4DP2X

The 1.8 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp2X00
1FWXA 4A2HA 1OE3A 1M56B 1OV8A 1TEGA 2YAFA 3FPXA 2WO3B 1J9RA 3OQRA 4YSRA 5B1JC 1A4AA 3IBOA 2BP8A 2Q9OA 3EH3B 2ZOOA 2VM4A 1OCZB 2YXVA 1NIFA 2UXTA 1WA2X 4QKTA 1AG0A 2PPEA 3MX0B 3ZBMA 4F2FA 4YSPA 2UX6A 3CVCA 3MBWB 5I5MA 2XLLA 4YSAA 1YLBB 3N55A 1T5KA 3V9CA 2CALA 4G7SB 2Q5BA 2EILB 2QPEB 1L9SA 4GXFA 2FWLB 3PXLA 4E9TA 4YVNA 4UANA 2VW7A 2VW4A 4GYBA 1L9OA 1RZPA 1ASPA 4HHWA 2BW5A 1JXFA 4JHVA 2DYSB 2PPCA 3T6ZA 1JZJA 1X9RA 1MZZA 4E9VA 2PPFA 1AACA 1XB6A 2LLNA 1OE1A 3UADA 5B7MA 5FC9A 2B08A 1SDDB 5IY5B 3FU8A 3NYKA 5E9NA 1PNCA 1A65A 1PY0A 3C75A 4KO9A 1IKOP 2PCFA 4BWTA 3KW7A 1PF3A 2CJ3A 2XXGA 4UAHA 2CBPA 1PZCA 2XVBA 1JVLA 1EZLA 3AY2A 1PNDA 2GC7C 4AZUA 1GS8A 1PZBA 3S3CB 2W8CA 1KCWA 3CZUB 5F7BA 3V9EA 2MRYA 4BXVA 2FQFA 2HX9A 2BWIA 4YSTA 1QHQA 4NB7A 1PCSA 3AG2B 3FYEB 1DYZA 4AKQA 3PPSA 3WG7B 4GY4A 4DP7X 2I7SA 3NSCA 4GP4B 1AR1B 1HFUA 3X2QB 1DZ0A 1J5CA 1JXGA 4G7RB 3QPKA 2PP9A 4BDVA 4PAZA 3PAUA 4YSEA 2VW6A 5D4HA 3S8GB 2R7EB 3QJTB 3GDCA 3BVDB 5I6PA 4A2FA 1I53A 1NWPA 2FTAA 2VSMB 1L9RA 3X1EA 1V55B 1BYOA 3GXUB 3QJUB 1IBZA 3FSVA 3HB3B 4DP0X 1FA4A 3OMAB 1AZRA 2JKWA 3TASA 2J56A 3OMNB 4YSUA 2QPDB 2A3TA 2WSDA 1B3IA 2FQGA 2GBAA 2GIMA 2PCYA 4EF3A 3IN2A 1TEFA 1CC3A 5I6OA 3FSAA 2FQDA 1PAZA 4KO7A 2DV6A 1ZIBA 3SBRA 3SBPA 3WNJA 2HX8A 3T6XA 2IDTA 2UXVA 1AAJA 1SHWA 3NJIA 1V54B 2BZCA 1CYWA 5B1BB 4DP2X 2TSAA 1A8ZA 1KBVA 6PCYA 2QDVA 5AZUA 2JXMA 3FQ1A 4KO5A 3NJFA 1NWOA 1GS6X 1NIAA 4KNUA 2XYBA 2W88A 4A68A 1GY1A 3X1FA 4GP5B 5TK4A 4HCFA 2AZAA 4AX3A 1J5DA 3ERXA 1NPJA 4A2DA 4ZK8A 3IE9A 2YAMA 4E9SA 2BP0A 4DP4X 4BXSV 4JHUA 3ABLB 2AFNA 2FJSA 1X9UA 2PPAA 3GYRA 5B1JA 4A2GA 4Q89A 5LDUA 3PCYA 3FS9A 3FYIB 3NSDA 5ANHA 3UACA 5F7AA 4BK5C 3NJJA 1BEXA 2JFCA 3T6VA 1JOIA 4DP5X 1TU2A 3FSZA 3FQYA 2Y1AA 4HCGA 1NIEA 4K9JA 3NP3A 1R1CA 1FFTB 1OE2A 4HCIA 4KOCA 2GSMB 1ZDQA 1JZGA 2OV0A 3CVDA 3AG3B 1KCBA 4A66A 2X88A 3D12B 3AZUA 4HHGA 4YSOA 2FT8A 1AS8A 3ABGA 1M9WA 4A2EA 4GP8B 4W9ZA 1SFDA 1M57B 1F56A 1IBYA 4DP1X 3NJLA 2IAAC 4YVUA 4P5RA 2P80D 3ZIYA 3FT0A 2YAEA 2BP0B 2XX1A 1OF0A 1GS7A 5AKRA 1E5YA 1XB8A 1BAWA 3EH4B 3IEAA 5B7FA 2BP8B 4WTQA 3WNIA 2GHZA 1JZEA 4MFHA 2ZONA 2H3XC 1GSKA 2DYRB 2FT6A 4M4RB 5EHFA 1RCYA 2AZUA 2BO0A 3UAAA 3AG1B 3H56A 3NT0A 3UABA 1WAEA 3WKPA 4KNSA 1EHKB 3S3DB 4BWUA 1IUZA 4E9WA 2PP7A 1SHXA 4W1TA 3TBBA 4DP6X 1AZCA 2YAHA 2YARA 3NJNA 3NSFA 4DPAX 3WKQA 2IWKA 4F7KA 2QDWA 3H4FA 1ET8A 1JZIA 1IC0A 3DIVA 1AG6A 3NJMA 2H47C 4KOBA 4DP9X 1J9SA 3CDZB 3UGEA 2AVFA 1E65A 2XU9A 1PLAA 4A67A 4E9RA 1JXDA 2FNWA 2EIJB 3EH5B 1ASOA 3T6WA 4QLWA 1J9QA 1TKWA 4YSDA 2YXWA 1QLEB 2J57A 1RKRA 1RZQA 4BWWA 1OOWA 4G7QB 2DWSA 1MZYA 2CCWA 3UAEA 1CYXA 4KNTA 1AANA 4AKPA 2GC4C 4AI7A 2XWZA 2BWDA 3TA4D 3QJRB 3EHBB 1KYAA 1ETJA 4E9QA 3AG4B 2J5WA 4WKXA 2IDFA 3AW5A 1QNIA 4P5SA 5I6KA 1N68A 1PLCA 3CG8A 3CDZA 1PZAA 4NERA 2VMJA 3NJKA 3FPYA 5TK2A 1E30A 2UX7A 1W6WA 1ADWA 5I26A 5B1KA 7PCYA 2UXFA 1GY2A 2X87A 3H4HA 4KO6A 2TSBA 5I6MA 1BYPA 4YL4A 1L9QA 1HAUA 3ASNB 7PAZA 5I5IA 1JZHA 4YSSA 5PAZA 3OD3A 1JZFA 1NPNA 2E86A 1SF3A 1A4BA 3FU7A 2Y69B 2HLEB 3N2JA 1ILSA 1BXUA 1SJMA 2VM3A 1ET7A 2J55A 1ZDSA 2IWFA 3QJSB 4G71B 2EIMB 1GW0A 2HXAA 2PPDA 2R7EA 3RYMA 3QJVB 1ZV2A 1GYCA 2IWEA 3PAZA 4TXVB 3QQXA 1XMEB 3CVBA 1SDDA 1SNRA 1URIA 1E67A 3L45A 2FT7A 1AZBA 3FSWA 1OCOB 1A4CA 3TU6A 1J9TA 4YSCA 2HRGA 1KDIA 1MG3C 1NZRA 3OM3B 4DP8X 3FU9A 1MDAA 3HEIB 2I7OA 2XXFA 1SF5A 2IDSA 1KDJA 1W6LA 3T71A 4FAAB 1NIBA 1UATA 1ZPUA 1NINA 1BXAA 5AFAA 4HAKA 1ID2A 2GB2A 1L9TA 1N70A 1NIDA 4DPCX 1AQ8A 3IN0A 2IDQA 4UF7C 1ZIAA 1ILUA 2GI0A 4N4YB 3S8FB 2AANA 3TBCA 9PCYA 1A3ZA 1PLBA 3NP4A 3ZX1A 4E9YA 4JKNA 5I6NA 2PP8A 1WS7A 4RH4A 2XX0A 4X4KA 3WI9A 4FA7B 2H5UA 2XV3A 1GR7A 5PCYA 4Q8BA 2CAKA 2PLTA 1MG2C 5I28A 4E9XA 3EF4A 2YQBA 1JERA 5I5JA 4CSPA 4HZ1A 2VN3A 1WA1X 2BHFA 2DY2A 2XV0A 3OMIB 5A7EA 3U25A 1V10A 1KGYE 1BQRA 5D4IA 2RACA 3DTUB 1OCRB 3ABKB 3SBQA 4AKOA 2IH9A 2HRHA 2CUAA 3X1GA 3SQRA 2HZHA 1BQKA 3NSYA 1AS7A 2VSKB 5B1AB 1ET5A 1WS8A 1AIZA 3DKHA 1XB3A 2YAOA 2BW4A 1WA0X 2YAQA 1KV7A 2MTAA 4F2EA 1HAWA 4ENZA 3X1NA 5B3SB 6PAZA 3WIAA 2P80A 4G70B 3FQ2A 4HALA 4N8UA 2UXGA 4CSZA 4YSQA 1CURA 1VLXA 3T9WA 1NICA 3ABMB 1CUOA 1NDTA 1PMYA 3NJHA 3PLYA 2DWTA 1AOZA 2EIKB 1KBWA 2FQEA 3PAVA 1AZUA 2XV2A 3G5WA 2ZWNA 3S3BB 3QJQB 2OCCB 4HIPA 2WO2B 3KW8A 1SFHA 2YAPA 1L9PA 4DPBX 3FU7B 3BQVA 3JT2A 2ZXWB 1JVOA 8PAZA 2EINB 3ASOB 1AS6A 4G72B 1NTDA 4L0PB 1OCCB 3NJGA 5B7EA 1W8EA 1ASQA 1AZNA 2NRDA 3X1BA 4PCYA 2HX7A 4BDVB 2BZ7A 5I6LA 3ZDWA 2OJ1A 1BQ5A 2N0MA 2IDUA 2B3IA 3JTBA 2I85A 5D4JA 4NAJA 2XUWA 1E5ZA 2QT6A 4M3HA 2IH8A 1BXVA
chains in the Genus database with same CATH superfamily
