4DP2X

The 1.8 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp2X00
3DIVA 1KDJA 2FT6A 2IDUA 3EF4A 2ZONA 3D12B 2E86A 2IDQA 4E9XA 2IAAC 2VM4A 2GC4C 5B7MA 3ABKB 1NPJA 1TU2A 2XV0A 1W6LA 4JHUA 4M3HA 1HAUA 3U25A 5B1KA 1R1CA 4DPAX 4GXFA 4HIPA 1W6WA 1NIAA 2Q5BA 3WI9A 1A4BA 4YSQA 3T71A 4ENZA 1PNDA 4P5RA 3ERXA 2A3TA 1IBZA 1XB3A 1KBVA 4YSCA 3FSAA 1ZIAA 3PAZA 5I26A 4E9RA 3PLYA 4HCIA 4YSOA 1ILUA 1N68A 2YARA 2J55A 2J56A 2TSAA 3ABMB 3UACA 8PAZA 1SJMA 1L9RA 2YAQA 2IWEA 4A2DA 3S8FB 2IWFA 1KCWA 5AZUA 1KYAA 2FNWA 5I5IA 1AR1B 4BWTA 4BWUA 1JOIA 1WA1X 2HXAA 3ZDWA 3WG7B 2XV3A 1JZIA 3QJSB 3FSWA 2CAKA 4YSTA 1ASOA 3OMAB 6PAZA 3EH4B 3X2QB 1GS6X 4FA7B 4P5SA 2AZUA 3CVDA 4E9WA 3NSCA 2EIMB 4KO7A 4YL4A 2B3IA 2BP8B 1IUZA 1OF0A 3SQRA 2DYSB 1E5ZA 2WO2B 5D4IA 4G72B 1X9RA 2RACA 2PPAA 1A4CA 2YAOA 2VMJA 3PPSA 3UADA 4YSSA 4EF3A 1QLEB 1AG6A 1BYPA 2X87A 2BZ7A 4A2FA 1CYWA 3FYIB 1MZZA 2GHZA 3DTUB 1XMEB 2H5UA 2YXVA 4YSRA 1DZ0A 1EZLA 2MTAA 1L9TA 1A8ZA 4G7SB 4BDVA 5A7EA 1AS6A 4X4KA 4YSUA 4DP8X 2PPEA 3IBOA 3H56A 3FU7A 4WTQA 4HAKA 4DPCX 2OJ1A 5D4HA 5E9NA 3SBRA 2CBPA 4F2FA 4GP4B 3CDZB 2BO0A 1ZDSA 4E9VA 1E5YA 5I5MA 1I53A 2PP9A 1AIZA 5I6NA 1ASQA 1NTDA 3HB3B 4G7QB 1JZHA 2VW6A 3QJVB 3NJNA 1SDDB 5I6LA 1GS7A 2AZAA 4N4YB 3CDZA 3T6WA 5B1BB 2BWDA 2PP7A 1J9RA 5TK4A 2WSDA 3T6XA 3NSYA 5B3SB 1RZQA 2FWLB 2Y1AA 1L9OA 1SDDA 1NINA 3SBQA 4F2EA 5I6OA 3DKHA 3FQ1A 4M4RB 1V10A 4KO5A 2GBAA 2FT8A 3X1GA 1MDAA 2DWSA 7PCYA 1PLAA 2W8CA 3EHBB 2PPDA 2UXGA 2HX8A 2HLEB 3AG4B 1PNCA 4YSEA 4GP8B 1J5DA 1BQRA 2HZHA 3NSFA 2H3XC 1NDTA 3FSZA 5ANHA 1CYXA 1J5CA 2PPCA 2B08A 3JT2A 2BW4A 4UAHA 1JZJA 2DYRB 3FSVA 4HZ1A 3MBWB 3AZUA 3WNJA 2XV2A 1HFUA 1AS8A 1OV8A 3HEIB 3L45A 