4DP2X

The 1.8 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
molecule tags Electron transport
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp2X00
1GR7A 1N68A 1MDAA 1EHKB 1ASPA 4KOCA 3QPKA 5I26A 4L0PB 3EF4A 4KNTA 1AS7A 2PPCA 1I53A 2YAFA 2IWEA 3ZIYA 1WS7A 2BWDA 4BDVB 2QT6A 2A3TA 4AKQA 1XB8A 2FNWA 4AKOA 1NTDA 4DP2X 3X1FA 1J9RA 1TKWA 1V55B 3UGEA 1JXGA 1AS8A 2IH9A 2XVBA 5B1BB 4YSPA 1XB3A 1URIA 4HHGA 2GIMA 8PAZA 7PCYA 4K9JA 1HAUA 1ET5A 2EIKB 2EIMB 3S3BB 3NT0A 1IBYA 4HZ1A 2BP8B 3QJSB 1PLCA 1BYOA 4YL4A 4E9RA 1KV7A 3ZBMA 2YXWA 2WO3B 3X1GA 3NSFA 4HAKA 4AZUA 3CG8A 4DP1X 1OCCB 1NZRA 3NP3A 3UAAA 1CURA 1KGYE 1ZV2A 4UF7C 2GBAA 1L9QA 4HCFA 2UXTA 4N4YB 1PY0A 5B3SB 4N8UA 1J9TA 5I6LA 2BHFA 1WS8A 3EH3B 2UXVA 4YSQA 2IDSA 1AANA 4GXFA 2IWFA 3UADA 4BXSV 3FS9A 1DZ0A 3NJKA 4BDVA 1V54B 1B3IA 4DPAX 2YAHA 1NINA 4G7RB 5F7AA 2H3XC 2R7EB 3TBBA 5TK4A 4HALA 5TK2A 3CDZB 4A2HA 5I5IA 2FTAA 2VM3A 3H56A 5B1JA 3WKPA 3DKHA 1AZNA 1SHXA 1UATA 2N0MA 3PAVA 2I7SA 5A7EA 3ABKB 3QJRB 5F7BA 1GY1A 1BXAA 3EH4B 2Q5BA 2DYSB 3NJHA 4AX3A 3ABLB 1ILUA 1MZZA 2PP7A 5PCYA 5I5MA 1T5KA 1NWOA 1AG0A 2PP9A 4YSCA 1RKRA 4DP0X 2CALA 3ASNB 2YAQA 2B3IA 2XLLA 1OF0A 2EINB 5B1AB 1M56B 1L9PA 2YARA 3QJTB 2WO2B 3WNJA 1BQRA 4E9YA 2OCCB 1OOWA 2PPEA 1L9RA 1DYZA 1WA0X 1NIDA 3OD3A 4G72B 2DY2A 2VSMB 2HXAA 2FQDA 2Y1AA 3UABA 1WA2X 1J9QA 1SHWA 2HZHA 3RYMA 2PPDA 2JXMA 3OMAB 4E9VA 4A66A 6PAZA 2B08A 4G7QB 4GYBA 2FQGA 1AG6A 4E9WA 2XU9A 1AOZA 1JZIA 3FU7A 5E9NA 1JERA 1IBZA 4BWWA 1KYAA 4F2EA 1CUOA 2CUAA 5I5JA 4A2FA 4KOBA 1AAJA 5EHFA 4YSTA 4KNSA 1FA4A 2CCWA 5B7FA 4CSPA 2ZWNA 4KO9A 1ID2A 2PCFA 5B7MA 1TU2A 4DP4X 4Q89A 2BO0A 2OJ1A 4UANA 2GSMB 4DP9X 3C75A 2XWZA 2WSDA 1ILSA 1OCZB 2XXGA 1AIZA 2YQBA 1NIFA 4WKXA 3X2QB 1AZBA 2XV2A 2YAMA 3TU6A 4DP8X 3ERXA 2RACA 2IH8A 3GDCA 5AKRA 3FYEB 2IDUA 2FT7A 3GXUB 1E30A 1JZHA 3T6WA 4YSUA 3WIAA 4DP7X 2IAAC 3KW8A 4QLWA 2AZUA 1OV8A 3S3DB 3QQXA 3WG7B 3AY2A 1A8ZA 2CJ3A 2J56A 2QDVA 2BWIA 3NJLA 2HLEB 2QPDB 1KBWA 1M9WA 3PAZA 3QJQB 5FC9A 4E9XA 1YLBB 1V10A 1PAZA 2QPEB 3FQYA 2PLTA 4E9SA 1TEFA 5D4JA 4HCIA 1MZYA 9PCYA 1NDTA 1GY2A 3CVBA 2UX7A 2CAKA 3FU8A 1NPNA 1AACA 1AZUA 3OQRA 1CC3A 1TEGA 2XXFA 1IKOP 1VLXA 2AVFA 3IN2A 1FWXA 2VW7A 3N55A 4GP8B 4GY4A 2XV3A 4UAHA 1NPJA 1R1CA 1SFHA 2P80A 4YVNA 2BP8A 2VN3A 5AFAA 3ASOB 1OE1A 4G70B 4KO7A 2VSKB 4FAAB 2FWLB 3NYKA 3ZDWA 4A68A 2UX6A 3S8FB 1BYPA 1SDDB 3CZUB 3FU7B 7PAZA 4GP5B 1PMYA 1SJMA 4P5RA 2BZCA 2DWSA 1E65A 2PP8A 4YVUA 3N2JA 3CVCA 3T6XA 3OMIB 4ENZA 1JZFA 1CYWA 1NIEA 4WTQA 3T71A 3UAEA 2FQFA 1JVOA 1WA1X 1HAWA 2GC7C 3PPSA 3DTUB 4TXVB 3KW7A 3MBWB 1NIAA 1GSKA 4BWTA 1JOIA 3FSVA 1ASOA 3SQRA 4BWUA 1PLBA 4F2FA 4BXVA 1OCOB 3NP4A 3QJVB 3DIVA 4RH4A 1W6LA 2HX8A 3AG2B 1GS7A 1ZDSA 3FU9A 1SF5A 4AI7A 1OE2A 1M57B 4KO6A 4KNUA 4Q8BA 3H4FA 4PAZA 4JHVA 3S8GB 3FQ2A 4A67A 2DWTA 2XX0A 2HX7A 2JKWA 1NICA 4JHUA 2TSBA 2MTAA 3ABGA 3AG3B 5B1KA 3GYRA 5I6PA 1W8EA 2H5UA 3BQVA 1NIBA 1KDJA 3FSZA 3X1BA 3CVDA 1A4BA 3JT2A 3T9WA 1HFUA 3NJMA 5AZUA 3TASA 4GP4B 1F56A 3FSWA 2CBPA 3H4HA 3QJUB 1X9UA 4A2DA 5I6OA 3AW5A 2H47C 4NAJA 4F7KA 1ET8A 4DPCX 2FT8A 3OMNB 5ANHA 3SBRA 4KO5A 1ETJA 2AANA 2IDQA 1J9SA 3NSCA 1PZCA 1L9OA 2I85A 3IE9A 1PZAA 4W1TA 3NJGA 5B1JC 3X1NA 1ADWA 4ZK8A 5I6NA 2NRDA 2VMJA 2ZONA 2HRHA 1ZIBA 4A2EA 2I7OA 2XV0A 1E5ZA 1A65A 1AQ8A 4NB7A 1BQKA 1XMEB 1AR1B 2IDTA 1GYCA 1PNDA 4G71B 2PCYA 3T6VA 4AKPA 2PPAA 1PZBA 3TA4D 1SDDA 5I6MA 4HCGA 1RZPA 2E86A 3TBCA 1SF3A 4M3HA 2R7EA 4DP6X 2HX9A 3FPXA 3WKQA 4YSOA 1L9TA 3ZX1A 1WAEA 2LLNA 1N70A 1PLAA 3ABMB 2IWKA 2Y69B 3NSDA 4CSZA 1SNRA 3FT0A 1PCSA 1AZRA 3G5WA 4HIPA 1J5CA 1W6WA 4W9ZA 1KDIA 2BP0B 1E5YA 3EH5B 2X88A 3AG1B 2PPFA 3CDZA 3NJJA 1ZPUA 2HRGA 1A4AA 1MG3C 2BW5A 5B7EA 5D4IA 2DV6A 1IC0A 2VW6A 3NJNA 3V9EA 3X1EA 4YSAA 1KCWA 1ASQA 4A2GA 2BZ7A 1BAWA 1AS6A 6PCYA 2GI0A 3FPYA 5IY5B 2J57A 2OV0A 3AG4B 3IEAA 3SBPA 3SBQA 3D12B 4PCYA 1ZIAA 2BW4A 4M4RB 1A3ZA 2EIJB 2JFCA 3S3CB 2UXFA 1A4CA 4YSEA 2VW4A 3JTBA 4YSRA 5PAZA 4MFHA 3PCYA 3UACA 2J5WA 3EHBB 3L45A 3V9CA 1OE3A 1BXVA 5D4HA 1SFDA 2J55A 3NJFA 3NSYA 4P5SA 1AZCA 2UXGA 1KBVA 2YAPA 1XB6A 4BK5C 4JKNA 1GW0A 1PNCA 3FQ1A 1CYXA 4G7SB 2VM4A 1X9RA 1JXDA 2YAOA 3MX0B 2X87A 1JZEA 3OM3B 3U25A 1JZGA 4FA7B 1BQ5A 2DYRB 3PAUA 1ET7A 1QNIA 2P80D 4NERA 3AZUA 2AZAA 2BP0A 2FQEA 2QDWA 1QHQA 2XX1A 1L9SA 1FFTB 1QLEB 1GS8A 1IUZA 2AFNA 2EILB 2IDFA 1MG2C 3WNIA 1GS6X 3NJIA 5LDUA 2FT6A 2TSAA 3HB3B 2ZXWB 4QKTA 1JVLA 4DPBX 4E9QA 4HHWA 4DP5X 2Q9OA 1J5DA 1RZQA 2W88A 2XYBA 1EZLA 1RCYA 3IN0A 4E9TA 3T6ZA 1PF3A 2MRYA 3PLYA 4EF3A 3WI9A 2YXVA 1BEXA 2W8CA 3IBOA 4X4KA 1KCBA 2GHZA 2YAEA 2GB2A 1BXUA 3HEIB 4YSDA 1E67A 1NWPA 1ZDQA 2ZOOA 3PXLA 3FYIB 4YSSA 1JZJA 3FSAA 5I6KA 1JXFA 2FJSA 1OCRB 5I28A 2XUWA 2GC4C 3BVDB
chains in the Genus database with same CATH superfamily