1SRDA 5DI8B 4R3SA 3CN3A 1J9RA 1AJ7L 4RMTA 4DAGL 3ZDXE 4ZMVA 3U4EB 3VWJD 2Q9OA 4H8HA 4BCXA 1GYWA 1KXQA 1U58A 4Z7AA 2DIJA 3QUZC 4UQ2B 4QXUL 1G7IB 3AMKA 2K8MA 3S2CA 5DFWH 4DKTA 2J8UA 1KY6A 3K8KA 1QBMH 3SJVA 4HUXA 2ZP8A 4HKZB 1ZGLP 1JGUL 1YN7B 3C6LA 1C1EL 4OCRL 5IVZA 3V9CA 4P9MH 5HVHC 3NEOA 4N2GA 5DJAA 3KYMA 3DRQA 3PXLA 4S1DC 4YDKH 3APMA 3O4OB 1MCQA 2Z91B 1E4XH 1G7PA 1EJOL 5GS2D 3VWJB 3VWKA 1TG8A 3S34L 1H6FA 1CU4L 4XN1A 5IEHB 1I1AC 1JXFA 5HHMB 2EYRB 1TJIL 2PPCA 2XIBA 1JZJA 4XCYA 4DGWC 3GRGA 4GKNB 2PPFA 5TPWL 4XOEA 2L0DA 4L9LB 5F96H 1XVSA 3QDGE 1QZ1A 4DKFL 3AFLA 3WMPA 3RUGA 2VMFA 3BZ4A 5ELIA 5DZ9A 3D50A 5EUKA 3VXTB 2JI1A 4ENED 3QO1B 4MA7H 4G8EA 3KW7A 4PR5B 4BZ1L 5C6PB 4K7PX 3ULUD 1M2VA 3I50H 3QXAB 4OFYD 1DR9A 2GC7C 1BM3H 2QSQA 2ESVD 1F11A 3V9EA 2ADGA 2NSXA 2Q76A 4BSWB 4PLNC 3ECBA 1HHGB 2CJUL 3K2IA 3LPGA 1WBYB 5CGYD 4AEFA 5L2JA 1P5UA 1SXCA 4J3SA 1B0RB 1MQKH 5KBDA 3VI3A 3SDCB 1YEFL 3ARBA 3HUJE 2ZWKA 3OHMB 1L7IL 2BFVH 3RA7L 1K3ZA 1DQIA 5B21A 1PCSA 1OT1A 4JEGB 2DWXA 4ZMAT 1ZEAL 4R7NA 2WK2A 2WQSA 4TN9A 1EUTA 4XPGL 2X4RB 1E27B 5IVNA 1ECZA 2XA3A 2Y7LA 5DJXB 4HAGA 5GRVL 1NOLA 4GT7A 3FUFA 1J5CA 3DBSA 3CZNA 2DEYX 2PP9A 5FFGA 1U8OA 3TYFA 4MGXA 4H13C 2CDFB 1NUDA 2HFFA 4JO2H 1KUMA 1DEEA 2YWZA 4PGEB 3QUMH 1S7XA 3ARBC 5T1KB 4FHKA 2QFRA 3Q44A 1TTRA 4ELMB 2EXYD 4KROD 2F5AH 2ICEB 3FOMA 3AREA 1CICD 4Q74A 3AT9A 3I6LD 4P5MB 1RUPL 1WUNT 4NUGL 4I9WE 5H8DA 6FABL 3IFPB 3HAEG 1B3IA 2K6WA 4HUWA 3SGJC 5C0JB 2P45B 3MBXH 2XBTA 4PB9L 1IAII 4B9PA 2AF2A 2XWTB 1PTZA 4NKMA 5F71A 1XXFC 1KCLA 1RUKL 1ZIBA 5SX4H 2FJUB 1IGIH 2XWBA 1Z66A 3A0OA 1ZHLB 2E7LA 3OKOA 2D31B 5TJWK 4I0PB 5SWZB 2YPKA 5D70H 3QAZB 3QUMB 4XX1E 3DBXA 2WBJB 3JV0A 5JZ7D 4HUUB 1P9MA 3DC0A 1MCLA 3LEVH 3QULA 2GPZA 1VIWA 1XR8B 3FQ1A 4U6VL 2NNFA 2OX5B 4MDRA 3D39A 1JFHA 1UXMA 1X5XA 3MLYL 4JHWH 2W88A 1YYMH 3GSOB 4HKBB 4JZNB 1AIFB 2Z93A 3GJEB 3B5HA 4LT7A 4LSRH 3KJ4C 3IU4H 3U36B 4EIZC 3TWCL 1CU4H 3L3IA 1MJ8H 3UFIA 1B4JL 4NO3B 2R29L 4MDIA 2R0WH 4G8FA 3W9DB 4NUQA 1SJEA 4PGCA 1S8DA 4IRZH 5DVPA 3ZKMD 2B8OT 3B8SA 1OSPH 3FS9A 1DSYA 3GZQA 5ANHA 5C0FB 1UA6L 3CCHB 1QO3B 1EZUA 4QRPE 3VI3E 3VXNA 4PIRF 4C47A 1H6EA 3QISA 4OM0H 4NQEA 5DD0H 5HHPB 3S96A 3TTYA 2JKRM 1OE2A 4KOCA 2BC4A 4NKIH 2GJJA 3GGWA 1RERA 2JKSA 4B9ZA 3FTSA 4GW1B 1G9HA 3IDMB 2XKNA 3EBAA 4DN4L 4YUEH 3I02B 1SLWA 3MQIA 4PIBA 4EOWH 1J0YA 2FWUA 2R2BA 1EDYA 3L4UA 3SBWA 4GP8B 3T0ED 1XIWC 3TO2B 4W9ZA 4YC2C 4ELKB 2XNAA 4JZJC 4K3DL 4RWYH 3RAJH 4DP1X 3RUGE 4M1CD 4QO1A 2EQDA 4KZDH 1FG2B 2WSPA 2YAEA 4M1DH 4GRMA 4PJBE 4J8RA 3DPBA 3PP4L 1BQHG 5C0CB 4EO5A 1CCZA 1DJSA 1BAWA 1NGXB 2E9BA 1MCBA 4NGHL 1UB6B 3MRPA 1AMXA 3EOBA 4KJPD 5GJTH 2CO7B 4G6JH 1H8NA 1O6SB 2FT6A 4UTBL 1RCYA 5B39A 1QBBA 1X7QA 5IESH 2YC1A 3PF2A 1A6ZA 1BZ7A 1CTNA 1LO3H 3S3DB 2PP7A 2VISA 2NY7H 4X9IA 4ONHA 2E76C 5DT1L 3SHSA 1PD6A 5IT2L 3DYOA 1A02N 2QDWA 4XXWA 4BFJA 1KBGH 2M26A 2APSA 5DZAA 3EJSA 1OGSA 4U1GC 2O61B 4L8SC 2VDPL 1MHCA 5H4YA 4GXUM 1R34A 4U3XA 2ENJA 2LOEA 3E9UA 1E8YA 3EH5B 3MV01 2XWDA 2P26A 1ZVYA 4KKAC 4ZUSB 4EI5A 3WS3B 2J6EL 3BX7C 1V7MH 5E8DH 5FUOH 1LNUB 5JLZB 4GAJL 3WNPA 2FJGB 4NQDD 2NT1A 4KUZH 1Y0LA 3QVAA 2RR3A 2XWZA 2ZX7A 4JFFE 1A6VL 3JWOC 5IV2B 5JHLA 4M3KB 3QFGA 2V3EA 4RVBA 3QYMA 2XWCA 5DMKB 2EADA 2JXMB 3FULA 4ZMOA 2H6PB 3VNYA 4NDMA 4Q6IC 3CV5A 2VSCA 2GUOA 3NAAL 4JRYB 3CMGA 5IG7B 4MLIA 1X5HA 3FF8A 4DOHE 4KPHH 3DYMA 5MEPA 5D70L 4ILDA 3ARDD 1HQ4B 5CGYC 2Z35B 1PZSA 4N0FA 5HVGB 2UVFA 4PJ9B 1N3NA 3RDJA 2EE2A 4OM1H 7PAZA 3NA9L 1KT2A 5AW0B 2JH2A 5I8OH 4JCMA 1J87A 5PAZA 2BIIA 3WNKA 3CAFA 1UD8A 2DQFA 2VLJA 1XBRA 2EIBA 4KQ3L 4BFNA 1EAPA 1SDAB 1DJGA 1KIPB 3IAPA 1AC6A 4AG4L 3C60A 3BDBA 1T66D 1I85C 4RBPH 1E2WA 4OZGF 1Z0MA 3RWCB 5DRZA 5JR1L 4JRLA 3VTAA 2G3NA 4TUJA 3PAZA 4YHNA 3WUZA 5KAQG 3SBWC 3ZTNL 3H9ZA 4S10A 2AXFA 2WCPA 4J6RH 3I2CH 1PYWB 4NLHA 1JIBA 1YY9D 4MD5A 5G4MA 1U2HA 5LNEA 1FZOA 4W4NA 2P7TB 3FU9A 3TPUA 4GBXD 1CXFA 5DD6A 2RA1A 4PV8B 4TSCH 5EFIB 2XXFA 32C2B 2VERA 3DX8A 4BA0A 3FB7B 3FRPA 4Q9RL 3FO1B 4WSGA 5IB2A 4F15B 3FO9A 5EU6D 3BN9C 2V5YA 2X70A 3QQ4A 2OP4L 1L9TA 5ICZA 3U0PA 2DB8A 5EC2B 4N24A 2G5BA 5EBLA 3H3KA 4G6ML 5F7HA 1JF5A 5IB3A 3JVFC 2ZUWA 3HHRB 4S1DD 4JN2B 5I75B 4NN5B 5D7JB 3VSUA 2OMZB 3FCTA 5HYQA 3OR6A 5BRPA 2FUTA 1FGNH 4RH4A 3UX9B 1BGXL 1U8IB 3BJ91 3HN8A 3Q6FB 2Y7OA 1T7ZA 3QIWD 4JJHA 4PJCE 4ZUUB 2ADFH 5JHDA 1BJ1H 3QP3A 2GSGB 2ZOWA 4LSTL 4UQBA 3PGDB 3VUAA 3ZSSA 2KDGA 1AGCA 4P04A 2DMKA 3QPQC 1DO6A 4AVHA 4LKCA 4E9XA 1Z32X 2XPZA 1LD9A 2BHFA 4NKQB 2WWKT 4JQIH 5CU9A 5C7ZA 5SWQA 2BDNL 4LSDA 4KZCA 3X1GA 1MEXH 5DMKA 3ZTJH 2AJYL 1AR1D 5D2NB 3E38A 5I73C 2P8LB 5EC1A 2BW4A 2F5BL 3VCLA 1PY9A 2YMXL 4TNWF 4AIOA 3NN8B 3UERA 2P80A 1HCFX 1BD2B 3MLRL 4PVBA 3C6LC 3ABZA 2GJPA 3OAZK 1CUOA 2XIIA 4MA1B 1F4AA 1UGNA 3LKRA 2FX9H 1Z9OA 4GLRI 4OQTA 5EULV 1HSBA 1NMBL 4W9GC 3T3PB 4EN2A 3MA7A 3RWDA 1BOGA 5E8OB 5CGMA 4MAUL 1DCLA 1N4XH 2MQ3A 2XDHA 3EYVB 5DHDA 3L2LA 4OCWL 3VD9A 1SEBA 1SXSA 2DQFB 2VLJB 4IU3A 5DS8B 4HG4K 2C4FU 4NNXA 5F0PB 1KXVC 1XF5B 3D51A 2P5WA 5DYFA 2E9GA 3I6GB 3HG5A 4ZD3L 4CNIB 1ZAGA 1ASQA 5IVXF 1NGPH 4G8GB 1IKNA 1A6WL 1MELA 3VXNB 3W5NA 2H2PD 3MHZA 4XMKH 3ZDWA 3NZHL 3IJEB 2GJ6D 4OCXL 2WXFA 3RP1A 3US9A 4FQCL 1VFUA 1WT5C 4OAWB 4JAMB 1OV8A 2YAFA 4CKVX 2FHFA 3HE7C 4M62L 5I1LA 1UB6A 3EH3B 2Y5QA 3KE0A 4LXFA 4NDMB 4KXAA 1AG0A 2WQUA 5KSBE 3MCLH 4PRNB 5SV4A 3SN6N 1HDMB 2K8QA 3FNKA 4YQXH 1YLBB 3PV6A 