2L 1NCNA 4NHCH 2E7LC 3QG7H 3OXSB 2DQFB 5SWSB 3PL6D 1WFNA 5DJDB 2BIOA 3Q1EA 2PP9A 3BFWA 3JWNC 1RZ8B 4GFXA 3SQOH 3D34A 1KBPA 1KGXA 3H8NA 4WI6A 1C8PA 3IB4A 1DEEB 1E8YA 1OK0A 4OD3H 4R0LA 3VXRA 1FLRL 2BIQA 1U8PB 4ENEC 4Y2DD 4YHIA 5T3XL 3CUPA 1NMCB 2DWXA 2DY2A 5DEGA 3ULVF 2HTKD 1IGMH 1UA6L 5TDNA 4YHIB 3S96A 4UYQA 5KANG 2HX8A 1WA1X 5D2NE 1XV8A 3D6GA 2YPVA 1DJZA 1A02N 1RI8A 1EVUA 3LIZA 3R4RA 4WWPA 1S7QB 1QFWI 5GSVA 2NY7H 1TO4A 3EJQA 4L48A 5I6LA 3LQMA 5D7LD 3UJJH 1L9RA 4U0QB 3EBIA 5INDB 2NR6A 3BH8B 1UXMA 3QRLA 3Q8BA 4YMPA 4APQB 2VUYA 3LKQA 1A47A 3ZDZF 1TFHA 1P4IH 4PV9A 1QTSA 2AGJL 4H8WC 5CLTA 4WK2B 3CXFA 3UC0H 5BS0E 4XPHL 5C07E 3T1FB 3BGMB 4HK0A 3FQ2A 4XBPB 3U0WL 3VXSE 5IY5B 5FW6A 2JCWA 2ZICA 2JCCE 2J5LC 3X3FL 1HOCB 3EG9A 2X6VA 1EO8H 4O02L 3VTMA 5F9JB 4AENB 3RY5A 1WG3A 4F8PA 3V4LA 4QXGL 1YN7A 5AZEL 1CF1A 4ODUB 4WHCA 5E4EB 2P46B 1TNNA 4DZ8A 3QPXH 2LU5A 3MV8E 4U6TA 1OP3H 3FU6A 5K5YA 4JY4B 3CLEL 5EFIB 2V7HA 4PJ8D 3KLHD 1E8XA 3DETC 3C5ZB 3O11B 3Q6GL 4G6KH 3FUMA 3LS4L 4H8WL 1EEYA 1C1EH 5DFTA 5L4JA 2CKBA 4EN3B 5T3XH 3FU0A 1VSCA 1IGML 1NGWA 1QFWM 1UA6H 5D7LA 5KVEE 2FYVA 4UILL 2BH0A 1WQVT 3FT3A 2W95A 4Z3HA 4RISH 1NGXB 4GKOA 3F7VB 1OD7A 5KVGL 3VRJA 1QRNB 3AB0B 3N44F 3MJ8B 2BSDA 1RIUH 2R0ZL 1JJUA 4R2GC 1A8ZA 4KKLC 3D51A 4ISVA 3STZB 2BSCA 4K73A 1CXIA 2VR9A 3D4YA 1E9PB 3GBEA 3ZDYF 3ULUE 2A2QT 4TNVK 5I5MA 4OM0L 5DD0H 5E7BA 3TT1H 3P02A 2D4FA 3ZTJH 2OMNA 3TVMB 2R2HB 1IAMA 3KPSA 4GEIA 4YL4A 3SDYH 5E8OA 1UGKA 5E2TL 3GHPA 2Y2WA 1AGFA 3MOAL 3RVXD 5HHOB 1AFVH 4H13C 1YY9D 1I85C 1KN2H 1JUFA 4QNPF 4OUUB 1CL7L 4W81A 3ARUA 2NX5E 4I48A 1KXQE 5D55A 3UBFA 3ECVA 3WS3B 2O6EA 3VXMA 2R4RL 2OMWA 5F89A 1UZ8A 4TUOB 2WIMA 2D9QB 3UAFA 3MACL 3VGAB 2OCJA 1AE6L 3RNKA 2O4EA 1FRGL 2WKGA 5J1TC 2GUYA 3T0EA 2XZAL 3NCJL 3KPQA 2VM3A 3OAYK 1S7SB 5F7YC 1J0YA 1LD9B 4HKZB 1FZMB 1AGEB 2E9BA 2IWGA 4G43A 1NAMA 1Y18A 1DO5A 1EZUA 2KLSA 4K5LA 3R7RA 4BUGA 2YGNA 4CADB 2E6QA 3BJLA 5D2LE 3OVUB 1AYOA 2ENYA 3BZDA 1FBIL 1I9IL 2WM0A 3N5AA 3ML8A 5CCKL 1AOZA 3BAIA 4IMLA 1IC4H 5DMIL 1O9ZA 1ZLDA 2F5AL 3QS2A 3B2VL 3FCTB 4I3RH 4CSZA 1NSNH 1NC4B 5BS0B 1NCIA 4L4TA 1JF1B 5HYSA 1MAML 3LNGA 3G7TA 4FFYH 1SXCA 4G82A 1UHVA 3QXAA 2UUDK 1RD6A 2AQPA 3U1SL 1ND0B 2HFTA 4K5NA 1TMQA 3GIVA 3KPNA 2ZOWA 1HYSD 2JTDA 2Z3FA 3C09B 2AVFA 2ZXGA 4QXTA 