1MCPL 5E5MA 1DQVA 5TH2B 4F7TA 4ODUA 2OQJA 2VXQL 4GO8A 3QXUA 4F5CA 1ZHLA 3G08B 4YFLF 1NANI 2GSGA 1P1VA 2F74B 3N85H 4YHZH 3IS0X 3CH1A 4GKSA 4Y5XB 1P4UA 5HDBE 2NY2B 3X1FA 5CILL 3ECUA 1JHTB 3D1MC 1AS8A 5GISL 1NGYA 2WQ8A 4E5XB 4KX9A 4FNPA 1DVQA 3OR7A 4HHGA 1J5OH 3L3DA 5E8NB 2Y7SA 1L0YA 1CT8A 4N9OB 4P5TA 4XAWH 1QKZH 5HI4C 1J05A 4YFEA 3C5ZA 4I3SH 5BOZG 4YN3A 1S9WA 2BP8B 1SY6A 3RI5K 1IAOA 1AQDB 1KLUA 4ES8A 4A7GF 5EPMB 4N0YH 3QWRA 5CZVH 3S88L 3CG8A 2IFGA 4NYLA 5IB4B 3VG0L 4BHUI 5KYNA 1GKOA 3GJFH 2YKLL 4XCYB 5SWZA 3VI3A 5ALBH 2X4PA 5JIKA 3MOAH 4C83B 1LNUA 4M4PA 2B0SH 3ZYIA 1PFCA 1U33A 1AJ7H 3HBGA 3L3GA 1A3RH 4JO1L 5C3LD 1V7NH 4WRLA 2GCYB 1PX4A 2MPVA 4G7YL 2WNKA 2EQDA 5HD8D 2DQEL 1E4WL 1HQ4A 2A6JB 3FO9A 1PEZA 2JTDA 2H3XC 4K94H 3HLAB 4U0RC 4OJDH 3WY3A 2HP4A 2Z8VC 5K69A 3FT1A 2VT0A 4MMYA 1YNTB 4XI5C 3U9UA 1ND0A 1Z7JA 1LO5B 5DJXB 2GT9A 2V5RA 1QBBA 3C12A 3T08A 2HFFA 3B9KA 1BXXA 2F19L 1ZV9A 1G7IB 1FRGL 3V4VA 1D7DA 4OLVH 5GIRB 4X99A 1MH5A 4X80H 4Y1SA 3RTQA 1QFWI 4I0PC 5CGTA 4XT1C 3TEXA 3ZZLA 3GF8A 4FQJH 2IANB 2B3IA 2XLLA 3RUGA 3VWJC 1M56B 2JI1A 1U2YA 1I1AD 1AQMA 5AYUH 1L9PA 1NC4A 1M7UA 1KMGA 3PWNB 1UEYA 1Q1JL 5CN1A 3ABZA 4NNPH 1O6VA 4Y2DB 3Q13A 4RNRB 3IB4A 3VXQB 1HI6A 1WA0X 4G9DB 5KZCB 1J9CT 1QR1B 5IMKB 2H1XA 2HG5B 5GSRB 3RUGF 3CZFA 3FQTB 5EEZA 2DQCH 3DBXA 5HJ3B 1QYGL 3TFKC 3AACA 4FTVE 4MS8D 4F93B 3RWHB 5MHSE 2X4OA 4EKJA 4G7QB 3WL9A 2W5PA 1KXVA 1JZIA 1AC6A 1MJ7L 1TTCA 2EDWA 3OG4B 4F9PC 3ZHNA 1MHCA 1WPCA 4XHJD 1VESA 1VRSA 5EU5B 1YZZA 2ZOLA 5IOPB 3MJ9L 1UH4A 2W9EL 2JB5L 2JF1A 4H0IA 4KOBA 1OGAB 1T0OA 1U8NB 2YGPA 2X5PA 1E9QA 4X7TA 4ZS7H 1O7VA 1BG1A 3Q3GB 5MENB 5AB1A 5AWNL 4CRPA 3EFFB 3MV8D 4AY0A 2OJ1A 2XN9B 4B7IA 1EQWA 3DC0A 5ACZA 3EO1B 3JTSA 3SCMA 5D7EA 4P8QA 3N0PB 1WGOA 3LQZA 3NN8A 2YQBA 1NIFA 4HPHA 4F37K 2VLJE 2FECI 2W07B 2XV2A 4UUJA 3TU6A 1QFHA 3CVHL 3CFBB 4GAYB 4EEEA 4KZCA 4ODBD 1MFAH 2DL9A 5IMLB 5DD5L 2OZNA 3F62A 1AHWA 4PJGB 3IMUA 2NR6A 2F54B 4EI5D 2DYPA 4HZLA 2B7DT 4WY7H 2NYKA 1M71A 3Q0HA 5BUPA 3Q9PA 2A1WH 4PG2A 1PZ5B 4PJ5E 2HTLD 5IESL 4WCYL 4KWUA 3OPUA 1KTJA 4U6TA 3UAJD 4GXVH 1IC7L 3L81A 1ANUA 1FYTD 2C1PA 4HS6B 3GPEA 2Q8AH 3CSFA 1CGYA 3V7AG 1GW6A 2RIKA 3HUJA 3OBAA 3ARDA 4I18A 1BZ8A 5C6WH 2UY6A 2NY4C 2NXYB 2DI9A 3LN4B 2AJXL 3QSKB 3L3DB 4MD4B 4H0HB 4HIJA 4MZ2A 4FI6A 4LLWB 2YBRB 3JWNG 3R06A 4LPVA 5E4OA 2FIRT 2WVTA 5KSVB 1RJYA 3V0WL 3QDGB 4YFLI 3FHEA 1NPJA 2P80A 2NQDA 1QUPA 3QNFA 2FDBP 4X4XB 3GRWA 2DQDL 4MXQC 4WWPA 1NAKL 4FLHA 1F4WH 3OC8A 4BELD 1KYOJ 1T04A 2DDQL 2HKHL 3IU4H 3GIZL 4HIHA 4XRCB 3OKMA 1NOFA 3Q2VA 1LP9E 4OI7A 4RZCB 5J57B 4BZ1A 1JZFA 3K2KA 4WTQA 2B5IC 4F1SA 1CDIA 3EGSA 3OLIA 3OKNB 4I5BB 4JJHA 3AQZA 3K8KA 3C9NA 4LOVA 3MLYH 4P46D 3RNQB 1ACZA 1NIAA 3CN4A 4L1SA 1QSEB 2ADIB 4BWUA 4N6QA 2QKIA 3TZVC 1BQLL 1DBAH 2PCPA 4IJ3C 1F86A 3QJVB 2VLJB 3EFOA 3SY0A 4JFYA 4UT7H 3CUPA 4ZODA 1FJ1A 5TTRA 4DJMA 1A47A 4GQRA 5ITFA 3VB8A 1D5IL 1GGCH 4AYSA 3WNKA 3VG0H 1JHKH 1XH3B 2QTVA 3H4FA 1TVHA 1IAIH 4JHVA 4IGBB 4MA7L 4DVBB 4JPKL 1SJXA 1WEJH 1EJOL 3F65A 1NFIA 1KCUH 2XX0A 2QQLH 5E2JA 2WLZA 1XH0A 5J11C 4FQXB 1SRDA 5F9JA 1VHPA 4KK5D 4MD5A 1U3YA 2HH0H 4KBPA 5GZOA 4Z7NB 3I75B 2X1QA 1CTNA 3VM7A 1KDJA 3CZFB 3FQTA 5AVZB 3X1BA 1GOGA 1AE6L 2HJKA 2GK0A 2X0VA 3JT2A 1F8TH 4JO4H 3VXPB 3FSOA 4OZGE 2BDNH 3UTSD 3DYOA 4PN6A 1QRNB 5BRZA 5AOLA 4MLIA 6FABH 5GRZA 3N43F 2X4OB 1KTLB 4XO9A 1QI4A 1ZT4A 2FEDC 4WTXA 2VERA 1ZHLB 3DXAA 4CMHB 3RU8L 1DQIA 2OJZH 1WYJA 1I7UA 5HI3C 3UO1L 4F7EB 2J4WL 3Q1SL 1H3PH 3PWLA 4OZFH 2ID5A 3BVVA 3DRTA 5IT2L 4Y5XA 3L3OC 3BXNB 5J56B 2UZIH 4KVPA 1EFQA 1AH1A 4NJ9L 2EDBA 3I9GH 5A7BA 4POUB 4ANUA 1TF4A 1JD9A 3V0AC 3NJGA 4NP9A 1ZPLA 2ZKYA 3RVTC 3AWGA 3EYQC 1YPZB 3KGRA 4N5EC 5LO7A 5T33L 4A6YA 2NRDA 1IBGL 4ZTEA 3UJTH 3WTSA 2K6WA 4C4KO 2XPYA 1DEDA 3WFBH 4HJGA 4XMPL 1CD9B 1RJZA 2QBWA 2Y06H 1DO5A 3F7VA 3MSPA 1FNEA 4PJ9B 1F3DH 4L05A 3WNLA 4B9IA 4Y1TA 3OJ2C 4P5TB 1Q72H 4L3EE 2Y5EA 4YFDB 4L37A 3GLEA 1Y6NR 1RIUL 5TDNB 1IGYA 3L3GB 5FGBA 1Z9PA 5B39A 1PVHA 5I1JL 4U3SB 3KM2A 3FFCA 3FRUB 3TOPA 5DQ9B 4BQ6A 1SOKA 4LCUB 5MERA 2LT9A 4WUKL 3PWVB 4HFUL 1UM5H 3B6SA 1RERA 4RDQG 3F5WA 3HG5A 3SDXA 2ALWA 3BUPA 3MRIB 4DHLA 2GT9B 3AC0A 2YUVA 4QTIL 4GLRH 5D2NE 1KYOK 5EUOE 2A74C 1YSOA 3SDAC 1HDMA 1UWGL 2Q1EA 2Y7QA 3S4SB 5I1KL 4PGDA 1YRKA 5H37H 5C97A 1NFKA 3GSWA 1ZLSL 2Q86B 2FR4B 5D8JL 4QRSA 3F83A 1JPSH 3BQUD 4I85A 1BVZA 2NXYC 4ZO6A 3TA3C 3AUVA 3E6FA 2OCFD 1GH7A 3TT3H 3RWEB 2BSBA 1N2RA 2ZZUT 4PP1D 2NUPB 1NCOA 1DVFB 2X42A 3OKDB 5BVJB 1MSPA 4OB5H 4F57H 3SBPA 3WDIA 3X14B 2JH2A 4JO1H 5AYUL 1BIIA 2JFCA 4O2FB 4Y16A 4KZ0A 5JORB 1W80A 1K2DB 2OCJA 5DVMA 5IQOA 4B41A 2EZ0C 1FFPA 3M46A 2WYTA 4LRNL 4YS4A 5KS9E 4MA8H 2YWYA 2ZWSA 1ZHNB 3IMWA 5F70A 3NFNA 2LU5A 2RQEA 1JGIA 4UNUA 5EIIB 4LLVB 2MOGA 4EXKA 4PS4H 3BKCH 4FFYA 3FO0L 2UXGA 1TMCB 1MFNA 3J27A 2R23A 2P28B 4OZIF 1XB6A 4J6RH 4PVNA 2XQBL 4IU3B 4WEBL 3FQ1A 5BW7A 4G7SB 5CINL 1K72A 3T1FA 4KK9D 1E7UA 5IKCA 1EBAA 2ZT9C 4LLQA 5EN2B 3U25A 5LBVA 4PJGE 3FK3A 1RD6A 2Y3AA 3B9DA 2D31B 2XZAL 3NDZE 5F7KC 5EU5A 2HT4D 2P80D 3QGVA 2WQRA 1SVCP 1DN0B 1K3IA 2QR0A 4P9HH 4RDQF 3L9YA 2BRRL 5GRUH 4OF8A 5BW7C 4H2CA 4YBQD 3JYBA 2XIBA 3L13A 1ACYH 1YC7A 1Y6MR 4TOYH 3CDGB 1QUNB 5EDXA 3UBHA 4WW2F 4NO2B 5EO0B 2HYMA 2VWEC 1LO2H 1AE6H 1NGXB 1ZK5A 1QTPA 4NKMA 4Y4HB 5DZJA 3VXME 2JSFA 3CQPA 4NEHB 