4TPRH 1PKOA 7CGTA 3C5ZB 2FB4L 4WKZA 1FFQA 2EILB 3D2TA 1A9EB 2WWOA 3CDCA 3LKOB 4K23L 4WW1B 1OP3K 3H42L 3I9IA 2X10A 4NWUH 1TO5A 4UQ3A 2CR0A 1OB0A 3NK3A 2VLKB 1CGVA 2XQBH 4PJEB 4BIKA 3IJ7A 3ZKNC 3QXVA 4GKSB 2IQ9H 3DBXB 4Y9FA 4PGDB 4HWBL 4AYSA 1JNLH 4DGVH 1ZHLA 1RLBA 4OLVH 3IWVA 2PTTB 3MLTB 1BIIB 2DL2A 4X5LA 5CJQL 5T1KD 4Z78B 2A9NL 4HIXH 4XXDA 3QDMA 3QR2A 4NKIL 4UM8B 3VYOA 4FFYL 4ZS7L 5B7MA 2VERN 4ZW6A 3ML9A 2ZAIA 3O4OC 4I4WA 1EA9C 3PABA 3QJOA 5IFAL 5JPMA 3WEXB 4JFFA 2FL5A 2EO9A 2HCZX 3QG6A 1T66C 4FA6A 2A1WL 1E5BA 4XOAA 5H2BB 5DJ0A 3O2DL 4H0LC 3UZEA 4ETYA 3WTVA 1J1XL 1WP6A 1B90A 2VWEE 3OKKA 3HHMA 3ARTA 2ICEA 3P69A 3QUKA 3EGSA 4F9LA 1KXHA 2ZWLT 2CR6A 1HCYA 1MCCA 3CXDH 4POZC 1H9VA 5AAWA 4ZQTA 2X2YA 2YC1B 5INCA 3APDA 4RX4A 2VR3A 1FNAA 2WCGA 5AKSA 3HR6A 4JR9L 2NX5B 3ALWA 4DFHA 3BE1L 4U1IB 3NIGF 4A6YB 1LEKA 1RFDL 3ZDZE 4Y1AD 5LXGL 3ZE1E 4YXLH 1Q72L 1RZ7L 1F97A 4J8QA 3JYCA 4J2QA 5DD0L 3MLYH 2I26N 3L1GA 4JHWL 3RDTD 1IE5A 2CG9X 2YK1L 1JPTH 3UH8A 5DJXA 4M56A 5EA0L 5JHDE 5EIQA 4FYRA 3F84A 1RD6A 4G9DA 2YD0A 2NQ3A 2I7SA 2XTSA 5SWZA 1JMXA 3EJZC 3IYLW 3OKOB 4LBAA 3EO9H 3THMH 3TO2A 4X4XA 1D3CA 2R2BB 4I2XB 2OR7A 4C4KT 3PHOB 5HDWA 3A6CH 1AI1L 3EO1A 4O02B 1L4IA 5EO9A 4YSEA 4HQQH 4HOZA 4W9IC 4OGAD 4D8PA 5CAYB 5K9KB 3IDUA 4WO0A 4DCQB 2WGNB 4X6FA 3ULVC 5I6PA 1ZLSL 3ZPDA 1RULH 2IFFH 2EUXA 4XAWH 1AGFA 1G7MA 2N56A 4MQ7A 3O3EA 4QRAA 2KERA 2Y36L 2Z9TA 3BHBB 4YIQA 3TBTB 1W72H 3LEXA 4HSAC 2M83A 3CLFL 3KVDD 1JF6A 4I18C 3ELQA 1R5VA 2JK5B 4G8EB 4J3OH 3MMEA 4LZKA 5SWQB 4PGEA 4OY9A 1SJEB 3RVVD 3WTYA 1CR9L 1AP2B 1MW2A 2FQGA 4EZKA 5K69A 4QRQA 3HI5L 4HT1L 3C8KB 4PUBH 4Z7OE 1NANI 4UOW1 4J6IA 2D7MA 1MFAH 3BKJL 3GBMH 1CI3M 5K59E 2AXHA 2LTQC 1CD1B 3ALXA 2IMNA 3BWUC 1XXDC 1AAJA 4S1SH 4KKLC 5IEHA 5F7WC 5JHDB 3BVVA 1TOXA 4TQHA 5EUOE 4HBQA 4DP2X 2WOYA 2PUQT 4XVJH 6PCYA 4FQ1H 5FUCC 2WBJA 4FX5A 1RIVL 4FQXA 1ZT1A 4QRFA 1BF2A 5DTFA 1A3RH 4HS3B 1TZGL 3MV9A 2UWEB 2ZP0T 5IQLA 3CGTA 3NIFE 5EOCH 1MLBB 4M7JH 1K8IB 4RZCB 4A6YL 1A6UL 3ERXA 1C16A 1MIEH 2YAMA 2MFNA 1KGUA 1VF5C 1HE7A 3IE4A 3GYRA 2PPAA 3NSJA 1KCUL 3QIWB 4XP4L 4KMTH 3QZMA 5HYJB 3TC9A 5GGVH 4F5CE 2JFCA 1LVEA 3VNZA 4DGYL 2FVNA 4HPYH 2X4TB 5TFSL 2GEEA 3PAYA 1PDKA 1TU2A 2X09A 5LXVA 4YDLC 1U8CA 5MERB 1HOEA 1IGCL 2APXA 3NP3A 2L7JA 4OZFB 1CG9B 3QEQA 4LVEA 5E0FA 1EBPA 3O6KH 1EDHA 2CDFA 3GLDA 3TA3D 3DOSB 3WY1A 3AG3B 3OXRA 5TDPB 3JTTB 4NOFA 4GBXB 2DQJH 1AQDB 4TQPA 2PWHA 5GS3A 1F3JA 2D4FA 3GO1L 4LARL 5B39G 2P43B 3NRQA 3KM2A 1YDPB 3GSRB 5HVWA 3NH7H 4R2GD 3DX4A 3IU4L 2QV4A 2CDEB 3D30A 1CR9H 3MRJA 4GAYB 2AERT 3ZIYA 4KITB 2COQA 1FL3A 3JV6A 3QEHA 4UU9B 5E2UH 4AZ8B 2O30A 4IBZA 1D6VL 1K4CA 1CS6A 3SYPA 1SOKA 3N04A 4FTDA 2ICWJ 4UDUA 1OP5H 1F02I 3S36X 5C8JA 3BLKA 4ZNCD 2CPUA 3PGCA 4PWFA 3UZVB 1WZAA 4PHZA 3QXAA 3QG7L 1G1KA 1EHLH 5CMAB 4KNSA 4I3RL 3VG0H 3BZFA 5F7LB 4BUQA 1F6AA 5HHVH 3FO2B 3HZKA 1JI1A 3H4FA 3B1UA 4JFWA 1S5IH 3SDXB 1FHGA 1NCAH 2OK0H 1QTSA 1QLFA 1AG6A 4LE8A 5HJDA 2WLLA 3WN5C 4APQB 2Z92B 3FN3A 4JM2A 5EUOA 5DMYA 3FBQA 1Q1JH 3IPBA 2OR9H 4IIQB 5KSAB 3GMPB 4JFYB 2J2ZA 5J9PA 1Q9WA 3RFZC 5A2JH 5LGHL 4N2OA 2EYRA 2ZKMX 3T6WA 4WENB 3O2WL 4KGLA 1CD9B 3QUYB 1E2ZA 4ZBJA 2J57A 1JZ2A 1G7PB 2NSMA 3IGAB 3BWSA 5JW5B 4JPWL 4AQOA 4KNTA 1M05B 3H2PA 4PS7A 4DF9A 4PJ9D 3K46A 3ETBJ 3QQDB 1MI5D 1P5UC 3FO0H 5E4EC 1I8LA 5FWRA 5B8CB 5KSUB 4HKXA 3TEYA 3L7FB 4FQXC 1XCQA 1IM3A 1HH9A 2NY2B 4BRJA 1H9DA 1C5CH 4TQEL 4DESA 4KJWC 4PBVC 1MHEA 2CBOA 2HVBA 1IV8A 3PXHA 4XC1H 5DRNB 1FIGH 2AJVH 4KRMB 2ORBL 4NERA 4Y8DC 1UUSA 2L7UA 3Q1EA 2BNUA 5EUOB 3S35X 3HI1B 3MBEC 2EXTA 3LQZB 2XBZA 5FUZH 3TBYB 3HN5A 3IGLA 4P23C 4YL4A 5TE4L 2DQIL 2CIKA 2ED8A 3VYNA 4JKWA 4PY8J 3SPVA 3VJ6A 1NAKL 4ES8A 2A6DA 3EYOB 3C5SA 5JIKA 3ZW3A 2P9RA 2E86A 1CVSC 1A4BA 5I6XB 1ILSA 5FYJL 1GYUA 2DLEA 3MUGB 3L5JA 2G9HA 3VU1A 5HYFA 1MCSA 4L4VD 5T8IA 1KXQE 4YHKH 3UAJA 3EAKA 3QJSB 5CF3A 3VQMA 4G71B 3RZCD 3ZOAA 5F96L 2HYMA 2R59A 3RYMA 2NQCA 1IGTA 1LILA 3Q8FA 3SDDA 2Q7YB 4JVPA 4GAYA 1ORQB 3K6SB 2NUTA 5C0NC 4ONGH 3DX9B 1BWWA 1SDDA 1QSED 4M61A 5GGRY 3BSGA 1YAZA 1A25A 1KCKA 3QWOA 3KCWA 1DQJA 1R19A 3LD8C 4Y8AA 5F88A 5L2KA 4FFZA 4M6OH 1ZLUH 1J9TA 5IW1A 1CD0A 4YBHA 3TLRA 2ZSWB 4PJCF 5FK9A 3UJJL 5AUMB 4LEXL 2V37A 2AJSL 3GM0A 3QRFM 1NGYA 5FIEA 3CMOL 3GSXA 4Y19B 3RGVC 4J27A 2CMRL 4XP5H 1FP5A 4OLYL 4EAEA 3O2DH 3FN0H 1ZE3C 1KPVA 4JRXD 5DFVD 4Q9QL 3MACH 5CEZL 2WINA 4X42A 5DUML 1U3NA 3ARGC 5I0XA 1OWRM 4WQOA 3R7RA 5DFAA 5C07A 5EEVA 2AK1L 3BEWA 2HMID 1VEPA 7FABH 4E0RB 4IRJA 4NZUH 3VXPA 4L3CB 2R2EB 3WEMA 2FBJH 3WHE0 3TZVD 5E99L 5EORH 3BH9B 2FH6A 4WWKD 1XT5A 3MLPA 3BFWA 3FMGH 3ZTJG 1QA9B 5IVOA 2BRRH 3VFVA 1PGRB 4B9CA 3GMNB 4YNYA 2KT6A 3VU2A 2WQWA 5BQ7A 3RFZA 4R7VA 3DROA 4YNYB 2XIDA 4Y19D 2FX8L 4YHIB 3VGHA 3SKOA 5I5JA 7TAAA 2VMCA 3HRZB 3LEYH 3V6OA 1WA1X 3UTPE 2VQ1A 4A7QA 5TF0A 1T89C 1L6PA 2X4QA 2QBWA 4KAQH 3DTUB 4HUCA 4A7TA 5DMGD 5DK2B 2D4DA 3U9WA 3P11H 3AREB 4LDLB 5DFTA 4WWKB 1BQKA 2BNQB 3O6LL 4MAYD 1HINH 3NSYA 5AVQB 2VSKB 5GSRA 5J3HC 2O5NA 3UMNA 3T2PA 4ZPVB 5G2NA 4ENZA 3V6FB 4L05A 