1AZBA 2EIKB 2CJ3A 2IDFA 1ETJA 3TU6A 3ZBMA 1V55B 2VW7A 1ASPA 1GY2A 4AZUA 1FA4A 2QDVA 3FQYA 2P80A 2VW4A 5TK2A 3BQVA 1OCCB 2ZXWB 2EIJB 4RH4A 3NP3A 1VLXA 2IDTA 1L9SA 3NSDA 1SHXA 3NP4A 5I6KA 4GY4A 1J9TA 2XWZA 4AX3A 2N0MA 2XLLA 1L9PA 1KGYE 3NJFA 2BHFA 2YAPA 4K9JA 4Q89A 4YSPA 5F7AA 4E9SA 3NJHA 1GYCA 1JXGA 3CG8A 2EILB 3S3CB 3X1FA 2OV0A 2QPDB 1B3IA 2GIMA 4KOCA 3QJQB 2FJSA 2GSMB 3S3BB 1WA0X 3T6VA 3QJRB 1ZPUA 3PCYA 2LLNA 1SFDA 1PAZA 5I5JA 4HCGA 1KV7A 4PCYA 2VN3A 1JERA 1GSKA 1TKWA 3FS9A 2BP8A 3ABGA 4UF7C 4E9YA 2ZOOA 3OMIB 1BXUA 2IH9A 3FU8A 3IEAA 4TXVB 1RCYA 4AI7A 3FPYA 3GXUB 1JVOA 2I7OA 1BQKA 2EINB 1AOZA 3X1BA 2IWKA 3NJIA 4N8UA 4YVUA 1NWOA 2HX7A 2PLTA 3EH5B 3H4HA 1PCSA 2XXFA 3NJLA 5D4JA 4NB7A 2UXVA 2YAFA 1L9QA 4JHVA 2CALA 3KW7A 1NIFA 1URIA 4W9ZA 2GC7C 1JZFA 2CUAA 3S8GB 1RKRA 4G7RB 1XB8A 2R7EB 1M57B 1AAJA 1CC3A 2MRYA 4AKQA 5PCYA 2AFNA 1NIEA 4HALA 1YLBB 2IDSA 2DV6A 1A3ZA 3AY2A 3RYMA 2R7EA 1KBWA 2CCWA 3S3DB 1BYOA 4NERA 1PLBA 2IH8A 3MX0B 1GR7A 1E65A 1OCRB 2JXMA 5B7EA 1X9UA 1JVLA 4AKPA 1JXDA 1PY0A 1BEXA 1KCBA 1OE2A 3TA4D 4DPBX 5F7BA 4DP7X 4WKXA 3UABA 4YSDA 2XYBA 4BWWA 2J57A 3H4FA 3OD3A 4L0PB 3AG1B 1SF5A 2P80D 3PAUA 1N70A 1CURA 2XU9A 1W8EA 3CVCA 1MG3C 4HHWA 1FWXA 4HHGA 3FT0A 2UXTA 2FT7A 2X88A 4YSAA 3UGEA 5B1JA 3X1NA 1J9QA 2UX6A 3C75A 4Q8BA 2DY2A 4YVNA 1A65A 5B1AB 1FFTB 1IKOP 4CSPA 2I85A 3ZIYA 2BW5A 2FQDA 3NJJA 2JFCA 3IN0A 3NYKA 4DP2X 5AKRA 1AS7A 1WS8A 4DP6X 2TSBA 5FC9A 1ZDQA 2BWIA 4KOBA 1MG2C 2PCFA 1ID2A 3KW8A 2Y69B 3WIAA 5AFAA 2FTAA 1EHKB 4MFHA 4QKTA 1AZUA 1DYZA 1NWPA 1PLCA 4GP5B 4A2HA 2FQEA 2NRDA 2QT6A 3ABLB 4DP9X 2QDWA 1RZPA 1E67A 2DWTA 1ET5A 3UAEA 4DP1X 1UATA 2Q9OA 3OQRA 4CSZA 4KO6A 3IN2A 