4FQQB 2ZUVA 5F1NB 1JZ5A 1KTLA 1PG7W 2PWHA 1CGVA 4R96A 4R6UA 3D0VB 1S4IA 3BN3B 3HAEH 4W6YB 4APQC 2ZOOA 2XG4A 4OKVA 1KN2H 3FT3A 5BMFH 1JZJA 2UY7B 3KG5A 4Y2DC 5IFJB 1A6PA 4XN2A 4F2ME 4FTVB 2GC4C 3LS4H 1AHMA 3INUH 4M1DL 3B7YA 3DOHA 3MLVH 2CNYA 5IBUB 1WEJL 2APFA 3GT6A 2AKRB 5I26A 3VFSA 5LWYL 5IVNA 4AMKH 4MMYB 4L18A 1PD6A 4QO1B 3VFUA 1KIQB 5AVSB 4WFFE 4G42A 3L4XA 3UJTL 4D0CA 1OTUD 3RWCB 3SDAA 4AQZA 4OF7A 4TV3A 1IU1A 4FQIH 4ZFGH 2FYVA 3ZE1F 1WK0A 4JO4L 3T2QA 4O58H 3SIKA 5JPMB 1C5CL 1OSZA 2ADGB 1B90A 5BS0E 1PX8A 4JDTL 5TDNA 4XB7A 3T0VA 4FLOA 1WBXB 3DX8A 3I3EA 2WLLB 4PTUB 1PLCA 2H3NA 3Q1SH 3GZQA 3ILDA 2X4SA 3LAFA 5I0ZA 4GKNA 4AENA 4IU2A 2WYIA 4A63A 3F7YA 5HGBB 3GHPA 5FHBH 4LSQH 5BRZD 5DZ9A 5F7UA 3BSZL 4MKTA 3HVDA 1PD0A 1W0WB 1A7QH 3NP3A 1H19A 5LG6A 4ZX3A 3BKMH 2GBAA 3E8UL 3K91A 4O2CB 1IKNC 4HCFA 3WEXB 1MLBA 1ZT7B 3VXSA 1OAZH 2IFFL 3LQAH 5DD0L 4P2AA 5HI5D 2ZXEB 1SDAB 5T3ZD 1YEHH 3A4FA 3BRGC 2F58H 2JKLA 5MEPB 4BSVB 7FABH 4BXSV 1PIFA 4X5PA 3RWJA 4BZ2L 4JRFA 2P3YA 3PQYB 1YHPA 2IV9A 4LHUG 3TBBA 3APNA 2BNQE 5D7LA 2EXSA 3OXSB 5F1SA 1NC2A 3CJJA 3N44B 1OW0C 4U7KA 4DGYL 1A6AB 4HUUA 4QXVA 1JHKL 4PY7A 3UJIH 4O51B 3HJEA 4Y5XC 5AAWA 4XP4H 3K8MA 3PWJA 5HJGA 2EE0A 3DROA 3FTXA 3ULVL 1RY7B 5I5MA 4X5LA 1IQWL 5JORA 1LEKA 2D8KA 3JV4A 3KJ4B 3U0WH 3WIHA 2NXZD 4GI6A 2HH0L 5A3ID 1U8OB 5D7IA 3OHXB 4HQQL 3EOAB 3O6FB 3LH9A 1FG2B 4PP2A 5ESVA 4AM0B 1NDMB 4JVUA 2BVOB 2IPKB 2ORBL 2AJVH 5I16B 5DFWH 4BQ8A 3E3QE 4U3XA 3BJ91 3BFOA 5FYJL 1MI5E 5I66B 2RCSL 3AREC 5D8JH 1A9BA 3ZUNC 4D9QE 4MQXD 3UO1H 2W0FA 1I1AC 4HWUA 4U2ZA 4N2EA 4FXGC 4L9LB 4WU7A 4XHQA 3IDNA 5C0JA 4PFEA 3VTAA 2IBGA 3QUXC 5DMIH 3GFUA 4UNTA 2IADA 1KEGH 4HLJA 2BJML 4R2GB 3W82A 2KQNA 4JFQA 5E9NA 2EH7H 5AAMA 1OTSC 4Z7WA 1PZUB 1CD8A 3WNNA 4NQEE 3IJYA 5EZPA 4YO0B 2CCWA 4B6ZA 4CADB 4JFDA 4RISL 3ILPA 3US0A 1XCTA 3FU3A 4L8CB 1TG8A 1JV5A 1KXQA 3MLYL 3P2DA 5KSVA 1TU2A 4X6BA 4MDJA 3HI1A 3ZTEA 2GSMB 4OFVA 4TUJB 1CFVH 4OIBA 3UYPB 2YPVA 3MJ6A 2H0JA 5EU7E 4PJ9C 2MPAH 3BD5A 3FXIC 1ZWIB 4MWFB 5MP6H 3PJSA 4HC1H 1KENL 3D0AA 1IAII 2DW5A 5DC4B 5GGTL 5IJCC 3QCUL 5EBLA 2X4NA 2DIAA 2XZAH 3EW3B 3K0WA 3FFCB 4GKZB 1NCDH 1OEZW 4EVNA 4YSUA 3SDCC 1E4HA 4TNGA 2BSSA 2ETWA 2EDJA 3AREB 1U8IB 5AW9B 1PSKH 2YC1A 1BQHB 4W9IC 5E2TH 1MFCH 3W37A 1LLAA 3JWDL 1S7QB 4XVUD 3GTNA 5DHVH 3IJEB 1A5FL 1FI8C 3ZDYE 2ZCLH 4C54A 3C60D 4JG0H 1XIWD 4DEPB 3HHRB 5IUCA 2ENSA 2L8AA 5DZLA 2BS71 3D2UA 5FA4A 3WKML 1OZUA 4E9XA 5C3IA 4OGYH 2NT0A 1V10A 1MNNA 5DCCA 3AB0C 2VN5A 3O2WH 4QMEA 2JJVA 1AXTL 2VLMD 3B43A 4MJ6A 3TTYA 1DJZA 1FBIL 3ROLB 1JGEB 5C0ND 3V5DB 4DWHA 3FU8A 4FFYH 1AACA 2Z7YA 1SXBA 2BOBA 2DBLH 3I3BA 3MRPA 2YGQA 2E8ZA 4CAGA 2W9DH 4U6VL 3MLTA 4FQXA 5F9JB 2I60L 4CVZB 2VN3A 4IOIA 3VG9B 4K3JL 4RGND 4PJEB 2HLFD 3O8XD 2X53A 4G70B 4X5WB 3FCTA 5DJXA 1H3TA 1UKQA 3E8VA 3VXUA 3D05A 3NAAL 1AHWC 2W1NA 2Z7UA 5D2NB 1BYPA 4JE4B 4OF6A 4JFFE 4IBWA 4GP5B 3D8MA 1SJMA 3HG3A 2NY5C 2PP8A 5CLYA 1I8LC 1FNSH 5HYSA 4HPYL 3CTTA 5B1CA 1RIHH 3HZMB 4LDOB 4XBPB 1WIOA 4JY4B 5AUMA 4KI1A 2DLTA 4GINA 4ODTL 3MLRH 1U0QA 3KCWA 1URLA 3BISA 2VDOB 4L2YA 1F4AA 2WN3A 4UOJA 3D07A 1JPTH 3HPJA 3PDOA 4WI4A 3FCSB 4DAGL 2UZXB 3R1GH 5SWSB 4AGNA 3TWCL 3V0FA 5FYKD 3VYPA 4UZUA 2JB6A 2E6JA 4L1LA 2AV1B 4NO2A 5E95B 1ACYL 4KNUA 3QO1A 3MUZ1 1X5HA 5DI8B 2ZG3A 5IZ7A 4D0BB 4N0RA 3TN0A 2ITFA 3FN0H 2UVFA 3WFZA 1HZHH 2UV3A 1LO4H 1W72H 2MTAA 3VI3F 4XXWA 5EO0A 5B1KA 4NNYA 2AJVL 5LGHH 1S3RA 4AV0A 1YYMH 3FO1A 4YZFE 4B9JA 4FNQA 3VFGL 1WTGT 1X5KA 1USZA 3GJFB 1S78D 4WFED 1UQSB 5JNYB 1EEUA 4MJID 2WIMA 1U36A 3EO1A 3JTSB 3FSWA 1QFWM 3SGDI 2GSGB 1QHOA 3EH2A 3FB5B 4JRWA 4NCC1 2Q7YA 4Z7UE 2BSRA 5C0DB 1TTBA 3FT3B 4QJ4B 4QCIB 1B6DA 4XP4L 4MNGE 3QI9D 5SWZB 3U36A 5I73B 43C9B 4YHNA 5LCVH 5IJDC 4TOYL 3S35L 2A0LD 1QBLH 3HHSA 4IBTA 1YEKH 4C59B 1AHKA 4HSCX 1TJHL 4S1RH 3RVVD 3IGLA 1HEHC 3D33A 5D1XD 4ICWA 3IAQA 4MXVE 2WM0A 4OM0H 2LU3A 3MCG1 4QRRD 3BGAA 2YQ3A 5FYJE 2ZX8A 1UZGA 3EDEA 2YFOA 2R2EA 4PTTB 2J5LC 4M3KB 2OI9B 2B1AH 1HXYB 2Y72A 4HBCL 1GPOL 3LRSA 5BO0D 1E6JL 2GTZA 4NB7A 1QEWA 2JCCE 1XMEB 2DLFL 4N2AA 1DCEA 1QLFB 3VRIA 4HWEH 1EHXA 4L3EB 3V55A 4LNRB 3DX8B 2G30A 1WFIA 4G71B 1JF6A 1SLVA 5E6IA 1ZD6A 1JI2A 5JXEA 3BSZH 4JEGB 3TA4D 4X99B 3QXAB 3W9DB 3U4BH 4LBAA 4RX4D 2GY5A 4MQ7B 4Y1AD 3ZJAA 3VH8B 1CL7I 4JY5H 4XNBA 5E8PA 5F0PB 4MSWB 2HJFA 5AW2B 1IE4A 2VC2H 3ARWA 3PY9A 4LPXA 4FXKC 1FVDB 1JI1A 3FRPA 4YUEH 1U3HC 5I74C 4CSZA 2HPTA 4XMZA 1CR9H 1CICC 3B56A 5F1KC 1YDPB 3P9LB 1AQKH 2MH4A 2WLJA 1GRWA 3SE8L 3HS8A 3O6ML 3TNNA 5B8CC 4W9ZA 3VFMB 4ZFOA 1T83A 4RRPA 2DWEB 2XOTA 4KJWC 1TTAA 4L9LC 4N8CH 4MQSB 4FKEA 3ULUF 1A4AA 1INDH 1TQSA 4CVUA 1LE5B 1R3IL 1NOLA 5FM8A 3X1EA 5LQBH 3QDJD 4L3AA 2VDRL 3AADB 3IDUA 1FSKC 5EN3A 3EYSH 3WNPA 4M1DH 2BZ7A 4LKCB 4PV8A 3IRCA 1IL1B 1GJUA 2GUYA 3UTOA 4A7GA 4OM1H 3QDJE 3QNYB 4TQIA 3QAZB 2JIXB 2IFFH 5F7EL 4XNUH 3VD9A 5IQMA 4LSSL 3OHXC 3PDGA 5FUOL 1AR1C 4AYMC 4DQOL 1A22B 4AL8L 4H8WC 1R3JB 1EERB 4I3RL 4JFDE 3RFZB 1C9SA 1UKTA 3LMJH 1XWVA 4GB9A 5DRNB 4FKHA 4AUJA 2ICWJ 4QXGH 3DUSA 5K1VA 2Z8RA 4GNKB 4JFEE 