5JW4R 1DCEA 3FQ2A 3QXDB 2YPLB 3CFDB 3PNWB 3S5LG 5H37G 3H2WA 1VLXA 2JCCB 5DJYB 4YHLH 1N8ZA 2IV9A 4UTAL 5MENA 1NMCC 1PX3A 1MIEL 2DQDH 4Y4FD 1H6UA 2ERJB 4TVUA 3VXUE 1T5XB 1IGJB 2FQEA 1O75A 5CEZE 1A1OA 1T89A 4ZFZB 4UIMB 4ZW5A 3QIBD 5I1HH 4FYSA 3CPLB 1KGIA 1DJYA 3HS0C 4NUJA 3FCGA 4MZ2A 3UPCA 4EDWL 1NBYA 1LGVA 4YE0A 2FYYB 1ORQA 3EF7A 3BW9A 1JDAA 3P4MA 1BFVL 1G1CA 2RCSL 5CSBA 1WEJL 4JCLA 1NEPA 2H32H 4N2KA 1K6QH 1DHKA 4KKBD 2F08A 5DJ6A 1OCWH 1VFAB 4K4KA 4WHYH 2OYPA 4FMFA 2EYSB 4BK5A 2AABL 2DF3A 3ETBF 3EG9B 3G7TA 2P5ED 2EEXA 2DZEA 1QTYT 2XVKA 4KDTC 5J6SA 5I71C 1U42A 3BO8A 3A6OA 5KVFL 2A4EA 4Z0XB 5B1JC 2WO3B 3O0LA 4QEGA 3WIFA 1J1OH 3GIZL 2AMUA 2PCPB 3NOIA 3OPUA 2VM4A 5JHMA 3CLFH 3VXPB 3V4PA 1WK0A 2A77L 3WJLC 1QKZL 3MX0B 4FQQA 4F2FA 3HG1D 2IWGA 3CVCA 1ZXQA 3MBWB 4JPQA 4Y2DC 3QT2A 2YUVA 4DEWA 1ZSHA 2BNUB 3B2UD 1N19A 4FA8A 5IGXL 3ULSA 1KFAL 1ZHBA 4HWNA 3L3DB 1ZKAA 3C9NA 2P28B 5D1ZD 4FERA 4KMTL 1EJOH 3KAAA 3GSNH 4GSDL 5JIHA 3MLXH 3KLSA 3D08A 4PGJA 2N3JA 4JRWA 3QARA 5IJKA 1DDHB 1RZPA 3AROA 3FFCD 2Z91A 3GNML 5HVFB 4E5XA 2WXJA 4I3SH 1K85A 1ONQB 4WHTB 4MXWL 4J28A 3QEGL 1MCJA 2F58H 4PW4A 5KSUA 4GOSA 5FLUA 1I7RB 5AVTB 1BMZA 5AVUB 1YUHA 5FKPB 3GKWH 1IAIL 4JHBA 5MENE 5DR5H 2H1LM 1F6FB 5I18L 3X11A 5GGTL 2UY6A 5GGRA 3SGKC 2EDQA 2C1OA 5D1ZA 1IKOP 1RZJC 1D5ZB 4MNQA 4UAOC 3VYPA 5B38A 2BH0A 4NRXB 3FQ4A 3UTTA 4PRPB 1C7SA 3QJFA 3GMPA 1MFVA 3KGRA 3AQZA 4X7CC 1RUMH 4X8GA 1XCXA 1YNLH 2CGRL 1TPXB 3GIVA 1QLFB 1UJTA 2A6DB 3EYOA 2YS4A 4O2FA 3B9DA 3EHBD 2XA8H 4G2AA 1V8HA 4FHJA 2J6EH 4WO4B 1JGVH 3L1FA 3NZ8A 5FF6B 4ZW3A 4YE4H 1HINL 4JGJA 3W2DH 2KKQA 1U3HC 3INUH 1KXTA 3UBXI 1W9XA 4PHXA 1AQKL 3VDCA 4H88L 1AQMA 4DUWA 4I5BB 3FUJA 1KTKE 1TZHA 3BPOC 4LCWA 2VN5A 2DS4A 1QPPA 3CHPA 3DUSA 2Y5TB 4G1EB 5F9OH 2VQUA 2DQDL 2FIKB 1TZAA 4KQ3H 2Q1EA 5JPNA 2ZOLB 1QYGH 4LSUL 3B83A 2ICEC 4G8GA 3QWOB 2WNGA 1WT5A 4XWGL 3CC1A 4JN1H 4I3GA 1MW0A 4KV5E 1PZDA 1QNZL 2EYTB 2J12B 1X4ZA 4DH2A 3PWUA 3GKZA 1HJBC 1F86A 2WLNA 4IMKA 1L9RA 5E24E 3Q9PA 1Q94A 5F89B 5CGBA 3E7JA 1IVTA 1IQWH 3HB3B 3INUL 3MROA 1Z9MA 3CVHB 5D1XB 2FEDC 2KQMA 5ADOH 5DD5L 3W56A 4H25B 2J56A 2OSLA 5D4QA 3O8XA 4Q0XH 1AHWA 2QPDB 3V7AG 1Q72H 4YAQA 1W0WA 2WIIB 2X4TA 3SYOA 1DO5A 4X4YA 4W6WB 2VDMB 2Z92A 2YD3A 4JM2B 5I6OA 4PJ7F 5IMKA 2KZ1B 2IXQB 1F1AA 3ROLB 4WU7B 1NAMB 2HRPL 4KRPD 3EYUH 2RBLA 3T6XA 4FEIA 3DRTA 3LVEA 4P8QA 1KJ2L 3FRUB 5GRJH 3ZL1A 1O0VA 2F19H 3B37A 5FKAA 4OD3H 2K45A 3KEHA 1MLBA 3O8XC 4HKJB 1DVFD 3MRIA 3QEUA 1JZ7A 3L7FA 4MAUH 3L5WB 4OLYH 1HH6A 2OXHB 3W0WE 1O7VA 1I4FA 4L18A 1MFDH 3AADB 3CFQA 1ZHKB 1THCA 1JI2A 2NPLX 3KS0J 4P4KC 1E0OB 1I1FA 2CM5A 5A2IH 2DKSA 3CU7A 3LQAC 4N25A 3WS6C 1CLZH 1Z5YD 3E6HB 2B4CL 3CDGA 3OR7A 2HT2C 3QUZA 4HIHB 4Q58C 1XH0A 1MEXL 3HCVB 3DHJA 1E8ZA 1KNOB 3VQ1C 3D39D 4TSAH 4XNXL 1HEZA 3QQ4B 2HA1A 4X6CF 3DX7A 2D3VA 8FABA 1MY5A 4JG0H 1F6LL 2CPCA 1HI6A 4NQVB 3QIWC 4XMLH 4Z7VA 5E6UB 2UYLB 5DD6B 3L1EA 5ENWA 1OAUL 1J5HA 4FOMA 3MUJA 4K8RD 4UM9D 5GISH 4JO3H 2XA8L 2ZXCA 1M9WA 4I77L 3O3EB 1W2KT 1WCBA 1TJGH 3BPNC 1MFCL 4U3CA 5JIPA 2VN4A 4YR6A 2WSKA 1T04B 2GJ6B 4ODWA 3WHE1 4MNGB 2CUIA 1F56A 1GIGL 1IBYA 4GKLA 4HOMA 2IEPA 2PTVA 4UYQA 5TE6L 2E9WA 4YO0A 2UZIH 2EDKA 4FNPA 3UBFA 5KYXA 2NNRA 2FSDA 4HH8A 4Z7UE 2EICA 1L0QA 1NCUA 5GGQL 4AEIL 1HN1A 1VKXA 1O9ZA 2A6KA 3WIHH 2VZSA 4WW2A 4B27A 5AZ2H 3RIKA 3CD4A 2Z8RA 4U6YA 2ATKA 2NR6A 3BAWA 3UYPB 3GXNA 1KJ2B 2NCMA 3CFJA 2DICA 2GBUA 4LVOB 4JKPL 3Q1SH 1U2YA 4JFDA 3LY6A 4CBZA 3CZSA 4UWQB 3TBBA 3CX5J 4JM2F 3L17A 3C5JB 4MCYB 3VMPA 5KYYB 2F68X 3QFJB 4F7KA 3QJHB 3EJQA 5EU6E 5T3ZL 4YHYC 1VA9A 2OMYA 5F1NA 1UA3A 5IG7A 3W9EA 3DJZA 1MVFA 3ZK0A 4OGXL 4UMSA 3EFDH 2V33A 3QAQA 4ZYKB 1S7VA 4XNUH 3G3LA 5IVXA 4WI3A 2ICWI 1R3IL 3WO4B 4NLAA 1QR1A 4AW7A 2BS71 3O45B 1MSPA 1B9KA 1VPOH 5IIEA 1RMFL 1JP5A 1N5AB 3X12B 3CZEA 4OFYA 1D6VH 1EANA 1OOWA 2NZ9D 3G5VA 1B3JA 1FRGH 4KXZI 1KENL 1IE4A 2KDYA 4PJ8A 5EU7E 1C16B 1AXSB 4ICWA 4Y1AE 2BRRL 3H9SD 1EO5A 4RRPG 2JIXA 5G5DB 2R69H 3JVGA 1LNUA 3TF7C 5HYSA 1UQSA 1DLFL 3LZFL 3VFNB 3SQBA 4NRZA 1HESA 1NGQH 1GRWA 4NQUA 5CEXB 3UEZA 2A9ML 1NFDA 3KHOA 2V2TA 5I0ZA 4AMWA 4JM2C 1N68A 4E42A 3CG8A 2BSRA 2V0AA 3QR1A 2ZIDA 2WWMC 4G9DB 4HW6A 4PRBA 3VGFA 3JUZA 4RESB 5HGDA 1I9EA 4BSVB 7PCYA 1RULL 3D3VE 5SWSB 3UDWC 4FYQA 3WD5H 4FXGA 4M6NL 4ABQA 4Z1PA 1H19A 1BYPA 2VZVA 4KKAD 4ODHH 5I6MA 2E6QA 2K3HA 3QHFH 2VUKA 1TCRB 1ZV5A 2A6JB 2X44D 3AITA 3ASNB 4LDEB 4R7LA 4UUJB 1NFIA 5KOMC 4LSVH 1KYFA 2M8XA 2Z34A 4IBYA 3L4YA 3HMXA 1JPST 2DMCA 6FABH 1RHFA 2CLVA 2G5RA 4A6YH 1E3XA 1AVAA 2WC7A 5IHWA 4DO4A 1MNUH 3KPRE 3VA6A 2APTA 2E75C 3D2UB 5I19H 1A0QL 2QQKL 1EZSA 2B0SH 4HPYL 3ARYA 1F8TH 3OKEB 3UDWA 1GL4B 4H8WL 1XF5A 3UYRL 5BNXD 2A0LD 4XVJL 4Q9BA 2OMVB 4OUUB 5I0YA 2VO8A 3NIDE 4B95C 1ZSDB 3L4CA 2HTLD 2WN2A 2Q2LA 5E95B 1CE6A 4LSSL 3AMLA 4Z78A 3GHBL 5K5YA 3PGFH 4L9LC 2K4WA 4CW1A 2F54D 4YSCA 3EUDA 3NZSA 3OLDA 2VDKL 4RSVA 2C9PA 2HG0A 2KLRA 5BUAA 4NXKA 1XTMA 4JFTA 1E50A 3L3OA 5IESL 3APFA 1KDJA 4M48H 1FSKC 4UT6L 5CZVL 3S3PA 5DRXB 1U8JA 5KBPA 2A99A 4NQEB 1QRKA 4WW1A 