3NSYA 1Y1UA 5E6RB 1QW8A 5GSRA 2IBBA 4BRJA 1T7VA 3GSWA 1BXVA 4NNYA 1WUNT 2VIRA 1A7OL 1KIUA 3ZQWA 2DH3A 4DT2A 1CFTB 4QYOB 3OKKB 3IRPX 3VYOA 1YPZE 4ALAH 4YHNB 5E2WH 1BJMA 1WBXB 3RVVC 3CSPA 2D03H 2X4OA 2CIKA 2DQDH 3E8UH 2H3NB 3PYCA 4MMZA 2DYPB 2EDYA 2HJLA 4FQ2H 2XZAH 3NCJH 4GXVH 2Q6WB 3S3BB 1ZPLA 4FNLL 2OMYA 2P5WE 3DUUA 5GRVK 1D5XB 3MV9A 4IOFD 3UXFA 3MDJA 5AG9A 4Z7NB 3OHXB 1DBKH 1FL3B 1S9KC 2IO5A 5LCVH 5CEZE 2FR4A 2R27A 4YSPA 2VXTH 3I50H 2QMKA 4QHUB 4KKCD 1BOYA 3S88L 3NESA 4PI0A 1M1XB 5BOJA 5IESH 2Y1AA 3CH8A 4LVHC 1ZHNA 1D6EA 1GGCL 1OTTC 1QRNA 2JKRM 5I0VA 4X6CE 1YEGH 2EXSA 3WUWB 2EH7H 4D3CL 2AFNA 2H6PA 3ZR5A 1XH1A 4A39A 1D5MA 2ZCZA 1K4DB 1KTJA 2F53D 5HHXH 3DMMA 2E7CA 5F96H 5FHAL 4D9RE 3OKMA 3P11H 1IM3B 2ZX8A 3CVIL 1ROCA 4U3XA 5CSBA 2F08A 2V7HB 5D9SB 4G83A 5DUBA 3GJFA 1HXYA 1YCSA 3V5DB 3DVNB 3W3BA 1E28A 1WV7T 3U4EB 4QRTA 2WINA 5MHSD 2OYKA 3O3DA 4XOAA 3ZN6A 4JPKL 4MLIA 5A40E 1X5MA 3IE4A 4NN5B 4DEPB 4G6AC 5DRXA 1F8TH 2X70B 1IAIL 1I75A 1WS7A 4O58L 4RGMB 4YDZA 3A6CH 2RTTA 1JWUB 1BF5A 1O6SA 3TJEL 4AKQA 2ZSVA 3T8MA 1OXYA 3OG6B 4HIHA 1NFDE 2FJGB 4PV9B 3NJLA 3BGAA 4MD0A 4EZMA 3MV8A 2AMGA 4APQA 4S1RL 1RK0A 1EA9C 3D85B 3V4PA 3AQYA 3LD8C 4FQPA 4YFEA 2QSCL 2QPFA 3BH9B 3QCVL 3VWJD 1R3IL 4RFNB 2A0LC 1QSFB 4M1GL 1XB3A 2N1KA 2AV1B 4IBUA 4CW1A 4MBRA 3HS0A 2XSKA 1MQKL 4Q0XL 5BVPH 2IV9A 1QHPA 1FVCB 2H6UA 3DBXB 4UOJA 3MRQA 1OAUL 2I27N 4PJHE 3GZKA 4FQXC 5TDNB 3L4ZA 4O2EB 4MNHB 3P30L 1OP5H 1PD6A 2HSIA 2ZAGA 3RUGA 3WS6A 5EC2A 1SNRA 1UUNA 3VWKB 1WYJA 4HUUB 1GGBL 3HG0A 3C8DA 2VITA 3MXWL 1E3XA 3HAEH 4NO0D 3A6BL 4XVSL 2WW8A 3VXRB 43CAB 1DEEA 1PY0A 5D4QA 1U91B 5EUKA 3DI3B 1HTYA 2K78A 3DWTA 5BRQA 2NW3B 2KI6A 5DJDA 2AXFA 2GTWA 3SDCB 2YBGA 3ERXA 4HIQA 4ZPVA 3DX9A 1KN2L 2GK0B 4PS3A 4WDIB 4E9VA 3VGEA 4OLWL 2OXGA 3X1EA 2OK0L 4IRSB 3K2MC 3RWEA 4OIIH 4M93C 4WTWA 5L8KB 4B9FA 1IAIH 3AREC 2KZWA 2GJZA 1SEQH 1E9QA 5BO1L 3FQWA 1HH6B 5F0PB 5B22A 5ACMA 1TCRB 2X1QA 2EZ0D 1U93A 4GQRA 2OPCA 4OM1L 2WN2A 4FFWD 4AIOA 4HG4K 5IHZB 4DW2H 4B9PA 3NCYP 3B3IA 2BNRE 2FIRT 4EMZA 2WYZA 3G08A 1UQSB 1G7PA 4W93A 3QQ4B 1KCLA 1LO4L 1IBGH 1A1MB 2VLJE 1N5AB 1B4TA 1PZ3A 1INQB 1QQDA 3ARZA 3BQUB 5GGUA 1HYRC 3MGAA 3ECBA 2W80C 2FTAA 3E38A 5B8CB 4HHAA 3SD5A 4F7EB 2J8UB 5TE7L 4ZUSA 2MMXA 3HG4A 4EF3A 2FJUB 5JIKA 4OCYL 2RAMA 