2YZ1A 4LESA 1XGTA 4M8VA 5FCUL 1CICD 1KG0A 3WN6A 4E42B 2GJ6D 1J1OH 4Z7NF 2YAPA 4DZBB 2ADJA 1ZTMA 2EE6A 2ADFH 4IGBC 1PNCA 2HLAB 2IBZY 4H20H 4IK6A 1FE8H 4RAUB 4CADA 4NUQA 3VXPA 2F74A 5A6IA 1IFHL 2FJFA 3KYNA 1PZ3A 4WI7A 2NW2A 1D6VH 2BSTB 4QO1A 2XNAA 1KIQA 1G5AA 3DO3A 1NCTA 5EH1A 4XP5L 3UTSA 3Q8CA 3TBWB 1TJIH 3D6GA 4OFDA 5HHQA 3C60B 3T0AA 2WC7A 2QDWA 3O8XC 5DD0H 1MJUH 5J1TC 2GW5A 4K73A 4G83A 2AEQH 3HLKA 4JZNB 4CVXB 3MFFA 3AB0B 3SJVE 1S3KH 2OMBA 2AC0A 4HXAH 1EFXA 1N4XH 4M61B 3OR6B 2ZOKA 3A21A 5IHBA 4ANXA 4WFGD 3U30B 2MIZA 1IAKA 3PE9A 4BFGA 3L5WB 3GMOB 1QABA 1PZ5A 4YXHL 1RUAH 4FD0A 3DIDA 2GBVA 1LXMA 1U8KA 1ETZA 4W93A 3VXNB 2CRMA 2R1YB 5EMYA 3HI6L 4CC0A 1T1YB 3J8F7 2PKDA 1EDHA 4WK4B 4XCNA 3A4AA 4N1CA 4JKWA 2ZCHL 4JDZB 3RKDD 3CLEL 1P7QA 2VDKL 2ATPB 4DEWA 4UOZA 5JR1H 1BVLA 3GSUA 4JCWA 5LNGA 4NBZB 4D8PB 3OJMB 5I28A 1U8IA 1TJMA 3MR9B 2WLKA 3WIIL 2AV7B 1GR7A 2ICES 4X42A 1NOAA 4B60A 5DJCB 4L8BB 5KVEE 4EIZC 1AZVA 2APSA 4GJTB 1CF1A 5ALCH 1M4KA 3VGDA 3MV9D 4PJAF 4Y16D 5DHYB 1E3ZA 1W16A 1DBAL 4R0LB 2IWEA 4FDWA 4HISA 5LN4A 4KMTL 3KLSA 4X7CC 2EVGA 2ZSWA 3D25B 4E0RA 2VDKB 4PRBA 3MGOA 1NTDA 4M62L 4Z7WE 3VD5A 1UD5A 5DQDL 5F88B 3UC2A 3VMPA 5IHWA 3H9SE 4NN7B 3ZT7A 5E6IB 2JLLA 1ZHBA 1CLOH 1FGNL 1T2QL 2VAAB 4P2CG 5GSVB 5BV7C 3I85A 3NA9H 3UZEC 5DU7A 1OTUC 4NN7C 3EG9A 4Q2ZB 1YEJH 2H1PH 1N0LA 5T1DL 2AJZA 2ZCLL 3IFLH 4YC2C 3B5TA 2A6IA 4M6MH 1NZRA 1KSRA 1KGYE 5CUSH 1M05A 4I77H 4AGQA 3X14A 4HEMA 5F3HB 5I6LA 4MTMA 2BHFA 4NPYA 2OK0L 4LCIL 3V4VH 1CBVH 1AANA 5JQ6L 3C5JA 1B0GB 2AK1H 3CFNA 2I32A 5D1QB 1DZ0A 1KELH 3P3YA 2COQA 4LK4A 4WJKB 5BO1H 4AQEA 2R7EB 4IRJA 3TO2A 5E99L 2FNBA 3N50A 3H7BA 3IJYB 1J18A 1NL0L 1F42A 3WFCH 3BAEH 2ZWYA 3W81A 4HP5A 3LH2L 2A2QT 3EH4B 4FA8A 2CA3A 5CSZB 5KJ4A 4AX3A 3QORD 2YO3A 5M95B 5DRZB 2E7CA 5PCYA 1QKZL 2ZWLT 3MLZL 1DZBA 4Y2OA 2QMKA 1AG0A 3VWKB 3IVKA 3QAZC 2JQAA 2NX5D 3WENA 1KIPB 3ARFC 4NRZB 3IKCB 3SPGA 1XCWA 1CLZL 2HUEA 1YPZE 5MI0B 1TZGH 1MJJB 4YL9A 2YIHA 4QGTA 5IK3B 3S0PA 4FE9A 3EZJB 4G8EA 3VXRE 3U36B 3ZVVA 4WV1A 4GMSH 3VJ6B 3LOWA 3QFJA 3F7LA 1KNOB 4IMLB 1VPOL 5D1ZC 2HVJB 2Q7YB 2BHZA 1ADQH 4OIFA 6PAZA 5DURB 4M5ZL 3ECBA 4PGBB 3TO4D 3ARDB 3P77B 4WENB 5DD3H 3ZDZF 5I74B 4NO5B 1T66C 5TF1H 2DH3A 4CMMA 4F2EA 5FGCE 3R06B 1BQLH 3I84A 1IFRA 4HPYH 4B9YA 2IOMA 4LRIC 3IMTA 5KSAA 4N0FA 1ID2A 5CCHE 4ODTH 5FFGA 2X3AA 1RSYA 5KAQG 1XO8A 1ILSA 4PY8I 2KZWA 1YQ2A 2GJZA 3LRMA 3U2JA 3BMVA 2VWEE 1T22B 3BP6A 1RH8A 4N2DA 5E0QA 2X44D 3ERXA 4GAGH 2G2NA 4NNPL 1E2ZA 4J3OF 2A0LC 1AO7D 3MOBH 4H8HA 1XF1A 4UTBA 1P7QB 2HSIA 3QZWA 4N1HB 4YPGA 1JZHA 4UT6L 1CLCA 1Z9OA 1HWHB 2ITCA 2M2DA 2X6VA 3DJ9A 5TD4A 4YH6A 3T3PB 3GS7A 1T20B 3UBGA 4N22A 1U2CA 4NQDD 4OR1A 1LO4L 3GEWB 2LTQC 4W6WB 4XP9H 3ZTNL 5LGKA 2CJ3A 1PY4A 3MCKB 1VAHA 5I0YA 2O4EA 3O2DH 4PB9L 2F8VA 1HHJB 4NC2B 5D7LE 4J4PC 1FJ1B 2DQGH 4TNEA 3QUMB 1CFBA 4HJ0D 4MJIA 4ODXA 4OV5B 4HWEL 3FAWA 4JFWA 1H15B 3K6DA 3RVUC 4F7CB 1AD0A 2E7HA 3NMEA 4WIQA 4YIQA 2B5IB 1Z9LA 1OAXL 3KDMA 2CAKA 4IS6A 1YG9A 1UT1A 5DLLA 4L8SC 1AZUA 3C5ZD 2EVFA 3TP4A 3IU3B 4P5TD 2EIEA 1WT5A 4IRSB 4UAHA 3QG7H 4XNUL 5D7IE 1XT5A 3D3VA 3EG9B 4KV5F 1BFVL 4EAEA 4X50A 5FR3A 3C87A 3BUTA 4U31A 4XNQB 4OY9A 4HF5H 5TGBA 3I02A 3A67H 3N44F 1SYSA 2O5NA 3UAJA 2QVMA 5D2LA 5BQ7A 3QISA 3N06B 2Y7OA 3VGBA 4EQ3A 4TSBH 1QPXA 3WEBA 5J8OA 2Y07H 1OT4A 2B1AL 4BUQA 4N8CL 4BRJA 1A9VA 1LDSA 4OJEH 3LY6A 2XTLA 1GZQA 4PW4A 1MHEA 1THAA 3T71A 4Y5VB 3THML 5LUMA 2R0KL 2XWTA 1CDGA 5B38A 4IRJB 4L2LA 1J0HA 4D9QD 1P53A 3T77A 3KW7A 1J5IA 3OB0K 1P5UA 3KPPA 4PGEA 1MVYA 2ZUYA 4YXLL 4MJ4A 5I16A 1UOKA 3RWIA 2VDOL 5K9OA 5ISZA 5KJ7E 1U91B 2BIOA 5EOTB 1YMMA 2HX8A 3B1TA 1HYSD 1KTCA 1AD9A 4K5LA 3SCMD 3SE6A 4A39A 1FORL 3K46A 1DJGA 4J5VA 1DSWA 5KS9B 3QWOB 5A40E 1GC1L 2V7HB 1WCQA 4FFWD 4B96A 3DV6B 3GHEL 2OMUB 3IKKA 3MRQB 3G6AB 1QWUA 3WCYA 3OKOB 3MCLH 4FQXD 4LBEA 3MKKA 2MQCA 2V6HA 3BP7A 3APFA 4OCXL 4FYTA 3R0MA 2DI8A 2K1MA 4KK5C 4IIQB 3W0WB 4IGBD 5IIEA 4JZOB 4LNVA 3PUCA 2F1BA 2VR4A 3P3SA 2Z1PA 2XJKA 3GQFA 2KHAA 3CNKA 2OMVB 3FC8A 5CJ8A 1N3NB 3GSUB 3MJGX 2WCSA 5A2CA 2FB4L 1G9EA 3DVGB 2FWOB 1SUHA 3MGTA 5AZUA 3V6OC 1EMTH 1NBVL 4LF3A 2CH8A 4XX5A 1YMME 3E1F1 1BZOA 1KLGA 3FT9A 4PB0L 4CDGC 1U4EA 4U1NA 5AENA 1F11A 4QAMB 5CCJA 1BA9A 1YMHB 3Q8FA 1T03H 4JFSA 1JPFB 2D7TL 1YMMD 4UQ9A 4WJG3 1UA7A 4WF7A 3DX2A 1A7PH 2CRYA 2Y06L 1NLDL 3DVNA 1S3KL 2OPCA 3Q6GH 4KO5A 4OVVA 1XD1A 1J9SA 3IXAA 2KDYA 3O11B 4LSPL 3PP3H 3SKJH 3DX4A 3L95A 4W1TA 1HE7A 4S1DC 3A3YB 3X1NA 2JJTA 3DSFL 4UQBA 3F8UB 1KPVB 2MNUA 3RX8A 4G9FE 1NC2B 4KXBA 1KXQE 3DUUB 1IFHH 1MCCA 3O8XB 3OWEA 4MB1A 5DC9B 3BMWA 5E1QA 4NWTL 4CA4A 1A66A 1A2YB 3RHWK 3D34A 2XPGB 2FD6H 1PNDA 1G1YA 2EYTA 2FHBA 4FFVC 3BGMB 1P2CA 1NCWL 2RBLA 3UMNA 3WGUB 4HKJB 1A1NB 2AJSL 5CF3A 4E41A 1XGYH 2GFBA 2N7AA 1I8IB 3GLAA 2EDXA 3GKZA 1RHHA 3NIGF 3LZPA 2MJWA 1ZJBA 1I85C 4A2MA 3U7WH 1G7HA 4Z9KB 4Q58C 5AKTA 3DHPA 5GSRA 4O51A 2QHRH 2CXGA 2VLJD 3QH3A 1II4E 1SMOA 3MRRA 4FNTA 4F57L 5TH2A 4ANWA 3TJPA 4KKRA 2SODB 3EH5B 4UBDC 1I3RB 3P4NA 3JYCA 2WLIB 1MUJB 4WHYH 3V0EA 2FO4A 