3B6SA 5CP7A 5TQ0L 1ZANH 2Q3XA 1ID2A 5CBAA 5IFAH 4ODUA 3D0AA 5AD0B 2CLVB 4XGZA 4UT9H 3HI6L 4DW2L 2VR5A 4IIZA 3NP4A 5DZOA 4E9YA 1J5OH 1IM9B 1K8DA 2NX5E 3OLIA 1BAFL 5HXMA 1EZVY 2IFFL 3WHXB 5DJZB 1FL5A 3V0WL 4BE5A 3IU3A 5CEYB 4ZPTA 2C9XA 5DC2A 2HT4D 1RK0A 2XG4B 3N5AA 5D9SA 1VENA 4UDTA 2CAKA 3QEQE 5CZRA 1TNMA 5AOLA 3ZT6A 5LDSA 3LYRA 4J3BA 3B2UC 1W72A 1G7JA 4TNFA 4N0UE 4WK2B 1CZ8H 4HZ1A 1J48A 1P84K 4UILH 4GKOA 4WUUD 4FULA 3MU3A 1GC1L 2V2TB 4L4VB 2BVOA 4LNRA 4HGWB 2H2PC 1N5YL 2N01B 2ZKWA 3CH1A 4M7ZC 1ZA3B 1LO5A 4ZS6C 1KGJA 3IXAB 4TUKH 3SGDH 5DJ8B 2YAQA 3CTTA 5FV1L 5MEOA 1MREL 1HAWA 1CT8B 3KPRA 4JE0A 3RFRA 5HGGS 5C9JB 1MJ7L 2R0WL 4PRHD 4CSZA 4C57C 3FO9B 2CO3A 4PRDB 1NFDF 4XP1H 4H8UA 2I9LB 5EBWB 2E56A 1EHLL 3ABMB 2BZDA 4HUWB 2WBKA 3Q8AA 4N0YH 1AOZA 4PRNA 3HS8A 1R5IB 1EFXD 4WNSA 5E9DE 4H20H 5FYLL 4YFLI 3SDAB 1YQVL 1UT1A 3OWRA 2BVPB 3W57A 3JV4B 3IKCB 3S3BB 5KSBB 2QSCL 1E4XI 1QSFB 4NZTL 1JRHH 1YEHL 2RIKA 2QKIC 1YO4A 3W9EB 1OTUD 4KKQA 3RG1C 4X5XB 1EJ6A 3ZRFC 4DVBA 2BOLA 1YPZA 4N90D 4OZHF 4W68A 5A2LH 1JAEA 1LO2L 4AOFA 1J8KA 4X7SL 4QTFA 2K70A 2P5WB 1HKFA 3D69A 3B2VH 1O6TA 2EIEA 3IETB 2HG5A 3GUFA 3QRGL 3CDGB 3OR7B 3WEAA 2FHCA 4I77H 1CQKA 2VLKE 2UZPA 1FIEA 2O6FA 4RAVB 5BO1H 4YUEL 1FF5A 4D2NA 2Y72A 3DUHA 3SE3C 3D85B 4PJHA 3SDCA 5KZCD 2VJ8A 3KPQB 3QCTH 1NANH 4JDVB 2ZCHL 1INDL 4PLKD 1LLAA 3A23A 2VDOH 4H5SB 2BOCA 1CXHA 1FG9C 5IJBC 1WBZB 3RGVB 1FAKT 3JWDL 1WFMA 1UA6H 5INDB 1BD2A 5IHUH 3HOGA 5F1OB 4FQCH 1JV2A 3FFCB 4D8OA 2BNQD 4MAYB 4ANUA 2GSIB 4EVNB 3WTUA 1T03L 3G5VB 3RZCC 2JJTA 5T1MB 2VW7A 5T5FH 1ZGLM 1A6WH 2JVUA 1P9MC 2P4AB 3MA9L 4AENA 5KSVB 1KTLB 1X9RA 5IVXB 1MCDA 1FDLH 4POYA 1LP9F 4OJAA 2VLRB 3SDYH 4UNIA 4JUSA 1A3LL 4KKCC 5DYOB 5IY5B 3DO7A 3BGMB 4JY5L 5E9NA 1BVKB 1HCVA 5KYNA 4OKVB 1A4JB 1PPIA 4Y16D 1CFVH 4R4BB 3IFOB 4EIGB 3BVTA 4ALAL 5C09A 4CVZA 1HHIB 3UC0L 1R75A 3UJTL 2EEBA 4AQEA 3O9WC 1ADQH 3FQTB 1RZGA 4AEHH 1GIGH 5LAXA 2XG5B 1K4DB 4H0GA 1FBIH 4I0PD 3P1VA 2C9VA 3FOLA 4PCTA 2O5XL 4R96B 1B0GA 4HK0B 1PJWA 4PY7A 2MCPH 2VIRA 1GYVA 3KPLB 1MWOA 4P2QE 3H9SB 3U7WH 4F8OA 5IB3B 5J57B 43C9A 2F5BH 4PJ9A 3FTGA 5C70A 3F7RA 2HX9A 5A40E 5B38G 2BJMH 4P5TB 2WTOA 4D9QE 5DQJA 5IF0A 3ECWA 4WSJA 1EFQA 3OB8A 5L7XH 5LWYL 1S3KH 3AG2B 5FECA 3P9MA 3OSKA 12E8L 2HN7B 4JHAL 3LIZA 4LCWE 4DP7X 4MNGE 5C2BH 3KS0H 1T04A 1MFMA 3P0VL 4X8XA 5FM8A 1CFQB 2CM6A 2IOIA 4ZTPL 1NUFA 3I9GH 1VGEL 4NBYB 4L8SB 1YNKH 3D48R 3HS0B 2O6PA 4G5AA 4NO5A 4EBQH 4RAUA 2C1PA 2I5YH 3DPBB 5ICUA 4BDVA 5BS0B 4LVHC 2QQLH 1FG2A 1WAPA 2QVIA 4ISVB 1FQ9C 2BMKA 4OQTL 2ICWA 4X5RA 4KPHL 3IDGA 1H3VA 1Y0LB 3TVMD 3MCYA 1A7QL 3D05A 2FJGA 4EJ1C 1UASA 5CR8A 3GXUB 1ANUA 1IAOA 5ILTL 2F0CA 5I8KH 3F7LA 1A1MA 3MO1B 5D8JH 4Z95L 3DXAD 1JZ3A 1J12A 1X5LA 3E6HA 3IS1X 1J10A 3KHQA 3PWUB 4L4VA 5I8EA 4FQXD 1EV2E 3UGUA 3EDDA 1AD9B 4MXQC 3U4KA 3TT3H 1SJHB 1JNNH 4Q6IB 4EF3A 2WXKA 4KTEH 1E9OA 2BY0A 3C60C 4QGTA 2FIKA 3SBPA 4ZOEA 4Z0BL 4UDTB 5FO7A 1GHFH 3PHQA 3QXUA 4DFIA 3NJIA 5GJSL 4HU8A 1DDHA 4YEEA 4GRLA 1F5WA 4HKJA 5F7MC 4ZAKC 2WLYA 3S9DB 4R4FL 4YH6A 4IJ3B 3V0JA 1A8ZA 2TRHA 3HAEA 1TIUA 3QSKB 1SN0A 4G6MH 1IGML 1LP9B 2MCG1 5JA8B 1DDTA 5I76B 1BLNA 1M7IB 1IILE 3GSOA 4UOJA 5E9DB 1U92A 1KLFB 3VXUB 3CQQA 4W9KC 5C0AE 2XBDA 2Y2YA 2C7FA 3HHSA 4O4YL 3L48A 1KIQA 3V6BR 2ITDB 4JN1L 2WLMA 5CLZA 4XMUA 4B9IA 5EF0A 4PRPA 5D7KE 4Y4HD 4LBEB 4N6RB 1XSOA 4KUCD 4ZUVB 3BVNA 3P2DA 2C1OB 4XN8A 2X1XR 3PCYA 2Z4QB 1HYSC 3NSDA 3O6ML 3PIQB 1RPUA 5F7AA 1BEXA 3SQOL 4OUUA 2R1YB 3ZL4L 3QJXA 4IKNA 2QPUA 1QBML 5F7DA 5IFJB 2FLRT 1RIUL 3FXIC 4OZHE 1JZGA 1Q9KA 2C7UB 4YXLL 5GJSH 3DTXB 4HJSA 5I17B 3M8OH 4HHGA 1N64L 4NT6A 3ABGA 4A2EA 5J3HD 2Y3NA 4LF3B 1JHLH 1NUNB 1O6SA 5IM7B 5DC0A 2QPSA 1JNNL 1LTXA 5JQHC 4NP4L 2OSYA 5TF1H 4N3TA 4FMVA 4WEUD 4PJBF 2VABB 2XICA 1FI8C 3L3IB 3UJTH 5EU3B 4RLDA 3FQUB 3MOQA 1U6AL 2A1WH 3IEAA 5CEZH 1ETZA 5CJXC 3L9RA 3RVXC 1R9FA 1Y07A 1ZWIA 4HKBA 4K3EH 4X2UA 4H8QA 3M1BB 4PG2A 1U21A 4P2RA 2ENYA 4L4VE 1SVCP 5BPPA 1HU8A 3LRSB 4EPSA 1MCWM 4ACTA 5AW7B 5EZLB 1OGAE 1U36A 4P2YA 2YD9A 4OQTH 1NFDB 3QJFB 4LEBA 5DVLA 3V5KA 2VQ1B 3ATDA 4L3EB 2WV3A 4NFBA 3NCWA 1EMTH 4NRXA 4BHUI 4XPTH 4CVWA 3RWHA 3F7YA 5HPMB 3LKQB 1NCBL 4M6OL 3TWCH 4C83B 3L81A 5DF0A 1FH5L 1KF9B 1WFNA 3JWNH 2JLLA 4K7FB 4O4YH 3CSPA 3GI9H 2A7BA 5FKPA 4DP9X 1VZGA 4GI6A 3B8YA 2P5EE 3TO4B 3O6LH 2XU9A 2VR4A 1IQWL 5ID1A 2ZSVB 4XVUD 5L8JB 1UG9A 2IQAB 1YYLH 4YSDA 4IRJB 2J6EA 2IGFH 3TJPA 5IEKA 2ADJA 2YXWA 3EZJB 4TNVK 3SODB 3G5ZA 4RX4D 3HW7A 3OC5A 3O6MH 3NCYP 3N40P 4B9JA 4HPOL 5DMIH 1NCIA 3CZFA 3LH2H 5KANG 1ZLUK 5EN2B 3ZDZF 1TQBB 2ATPB 3HE7A 4XX5A 1VGKB 3EJYC 2BWDA 4KRNA 3BMWA 4D0CB 2BOBA 2OMWB 4ERSH 3K5SA 5AW1B 5E08H 4M29A 4BKSC 4ZMWA 3MZGB 2XZCL 4MXQD 5CLWA 1YEJL 5HHNA 3TIEB 1LQBC 4B7LA 3QA3A 3DRQB 3MRLA 4G9FA 3VI4F 3CDZA 4MTMA 3WNNA 3UG4A 4DO6A 4HWUA 1TSHA 5I8KL 1SVBA 1T7WA 4S1RH 5GRVK 1NAML 2W95A 5CUSH 2IC2A 4ZAKB 4ALAC 2GT9B 1MI5A 4R0LC 1UADC 2HLFC 4QKXB 5CFAA 1WBYA 3V8OA 1HAUA 4I0CC 4BZ2A 5D5MF 4TRPH 1LQSR 1WWWX 4QCIA 3TVMA 5HHVL 2XWJA 3ESNA 4F57L 1HTYA 1LK3L 