4NN7C 2CJSA 4B3EA 3VE0A 3UTSE 4G8GD 2P5EE 1DQKA 4XXDA 2APBA 4A7TA 4W6WB 2VXUL 2WXRA 4XN7A 5K1VA 2P1YA 1YNKL 1YEDB 4IKJA 2F8OA 3F6IA 5C0ND 5I1CH 3EDKA 5JW4Q 3OKLB 2J6WA 2VDOB 2QJDA 4Z7UF 4HIJA 2BY3A 1UVQB 3V9CA 1AD9A 3CSFA 5HVFB 3MJWA 4J2XA 4QRQB 5IB2B 4Q9QH 2MJWA 1YNTA 3N50A 1T5XA 1JZ4A 4OLUL 7CGTA 4X8JA 5HHXL 1Y6NR 2JTYA 5L9DL 1NFDF 5FC9A 1NGPH 1I1YB 1UB5A 3KWXA 3A4DA 5E4EC 5HHNA 5EU6E 4ZXBC 1SEQL 3WD5H 4XMLH 1SJHA 1WGOA 3WIIH 1HOEA 1LLAA 1X5HA 5DEZA 1DSWA 2VZVA 3BZFB 4LKCA 5AFAA 2BCMA 3A5VA 4E5XA 2ADJA 4NQSA 3QUXC 1QABA 5LAXA 1PG7H 4MNQB 1MRDL 4F37F 1RZFL 1EMTH 2Y36H 5C6WH 4IQHA 2WWKT 3A6CL 4R97B 1JIBA 2J4WL 3CU7A 2Z4QB 1S9WA 2OMXA 2X5PA 2RB8A 3KHOA 2XN1A 5TE7H 3F3HA 4APQC 4WJ5B 1G6VK 2EDQA 3DNKA 4PRIE 1OT2A 1IGIL 4G6MH 2R2BA 3HAEA 2K45A 1QACA 4PYHA 5GS0D 3AQXA 3P3RA 2FT7A 2OXHB 3GTTA 2XIBA 2MHAB 2XN9D 3IGUA 5H94A 3QARA 3OX8A 5FHBH 4I3GA 1A6TA 3NG5A 1IL1B 4PJ8A 5D1ZI 2FBJL 4NPYB 1DUZA 1DEDA 3VGAC 1E9OB 4FMVA 3UTTE 4JM4H 2VL4A 4CKVX 1DZ0A 5D7SL 4ZW7A 2IANE 4IGBD 4P4RA 4YWGL 5CLZA 5FYJE 2CDGA 2W9DL 1NAKH 3CGTA 3ETBJ 1Z66A 3GSQA 3FO0H 4P2YA 4LCCC 1GYUA 1F4WH 3KYAA 2X1OA 2ZYRA 2R51A 3IN0A 3SD2A 4KMTH 1A8JH 4CBPA 3R8BB 3WO3B 4ZT1A 4AJYV 2JI1A 5JZ7C 3VFRA 1MEXH 4LEEA 5AW6B 2F7IA 4JGUA 3KPLB 5KJRH 1UM5L 5EOQH 3ZE2E 3V6FB 3JV4A 3B56A 3CQQA 3QRGL 1PLAA 4HJGB 2NY1D 4BGDA 2BZCA 1RUQH 4TNFA 2C1OA 4GT0A 1O5PA 3P4NA 2D4DA 2OL3A 1NCAL 2G60H 3F84A 3QEQE 4AL8L 4R7LA 1WHOA 3B6SB 1FCCA 1O7SA 4HD9A 2XY1A 4NWTH 2WKOA 5KUMA 3S3SA 4JFFD 1FH5H 1MQKH 1U8NB 2I25N 4I13B 1RFDH 1V54B 4DO4A 1VCBC 1W0WA 4RZKA 3F8UB 2D3LA 5CMAB 5F6IB 1LEKB 1RZJC 1S7XB 2YA2A 2P5EA 5CZVH 3F7RA 1WH0A 1E30A 2VH5H 1ICTA 4IU3A 1C5DB 4LU5L 4NQXB 3VXPB 1KXTB 1D3CA 1QLEB 4MMYB 4IEFB 2BP3A 1J0KA 5I6OA 4JZNB 3CNKA 4P3CH 4AWJC 4ZO9A 1SYVA 2FSDA 1KIQB 4MCZB 5DMGD 3HE7D 3WEXB 3PDGA 4XCCL 5C0BB 2ZCLH 1N5YH 2QSVA 3P77A 2Q3XA 5CUSL 4EN2A 4PRPB 4Y5XA 3VWJA 3IGFA 4MX7B 2V2WA 3S5LB 4Y9GA 1M6OB 5KYXB 3L3DB 5AWNL 4AJVA 3AXHA 3IAGC 1ITBB 2WXOA 4RGNC 3WEMA 1AHWA 3JYCA 4YL9A 1BWMA 4P99A 3QZWB 3MNZA 3ZTCC 1CB4A 3MA9L 1F56A 1SMOA 3FYEB 3LZLA 1A6ZA 5CU5A 3WY4A 3WIAA 1MVUA 4DW2L 1GMEA 1RUQL 3MNVB 4HXAL 5KWYC 1NWOA 1RU9H 5FB8B 1GOFA 1BLNB 1MFDH 5I1AB 1HEZB 3FQUA 3QJVB 4R90L 2GSGA 2JMRA 1BVZA 3ARBC 2VN5A 3H0TA 1TJMA 3GT6A 