4JS7A 1R4XA 3FQUA 3JWNH 3EOAA 4AEIL 1ROWA 2Y6SC 1DDHA 5CEYB 3U83A 2VXUH 3QIBB 2AJ3B 2YS4A 4YR6B 4XWGL 4JPVH 5DFAA 4R0LC 2A4EA 1J48A 4NAQA 5JW4Q 3HPJB 2BNRE 3PDOB 1Z6JT 4PG9B 2OK0H 5JOFA 1A3ZA 1CFQB 2YRZA 5C92A 3JV6A 3IJSB 3L9BA 2XQBH 5IG7B 3JXAA 2C26A 3UYRH 1IAOB 2VW4A 4UUJB 3ZOAA 1SGKA 2YD5A 5K93A 4GAYA 3ZKND 3UACA 3L45A 4Q6IA 3V9CA 1JGUH 4IRSD 4IRZH 4KI5E 5D4HA 4YHKH 4R26L 5D2LE 1I9IH 2WBJC 5DEZA 5E9DA 1T2QH 4Z0BL 4OIIL 2R9HC 3ARXA 4U1HA 4UTAH 5I6XC 3TEUA 4U1IB 4FHBD 4HD5A 3WE6A 2JJTC 4Y5YB 1XXDC 1PSKL 2K78A 2LOEA 1WD9A 3QG7L 3QJXA 4R9HA 5IEKA 3MUHL 2H6OA 1D5XA 1G9MC 2F5BH 3HCVB 4G42B 3VXSD 2E0PA 4Y4FB 4BSWA 3Q05A 3NCYS 4FNSA 2YRLA 4PV9B 4N2KA 5DWPA 4PGCB 4X6FA 5E2WL 4ZUVB 3T0BA 1ROCA 4LCIH 2DQIH 4O5LL 3VDBA 1L9SA 1FFTB 1LVEA 3DIFB 1IUZA 1GGBH 1HINH 3DHMA 5D96C 1S5HA 2F54D 5D1QE 1ECYA 3FFCD 2W0PA 5H8DA 3HHSB 5FKPB 1Q0YL 3E9TA 3TONA 2EJ1A 3PFQA 3IPEA 1HIMH 2XACC 4X4ME 5D7SL 1RMFL 3T0WA 4BQ9A 3ZDYF 4U7MA 4U1NB 3QJFA 2W8CA 4K2UL 4DGVL 1M05B 3V0VA 5JO5A 3O45B 4H7VA 4QTFA 2ITCB 3KWTA 4QHPA 1IGCH 1V05A 2AXGB 3DECA 1NWPA 1BMZA 3FYIB 3IGAB 3QT2A 4J6RL 5D2NA 1JXFA 2OMWA 5E5LA 4ETYA 1HHHB 1KGIA 1OP4A 3MBEB 4K3DH 5KW9L 3VNZA 3RFZC 1ZSDB 4HWZA 3BYTA 5ESQA 2WTRA 1ASPA 2L7JA 1D5BB 3L95B 1I7TB 4JO3L 4L23A 2C3GA 5HHPB 3WJLA 4JN2B 2MCMA 3D0LA 1B0WA 2C9XA 1MW0A 4G43B 5AUMB 3WO3B 4AK1A 4HEME 5T5FL 2YAFA 1P5UC 2YXFA 3RY5A 5C0NC 35C8L 2OYLA 2MCG1 3BIKA 4L4VE 2P8PA 2VXTL 3PP4H 3W39B 2XZZA 4YXKL 3PHAA 5D7JD 2CBOA 5D2LB 5BQ7B 2XN9A 5FO2A 1EHLH 4LRIA 4RRPG 4YDVA 5E2VH 1KIPA 1RHFA 2AJSH 5FUCE 1CG9B 1EXUB 3QUZB 2WB7A 4OKVB 3RVXD 1BM7A 3QXDB 3ET9F 4GQPH 4XN9A 4P49A 3N5AA 5C0EB 3APDA 4HCRH 3QRGL 1JNNH 1WT5C 1CD1A 2IGFL 3NZ8A 2DTML 2UZXA 3DSFH 4N5UA 4N3TA 5SWSA 4A04A 4Q9RH 1WS8A 4HA1A 4GG6A 3EO0A 3EHBD 4GI8A 5KVGL 1MAMH 4GXFA 1MW1A 2WXKA 5JIIA 4MJ5A 1TZ8A 1E28A 5FFLA 3RZWA 5F7AA 1T80A 2L4OA 1OCWH 2CBQA 3CX5K 2YHGA 2X38A 3ZYZA 3FUKA 5I5IA 2BSRB 4A7SA 1L9NA 4XVTL 3RL1B 3QXVA 1TU2B 4X6BB 4XMKH 3SOTA 3KPRA 2Q8BH 1WZKA 3ILEA 3QQDA 5GS0D 5JPNB 4AM0Q 2Q76B 4O2EA 3W57A 3ARGB 1EEYB 2N59A 4A1RA 2XQYA 3ZHDA 4XB8A 3ABLB 3VDAA 4WHTA 2CQVA 1JV2B 4KZEH 4W9LC 1NGWB 1EGJA 2FYYB 1F2XK 2G5RA 1HCVA 2NW2B 4NSKA 4BGLA 3C5SA 2NT1A 4NUPA 3V0IA 4M5YH 4UQDA 3U7WL 32C2B 4MNHB 3SYAA 4ODSH 4XC3H 5B1AB 2BCKB 1OF0A 3E38A 2ZCKL 1Z9SA 2V2WA 2CD0A 4YWGH 3QZBA 1J8KA 2R1WA 5FPIA 4PJXF 5JA8B 3GM0A 3HLAA 4GG8A 3BWUF 1HJCA 4ONOA 4E9LA 1JFQH 2V3DA 1P84J 1FORH 3BDYH 3V5HA 3BPLB 1RLBA 4L8DB 4M6NH 1C8PA 5LG1A 3F84A 3EJQA 4KFZC 4Y5YC 5D6CB 3F05A 1AO7B 1MREH 1IEAA 5DMGD 1GSMA 1N6UA 1H15A 3U7AA 1WIPA 4FFZA 2ZYHA 1BV8A 4K7FB 4O5LH 4Z0XA 3CLFL 3WEMA 1CXFA 3UZEA 3THMH 3DX0A 4TTGA 4LASH 3K3QA 4XTRD 3KDMB 3FJTA 5GGTH 4RGNC 1CFSA 2VDRB 1HCYA 2VR8A 4JJOA 5FUCC 3W9DA 4JQIA 4RNRA 5IJVA 3TURA 2NR6D 4MXQD 4XI5D 4ELKA 3P2TA 2ZX6A 5DZPA 5DHYA 3QUYD 3KLLA 5LVEA 4OIIH 3NIGE 4BCXA 5E1IA 4JG1L 2Q2LA 3KWWB 1HK6A 4G6JH 3JWDH 4QXTB 1HCZA 5F0MB 2P5PA 3GDCA 5AKRA 1M1XA 3V0GA 4KKBC 3K1KC 1U8MB 1YC8A 2NLJB 4I3SL 4P46C 4PVLA 4HGKC 3BH8B 4W4NA 3DX6B 2FT7A 4A7VA 5ADOL 5BV7L 2ZKMX 2PWGA 1CFMA 3FMGH 4KROC 4LXFA 5EBMB 2OXGB 3UCQA 3VXTA 1NFIB 5F96H 1XCXA 3MLRL 2A9CA 3STLB 4UQ2A 5CKGA 1YEEL 3GUTB 1G9MH 3UG5A 2VDML 2WXIA 4N90E 1T1WB 4LEEA 3CFJA 2J56A 1ZTXE 4XNYL 2GK0B 2QQNH 4JRYD 2VDQH 1JVKA 3QIWB 5DJ2B 4KJYA 2EE9A 4DZBA 4JX0A 2B1HH 3F12B 4NPYB 3HC4H 4K94L 5CEXB 3NAAH 3KYOB 2W07A 1BP3B 4ZMLA 5KBLA 4ODWA 3NCCB 3BOVA 3CZKA 3KLQA 4HCIA 4TLUA 4Z76A 2RH0A 2XZCH 1OSEA 4PJIF 2NSMA 3RIFF 4KZDH 3OKOA 4BA0A 4NKQB 1HZKA 3TBWA 2J71A 4DT2A 1VLXA 3RGVC 1T3FB 4YLCA 3H42H 4UM8B 5AKSA 4LCWB 2QVFB 4LSPH 3HB3D 4WI5A 5JXED 4PHXA 4YHLH 2H26B 4M7JL 2J72A 1QO3A 2XVLA 4UIMB 3ZR5A 1MFDL 1YN7A 2VSKB 3KPRE 1BOYA 2Q20A 3PQYD 1HL9A 1PZDA 3IE4A 5SV3A 2E6QA 3C8DA 4KVCL 1G7PB 2CDFA 3CIAA 3ZE2E 1B88A 2O61A 1OVZA 5T1KB 2DWSA 4RDBA 2YA2A 2FX7L 2CDEA 4ZPTA 1X9LA 5G4NA 2R29A 3VXRD 2EEAA 3K2UH 1IGJA 1N19A 4MNGA 4H44C 4F7MA 3OX8A 2DM4A 3DURB 5DJ8A 5J3HD 5E6YA 4JO8A 3TJHC 4NRYA 5I1IL 3S35X 4XCNB 3I6LD 4BRVA 2WJ7A 4I3GA 4YUEL 1EHLL 5GS1B 1ASOA 2YA0A 4OQ1A 5EIVA 4KJQC 1BW8A 2QLVB 3KXFA 1VKXA 5D7KE 4Y9FA 4D8PA 1FGVL 1S7SA 1SJHB 1TQWA 4GS7C 4MAYB 4X4XA 4K3EL 5IWLC 2QV2A 2GSIA 1A6ZB 3MC0A 4O02H 1G87A 1KCSH 2YD6A 3LX9A 2LFEA 1HXKA 1AGCB 1CL7H 2B4CH 2BFVH 4TULL 3RU8H 4F1ZA 1IT9L 4AYBA 1E27B 2A6DB 4RCAA 1X4YA 5C08E 1ETZB 4PBXA 4FQLL 2FHFA 3CBJB 5IESH 4FADA 4QF1B 3WLWC 1UB5B 4NO5A 5I1GL 1VFMA 2DWTA 5EU6D 5DVNA 2JMRA 3U48A 3QQNA 4K71B 2R1XA 3GNML 1IC4H 1JL8A 4E68A 1DVUA 1S8DA 1TMQA 2XY1A 1QW9A 1OSZB 2ADGA 3RL2A 5ID0B 3VSUA 1W8EA 2VJ0A 4ZXBD 3C09C 1XIWC 2Y1ZA 4LSDA 3S3PA 1FFPB 4KI5F 4ALAC 4OGQC 2KERA 3RBGA 4UT9L 1HFUA 1MFAL 1HH9A 1TYJA 4FF9A 2PR4L 1BGXH 1S9VB 2OMNA 3MNVA 3QJZA 1UJ3A 4DF9A 5T1MA 5DO2C 3VD1A 2JXMB 3D0LB 2C8NA 5J1AA 1Q72L 2UWEA 3QRBA 4A2DA 4HHAA 3BUYA 3PQYE 3V4PH 1CU4H 1K5NA 2DEYX 2P26A 4M3JA 3QZWB 2C9QA 4GH7B 2VDQB 1G7QB 2IDQA 2FO1A 2XVGA 2AP2A 3G6JF 5BOJA 4Z8FH 1BOGB 3NFPA 3OG6B 4YDVB 4ZK8A 4XCCH 2GUOB 5CD5D 4BD4A 1QPKA 2L7QA 