4NAJA 3QJUB 1BAWA 3OMNB 3AG2B 4KNUA 1AACA 1PF3A 1ET7A 3QJTB 1GS8A 3FQ2A 2FQFA 2XUWA 1AZRA 4HCFA 5I6PA 1AANA 1GY1A 2H47C 1E30A 1NZRA 2YAEA 1WAEA 2YAHA 4KNTA 1QNIA 3UAAA 1A4AA 2XX1A 2BP0B 2UXFA 1SF3A 4DP4X 1BQ5A 1XB6A 4F7KA 1QHQA 1NPNA 1V54B 3G5WA 1JXFA 1IC0A 2ZWNA 2AANA 3BVDB 1ZIBA 1BXAA 1WA2X 1NICA 3GDCA 3ASOB 2BP0A 3CZUB 7PAZA 3WKPA 1MZYA 1SNRA 1OCOB 3NJGA 4UANA 1TEGA 1BXVA 4BXVA 2QPEB 2JKWA 2BZCA 3T6ZA 1ADWA 2YXWA 5LDUA 1AZCA 2AVFA 3QQXA 1AZNA 3V9EA 3NJMA 3AW5A 4FAAB 1OCZB 4A68A 1ILSA 4JKNA 1AG0A 3ASNB 4BK5C 1KDIA 3TASA 4G70B 2J5WA 4E9TA 4G71B 1OE1A 3IE9A 3PAVA 6PCYA 2PPFA 1F56A 9PCYA 3TBBA 5PAZA 2VM3A 4DP5X 2YAMA 3X1EA 4BDVB 3WNIA 4GYBA 3NJKA 2GB2A 3EH3B 4E9QA 3NT0A 2HRHA 1J9SA 2XXGA 2FQGA 3FU7B 3FU9A 2PP8A 4KNSA 5B7FA 3WKQA 3GYRA 2WO3B 1CUOA 1SHWA 3CVBA 3TBCA 2XX0A 2OCCB 2XVBA 4KO9A 1PMYA 1T5KA 1IBYA 1JZGA 1NIBA 3T9WA 1NIDA 1HAWA 1JZEA 1TEFA 4A2EA 1PZAA 1ZV2A 2UX7A 1M9WA 4W1TA 4A2GA 2W88A 4A67A 3FYEB 1ET8A 2YQBA 3QPKA 2I7SA 1GW0A 2HRGA 4AKOA 1SFHA 4DP0X 3N2JA 1OE3A 1PZCA 3N55A 1PZBA 3AG3B 1WS7A 2VSMB 4QLWA 3ZX1A 5I28A 5IY5B 3OM3B 1OOWA 5EHFA 3SBPA 2VSKB 1AQ8A 4BXSV 4PAZA 3FPXA 3JTBA 4ZK8A 5I6MA 3PXLA 2PCYA 1M56B 2GI0A 5B1JC 2HX9A 4A66A 3V9CA
chains in the Genus database with same CATH superfamily
5T1JA 2E5EA 1JXJA 4LOVA 5DLMH 1S9WA 5D2NA 3GSQA 3HFML 2BVQA 4BBWA 4XCEB 3HUJF 4ADGA 4E41D 3AT8A 4WJKB 2CJTA 1OT2A 4PJ9C 1I8IA 1RUKH 2WKOA 4ZS7L 1U3ZA 1I82A 1W6WA 2A6DA 1MQ8A 3GMLB 1UXMA 2QFRA 3JWNE 4FP8L 4NN6B 1DVYA 2FX9L 4YSQA 3KMDA 4FKEA 4HWBH 3DNKA 2QR0B 1RV6X 1IFHH 1XVSA 1QSZA 3EUUA 1BZ9B 3NEOA 3PNRB 1BIIA 4BZ2L 4K23L 3UG3A 2W80C 3RZCA 4P2RA 1D9KB 4PGCB 4BFIA 3ZYIA 3BVNB 4XCYA 3S35L 