5L2JB 1BVNP 4NQEE 5F97E 3GB7A 5IUCA 1N3NB 2YEZB 2HG0A 3H7BA 2VH5L 5JIMA 3KCWA 4OAWA 4PIRF 2FL5B 4UQ3A 3V52H 2QELA 4KTEL 2BC4A 4U1KA 1SBBA 4DH2A 1DQQA 3L6FB 1CGVA 3HI6L 3L45A 1YMMA 4IKLA 2IAMA 5FYJD 3SSGA 1S8DA 3UTTA 2MFNA 3FTYA 2YR3A 3IGAB 2LT9A 4ZODA 4OIFA 3KCPB 4QRSA 4OLZL 4XTRD 4L4TE 2SODB 5KYYB 2XWDA 3QXWA 3IETB 3L2MA 4Y88A 5TQ2H 5JW5B 1KLFB 1Q0XH 3VFMA 1BAFH 1QRND 1UZ6E 2L3BA 3NCXA 2C4FT 1PG7W 1AYRA 1X4XA 1FN4A 2WBJD 3QO1B 4R2GD 5EN2B 1AGBA 1XAUA 5IROC 4NZRH 2BJMH 3ZTEA 1C9SA 1N4XH 1JE6A 1NFIA 1U6AL 4NNXB 2BXYA 4E41B 4MQTB 1SDDA 1A7RL 3ZE2B 2R0LL 4PJIA 3QXTA 1JDDA 3T77A 3O2WL 2PR4L 2EDOA 4NENB 1E5YA 5DI8B 1FL6A 2E75C 1F4YH 1N8OE 2GSIA 2Y7OA 4FFWC 1G7JB 4NJAH 4U1JB 2KL6A 1QTPA 3OJMB 3TX4A 5LGHL 3HC3L 3EO9L 3MRJB 4FQ1H 4GAFB 3E9UA 5DO2C 5HGDA 1OTUD 4JKLA 1M4KA 4QRPE 2XN0A 1E6JL 3WEOA 1OCWL 1TOXA 1E2ZA 4WFFD 4OZIE 3FO9A 3OC8A 2XWJB 2K8MA 4A6YA 1T5KA 3NJNA 2B08A 3HVNA 4IHOA 4F1SA 3FO1A 4DP8X 3HHSB 1SDYA 5J6HA 3BWUC 2X4QA 2XV3A 3D50A 1L6ZA 3OGOE 1A6WL 5TPWH 1V55B 2Z91B 2X4PB 1V7NL 2HCZX 4U1KB 2WJ7A 2CGZA 5AVTB 2AAAA 3EYOA 4AQOA 5JHDA 1OWWA 3LKPB 2RFXB 1FYTD 2VQ1B 3JSSA 5FIEA 4HWBH 1K72A 3C5XA 1U8KB 4WI0A 1RIVH 2X4NA 4N9GA 4OKDA 5E5LA 4DNLA 3BUPA 3SYPA 2Y6SC 2CO6B 1USZA 3FRPB 1DJWA 4MNQE 5K59F 2BERA 1FNGA 1IBHA 3TWCL 3SQBB 5C92A 3ZQXA 1W72L 1JHLH 3LRMA 4I7ZC 4JM2C 4HK3J 4QAMB 3AT8A 4GSDL 1ED3A 1MFCH 2DWEB 2YGOA 2NY3B 3RGVB 5E8EB 3X11B 3ZT7A 1H6TA 3I85A 5KSAD 1HEHC 4FABL 2FGWH 1H3WM 2F1EA 1A7PH 2P43B 1X7QA 5DZPA 4DO6A 1J5DA 1M6OA 3B9AA 3SQBA 2DEYX 4LASH 1H3TA 1MCBA 5ALCH 2OTWB 3O81A 2QQLH 2F74A 3VXMD 4JPIB 3BN9D 2LV4A 2VDNH 3WKPA 1U8IA 2ZPKH 1CTNA 3FOLA 1KZYA 2FLRT 3FUIA 4PG2C 5GRZA 3VFOB 1NCWL 2YUXA 2H6OA 4XCYA 5JW4R 2VW6A 3H3PH 1ZANH 1RKRA 4Y16D 1AP2A 1KXVC 5AG8A 3PWPE 2I60H 5C2BL 1GGIL 4XP9H 1UYWH 1C5DA 1CN4A 2Y2YA 2VQ1A 3NFSL 1MCJA 2XTJB 2YMOA 5K9KB 1MZYA 1O6TA 3O4OB 3QZLA 4RNRA 5JHDB 1BD2A 5F71A 5DK0B 3S4SA 3TV8A 1D2PA 3RP1A 2J8UE 4JKNA 3C60A 4YEEA 3QJUB 3RPIA 5EF0A 2V33A 4HU2A 4JHAH 4HPOH 1GJUA 1F4XL 1AY1H 2WJ5A 3V95A 4PPTA 3EHBB 5FGBC 4DN4L 1HHKA 3FT9A 2EQDA 4L37B 1EBAA 3FPYA 5LDUA 3OMAB 4MMXC 3CE1A 3GS0A 2DLTA 3APCA 2EIZB 4L4VB 5B7EA 1OAKH 4XAWH 4TTDC 5I75C 4JB9H 5JZ7D 1JGLL 3OHMB 5IM7B 2F58H 1JNNL 3EGDB 1YC7A 2QMJA 5HVHB 3MJ7B 4BHUA 4MFHA 1AXSA 