2VMJA 4OD3H 2VISA 3MOQA 4XPAH 5EOQL 3D69B 3VXUE 3G5VA 1J12A 3V5KA 2F5BL 5GGSY 5ANMB 1MVUA 3DX7B 1NJ9B 1K8IB 5ERWA 2WMPA 3IJSA 5GRJH 3WXVH 2X6UA 1MQ8A 3AT8A 1VDGA 1EO8L 2NY0D 4TMPA 2DQTL 1RSFA 4WGVB 3VGEA 2KBGA 3VXUD 5JHDB 3C5JB 1PZBA 2ZKXA 5DD1L 2W9LA 4JFZL 4UMGA 4FQQA 4JKLA 4UQIM 3P0GB 3WXWH 3SYCA 4ZTOH 3SQOL 1I8MB 1MCOL 3ZMRA 1Z9MA 2IH1A 3BZDA 4GRWF 3HFMH 2PR9A 3C60C 3O4LE 3T0XA 3L3KB 2YOCA 3MLWH 1UYWH 3MBED 4U1LB 4AEFA 2X4QA 3CFMA 3LQMA 3MBXH 5EORH 4GG6B 2NY1D 5FDWB 4MMXA 4HIPA 5IMMA 2VXSH 1RXLA 1A7RL 2Y5QA 3EBAA 1FL5B 3PABB 4KKAC 3ZZ1A 1PJ9A 1GCFA 2Z9TA 3D9AL 1YEGH 4L9LA 3X11A 4TF4A 5HI4D 5GZND 1K8DA 2N4IA 1SXZA 1MG3C 4JZNA 4PJHE 4X5XB 4CVXA 4P2QA 3VSTA 2Y9RT 4QWWD 1DVFC 5TF0A 3KZ8A 4LLYA 4PJ7F 4UT7L 3OZKA 4HBCH 5KW9H 2A73B 2R0ZH 1V7MH 2F7QA 1SVBA 1UZ6E 1PTZA 4U3SA 5IFHL 2QGDA 2BLFA 3GSNB 3MV7E 3NCMA 4HEPG 3SPVA 4YHLL 4F37F 5A43C 3QXAA 5CFAA 4BKLA 4FNLL 4U1KB 1IGMH 4OF3A 5DQDH 2WLYA 3QUZD 3L16A 4YWGL 1M9SA 2J8OA 4HUCA 4EO5A 4BA8A 4QLRA 2ADFL 1FN4B 1K4DA 1KT2A 5EPMA 4FOMA 1NBYB 2CIIB 1QATA 3ENEA 1ITBB 2ZE0A 3O41A 3WIFB 3H2QA 4YSRA 1UWXK 2X4RB 1U3JA 2J6EA 5AZ2H 2RFXB 3LS5H 1JWUA 1XVSA 4R90L 3T5WA 4J1UB 5L88H 2GCYA 1BG9A 2XVKA 1ZANL 5EFIA 5HDQH 1RIVL 1KBVA 1XGPB 4P04A 6FABL 2E7LA 5JOPE 2WZPD 4NXKA 5DZVA 4EXPX 5CS7A 4CJ0A 4X2UA 4ELMB 1GZPA 3ARBD 2GSIB 3AJ7A 4XR8C 2QGCA 4MZIA 4TUOA 5FUZL 4ODSL 3AROA 4OCMC 2NY0C 1OF2A 4LASL 4ZJ9A 5ABAA 2V5YA 2F5AL 3MZTA 2UZIL 1L7IH 5IVXF 3QWRD 2HFFB 2RGSA 3B9KB 2Z0BA 1UG9A 3UFIA 1AMYA 2X70A 2AEPH 1NFDE 1QLEB 4Z7VB 4U0RB 2XETA 5DVOA 2B59B 3UBXI 3RX9A 2ZKHL 3ESNA 5IF0A 1PYWA 5LN8A 3VFTB 2E7LC 2LE9A 2X7LA 4NGHH 3FQNA 2M1KA 4X0NA 1JTPA 2Q9OA 4FP8L 2XKNB 4QTIH 3RJOA 1J10A 1VF5C 3D7PA 1WVZA 3QYMA 3L3HA 2V5SA 3MA7A 4C4KT 1QSEE 2J5LB 3LVTA 5CSBA 4H88L 3V6ZB 2GEEA 3LRGA 2YPLA 4KJWD 1HZLA 2JKJA 3POCA 3MTRA 5IGXH 2Z93A 4YOKA 3MRCB 2PO6A 3V52L 1HKLH 4K8RD 4OT1H 4ZSOA 1ZGLP 2WV3A 5IM7A 3UPCA 1IIKA 4MQTB 4QKXB 1LYQA 4LLUB 3D52A 3AQDA 4PYGA 5B8CB 3HG4A 12E8H 3BVDB 3JT0A 2CKNA 3D87B 1PG7L 1VPOH 3EADA 2R2BB 4JN1H 5AD0A 5F9AC 3QDGD 4J8QA 4PD4J 2BSDA 3HG1A 1NCBH 3NA9L 3RL1A 4JFUA 5B38B 5BJTB 5FYJU 1JNHB 3N40P 3DARA 4ZBJA 2CA4A 3SOBL 5GRWA 4EZJA 3OR6A 2A3TA 1YEHL 5HGHA 3KWUA 4KTEL 4PJFA 2DKUA 5KSBA 5ANMA 1T0MA 4LHUA 4DFHA 3MUJA 2AJYH 2Y25A 1P6FA 2WXHA 1AY1H 3HR6A 1LL1A 1YQVH 2GIMA 5EOCL 3P30L 8PAZA 3QZMA 3DETD 3LKRB 3QNXA 3T09A 5FF6B 5KS9A 2EXWC 4RQQA 3S3BB 1JF1B 3GI9L 1VGKA 2HTLC 2ZSVB 4I13B 4OV6F 5DZOA 2VABB 3G6AA 5D9SB 5BUGA 5K9KA 3DTDA 2YXMA 4U1LA 1AGBA 2J20A 2C4FT 2A9ML 2VMCA 4YDLC 3W0WA 4AEHH 2HWZL 1YMMB 4Z8FL 3C5XA 1FZJB 1P5VB 2C9UA 2G2RB 4Z7UB 4ANKA 4EBQH 1T0PB 4NLAA 4QYAA 4JPIA 1CDHA 2IDSA 2V8MA 3AREA 5HI3D 3O3BA 1IGJB 4MNGB 3HAEG 4LVOB 3QWOA 3FS9A 1AGDA 2V7HA 1RPUA 2D3LA 3MVSA 1A6TB 3HJ0A 1HNFA 3JZ7A 5ADOH 1G84A 2P5ED 3HA0A 2VMFA 5DUBA 5EUKB 1ZT1A 4TQEL 2WNWA 4NKDA 3WS3B 1HVXA 5G4OA 3OQ3B 1AQHA 1MY7A 2WCPA 3AFLA 3C2AH 3QDMA 2R1XB 4OF5A 5F7BA 4FHJA 1CFNA 1F41A 3DUHA 4QPEA 4XPHH 3U1SL 1ILUA 1URZA 4OTXH 5AYQA 4B9PA 3QDGA 4IW4C 3FH8A 3SHSA 4LEBA 1UADC 3NFSL 1S7RA 4RFEA 3MBXL 4HULB 2GG1A 2P7TB 1RKRA 4QR7A 3QARA 2PW1B 1XZWA 1HI6B 3CC5A 5J89A 2EE3A 1WBZA 5FO8A 4FQIL 4AQ1B 3NK3A 4ZFGL 4I77L 4DNLA 3FCGA 1U8HA 3DBXB 1OAUH 5AW4B 5HJ3A 3IAGC 5HDQL 1S9YB 3WAKA 3P0VL 4G72B 4J2XA 2EDNA 4TPRH 2BVPB 1D5MB 4JFEA 3VXQA 1NSNL 2X2HA 3P4MA 3ARSA 2Y2WA 2Z64C 4DW2L 4AM0A 2NY7H 3TBTA 2JXMA 3AS1A 5MP6L 3HS9A 3ULUD 3UDWA 1QSEA 2ADIA 3LD8C 3L1OL 2DBJA 2KZ1B 3BUYB 2XU9A 4N85A 3DV4B 5TDPB 4LKXA 4BWWA 3QR2A 1FSKB 5I30H 4JKMA 4WNQB 1LEKB 3U30C 3MKGA 2NYZA 1CIDA 1ZTXH 2CUAA 1H8SA 2W0FB 4WZ9A 2APTA 1MF2L 5F9DC 1H3WM 1LP9B 2X6CA 3SKMA 3H3BC 4PJDF 1IGTA 3M1BB 1F1AA 3BH4A 1WRFA 2ZWNA 1PU0A 3WTTA 4NENA 5CMAA 2R0LH 2H2PC 3P73A 3ZE0E 5HDLA 4HZAA 5D5ME 2XXGA 4EDXB 4M56A 1RIVH 3LTVA 2P8PB 3TJEL 2RACA 4IBSA 3FNKA 1XF2B 2APXA 3WD5L 4PUBL 4FG2A 1HKLL 4XC1L 4AGMA 1SVZA 1KLUB 2IAMB 1Q9WB 4JUSA 4MCZB 1V3MA 3GXUB 2A9BA 4GAFB 2I07A 2DWXA 5FYKL 5DUPL 4XCYA 1FUNA 1JDDA 5DJ0A 1OV8A 4F33A 4MCYA 5GRVK 1BAFH 1SN5A 4FJ6A 3RX7A 3WFEL 3RGVA 2HJLA 1NCIA 2NYYD 2WQUA 2IG2L 1JN6A 1KGWA 4EVNB 2AJ3A 2QDVA 4UTAL 4PJCB 1OW0A 1VA9A 1JHLL 4PJCE 4JDEB 1SHSA 1VKXB 1MWAB 2JCCA 5EU3A 3T04D 3UYPA 1G6RB 1WAAA 2DMHA 2RCSH 2VLRD 4G11A 4RMRA 3FTGB 3FUNA 5TPWL 1LO5A 1RZ7L 2M8XA 1YQVL 1W8OA 4ZW5A 2PXYD 3QIUD 1FNHA 2XBTA 3CMOH 1A0QH 3QFDA 1SY6L 1IKOP 1Q90A 1OIOA 4K94C 3VD0A 2V37A 5C0BE 1DJSA 3U6RB 1QX1A 3L9RA 3LKSA 1F3DJ 1FZMA 1A6WL 1YAZA 4HVBA 1BD2A 1A4JB 3CDFA 4FZEL 3MV9E 3TCLB 4XBMA 3KPRB 1IQWH 2CHNA 1BQHA 1P4IH 2EAEA 2DI7A 2FGZA 4HIIA 4LHJB 2FEDD 3FTUA 1EEYA 4HSQA 1INQB 5C0GB 4Z7UA 2Q8AL 2AXHA 3W56A 1NCWH 2CUIA 4X6CF 1DVFD 1MIEH 4ZUUB 32C2A 4MNHA 1J5OL 1WAPA 3IPFA 5D7HA 2VLRB 1ES0B 1NIEA 3QEGL 5FHAL 1JVOA 4YHYC 1IGCL 3UO8B 3PPSA 2X2IA 4JANA 1JK8B 2EEFA 4JDZA 3ROLA 4AVKA 3HTLX 3HZKA 4BZYA 3OAUL 3S5YA 3VVWA 3TS8A 4G6KH 3OKNA 4I5BA 2EDLA 1SLUA 2E9BA 4N26A 4OZGA 1F3JA 3N0AA 1KN4H 2X7LB 3AG2B 1QRKA 2B0SL 4CC4C 4XPHL 3U1SH 2XJLA 4N9GB 3QQ3A 2EABA 