3ZYIA 4YSSA 3BXNA 3AXLB 3H9HB 3QI9D 4H1LG 4JPWH 4ODWB 5KJRL 1N7MH 4MHHI 3RWGA 4ZFOL 2W5PA 3CH8A 3RY6A 1NBYB 3EJZD 4Q97A 3ROOA 1C9SA 5ACMA 4OIAA 4XB8A 2WINB 5BVJB 2ESVA 1WH0A 1TUPA 2A6IA 4J1UA 2VAJA 5T1JA 4NEHB 2VABA 3GKWL 4OFQA 1RURL 4IOSA 1FLRH 3T3PF 2E6PA 1EBAA 1D5XA 1SNRA 4UILL 1MHPH 5M7QA 2PN5A 4PJHF 4PJGE 4AH2B 2FGWH 2JJWA 3LTVA 4Z7VF 3EGDA 4FLRA 5K33A 4JJ5A 4JFSA 3KPOB 1YMHA 3J07A 4QGYA 1HH9B 3ZO9A 4OD2A 4YXKH 5GSRB 4YHZH 1D5BB 4U0RC 4TLKA 3KL5A 4APXB 3NQIA 4MA7L 5EZPA 5B8CA 1NCWH 3B9KD 1JF1A 4TS6A 3FTXA 3EJRA 3LS4L 5DJCB 4WI7A 3F65A 2HLAA 4KVCH 3MFGB 4PP1D 4PJXA 3V7MA 1F3RB 5KG9A 1UM6H 1I4FB 1ZVSB 3QIUD 5JXAL 4YC2B 2XPYA 4QRBA 3PIQA 4N4YB 3DV6A 3WFEH 2EUZA 5I6NA 3EJJX 2VYRE 1RUQH 1RJYB 1MVUB 2JJVA 4G6FD 3VJ6B 4P3WA 4ESKA 4JO2L 3WI9A 4NENA 4FA7B 1MJ7H 1L9MA 5CFHA 1KCVH 2R2EA 1G5GA 3A67H 3HPLA 1XEDA 1WIUA 4FKKA 1FFNB 1BM7A 3BAEH 3FF7A 3FAXA 1SYSB 4LSSH 4R26L 1CL7I 4UV4H 1JFQH 1YA5A 1JTTA 1XF3A 2VDOL 2GJZA 4X99A 2RACA 4LSQH 2EE6A 5JHBA 4J3OC 1IM3B 1NGYB 2AAAA 3DK2A 4OIIH 3SQRA 3RBGA 1HHHB 3HZYB 4MQSB 3DUUB 4PCSA 3UXFA 4MBRA 2NY1B 5KG9B 1GOHA 1CDBA 4LDCA 3VXUD 1KFGA 4NQXB 5DJDB 1AKJB 4QRRB 1SJXA 4ZZFA 1YN7A 3GMQB 1TT6A 1AO7D 4G11A 4OLXL 3G9VA 4N2FA 5H35A 1BMWA 1JYVA 2UWEE 2EDWA 4WWOA 2APFA 1AZUA 3IGUA 3B7RL 4S1RL 5IBLC 3FQXB 3T4AC 2MKWA 3COOA 2WNXA 5E1HB 5D7IE 1S7RA 2CHDA 4OF8A 4GO8A 2EEDA 1ZLVH 1J0JA 4IBVA 4Q9QH 1C5DB 3ECUA 3ASOB 2BMKB 2RHEA 4G72B 1M1SA 3SZ6A 3DURA 4I1NB 5BRZB 1ZLSH 4P9HC 4IOIA 3NPZB 2OJ1A 2N0MA 3SD5A 2B3IA 3R06B 4G9FE 2XUWA 4XPTL 3S4SA 5CZXD 4KJPC 2WLKA 5EDSA 2H32A 4HP5A 4X8JB 1FWXA 3OPZH 4JZOB 1FHNA 3CXFA 2R2CA 5LCVH 2V5SA 5BV7H 1KENH 3UTTB 5I1EL 4QTIL 3TEUA 3D9AH 3FT2B 2CBQA 5HTSA 4R83A 1SQMA 5GRYA 3L3OC 5EIVA 5J1TC 2WZPD 4MJIE 4K8RL 2IOMA 1DBAH 4R26H 4UV4L 4PJXB 4KKNA 1FSKB 1TJIH 1YDPA 3GSRA 1K3IA 4QYOA 3SEPA 4K94L 1P4LA 1YG9A 4AGMA 3F00A 3W11C 1L5GA 4UANA 3EFFB 2EH7H 2ZWZA 3LN5A 1L9OA 3OXRB 4M6NH 4WI0B 3BH8B 4WI9A 5EIIB 1MPAL 4XMPH 4D3CH 2LFEA 4FZ8L 2BW5A 1GH7A 1P84J 3FW6A 2GJZB 4X99B 4E9VA 1T80A 4M7JL 4PVMA 3HC0B 4QRUB 5DK0A 4MMXA 3HMWH 4R8WL 3LKSB 4CGTA 1IC4H 3JYBA 5I1JL 3HTLX 4QXTB 1GGIL 3TBVA 1F58L 3MMEB 1T2XA 4E2OA 3MRFB 4OGZA 3WE6B 2HVJA 1I8MA 3KYOA 1O9VA 4RGOL 5E4IA 1FNGB 4HOXA 3RIFF 3WIFB 2AEPH 1QBAA 2HH0H 4D9LH 1G7MB 1PNDA 4B60A 5CD3B 2GTZB 4XNBA 5C6TH 1HE8A 5INDA 1JYNA 4H2AA 4NNPL 2VLRD 2IGLA 3RZCA 1RZIB 1ZVSA 2EYSA 4XPAH 3TVMB 5JMOC 3RWHB 5HPMA 1UTDA 3O9WB 1XF1A 3UTOA 2GT9A 1BBDL 3KGSA 4L4JA 1JDCA 5J12C 1KPUB 1OGAB 2HT4C 3QC5X 4FQLL 3MFFA 5IUSA 1HL5A 2FEEL 2OR9L 3WTXA 2XQ0A 3DMMD 5K39B 4R4NC 1RY7B 5EU7C 5HHNB 4G7RB 2R69A 1IFRA 1EHAA 4AMXA 4DN3H 3PP3H 4PY8I 1XGYH 3RGVD 4LHUA 5ALCH 3CU1A 3RJDA 2VW6A 2WNWA 2FJFB 4FXLA 2NOYA 4JRXA 4K23H 5D4HA 1G7QA 3QUGA 4HWBA 3FUHA 3ZHDA 3PYCA 3GB7B 3D4GA 2AV1B 4GUQA 2VSMB 3HNVH 4Z18A 4EXKA 4Y5XA 1A3RL 2XETA 4PJ9C 4ZPVA 3VB8A 4ZQKB 1KCRH 5TE7H 1CWVA 5IQOA 4GSUA 2F7QA 2VLME 3L3JA 5D6DA 3GHPA 2EXWC 2V3DA 4JW3A 2EDXA 1PKQE 1XL6A 3HNSH 5K93A 4P3CL 1A7PL 1A7QH 2A3TA 2DBJA 1P5VB 5J6HA 3ETSA 4PWJA 2BFGA 3DXAE 3GBLA 4B5ZA 4FI8A 4R2GB 3SKMB 3BP7B 5E51A 4MKTA 4XBMA 5F6IB 3QZNA 3RVXD 3ZDYF 3HLAB 4OZHA 4URKA 1SVZA 1WIPA 4XT1C 1RVFH 2WUCL 1P1ZB 3GLAA 5D7EA 1F90L 2UXVA 4OLUH 3DGGA 3LKNA 2IBGA 4C56E 2QQNL 2OYMA 2EECA 5FA3A 5I66A 1B0IA 3MLSH 4WJKB 5I73B 3GMRA 3MRKA 4AYBA 3BUIA 1CICA 4MCMA 1I1YB 1E6OH 3OJ2C 4L3CA 2K0RA 2ZG1A 3FQWB 3O81A 3TNMB 5JORB 1A7NH 5C07B 3ULUE 2OMWA 1G7JB 3TIDA 1KC5L 3MGTA 3OC8A 3SQOH 3QEGH 2AK4D 1GKOA 2NW3B 3EO0A 3FUDA 3RB5A 5EMYA 5CLXA 3HE7B 4GKZB 1AE6L 3T0BA 2X1WL 3U6XA 2NXZB 3QUYD 3RWFB 4XRCB 35C8H 2X0WA 3EGSB 4O51A 3DX1A 2BY1A 5B1JA 2W80C 3LZRA 4FTVA 5AOJA 1WBXA 5DJ0B 1RJLA 3C8HA 3SGEH 3V0DA 1A7OL 3V0AC 1MCIA 2H0JA 3FYIB 3HS9A 5EF1A 3KLKA 2RCSH 2E46A 1QUNB 4FKHA 5EA0H 1LEGB 1BZ9B 1E3FA 4AUJA 1AD0A 4EQ2A 1RJZA 2AK4B 2BHZA 4JY5H 1CGUA 3B43A 3D0LB 4NM8L 3X3GL 4NUMA 5GRWA 2FEJA 3VE0B 1Z3GL 3PJNA 3TH2T 3VI4B 2R1YA 3AJ7A 3CVDA 5CD5D 2HKAA 3HPJB 4OFPA 2V7NB 3UROR 1BVLA 1WTLA 3CFTA 4L29A 1HSAB 1XGTA 2XTJB 1RIHL 1V5JA 3M86A 1T6BX 1WTGT 4HFUL 3C5SB 1UENA 2WMPA 1WRFA 4LBEA 4PUBL 5T3ZD 1NGPL 1R3HB 4WUKL 4GG6A 2DW5A 4Q2ZB 4O58H 3NN8A 5KVEE 2HJFB 3EH4B 4HG4J 3RNKA 1BOYA 3Q3GA 1KLFA 2BP8B 4FFYH 2ZG2A 2H6UA 4UTCA 4NO0B 5KOVC 4TSAL 4M4RB 4XNXH 1HKLL 2NTFB 2ETWA 1G9ML 1L6XA 2X6CA 4XMTA 5JOFA 3TA3B 2F58L 1MHEB 3ARRA 1WAEA 3BAKA 5F72S 3VXMD 4HV8B 2J4WH 3L08A 4E9WA 5DEFB 1XCQB 2FX9L 3DTXA 5I17A 3FTGB 4FABL 5IB1B 4OZIB 2P1YA 3D25B 4B0MM 2IWKA 2R1XB 4YXHH 3H9SA 1IC0A 2HJLB 3U4BL 3DIVA 1M2OA 2MNWA 1S7SA 4UT7L 4HX1B 4P49A 4YDZA 4KOBA 2GABA 2YZ1A 3MN8A 5HI3D 3IJYA 2FBJL 2EDLA 5DEZA 3QH3B 4H88H 5IR1B 1HEHC 3BQUC 2DWYA 4LLDB 5EG6C 3WFZA 5DZVA 2C4FT 2K6YA 4A67A 3F6JA 2H45A 4LCVA 3AC0A 1BOGB 3MJGX 5BXFA 3MA7B 1U0QA 4QLWA 1TKWA 2YK1H 2HKHH 3FH5A 4N8CH 4A7GF 4AYID 3RDTB 4QXWA 3F12A 1ERNA 2IG2H 2BJML 1BZQK 3PWLA 3GIZH 2CMRH 3V95A 4G8GE 2WLIA 4RFEB 4XWOD 1PG7W 1CYXA 2VLRA 2RB8A 1KIQB 4AKPA 1WGVA 3BJLA 4NHUB 3RTQA 1GTNA 4Y4KC 2QV2A 