1JHKL 3IU4H 3NCCB 3V0VB 1ZD6A 5TE4L 5KEZA 3LY6A 5E8PA 3QDJD 3B7YA 3NGBB 2YD4A 2FIKB 5DXWA 5A7BA 1HE7A 2WBWB 4N2DA 2QQLL 4JRYD 1CDCA 1ET5A 1IFGA 3KLHC 3GK8H 3QCTL 4G6JH 4NNXA 2UZYA 4S0SD 4Z7VB 3SKJL 1EGJH 1KTCA 1BBDH 1B0GA 3FOMB 2FB4H 5KJ7E 2B3IA 2WTRB 4LOUC 3T2OA 2OMUA 1CDGA 4QRUA 3EO1A 1G0YR 4L1HA 3BDYL 4BH8B 1TYRA 1KIRA 3NCWA 4MQ7A 5FO8A 3SIKA 2A3TA 1OWRM 1QSZA 1FO0L 2AKRB 2E4TA 2GKIA 2FK9A 3K80A 5JHDE 3VTTA 4EE2A 5CKAA 2Z4TA 2YJQA 5C0JB 2AQ3A 2ICEA 4DP2X 2MCPL 4HH9B 2YQ3A 2FJHA 2E5EA 2QDVA 3AT0A 3IPBA 1B6UA 4RSVA 4ELMF 5D7EA 2YMXH 4D3CH 4ZX3A 1BBJB 4QJ5B 1R4XA 4KKQA 3MPCA 1I3VA 1KGIA 1BFOA 3MRDA 3TT3L 2VUKA 4F7PA 4M6MH 1KJMB 2MQ0A 3AUVA 3IVKA 1G0DA 5J6GA 1IAII 3ARYA 1FP5A 1YN6B 3HG3A 3K72A 4IBSA 1MFEH 3MRHA 2FWOB 4Z77A 2H9GB 4ABQA 2WZ5A 3UBXA 3LKNA 3MRNB 3WTUA 5G2NA 4BFRA 2Q10A 2ROXA 1SHXA 3L3KA 4HOWA 3A67H 3RVVD 2QGDA 2XBTA 3CX5J 4BJLA 4HULB 4FXKC 2WSPA 1F3RB 1BJ8A 3AJ7A 3MUY1 2G9KA 3DV4B 3VGDA 4PP2A 3VD5A 3GYRA 3MJ9A 4V1DE 2BVUA 3QQ9C 2YAPA 2ITCB 2IALA 1V3LA 1KULA 5IJKA 3EGSB 3WAJA 5IBUB 2WLNA 2ZNWA 3P3YA 5DYOA 3HTLX 4D8PA 1S7TA 4R6UA 1XB8A 1E7VA 1YEDA 3FKUS 4L5FE 4RAUA 4QWWD 3H42L 5T5NG 2VLKD 2VXUH 4CMHC 4Z3EA 2OR9H 3V5HB 4C56E 3MLVH 2XV6B 4L8SB 4YHLL 1YSOA 3OPZL 3L7FB 1IJ9A 4B9YA 1ZLWH 1AHWC 1HHHB 2A77H 3BMVA 3UZEA 1T03H 5B8CA 1NCJA 2XQBL 3EO0B 4BA0A 2QADD 4IU3B 1CFQA 1UFUA 4DJMA 3TIDA 4M7ZC 2CCWA 1LEKA 2QKSA 1J1XH 4UCFA 4HS8H 1F3DH 3D4CA 4PCYA 1NCCH 1P9MC 1P53A 2AK1L 3WL9A 3MCLH 4KKBD 2XDHA 1EHLH 3DVFA 5T3ZH 2DLFH 5LB1A 2G75B 2N56A 1W16A 4MAUL 5JO5A 2H2SD 2JKLA 4Y7MA 1E5UI 3ULUH 4XPHH 2X4RB 4PJDF 2H2SC 3CHOA 1D5IL 4WW1A 2R2EB 1LGVA 4WNQB 1VGEL 2HWZL 3FQNA 3UZVB 3SZKC 3B8YA 1PY9A 1GH7A 4KKAD 4KUCF 4PUBH 3DA0A 3WU1A 1DJSA 1DBAL 1MRDH 4HETA 4KAQH 3V0WH 2IQAA 5KSBF 1ZLWK 2W60B 3T0EE 2Y72A 4QGYA 3WTVA 2VLRA 4K3JH 1EEZB 1R5VB 2HTLC 4FKKA 3HN3A 3PFUA 2ENJA 5EA0L 3VI4F 2FEEI 2K70A 1AZVA 1QFPA 3OR7B 3UZQA 2Z7UA 5AZEH 4PP1C 5D2LA 4H8HA 1FZOA 3QC5X 4DPAX 4JFDD 3AQDA 1Z5LA 1T1YB 4Z7QB 4AE0A 3HE7C 4P4RB 3SE9H 1LM8V 1KC5L 1TR7A 1QSFD 5I6XB 3UTOA 3CHSA 1YECH 2COQA 2XA8H 4WUKH 4M02A 1FVCA 3PAYA 5GZOD 3QUMH 1LK3H 2J5LB 5DJAB 4YHPB 5FUCC 5AL0A 1VFMA 5MEND 1HINH 1OEZW 3W5NA 3NH7H 2DQUL 3QIWD 2HTKC 2HVKA 3QUKB 2XN9A 1TQBB 1KYOK 2DQGH 4XCFL 1CFSA 1I9EA 1GCYA 