4UI2A 5L9DH 4S1SH 1R3KB 4X7TB 3VWJD 4YHIA 1DQML 3SO5A 4WSGA 5DK0A 2FEEI 3TA3A 4HWBA 1UUNA 3L2LA 4U1MA 2E27H 3CC5B 4XO4A 3QEUB 4S2SB 1FC2D 3GJEA 1HL4A 4XNZC 4XZUB 1K6QH 3HNSL 3A6CH 3LJ3A 3TTSA 4HIEB 1OAUL 2I9LA 4FI7A 4NQEB 2A74A 2DL2A 1TPXC 3GSOB 4G9FA 1TSHA 4WUUD 1RL1A 3V52H 2GY7B 5LXGL 3RIAF 3D2TA 4FFYL 4GP4B 3ZDXE 4PLKC 4RAVA 3H4HA 3LXCA 5FWQA 1A1OA 1KB5H 4FRWA 5KVGE 2JE8A 2RTTA 3PV6A 3MMEB 1JGUL 4IRZL 2E9JA 4EUPH 2EDKA 4OCRH 5C0EA 5HD8C 1NAMA 3TEWA 3EOTH 4L1DA 4RAUA 1XSIA 1YNLL 1MY5A 3B8SA 4FKKA 4AZ8A 3LSOA 2CWRA 4P46A 5C0AE 5DO2D 1G7LA 5FW7A 1I3UA 1FNGA 4ATTA 1QFWL 4KXZI 5EZJA 2Z6FA 1C08B 1VB9A 4EUPG 2NY2C 2Y6SD 2VRAA 3H9SD 3Q5TA 1QNZL 4I87A 4KC3B 4ZUSB 4Z7QB 4HU8A 3QPQD 5K9KB 2ZYIA 4X4YB 3AQYA 3H3PL 2XNAB 1WTLA 1ZS2A 4NQCE 1R5WA 4PRHE 5C9JA 1KC5L 3FOLA 3NJXA 4HJTA 4M61A 3RB5A 3LKRA 3QNXB 2B2XL 1QQDB 2VUKA 3P11H 3FRUA 1WFJA 2B3RA 4N2BA 3T6QC 5F1NA 1JV2A 4Y16C 2EH8H 1NBVH 4RVBA 4DOHB 5HP5A 4NRZA 3AXHA 3WDHA 3FBKA 2YFNA 4J1UA 5KBMA 1Z32X 3ETTA 2ZUXA 1OP3K 4Y5YA 2PW2B 3T8XB 1DQKA 1MFEL 4DQOH 2XZQL 4X8CA 5JPNA 1N8OE 1TPXB 1E50A 2ATKB 4C4UA 2OL3B 2EICA 4BFFA 4MHHI 1NCUA 3GIVA 5F1IB 3EYVA 2CM6A 3AG1B 2CKBB 5TPWH 1TQUA 1TVBA 1GGCL 2HRGA 5FCUH 4N25A 4JO3H 2CGYA 4Q9QH 2VW6A 2OLDA 1N5YH 5HDRA 1KCWA 3WY1A 4W9CC 2GBTA 3V6BR 1I3GH 1HXMB 1Q9LA 3NEOA 4P2RB 3SYPA 4K7FA 5IY5B 2FECL 4CGTA 2OV0A 3AG4B 4TL4A 4XPBL 3WE1A 1AKJD 3A6BH 5KYXA 2GAZB 2BMKA 3MZGB 3G7TA 3MXVH 4EBQL 5TE4L 2IC2A 2YQGA 2WQWA 3BH9A 4ONFH 3D3VE 4G3YL 1M2OA 4DGVH 1U8PA 1NCAL 4GRMB 3U7YH 1MDTA 3TZVA 1CI3M 4AC4A 3EXLA 3I75A 1E8XA 2AXGA 1A21A 1QFUH 3VX1A 1TETH 2J5WA 3L3JA 3TZVD 2LLGA 5JTWA 1A64A 1Z5LB 3T0EE 3P4NB 2IAMC 1KGJA 2WKOF 1KIRB 1I7TA 4R7DB 1TR7A 4UDUA 1U30A 1UCBH 2A6IB 4YPJA 4N9GA 4H20L 3VFNB 1JZGA 3OAYK 5GGRB 3S8WA 3R4DA 2HPOA 2BNRA 2UWEF 1BLIA 5IW1B 4DTGL 4ZNEA 3BZ4A 4NFCA 3X13A 1RMFH 2BC4A 2FQEA 4JE0A 2IWGA 3BUDA 3S3JA 3HMXA 3W5NA 5CR1A 1I4FB 3AAZA 4QYOB 1YPZA 5TQ2H 3S36L 4DGIH 2PXYA 3QIUA 2MKLC 1GS6X 5SWQA 2D03H 1C1EH 3BH8A 1I1YB 4MB3A 2Q8BL 3SQBB 3CSGA 5I76A 4RGMB 3SGDH 3OKEA 2A74B 3FB7A 5IVZA 4JG5A 2PYED 1I82A 3P0YH 4R5VA 1GJIA 3T6ZA 2OJZL 3OL2A 3BN9D 1P9MC 1OPGH 1MCLA 3VQLA 3WEAA 2AQ3A 4IBLT 5FAAA 4ZO7A 4EOWH 4NM8L 3H7LA 3RTQD 2CHXA 2QFRA 4WUKH 1KCBA 1RI8A 2GHZA 4ZUWB 5SWSE 1A6VH 1LEIA 4MDRA 3L3IB 2H26A 1ZTXL 2J8HA 4AV4A 1K8IA 1MXGA 2C3VB 1EJOH 3QI9C 4M5SA 4DN4H 3B9KD 5MHSD 4DN3L 2H9GB 3EOBA 2CKBH 3REWB 4F33B 3KEDA 2AJUL 1IGIL 4WTWA 5G4MA 3RPIA 2E27L 3DXAE 1NBZA 4HJ1A 3QULB 2ALAA 4RGNE 1T6BX 3CDCA 1U6AH 5DJAA 4QXGL 4KNTA 1FIGL 2VR7A 3OX8B 4LO9A 1MWAH 4CKVX 4DVRH 1AS7A 1FLTX 2WXFA 4WWOA 3V9FA 2HFGL 3WDJA 3WEOA 4NQQA 3EBGA 5DMKA 3IMBA 4QHNB 5JLZA 2EKJA 1U92B 3B1UA 3OKYA 3QQ4A 4WJ5A 1EHNA 4UQ3A 2WSKA 3NTCH 3ZKNC 5LXGH 4MBOA 3CPUA 1JXGA 1ZS8A 1C7SA 1VENA 3QRGH 2CBMA 5CJBA 1ORSA 4ES9A 1T1ZA 4P4KD 1MJ8L 1IAIM 3VI4F 5E6ZA 1VEOA 1QFPA 4GIAA 5IFAL 1JZ8A 1A4JA 2G5UA 2FLBT 4XXDA 1F13A 4OZ4A 5KUKA 2JIXD 1UM6H 5DGQA 2VIRB 2A73A 3X1GA 4JG1H 2CG9X 1KXVC 1R24A 2O6DA 4MRBA 3S9DB 3U2IA 1F90L 3UAAA 3AGWA 4XVTH 2CGZA 3KEHA 1OGSA 2LU7A 5IROA 2OP4L 3HW7A 2FL5A 3EJZD 5CD3A 1BVKA 3HZ3A 1MQKH 2X3BA 4GW5A 4FYRA 4Z3IA 2IWFA 2XBZA 3U0TA 4WI3A 2KDGA 4PRPD 1HH9B 3TT3L 4BDVA 1V54B 2XN9D 3ARDC 4JRXE 5JQ6H 1KUMA 4FCAA 1IRAY 4DK3A 2CK2A 5CZKA 5ICUA 3VXOB 1BDYA 4J3VA 5J1AB 3VWJA 1MH5B 4OZGB 4ZDHA 1M7DA 1NFDA 2H7WA 2QQNL 1BWWA 1JNLH 4FMVA 1ZA6A 2X9XA 5KYYB 3T0EA 4KKLD 5FHBL 3WFCL 1MHHB 2NY1B 3OXRA 2R56H 3WL9B 5DHXB 4G80A 3WFDL 2JKSA 1MJUL 2PP7A 1XBDA 4QGYA 4AE1A 2JELL 2VLKB 3CV5A 5I19L 5A1AA 5EOQH 4I48A 4YSCA 4EI6B 3SPIA 1IBDA 4LFHD 1NH6A 1KIUB 4FXKB 1NMCB 3TBVA 5DRXB 3WHXB 1A1OB 3LN9A 3EO0B 4IS6B 2NYYC 2X1WL 2YSSB 1OOWA 2OTWA 4BKSC 4OFPA 5DD1H 3ELQA 5D1XE 3SCMC 3BLBA 1TQCC 3MRDA 3MU3A 4Q9BA 1L7TH 2FQDA 2QVKA 2O5YL 5B3NA 1N5YL 4KROD 2HZHA 2Z35A 5J5EA 4PLOB 2ZOLB 3MLVL 4Y9EA 5IOPA 2W81C 2NSXA 3K2IA 4YE0A 1I85A 4EIBA 2X28A 4BK4A 1FNGB 1MFBH 1G7MA 1JS4A 3BZ4B 5GRYA 3PGCA 3QQ9C 4NQVB 2FSDA 2PYEB 3VD7A 3L5XH 4GBXB 1NGWA 1E5CA 3BRFA 2AV1A 4JY6A 3RVXC 2VZVA 5GJTL 5B7FA 2QZQA 3OTTA 2ZJSH 2XXMB 4UQEA 5BXFA 2HRPL 4DP4X 1FHNA 3P0YL 2DJ4A 4XMXA 2GJPA 3C6SA 1U8QB 1KJ3H 4CVWA 5EUOA 4KXCA 4PJDA 3UPRA 2BPBA 2AXFB 5KSAB 3BUIA 4N8PA 4I18B 4A7QA 4M8UA 1FG9C 3HKFA 5I23A 1NCGA 4Z1PA 2R2CA 1EEQA 1R6VA 1Y0LB 5TDOA 4CU8A 1TTGA 3C6LD 3UAJC 3P77A 4LPWA 3QAQA 1Z9NA 5D1ZI 4KGLA 4JM2B 4Z18A 3MLZH 5DEJA 3KW8A 1QASA 2KZKA 5L8KB 3SKNB 1A8ZA 1LO2L 1L0PA 4JVWA 4HDIB 1J0ZA 4BFBD 2YPLD 1KTDA 1I1AB 3FOMA 5CGYC 4N2MA 4ZSOE 4TUKL 5J3HC 1QPPA 2MOVA 1SJHA 2QPDB 3V6OA 3WE6B 1P7BA 5F6HI 3TM6A 4AYEC 3CX2A 1BHGA 1U8LB 1YLBB 2VZOA 1Q9KA 1DLHB 2WZ6A 1Z0NA 1YYCA 3BP6B 5DEGB 4XP6L 3REVA 5HVHC 4FS0A 1E8YA 3KNBB 3C9NB 1UXMA 2UX7A 5MEQB 2LLLA 5C0FA 4ZUVA 2J6EL 1NPNA 2J3SA 2CHZA 4TRPL 3TA3B 4NWUH 3BPNB 3WHE1 2XXFA 4K3HA 2XI9A 4X7SH 5DYOA 5EUKA 5BZXA 2HG5A 1SFHA 4PJ8A 3GBLA 3D39E 5T1JA 4BSJA 1A25A 3QFGA 1N64L 5ELIA 4UQ2B 1FG2A 2R27A 2X2UA 3BVNB 4LU5L 2VLLA 4PP2B 3C5ZC 4NQTA 4X9FA 3SDYL 4YZFF 5KG9B 1OAYH 