1LK3L 2HVKB 2IWFA 1PBYA 4X98B 1U3HD 4P23A 5HHOE 1XF4A 1C5BH 2BH0A 3OKMA 1E6JH 1TETH 2R29A 4GQ9L 5HHNB 3WNMA 5JHLL 1XCQA 2VXTL 1YUKB 3P4MB 5CWSB 2R0LL 4X6DB 2UWEA 4PLJC 2VDRL 3QUGA 4KVCL 4MCNA 1IZKA 3KHQA 1NUDA 4BQ9A 1DLFH 3H9SE 3W56A 3VSQA 2NY4C 3OR6B 4HJGA 3NSCA 4U6XB 4GI8A 1MJUH 2EKSA 1MCKA 5EEVA 1T20A 5A16B 3S36H 3LEVH 1L6ZA 3JUYA 4IIQA 4HSAC 5F7DB 5ID0B 3EFOA 4U3XA 5GSRB 4KY1H 3VFUA 2EKJA 1QABA 5FO2A 1A4CA 2X5PA 1T0MA 2VMJA 1HS6A 1UD8A 2MQCA 5EC1A 4N22A 1TCMA 5EU7C 2CK0L 1BYPA 3TJEH 3GSUA 4YAQA 1FZKB 4FFWD 3V9FA 2TRHA 3FQ4A 1MAMH 4JZOA 5DVPA 3LKPB 3JVGA 2AEPL 4DOHE 2ITDB 2DL9A 3QC6X 3U4AA 2F8IA 1I7UB 4R8WH 2WUBL 2BS8A 5C0CB 5E1QA 4Z7OE 1TYRA 4PRIA 3MPCA 3GRWH 3QPXL 3BAIA 3SE3A 4OZIE 4L8SC 4F2FA 1XGPA 3UCQA 5CO1A 3PRZA 4BUHA 2JCCE 4GBXA 3OXRB 4XRCA 5D9SB 2VW6A 3MLSL 3DTXA 1ZCRA 1ZRUA 2IO5A 3C6LD 3NIFF 2XNAA 3FTSA 5FAAA 3OHXA 1SLUA 3BAWA 4Q6IA 1XIWD 2PWDA 2SODB 3FQ1A 3HI1B 3O6LH 3RTQC 3EJYC 1PCXA 5D2LA 4PG2A 3RIFK 4K55A 3ARYA 3HZVA 4WW2B 5CCKH 3L9BA 2NY3B 1PDKA 1C08A 1JCKA 2XQYG 4OLUL 4QHLB 1HL8A 3T0EA 1J5IA 3IMUA 3TV8A 1CBVL 1HCZA 2AQ1A 1T7VA 5KVDH 4MJ5A 1NGZA 1A6UH 1BZOA 1VFAB 4GMSL 1DQML 4L8DA 3RFZB 1SJEA 4WUUE 4PRHE 5IOKA 5CJOH 3VFSA 3V55A 5LGKA 1S9YA 3SD2A 4MMZA 1A9VA 3BD5A 3BO8A 1WHPA 4MX7A 3KCPA 3DXAD 3OJDB 3CLFL 3QIWA 1CK0L 1EFXA 4PV1C 3QIBB 1A7NH 2X4OA 1UC6A 2J73A 4MBOA 3ZKXC 4Y5VC 3GMQA 2ESVE 3A6BL 4P46A 2NLJA 4BKLA 4AMKH 3F04A 4EZLA 4LOUD 3P9WB 3ZDXF 1UH4A 5BO1L 5C3IA 3BQVA 4OFIA 3W11C 2QGBA 5JIQA 3NCJL 2QQLH 3OWRA 2R29L 3OKLB 2R59A 4YFLF 4Z3HA 3NIDF 3VFNA 3V0WH 4XMLH 2KKQA 2FB4H 5F8QC 3ZE1E 4ZMAT 2AK4D 4UV4H 3JV5A 4U7KA 3FB6A 4M7KL 2ADGB 1DQDH 2K4WA 3AY4C 3VI4A 5KS9E 