5EG6C 2YAHA 4NN6C 5GGTL 1J1PH 2QGCA 4HS3A 2F19L 4OZGE 3V7MA 1CS6A 4J3OG 4LKXA 4RETB 4HZLB 1WT5A 4BFIB 3RIFK 1HZHL 4FZ8L 3M7OA 4MSWB 5EO9B 3W11C 5KVEH 3TN0C 1P7QD 4U3SB 1XL4A 3O6LL 4YGVA 2ADGB 2FCBA 2DQHL 2Y7SA 5FO7B 1WSST 5MEOB 3GSUA 4IMKA 1L9TA 4IK6A 3F01A 1XGRA 1R5IB 5HHOE 4YDLC 2PPCA 4X2UA 3EFOB 5E6UB 3U4KA 3AUWB 1AQHA 3KW8A 3T04D 3OB0K 3UO1L 2JE8A 2ZKXA 1VPOH 4UAOB 3AWFA 2AJYL 4UT6L 1JD9A 2R9HC 4PW9A 2VQUA 3FQRB 2DWTA 3VNYA 1T5XB 3HCVA 1C16A 5F72S 5ID0B 2W91A 2OZ4A 4F7CA 1A22B 4Y16C 1UVQA 2KBGA 2P5WD 2R69A 1Y6KR 5CGYC 4N2MA 1D6VL 3TU6A 5LNDA 2NUPA 2OMVB 1DLFL 1WF5A 1U58A 1UG9A 3NTCH 3VI4A 2ZIDA 2OSYA 3NQIA 2EC9T 1ITCA 1MFVA 2VDMH 1OANA 2WLHA 2XWCA 1U42A 3EXLA 4FFZL 4JM2A 4NM4L 2KHAA 1N64L 1RL1A 2XG5B 4DPBX 3V2AR 2BY0A 3IDGB 4TS6A 2NMSA 2CLRB 4F5CA 2WGNB 4JCMA 2IIJA 2H0PA 4GRMA 1QFUL 2OTPA 4A2FA 1DN2A 1VFAA 2FJFB 1UD6A 4JG5A 4OCLC 3W39B 1N9PA 1Q9KB 2EDKA 1M71B 2GCYB 2G5RA 4ABUA 5T3ZL 3GQFA 4ALAL 1BJ1J 1CG9B 3E0GA 5I17B 3TA3D 4I0PA 1IM9D 1RSFA 1JHTA 1WZMA 2D03L 5JXAL 1L7TH 1TQTA 3KHQA 3CV5A 2YPKB 3BLBA 2XACC 3S36L 4HG4J 2ATKB 3JWDL 3MKKA 4LARH 2JWYA 1OGTA 4PS8A 3HE6B 4GUCA 5I17A 2CAKA 1G0XA 3MN8A 1F3JB 3AACA 2GCYA 2OQJA 3ARBB 4PJGB 4TRPH 3PG2A 1UM6H 1KMGA 4E9YA 3QUMA 2GTWB 3EH2A 3LXCA 2PKDA 2WCSA 3L9YA 3EJJX 3NSFA 1NBQA 4F80A 2YBRB 1LYQA 2P5WB 1ORSA 2ID5A 4NCC1 4WTZG 1S5IH 1A6VH 2VXTL 2VITB 4AGLA 1FNEB 3NRFA 5FUZH 1T1XA 2ZJSH 4M6NL 3WE1A 1OAYH 4JR9H 4I3SL 4IRJB 3FUFA 2VDLB 3EH4B 3BSZA 4KX9A 3VGBA 3STLB 3MO1B 1Y18B 4ATTA 1FBIH 2CBOA 4N26A 3QWRA 4RFOL 5CBEB 2W65A 1IAIM 2GTQA 2B4CC 3KR3H 1XVSA 2BSEA 4BELD 2X3AA 4KQ4L 3N0AA 4I0KA 4Q14A 2E47A 4AVIA 5D1XA 4C4BA 2UX7A 3OKEA 3MV7B 5KVDH 3DX6A 5TDPA 5JOPD 1MFMA 2DIAA 3BP5A 3M8OH 2WO2B 5EBMB 3GINA 3Q2VA 4YUEL 1NL0H 1YUKB 5FA4B 4NUGL 4XP6L 2IQ9L 1AR1C 3MUHL 4H0HB 3UG5A 5ACLA 1PQZA 4PYGA 4EO5A 2CJ3A 5HVGB 2YAQA 4JFPA 5BQ7B 3N06B 4HWEL 4J1UA 2EEDA 1DR9A 4HCFA 3T3MF 2YSSA 2NR6C 3Q06A 3WYRA 4FNLH 1KJ2A 4UNUA 1NEZG 4MMZC 3LH2L 3IDNB 5LGJA 5D1QE 1LILA 2R69H 4QCIA 3I9AA 3ZL2A 5DYFA 1A7BA 1OE3A 1MPAH 2DMBA 2Z0UA 3NP4A 1HNFA 1L0QA 5DFWH 4DKFL 1UH2A 1OB0A 3MCKA 2XOTA 1S6NA 4W9KC 1RERA 3SQOL 3BZEA 2NYKA 3GJFB 4M1CD 4NHUA 3FDWA 4YQXL 1LEGA 1LMIA 4X6FB 1SLXA 4JFYB 4KXBA 4OLXL 5I66A 15C8H 3C5ZD 4LQ1A 5IF0A 1PX4A 3GIZL 