5EEZA 1Y6MR 4EI5C 4BJLA 3MV8B 3ZE2E 1T3FB 3UOAB 5FA4B 2W60B 4JLRB 4WI6A 3CXDL 5AAMC 2C9RA 4GAJH 3KLQA 4DSYA 3AB0C 3UBXB 3TCLB 4PD4J 3UC0H 4ONGL 1DE4A 3F5WA 5EOQL 1PYWA 2AS5M 2GITA 3G04A 3SYCA 3C60D 5HD8C 1T0MB 3OG6B 3C5XA 4QYAA 3CLWA 2EH8L 1X5MA 4U6HB 2EO7A 1OAXH 4JFUA 4F8NA 5J8OA 2OMYB 4ZS7H 2BSSB 4ZFGL 4EEEA 3MCG1 5IF0B 3MXWH 5JPMC 4AQ1B 5I1HL 4J4PD 2X9XA 2Q2EB 5IB5A 3GC3A 2BIMA 1JNLL 3P4NA 4IS6B 4D7PA 4FADA 1AGEB 2CDEA 3Q6FA 3IDIA 4LCIH 3QYCA 3KZ8A 5ALCL 1MREH 5F3FA 4KI5F 2DQIH 4RETB 4NKDA 1H8LA 2AEQH 1KFAH 4HK0A 5JHLL 3MLZL 1NL0H 1UJ3B 2Y69B 4TULH 1SJMA 5HYJD 1QWNA 5JIMA 1S9WA 2YGPA 4GBXA 1L3NA 3LB6C 4C54A 3PWVB 1U4EA 4POUB 4B3VA 2B1HH 2P24A 3NPSC 4WGVB 5DHXB 5C0BD 3ZL4H 5CCKL 2ZCHH 4FJ6A 1J0KA 4DVBB 3OHXC 1MUJA 4OKVA 2J88H 4KU1A 1BD2E 1FNSH 5KVFH 6TAAA 1AZBA 1FZOB 1GZPB 2VDPB 1DVTA 2UZXA 3NIDF 4GUCA 2CLRB 4KKCD 3OM3B 2FO1A 4LKXB 1HWGB 4N90E 3DETC 3DVGA 3ZYJA 3HEIB 1IBBA 2I7OA 5MHSD 3GD1C 3FONB 1MUJB 4PQXA 4ATTA 5AW2B 4OCYL 4L1SA 4IYKA 5DJ8A 1A3LH 1NIDA 5MEOB 2L7QA 1UWXK 1TZIA 3GBDA 1LE9B 3IN0A 2DRUA 1EAPB 4UTBA 3MACL 4K71C 3HG0A 2YQ3A 3ZX1A 2PWFA 4Q9RH 4JKNA 4WO4C 1NKGA 3UZQB 1V3LA 5AAWC 5FYLH 3FRPG 1N3NB 2KH2B 4HPHA 1EERB 1U3HB 2CIIB 4XB3A 3F3HA 3H6JA 2FNBA 3FCTB 5HYQB 1DN0A 3L6FB 4XMKL 1R4XA 3FB6A 3QHFL 1KELL 5ESVB 2MQGA 4XNMA 5B1CA 5T1DH 4L1LA 2D7PA 1J0IA 3QWRA 3BGMA 3ZHNA 3EOYG 4YBQC 5AG8A 3CFCH 2N1TE 3Q5YA 4HBCL 3A22A 5C2BL 5ISZA 1A0QH 2QQKH 4BKLA 4C59B 3ABKB 3FONA 2LTQB 3ISWA 1H3PH 2H6PA 4JFXB 4M4RA 5L6YL 4GIAA 4AQAA 4XPHL 4IK6A 1AIZA 4IHOB 3K6OA 4OGYH 2ZZUT 1JK8A 5HGAA 4LESA 1R33A 4RISH 5B3SB 4WI5A 4LLMA 2HFTA 1FNEB 2YGQA 1AOHA 3RPBA 4B9KC 3VD4A 2X12A 4X6FB 4NQEE 4W93A 5E5MB 4WFGE 1BHGA 3EYFB 4LSTH 3RY6C 4XVUC 3UTZB 1RUKH 4Y0GA 2BOCB 4MB4A 5F6HI 4YN3A 5EBWA 4TOYH 3SOTA 5CJXA 4D9QD 2EIKB 3WS3A 2FWSA 3IRCA 2P24B 1A2YA 4PJHB 2E7DA 5DMJB 3PHOA 2R29A 3EYQD 1IAMA 3D0VB 1A1NB 4DWHA 2WY3B 4CMMB 3HNSL 4PJ5E 4Z7NB 4U6VH 1MXGA 5ETUA 1BVLB 2A77H 4RCAA 3QH3A 4AGLA 2XKNB 2DL9A 1MHCB 3EJYD 3LEVL 3N43F 2UZYB 3FU7B 4FXKA 2OYLA 1J0ZA 4CVXA 4Z3JA 5JW4N 3JT2A 3PNRB 4LHQB 2A9MH 4XI5D 3UTQA 2R2HA 1JL8A 3D3VA 3NJGA 4IEFB 3MA9H 1AGDB 3P54A 2FWOA 1TCMA 4JVUA 2H0FA 1UZ8B 2HX7A 1W72B 2P8MB 5KS9F 2ZX6A 3GT6A 4NQTA 2FK9A 1YEIH 3TA3A 1SLUA 2QT6A 3LKPA 1RJLB 3VH8A 5D7HA 2VNCA 3C2AH 5CGTA 1NC2A 4K7PH 2GTWA 3EOBB 4Z7UF 4LP4A 1I8AA 4F91B 1A4AA 2QLVB 2O93L 4NS0A 2BP8A 4XN7A 1DE4B 3F5WB 1H3XA 4LVNC 4M6ML 4O02L 3W37A 4N2LA 2PPEA 1MCNA 4C55A 4DK6A 5JIQA 4YSPA 1I9IL 1BJ1J 1ULVA 4Z3HA 1FLTX 5HGDB 3MCKA 4PJAA 2CA4A 1UJ3C 4L37B 5DDHB 5TE6H 4BBWA 3GIVB 2Q5BA 3DDGA 2N7BA 4FCAA 1Y18A 1I3GH 2Y2TA 4NN7B 2EDJA 4QHKI 1HSAA 1XGTB 4PRID 4ZFFA 5AW6B 2MIZA 1VB9A 3DPDA 3KXFD 1LO5B 2WW8A 5GZOD 3RJQB 1X5AA 1Y1DA 1QVOA 2CCLA 3FJTA 4FXGC 2BS9A 4JFOA 4DGUA 1YEKH 4MNQB 2YPKB 5B38B 4JL1A 5CD5C 2BPBA 1E5AA 2F53D 5G5DA 4F7TB 3DX6A 3GQFA 5F0JB 2FR4A 3JUYA 1JWUA 1XB6A 2NYYC 1OPGH 2WLJA 1XZ0B 3BCFA 4XPBL 4MCZA 4B7IA 2Q20A 1DVYA 3SE4A 4R0LA 5CHNA 3ARFC 3NYKA 1N5AA 5JA9A 5JYMA 2DYPA 4H8WC 2ZAGA 2PO6A 2X2UA 5HHQB 4XCCL 1DVQA 4ERSL 5DEFA 4LDOB 1QWHA 3QFDA 4LRIA 5F9JB 2MMXA 2CXGA 1F90H 2MCAA 1SYVB 1XCWA 4H26A 3AY2A 3SPJA 3T2QA 2P42B 5B39B 5F1NB 3PV7A 4NZFA 3ULSB 3N50A 3MREA 4LLVB 1TTCA 1F41A 1PG7X 4YZWA 5CBAB 2DQ6A 5CLYA 4QRPB 3RHWK 2FQFA 4PREB 5DUBB 4OF0A 1MLCA 1UXWB 2B9BA 3I6GA 4Y16A 4HJ1A 1W72L 3HB3D 3K2MC 4AKQA 3QUXC 2OJEA 3MLWL 4X6BB 3BOVA 3BZDA 1AR1B 4YHKL 3EFDL 2E7CA 3S36H 3K6IA 4UT9A 3EG9A 1NCBH 3AXIA 1PZ3A 2J71A 1KBGL 2JKIS 1X5GA 4ETQB 2VMDA 1BQUA 2WWKO 5F7EH 4J3OD 4JG1H 4UV7H 1TR7A 3FFOA 2DM7A 3SE9H 2R7EB 4P23D 1N67A 4LSRL 3WD5L 1PBYA 2K78A 1C1EH 2GTZA 3BVDB 3GDCA 4OCRH 2GJ6E 5BZZA 1NWPA 2R51A 2FTAA 3NIGE 2WD0A 4UZUA 3BN3B 3X1EA 4ZMTA 2J43A 2AJZB 3HR5A 2WP3T 3R19A 4ZUWB 3WGUB 1QBLL 4KQ0A 3IMRA 1I1AA 5BOJA 2EC9U 1NBCA 4FTVB 4NQVA 4OH2A 2AMGA 1NFIB 4N9OB 1VERA 3T6QC 1QAWA 5C08E 3V0VB 2G3ZA 1C5CL 4NQCD 4TQEH 4BFFA 1OSYA 1F4YH 2DJ4A 3IN2A 3LXAA 5C0ND 1E4WL 2DV6A 3V6FA 4LGRB 3BKYH 3VFSB 1PKQB 1KSRA 2BIPA 3QJHA 2VOTA 2ZXAA 3QDJA 1DTUA 3MOAL 5C86A 4IK7A 2OZ4A 1AC0A 1U8IA 1L5GB 1HOCB 3WY3A 5GJTL 1OTTD 3BT0A 4FXTA 3UZQA 1I1AD 2K1MA 2OMZA 4ZZKA 5DJ2B 1IKFL 3HMXL 4KNUA 5SWZE 5IB4B 2OZ4H 2Z31C 2GK2A 5F97E 1GZHC 4Y4KD 4YE4L 5EH1A 5D6DC 3GMLA 3GSNB 3MRIB 4UT6H 5CZVH 2YRZA 5E8NA 4A2DA 1NPJA 4K7PL 4ZK8A 4PJ8B 3QR0A 3HG1B 4LB8A 3JZ7A 4P9HL 4DP4X 3VFGL 3CSTA 3ABLB 5FHBH 3VSTA 2NLJA 1TYJA 3DVGB 3GHBH 4L8BA 4X80H 2L04A 5LDUA 2J8UE 4I3RH 2FZ3A 3EOAB 3BZ4B 1XV8A 5DVKA 4FLQA 1OHZA 5GGQH 1R6VA 2WTPA 3D09A 4AEIH 4ODVL 1JOIA 4JO1H 2EH8H 1F4XL 3W11D 1VDGA 4H44C 1PEWA 1KBKA 1H5BA 2Q8BL 2Y1AA 2YD8A 3Q8EA 5ESAB 4F9PC 5GGUB 2CJUH 2VZ3A 4B41A 4MCYA 2OV0A 4HAFA 2YEVB 1PZ5B 4CKQA 3T1FA 1IC5L 3DI3B 3CZJA 1S7RB 3PS6A 4OV6F 1JHTB 4Z7UA 3MRHB 2DMGA 4PEEA 3VFPA 5ACLA 3KYMB 2A73B 4K9EC 5DQ9A 4KTEL 4AIXA 5T33H 4HJGA 3KWTA 3AU1B 2XACC 4YPGB 3OF6A 3O9WD 2UUDH 1PX4A 5DMGC 1FUNA 5HYIA 3FL7A 2JJTC 3KR3L 4XHJC 4XCCH 4HWEH 2W0KA 3VRLE 1R46A 5D96B 2D73A 2BINA 1BVNT 3T4YB 