2YOCA 5EU6E 4R3SB 3KYKL 4GFTB 4ZSOA 3CG8A 3GO1H 2O6CA 3K1DA 1Y7VA 1NC2A 3HG1B 3AABA 1PZ2A 3C60A 3O9WD 5FM8A 1WA0X 5KVFH 3LNDA 5GGSB 5D2NE 1EGJH 1SOKA 1DZBA 1XQ4A 3QCVH 5IHHA 5MP6H 5IOPA 4PCYA 1IM9B 4QR7A 3SDDD 1QD0A 2Y7QA 2RB8A 1R24A 4HDIA 1TZGL 2GUYA 1GGUA 4L4JA 1EAPB 1CFNB 3VQLA 4PHZA 2DQCL 2UZPA 1P69B 4MYPA 5KJRH 1JRHI 1NKRA 2DI8A 2FJHA 2FCBA 1OSEA 2GKIA 3DUUB 2ZSVB 1IU1A 3DX6A 3HE6B 1Q9OB 1RCYA 4G6ML 4GKSB 1WWWX 4RIRB 2OR7A 1JVOA 3L4TA 5D1XC 5EWIL 2V5RA 5IG7B 1I75A 1R46A 2WZ6A 4HC1A 3HA0A 1A5FH 2VM9A 4OU3A 3ARGC 1NWOA 2HX7A 3GBNH 4NP4H 4P2RE 4OQTH 2XXFA 1N67A 2FX8H 4XMZA 3NAAH 1RU9L 2IPUG 3N43F 3TBYA 5E08L 1OSPH 1ROWA 3L17A 4JY4A 2ORBL 2WWMD 2ICEC 4G6AC 4XPTL 5DRXA 1QBLL 2HTLC 4N2GA 1U8PB 4WWPA 4RISL 2XZAH 2I9TA 2V6HA 4L0ZA 2ICES 4LCCA 2BFGA 1XB8A 2F54B 1DL7L 3WDIA 2X1PA 4TLKA 2XPGA 2MHAB 4GAGH 2UWEE 1AFVH 4TSCH 3MGAA 4P49A 4XTRD 3AM8A 4ZPVB 2EEXA 2Y5QA 1G0YR 5DJXB 2VISB 5FB8A 3LPFA 1HCFX 1JGVL 4MB4A 3NFPA 4P4RA 4KKQA 2IOOA 4DP7X 5IQ7L 1RJLB 1MVUB 5EFIA 5F89B 2QQQA 1IEAB 3FUFA 3HAEG 4AM0A 2FEEL 5B39B 4TVPD 3VWKD 2WVVB 1A3RL 1JWMB 3KLSA 3QNYA 3PJLA 2FAUA 4WU7B 4GFXA 3ULUL 1UWXH 3IE4A 4HHWA 4HWZB 3OZLA 2GY5A 1BMZA 1DBBH 3GIVA 3PV6B 1U58B 4HGWA 2BM3A 2J12B 3C75A 1NGXB 3EBGA 4LSQH 3WBDA 1TTBA 1AGDB 1LMIA 2WWKO 3ZIYA 3NJJA 1IFRA 2LV4A 5FKPB 3UTTB 4DP2X 1AR1D 4XPGL 5E7BA 3WXVH 5KYUB 1AS7A 2JQAA 4APQA 5DQJA 2XKNB 3KR3L 3B6SB 4PRIE 5AAMA 2NR6D 5ICZA 2R39A 4AYSA 4IJ3B 4O02H 2HMID 1YN6A 5LWYL 1FLRH 4F7MA 5F3BA 1TNNA 1BBDH 2OSLA 4NCDA 4EZMA 3JTTB 2FTAA 2HT2D 4YN3A 2B2XH 1MH5A 4FQCH 1EXUB 1T1YA 1WBYA 4UOQA 1ACYH 2F5BL 1NDGA 1MI5D 3CBKB 3BUQA 5LLIC 1G9NH 1SMDA 1Y18A 4DP1X 2WC7A 2XJKA 3L13A 