1KCWA 4XNYH 3QUZA 2VXSH 5IV2B 5HHPA 5FYLH 3G5VB 3MNWA 4LSVH 4ONFH 3Q0HA 4OZFH 4RMSA 1UOWA 1ZCRA 4JFYA 1X5GA 1AANA 4Y4KD 3DPDA 2NX5B 4EI5A 4M7LT 4FTVE 1PS3A 4OD1L 3RILA 4N86A 5L7XH 4S0HA 2WMPB 4P2AA 4A7QA 1H9VA 2P5ED 3B1UA 3OV6A 4FFTA 2NXYB 3EOAA 2H1XA 3H4HA 4UQCA 2NT1A 2NY6D 5J1AB 1L0PA 2F54E 2GW5A 1PKOA 5DRWB 5IVXB 3AS3A 1R3JA 4ACTA 2OP4H 3FUNA 2BM3A 3MJ6A 2CR3A 3FTGA 5DQ9B 4OIBA 1F2QA 3JWOL 3B9KA 4PRNA 3FU5A 3S4SG 3VB9A 4AYDC 4DESA 1HKFA 2X4OB 2W5PA 1OP4A 3QCUH 4AKOA 3S5ZA 1WBXA 2KPWA 4PS7A 1J9SA 3L9EA 2JIXD 2N7SA 1GGUA 3O6FC 3OZ9L 5SWZD 3B9KD 5INDA 5I2IA 1C7SA 4Y5VB 4JUSA 1ZGLM 2R23B 3ALXA 3RG1C 4JFPB 2CIIB 4UYPA 3QA3B 4LCWB 4GAGH 4PJ7F 4MJ4A 4PRHA 3TJEH 5JO5B 3ELAT 5GJTH 3DURA 2AAVA 3UAJA 3JYBA 3M45A 4JAMB 1XGQB 4EIZC 1J9RA 1EJ8A 1DLFH 1IGJB 1T0MA 3TZVC 3A21A 1CFQB 4NC1C 1AQKL 1NKRA 2ZT9C 3QDMA 2V0AA 5SWSD 3EF4A 3EKCA 2GEEA 3GHBH 1U8PA 2ICWA 4OCYH 3WSQL 1DSYA 4OD3L 3VH8A 3UTPE 5C08E 1WWCA 4RLDA 5EF1A 4WSJA 3STLA 4PFEA 2Y7QA 4OT1L 1ZLVH 4HIEA 3VFNB 4YXKH 4LMQE 3UG3A 3TTSA 1Q9LB 2BNQE 2AEQH 3V5KA 1U8QB 5F70A 1N10A 4JDTH 1TTCA 2BNQB 3VG9C 1BZDA 2GAZB 3EADA 1S7SA 1GTFA 1ZKAA 4LESA 3TCTA 3F5WA 4WFGD 3MBED 5AZ2L 2B16A 4YXLH 4J3TA 2F7QA 4PJGA 4G72B 4MB5A 3WG7B 4ZSOA 4KO5A 1CG9A 1PLGH 4F91B 3NAAL 4OTXH 1J5OH 4PBXA 4JPKH 1KBBA 3DOIA 2UUDH 3QJXA 3W39A 2FJFA 1AS6A 3MROA 4XZ4A 4WU5A 1II4E 4WI5A 3MMEB 3I6SA 4LEXH 3Q5OA 3C2AH 3K4AA 4ZOBA 4I0PB 1TTGA 3ZZSA 3CSYB 4PJ5B 4HGKC 4X6DE 1KNOA 1AXIB 1SBSH 1IJNA 3WHXB 5DD6A 3MBWB 2R2HA 4PWGA 4Z7WF 3I9PA 3V0DA 2P8MB 4JN2B 2D0HA 3PRZA 5BV7H 2RIKA 4RGOL 2VDKL 3BAEL 4NX0A 4X5PA 4PJ7A 4ESKA 4ES8A 3C6LA 4NB7A 2C9QA 1EX0A 3JTSB 1E6OL 4PY7B 4FHJA 2ICES 2NQDA 1IRAY 1DVSA 2WBXA 1CYGA 3QYMA 2M26A 5C0DA 3WKQA 2QPEB 3VI4B 4BFBD 3FO0L 4OV5B 3EO1B 1DANT 1MCIA 2XC8A 3OAWA 1L0YA 2FH8A 2J6EL 1EAQA 4MJ5B 4NC1E 3SCMB 5HYSG 5JPMB 3HG1B 4ZFQA 2W9DH 3IMVA 3W9EB 1COBA 2PWDA 3WN5B 3RWHA 1AIFA 2FQFA 3HCVB 4X9BA 5C09A 2AEIT 4LCWE 1U21A 1G4MA 1GOGA 5EIIB 4LT7A 4Z7QF 3CHXA 1MCKA 4WFHD 3WUWG 5BCAA 3U6XA 3TN0A 2CCLA 5IR1B 1HL9A 1VJSA 5KW9L 3MZGB 3HBZA 2R1XB 3FS9A 1EO8L 1U3HA 2CO7A 1MPAL 4JFDE 4MXWH 4XP1L 4XXWA 3GLDA 2VWEC 4I0PD 5ICYB 1PG7X 5ISZE 1J88A 5BO1H 5CR8A 1QPKA 5DMKA 1JYVA 5L88H 4CN6A 1BSIA 5EO1B 4UT9H 4ZS6C 2HLAB 1H8LA 1JAEA 2E7DA 2JB5L 3C60D 