1DN2A 1LL1A 3EKCA 4TL4A 2ADGB 5IBLD 1I9RL 1KIRA 4JZOA 2DYRB 1TZOA 3BIBX 2F54E 5ANME 1IT9H 1FVDB 2OMXA 3UABA 1I8LC 4NWTL 2VXQL 1DLFH 3LZFH 1FNGA 3UBXA 2CIKB 3Q5OA 1NJ9B 4IBSA 2AEIT 4DP6X 2BVTA 1I8MB 2YAHA 1KCUH 4XP4H 4PJXE 4BH8B 2UYLA 3OZ9L 3STLB 2FGWL 3MV8A 1NAMA 2F15A 1AZZC 1YNKL 1HI6B 3GK8H 1QYGL 4LSUH 1AR1C 2H47C 4KNQA 2ROXA 1BXXA 3REVB 4LP8A 4MMXB 1J9SA 2CUMA 4JFHD 3UGEA 2IH1A 3PFUA 2OZNA 1S78D 3K0YA 4N85A 3JTSA 4R2GC 2RQ8A 4IRSD 1E65A 1XD0A 4JPIB 4PLOB 4E9RA 4TQ8A 3F12B 1XF4A 4KJYB 4XCYB 2H8PB 4F7CA 1JCVA 3EADA 5IBUB 4C4BA 5KVMC 1OP9A 2H26B 2BSED 3BWAA 1DFXA 5F7UA 1MZYA 4FLOA 3EYUL 4GPVA 4X7DC 4FMKA 5MEQB 3GRWH 3ZZSA 3ZZLA 1A14H 4QYOB 1I7RA 2GC4C 4OI9A 1E4KA 5FCUL 4A63A 3ULUF 1YEEL 5MEQA 4KXCA 4MLSA 1MFBH 5CIPA 1X3DA 1UB5A 1Z9SB 3T0VA 4K5MA 4GUOA 1HHHA 4HXAH 1C08A 4JO3L 1KYAA 1J18A 2L8AA 1QSFE 2LV4A 1JPGB 2J3SA 2DIBA 1PSKH 2ZOLA 3MUY1 5GSVB 4TNEA 1VZIA 1LMIA 3FT2A 2YMOA 4N0CD 1L9NA 3CUPB 2VT0A 5KSAA 4LOFA 1IX2A 4CA4A 4L8CA 3NJKA 4LLAA 3KLHC 4APQA 2WJ5A 5E94B 1SOQA 4P4RA 3VFMA 4X6CB 2J8OA 2BVQA 3GF8A 5DURB 1NGXA 3TOPA 1CLYH 2ZE0A 3WLWC 4AITA 4K7PY 5TPWH 1W8NA 3HZKB 3V4PB 3BEVB 3FQNA 3KWWB 4QOKA 3VFUB 1IEBA 3WENA 4YHLL 5BVJA 3G5XA 1TVHA 1QLRB 2XWRA 2WXMA 1XTLA 3O8XB 1NDMA 3M6DA 2NNAB 3FT4A 1UWEL 2AXGA 2CKBH 3CFEA 1IAKA 4F33B 4LPTA 4TNWK 4ZS6D 2OL3H 5KSAD 2V7NA 4RGNB 4XMLL 5LBVA 1VFAA 5F2FA 4J3WA 4APQD 3UYOD 2NY3B 3KPSD 4JUTA 3G6JE 4TTDD 4E41B 2J1YA 2DLIA 12E8H 3BZEB 3Q48A 1XGUB 5C0AA 4XCEA 1ZXKA 3JV6B 3QEHB 3VXRA 1E42A 4JY6A 3LEYL 4KK6C 4GAAA 3QQXA 1I9JH 4P46B 2WLZA 2YSSB 4PRPE 1CGTA 3VD3A 3UMTA 1YN6B 4RDQG 3FSWA 2N7AA 4OZFH 3ARWA 3BUYB 3D06A 2CO6A 3TU6A 1CLZL 1ONQA 4WHTA 3FMGL 2F1AA 4K55A 3G6DL 4L4TB 1IU1A 1FBIL 2BY2A 4NN5C 5D7JC 5KS9E 4OZFA 4NZUL 2X3BA 3BKMH 1GOGA 1M3JA 2FSEB 1G4RA 4F2MA 3QI9C 5I1JH 4NC1C 5C08B 1AR2A 3HMWL 1A6TB 4N22A 1KB5H 4NQDE 3EOAA 1S9YA 4ODVH 4FE9A 4OZ4A 1P2CB 2NT0A 2IQAA 3RTQC 3ELAT 5D71L 3BXNB 3H9HA 2QL1A 2XWJB 1O7DE 4XNDA 5C7XH 3NCJL 3OXSB 4KK6D 4X4KA 4MZRA 1VACA 2B59A 1BZDA 5E6SB 1MI5B 1XQ4A 4K94H 3O6FC 3N85H 1TVBB 5J1AA 1V3JA 4JFEB 5CILH 3B9KA 3BDYL 3HLAA 4OZHB 1OP5K 2BP3A 2NY1C 2FLBT 4L3EE 4OLZL 4XZUB 3EF4A 3VFVB 1IBDA 5F9OL 5DTFB 3REWA 1U8KA 1DJXA 1IEHA 4M9PA 4FN0A 4G7VL 1MRDL 2HFGH 2F9BT 5C0JA 1BQRA 4LIQL 5ITFA 1NFKA 4OZGE 1EEZB 2HRHA 2Q87A 3NUKA 4KKBC 1D5BA 3EBIA 1Q38A 3I75B 5FLVA 4JFVA 1BV8A 2RQEA 3NG5A 4B6ZA 1ET5A 2JJSC 3NFPA 2YN3A 3KPOA 5FEBA 4U1HA 1A6TA 1G9MC 3LB6D 1U4FA 2W65B 2DTMH 4HXAL 3FQUA 4IGBC 1LO4H 5DHVA 1KG0B 2GBTA 3G6AA 5C0EA 2IADB 1Z2KA 2ADFL 5DHYA 2YBRA 3ARSA 5HHOD 5EF3A 1U8LB 3GZOA 1EH9A 1NDTA 1UKTA 1T7YA 3PLYA 3FQRA 3PUUA 3FN9A 5T1LA 3PAVA 1OEZW 5BVPH 3G5WA 4M93C 2IJ0C 1JD7A 1AO7E 2ESVB 1GVIA 1QSEE 5CCJA 2VDRH 1AQKH 2HTKC 2AKRB 3KH3A 2IH3A 3R4RA 3IJHB 3HJ0A 4QXGL 4U6XA 3MFFB 3DHUA 3UIYA 1KIUA 4N1EA 4F80A 2L3BA 4NZTH 5TH2B 3N43B 2R9HC 1S78C 4MQXD 5K9KA 2EINB 5EU4A 5FO9A 1XGUA 1M7UA 3ARBB 5AOIA 4LLUB 5B7EA 3T0DA 2VMEA 1YPZF 1NCAL 2DAVA 4OCXH 4PCYA 3G08B 4Y4FA 1BQ5A 1HL4A 4JFHE 1UWGH 4BQ9A 5IZ7A 1QFPA 9CGTA 1MHHA 2FYYA 3UZEC 1PFCA 4U6XB 4YHPB 2AHIA 5D71H 2N7SA 1VGEH 2MKLC 4Z7OF 1YEDB 3K6NA 2GYSA 1NLDH 3OGOE 4GG8A 4OGQC 5CU5A 2BSEA 5I30H 2D3JA 4ELME 5GRUH 4M8QB 5L4FA 1HC1A 2CCVA 2YXVA 3BAJA 3BEVA 4JGUA 4TUOB 1UWFA 4XP9H 3TBVB 5T1LB 1T5XA 4PJDE 4IDJH 1XAUA 2FO4B 4L8CB 1BLNB 2P52A 5IM7A 2WBJC 1S5IL 1L9SA 1ID5I 1UOWA 3DECA 3GJFA 3LXCA 1NUGA 2D7QA 4MNQD 4KY2A 35C8L 1Q0EA 2B9AA 4JMXA 3U2SA 1T21A 3HG4A 3UAFA 4HS8L 2VXQH 4P2AA 3RPKA 5DK2A 1DL7L 2C9UA 1DFBL 5ID1B 1CXEA 4XWOC 1DQDH 1KGXA 3IDNB 3F7KA 2DPKA 3T0AA 3QPQD 1S3KL 2R1WA 5JW5A 1QZNA 1SDDB 4UM8A 1NCJA 5I0WA 1YECL 3C6LD 3K2UL 3SDDB 1TYRA 3B9KB 1R24A 5JW4Q 3C75A 4OF5A 3U9PH 4ZUVA 3R0MA 4BWTA 3IJ9A 1U58B 2KPNA 4YFLF 3B2XA 4K94C 4UBDC 5TGBB 3RTLA 2JB5L 3BSZL 3CN1A 3WN6A 5F44A 4MB1A 1Y18B 4HJIA 4RRPA 5DA0B 2LFGA 1KCWA 3NDZE 4QJ5B 1A14L 5H94B 2YKLH 4NQDA 1TVHB 3RU8H 1HWHB 1M6OB 3FT9A 2EIDA 2VC2B 3CHQA 3F6IA 2VLRE 2OZ4L 5AYTA 2BVQB 5AYUH 2NSQA 5E1AB 2BFVL 3RA7H 3E3QE 4QHUA 5CNHA 4DVRH 1CDGA 3NSCA 3O11A 4WV1C 2HN7A 2EDEA 4KDWA 4PG9B 3TEZA 1IVLA 4LLQB 2OW7A 1EK3A 3RI5F 3U2IA 3KPPA 1N2RB 3RY4A 1UZ8A 2F61A 4P5TA 3GPEA 2FWOB 2TAAA 2YRBA 4KZEL 3SY0A 1BX2B 2XFGB 1Z9SA 4LLYA 4X4ZA 3CE1A 3K6SA 2W94A 4N5EC 1RK1B 3CFKA 4NYLB 4UQIM 3NEXA 3QZPA 1K2DA 1SEBB 4IU3B 5DS8A 4TL5A 5E70A 3OVUB 1BYOA 1YQ2A 2XG5A 1MFEL 3MR9B 3MRBB 2EDHA 1HNGA 3MRMA 1MAMH 1FO0L 4FL4B 4OF3A 2D03L 1A4JA 2GI7A 1CK0L 5E6ID 4I88A 4MJ4A 4XBPB 3UTZA 3FZUC 4R5XA 2XXCB 1KN2L 1CC3A 4FFZL 1BJMA 4U2YA 2VGLM 4KO7A 2V5RA 3HFMH 3SBRA 1KJMA 1KTLA 3WNJA 3TEWA 4Z76B 5AVVB 4X6DE 1GW6A 2AEOA 5AKTA 4U1KB 4P57A 4KY1L 4YOKA 4JRYE 1I8UA 5CM1A 3HAEB 4BKLB 1Y7VA 3ARED 4DQOL 3NVQA 3PGCB 4KK5C 1MCPL 4N0UB 3UO8B 2F18A 3VXOB 4FG2A 4KKRA 1YJDC 2D3LA 1GY1A 5CIPB 4PJFB 3C08L 5JTWA 4HCFA 1YEGH 2HKFL 1B0GB 5E9DD 1M05A 3JWOH 1QX1A 4LPCA 4PS8A 2ZOTA 4UU9A 4ZOBA 2BP0A 5GGVY 3QDGA 3OWEA 2FJSA 4NJAH 4FCHA 4ADJA 4S1QH 1G9NH 1MWAH 2DH2A 4BGLA 1CD8A 3GSVB 1ZLVK 4OZI<