3FU7B 3V6OE 4R83A 3U6XS 3BX7C 3QZOA 4Q74A 4M1GL 4K0OA 4JDTH 5I1LB 5ID1A 3S88H 4F7CA 4RETB 1TFHA 2AEOA 1FDLH 1BZDA 3QIWA 5DJ2A 2GEQA 3BDXA 4PW9A 5GGSB 4ZMZA 3EJZC 1UACH 5KVEL 1Z3RA 2Z93B 4NCC2 1FH2A 3SQRA 5AW8B 3C09B 1NM9A 3NPSC 4WFGE 4BXVA 3GNMH 2VMDA 3QPQC 3S37X 2ZAHA 3HBPA 3EJRA 3U82B 3GMPA 2HT2D 1OM3L 5DD3L 1DVXA 1FZOB 2XA3A 1SOSA 1NUNB 3R0NA 4U1SB 5DS8A 4P2RE 2NZ9C 3LZFL 1Y18A 3FFCE 4JREB 3V6ZA 1LK3L 1A7PL 5BJTA 2HT3C 4QHKI 1B2WL 1VGEL 2FO8A 5FM4A 4X8XA 4P2RD 5JIMA 4H0LC 3WY4A 3VM5A 5FLUA 3Q6FA 5EOCH 1TYEB 1J8HE 1UQSA 3D18A 4NM8H 4PI2A 5F7DA 3RHWF 2H9GA 1WC7A 3GEFA 5IHUL 1BPVA 3PWPB 1GZHA 2D7NA 2EIZA 4JM4H 4B7LA 4ZMQA 4ZW8A 2EH7L 4GIPD 5LBSA 1TQCB 3FBQA 3T4YB 2KYIA 1H5BA 4FFTA 2ZF9A 4IKNA 4I2XB 5DJAB 4ACTA 2NW3A 4ZFZB 3PGCB 3MBEC 2QPUA 1M3IA 4F7KA 4F24A 4ADJA 1GVIA 2C34A 2E9WA 1U92A 4WJ5B 2FT8A 3PYCA 4MCZA 5FIEA 3W2DH 4A38A 2XN1A 4X5XA 1ODAA 2FEEL 4LHUD 3SBRA 4NHUA 1ETJA 1G4RA 4K8RL 5AKVA 2AANA 4C57C 4IIQC 4TVUA 4LB8A 4APXA 1NLBH 2A99A 4FNLH 2HT3D 3SBWA 4OZIE 2OL3H 1B0IA 1RPKA 2QGEA 1Z5HA 1O9VA 2XV0A 3QCUH 3O11A 2OKMA 5C6TL 4OGZA 2WXPA 4OTXL 1BQKA 2R2EB 4PTTA 4EZKA 1LQSR 1RZFH 3W1ZA 4HUMB 5JW4R 3ATEA 4LCUA 2J25A 3HC0A 4AG4L 5KSAC 1MCNA 1N8ZB 1OO2A 1UOVA 2VGLM 3BAWA 1P4BL 4RA0C 4XVOA 2L0DA 3BVUA 2OJEB 4XNMA 3D9AH 1HNGA 3RWEA 3PHOB 4BFOA 5KVFH 2LLNA 3L9RB 1N70A 1YJDL 2YD8A 1TNNA 2ZP9A 3DOIA 4R7DA 3VXOA 4BEIA 5HVFB 1BLNB 1OAQL 1V7ML 2R0ZL 2H32A 1AZRA 1J1XH 1KPVA 1RP9A 4K55A 2CR3A 2R0KH 3QJFB 1WFMA 4XNXH 1E5YA 4Y2NA 4U1GB 2WBXA 5FB8B 1G7HB 3AMLA 2D7QA 3NJJA 4EDWH 1ZPUA 5DJYA 2PW1A 2BIPA 2DV6A 1IC0A 4POZC 1NDGA 4Y4HD 5IF0B 3CX5J 1JIBA 2WMPB 3V4PB 2WXLA 1BIIB 3BIKB 3CXFA 4RFOH 4WI6A 5I8KL 2KZBA 2CUHA 1B4JH 4IU3A 5T8IA 1BREA 3KYMA 5I76B 1DJWA 3QDJB 3IEAA 1MCQA 3MNZA 4P3CL 3WFHA 3TN0B 2J2ZA 3X12B 4I1RA 3D12B 1ERNA 1F18A 3RZCC 3NFNB 5EIIA 2V7NB 1Q9OA 3LN5B 3QDHA 4K7PX 5E23A 2NCEA 1JRHL 2KS0A 4UINH 2LVEA 1T21A 4DGWC 2C1OB 5PAZA 4J23A 3L3IA 3GB7A 1HILB 4KK9C 4PUBH 4XC1H 1CFQA 4DETA 2NY6D 1BXVA 2FGWL 4PJDE 5D6DA 3LHPH 2ADYA 3EO9H 1AZCA 3Q2NA 3A0OA 4Y4HA 4AMWA 4P23D 3BSHA 2GKIA 2ZKHH 6CGTA 3QVAA 4AWJC 2J43A 2UZYA 1G9HA 4X7SL 3QW9A 3QXDA 1M7XA 1YEIL 1YO4A 4NDMB 4OFIA 2ICWI 5DRWA 3RA7H 1PJWA 1O6SB 5IHZA 1TTFA 4BZ1L 3R8BB 3LB6C 3F6IA 5KSAD 1G4MA 5HHMB 3FT2B 4NERA 1LEGB 1ZE3H 4QHLB 1JXKA 4X6DF 3X3FH 3K5RA 1QR4A 2OR9H 3DETC 4OLVL 2FX8L 1ORQA 2HVKA 3RIAK 1GS8A 3MBWA 2OZ4H 1TZAA 4RMVA 4U0QB 5B39B 1KTBA 2GI7A 5A2FA 1FLRH 3C2AL 2DJUA 3FDWA 3T2NL 3OPZL 3ALXA 1INEH 2VM9A 5CJ5A 3D18B 5F7DB 3KPOA 4L4TD 2E4FA 3PWUA 3LRHA 5KVDH 3VXMB 3TWCH 1JMZA 3P4OA 1PF3A 1BZ9A 2PWDA 2Y3NA 4L5FE 5CGMA 1WWBX 2D9CA 3UOAB 4C55A 4ZMTA 4P5MB 3TO4C 3U2SB 5AVQB 2ZXBA 4RISH 2OSWA 5CP7A 2WBWB 2WTPA 1H5BB 1MFMA 3QC6X 1N59B 2E5EA 3MRFB 4K5OA 3I6LE 4Z78A 1R5WB 4PV9A 2IOIA 3B6SB 2X6MA 3FSAA 2AJXH 3FTYA 4KU1A 2XUWA 4ZX4A 1F00I 1CGTA 2Y7NA 4TS6A 5KWYC 7CGTA 1N68A 1AQ8A 4PRIE 2X70B 4KOCA 3KGSA 3MR9A 2NUPA 1AYOA 3QEQB 5CP3A 6TAAA 4XBGB 5AWNH 1EV2E 4KY1L 3MX0A 4KKBD 4DKEL 3IDIB 4QRSB 4RBPH 4O2FA 4XWOD 4Y16B 4DK6A 4XMVA 3US1A 1N6QL 5KVGH 1X4ZA 2V2TA 1KULA 4WI0B 4AYFA 4PJAA 3SO3B 4MAYA 3EZ8A 1INQA 1BZ7B 3PP4L 1X4XA 2HFEB 4HJ0C 4U6HB 1FAKT 3EYVB 1HHKB 3LKNA 4YSPA 3G5XB 4LPTA 4NZTL 2A6DA 1FFOA 4FXKA 1LTXA 5GGQL 4HJEA 3WEXA 1B9KA 3T4AC 4OGYL 1KXTA 1KLFB 4M48L 3UXFA 4ADGA 1UVQA 2VDNH 3NCWA 4V1DB 1YY8A 2WBKA 2G3NA 4P2RA 2VQ1A 2UYLB 3ARBC 3IMRA 5DQJB 1ZT4B 4NKOA 3K4AA 5ITBH 3KCPB 3WELA 2VDPL 3BVXA 1U95A 3DVFA 4G8GD 3SKOA 4HMDA 3QI9B 2HN7A 3DDFA 3GXDA 4YSQA 3D51A 1K9TA 2VKXA 2YPKB 1UHVA 5FYLD 4NCDA 4R4NC 4PJ5B 5EV7A 4LT7A 1MAML 3LZQA 1B3IA 4WTZG 1UURA 5D7SH 1SXAA 1PIGA 4K7PL 4TNVF 3SKMB 4OCRL 2LTQB 2QADD 3PGFL 5D1QA 5JOEA 2FUQA 3WKPA 3MNWA 4ERSL 2NNAA 1RV6X 1JZ4A 1U21A 2WHVA 3ZTDC 4JZJB 4IDLA 1BXAA 3OHXA 3TL5A 3SDYH 1JPGB 1MW2A 4R97C 3LSOB 3QUGA 3CN2A 4YDZA 5E00A 1FYHB 5AOMA 2KPWA 3VFNA 5AVRB 4Q7DA 1QNZH 2DQDH 5CP3H 3TBSB 4PWJA 4RWYL 1RUAL 4KRMB 4WVRA 4UM9D 2DMBA 3TIDB 4PRAA 5EZOH 3UROR 3WNJA 3CN0A 2BNQD 1SEBB 5M94B 2WUBH 5HHNB 1KNOA 1R34A 5CGYD 5SX4I 4TNFA 4WHDA 3OD3A 4ONGL 2J1YA 1WA2X 1OZTG 1BWMA 2CIKB 4NHUB 4XCEA 5CO1A 5IVOA 1QSED 2KLTA 3OMAB 3T4AB 4ETQA 2R0LL 4JDEA 4Z7WB 3ULUC 1BJ8A 2X89A 4HT1L 4LARL 1EFXD 1TVDA 4PWGA 1XEDA 3LMJL 1BJ1H 1X5MA 2GITB 4NXSA 5EBLB 1JERA 1NA8A 1AZZC 1U8LA 3HMWL 2OR9L 2D3NA 5HDOA 5I5JA 1C8QA 5E2UL 2BCKA 3STZA 4FL4C 4G59C 1RZJC 5JXEC 1YEWA 4WI9A 2QSVA 4U1GC 1SM3H 1X5XA 1OAKH 3O0LA 3FTZA 5FWRA 4XN8A 2B39A 1WBZB 2QVIA 5L7XH 1MLCA 2K7PA 4P06A 3MV8B 2V9QA 3GLZA 1NBQA 1P4IL 3BGFC 2DQJL 4RSYA 3MV8E 4DEPC 1ED3B 4PJIB 1N18A 3BZ5A 4GKZA 1ADQL 5KOMC 1A6ZA 3B2PA 4Y88A 3UTZA 4HAGA 3QUHA 3PF2A 3IDMA 1J8HB 3CVHB 4G3YH 4ZQKB 2V2XB 4LCVA 5FS5A 4B9FA 4AJVA 1XCQA 2WXJA 2XWJB 3ZDXB 2CMRL 2NUTB 2WBJD 3A4DA 1YMHA 2AZUA 3F7RA 3D2UB 5T1MB 4ZW3A 3B2XA 3LPOA 2Z92B 4G8IA 4JKKA 1JNNL 2GABA 4XC3L 4XX1E 3ARED 3W38A 1YY9D 1UT2A 2WQAA 1NEUA 1INEL 5ETUA 4OBRA 5L2JA 5C9KA 1NL0H 1LWHA 4RMQA 4PJ5D 5L9DL 4JFFD 4GUPA 2FJGA 2BOBB 4N2HA 4N24A 4KRPD 5HYSB 1VCAA <