3N43F 1U3HC 4QAWA 4XXWC 5EN3A 3KPRB 1M7DB 2XI9A 1E2WA 1INDH 5KS9F 2DQIL 4WUUB 4IDJH 3A47A 1OT4A 4MJ6A 5DJYB 4PD4K 4MSWA 5EO9A 5IFHL 1WD9A 5DLLA 4F2ME 1S9YB 4ZUVB 4YHLH 5FV1L 3V79C 1BOGA 4EIUA 4Y9EA 5CZXD 3GO1L 1RUAH 4JHVA 4A6YL 1TQBC 5IG7B 1VKXA 3QDGD 2OCFD 1OPGL 1FUNA 5K9KA 2G3ZA 3X12B 4P5TB 3WN6A 7PCYA 1T1YA 3L9BA 5DJZB 3BEVB 3QJQB 2OM5A 3MV8D 1IBYA 4G6FB 4KRLB 5D2LB 4LLVA 5HI4D 2OBGA 5MERA 3BUIA 3HN8A 2MCPH 3K7UA 2G4GA 3ALPA 1NFAA 3MV7E 4F9PA 5L2KA 4HUKB 3EH5B 3KWVA 2FRGP 3U83A 1DQJB 1ZS8A 1YMMD 3GMRA 3NGBC 4Q8BA 4I0CC 4NQUA 1WFTA 2WLLA 2X09A 1ASOA 3U2SA 1SDAB 1QUNA 2IWFA 4I8DA 4EZJA 5KN5A 1QLEL 2XWBA 1QR1B 3ZT5A 2K0RA 1XIWC 5C0GB 4OKVB 1AHMA 3C87A 1LDSA 2YFNA 4P23D 3US0A 5LBSL 2VC2B 2YD3A 3NFNA 1FFNB 5KG9A 5ACZA 4I9XA 2IH8A 4MMXB 2QKIA 1GZHA 2C7UB 4L8DB 2EVHA 1G4RA 1LDPL 3HG2A 3BCDA 3L4XA 3SE3A 2IC2A 1IC5L 4KK6D 4HBQA 5C7XH 4MCYA 4U4BA 1R3KA 1MLCB 2Y1VA 5SWZB 3VSUA 2PYFA 3GSNL 3QJHB 4EUPB 4AEIL 2BVOB 3ARFA 2BNUA 4P59H 1QHOA 3UZEC 4B60A 4K7PH 1PYWA 5J5EA 3L3GB 1KPRB 5GZNC 1X9RA 2X4NB 4ZX5A 2O6CA 1C12A 2CLVA 3VXQA 1I9IH 2E9GA 4YBLB 4UM9A 4NQDB 5GGSY 3U2IA 4HX1B 3PAZA 2AVGA 3RX7A 2FX7H 3FW6A 3FTWA 3OR6B 4LCCB 4AYGA 3EH3B 3I9GH 1JNHA 4KDVA 4BDVB 4GY4A 3AU1B 5KS9A 1RJLB 2NXZD 4R26H 3DYPA 1JVLA 5DT1L 5HDBE 1TITA 3CPUA 2F0CA 2GIXA 4GKSB 1Z9SA 4HKXA 2WQSA 4RMBA 1JK8B 1ZIAA 3LKRB 3G9VA 2DJMA 1YC8A 3GSOB 3Q3GA 4KHTL 1YY9C 1NM9A 3WJMB 4ZFOL 1XBRA 1IQDA 2DLHA 3MV9E 3EOBB 3LDBB 1B4RA 2PR9A 2Y23A 3BD5A 2Y9RT 4JRXA 1A6AB 4OJAA 1RQ5A 4U1NA 5EIQA 2ORBL 5D70H 1UT2A 1DFBL 2Q7AA 4Z1PA 1YYLL 2L7JA 4JFDA 1U8OB 4F8OA 4B7IA 5DI8A 1J7VR 3FQXA 3HPJB 1KJMA 3GBNH 3BIKA 4ACPA 4LHJB 4F7PB 2IF7A 4MAYA 2DMHA 1UM4L 2ALWA 1B0IA 3QJTB 4RWYL 4AG4H 3PE9A 1BPLB 4JVUA 2QVIA 3KZ8A 2V7NB 3EO9H 4FQ1L 4GW5B 2FWOA 3ZMNA 4NAQA 1UADC 2YD2A 3NMEA 2I5YL 1U8JB 4GH7B 5EU6B 5BUAA 4K3DH 4OZIA 2AANA 5L4MA 2EDRA 5HVWA 1NCAH 1OAZL 5KVFH 3IVKB 2X4TB 4NBZB 3EUUA 4S1RH 4HH9A 2ZF9A 4RSYA 5F0MB 1I3RA 4AZ8A 4HGWB 4WI7A 5KBMA 4KZ0A 4JFED 4NOFA 1MW2A 4QWWC 2XVBA 3FT4A 4P46C 3KCPA 3ASOB 5D93B 4Y7OC 5KVMC 2R7EB 4KGLA 3DMMC 1IGTA 1Q0EA 2UWEB 5HDBB 1YMMB 5AVUB 3MUZ1 3PUCA 1Q0XL 4BK4A 4P3CL 3UG4A 2O5XL 1L3NA 2BC4B 5L2KE 5EEZA 2JQMA 3ZBMA 3FHEA 4NRXB 1KEGH 3FSOA 4OAWB 3F7KA 5A2AA 4F7KA 3OLIA 3T2LA 5FO8B 1DQT<