1X3DA 3PL6B 3OXSA 4WW1A 3O6KH 1BVKA 1I3VA 2DEXX 2XI9A 2AXJA 4EUPB 3P30H 4AM0Q 1G9MH 4FI8A 1DVXA 2NX5A 3EO0A 4IU3A 1IKNC 2J88L 3RWFA 2VIRB 2F74A 4HCRA 2BFVL 1KJ2A 3GBML 2WZPA 4XHJD 4NO5B 1A4JB 1A3QA 5I71B 1QNIA 2XXCB 1LO2L 3LN5A 2W0PA 4KZEL 1OXYA 1YY9D 3T0EE 3TVMD 2AGJL 1FL5B 3WSQH 1S7WB 4F7KA 4M1CD 4Y2OB 3A6OA 4Z77B 2H0FA 3BH8B 3RGVA 3Q9PA 1NICA 4OF5A 1T0NA 2BMKB 4NNXA 4ACTA 4YDNA 1WTLA 1KCVL 3I75A 2VDKB 3BZ5A 3N0PB 2JJVA 5IWLC 3RY5A 4YIQB 3MRPA 2Z34A 4HC1L 4PJEB 4DUXA 2VO8A 4KZCA 4RQQA 2FRGP 4OLWL 1NCCL 2BSBA 2FWSA 5KOVC 4BK5C 4GRLA 5F7MC 5D5MA 3TASA 1PEZA 3MJGX 3RA7H 3TH3T 2DQDH 4YBQC 4YXLH 3CFKA 5DSCB 2DWDA 1BFOB 1YMHB 3NFNB 4XMPL 3TA3D 2W81C 5JHBA 1ZS8B 1CI3M 3QUYC 3ASWA 4B9JA 1NUFA 4EO5A 3QEGL 3OF6D 3T2LA 4EE2A 4F1ZA 1OLZA 4E0RA 2X4RA 3FF7A 1WICA 1N18A 4XODA 2VDQB 1FORL 3RQ3A 1G7IB 5L4JA 3X11B 3IDJA 1A14L 4XXCA 3DV4A 3RL2B 5GJTL 4ZDHB 1VJSA 2N01B 4G59C 4PWKA 1BD2D 5I73C 3TT1L 2O6EA 3QJXA 1LO3H 1TPXB 1BOGB 4QT5B 3KL3A 4J3WA 1N0XH 4HK0A 2XBDA 3NIGB 1OB1A 2O72A 4ZSOE 1INQA 1VSCA 4UOW0 3ZZ1A 5M94B 1J05A 3QXUA 3BPNC 3DJRA 2WN3A 4D0CB 1DE4B 3LHPH 3FT1A 2OSYA 3QI9B 4AIZA 3ZN6A 4LVNB 1P4UA 2JELL 5L9DL 5GGQH 2MPVA 5B1CA 3SE4A 1P7KA 2CDFB 2VMCA 3CSYA 3K3QA 4DZBA 5FO8B 3II2A 5IB2B 1AO7A 3QCUH 4OTXH 3BP5B 4HAFA 3A0OA 5J9PB 1XF1A 2YC1A 3TURA 1BZ7B 3ATFA 4HKBB 3AMKA 1IAKB 1HL9A 1WS7A 1DQLL 4G5ZL 1UXWB 4QYAA 5GXBB 1JZ8A 1A1NB 1KBPA 1OOWA 4BFFA 2CJUH 3QRBA 3FUDA 3RJOA 2ZG1A 4XNXL 1IJ9A 4IBQA 2VL4A 2W94A 3HI6L 1HSBA 5D7LB 3TLRA 1A3LL 3CDFA 3BUIA 1DLHA 3ABKB 4ZMOA 4AYID 2DQGL 5JDSA 1I8MA 1IB5A 3EBHA 1IVTA 2VDOH 5FGCB 5AW9B 1J18A 2P5ED 1KZQA 3GMRA 1TJHH 4M3HA 4PYGA 2FIKA 1FHGA 1S7VA 3E6FA 2CSPA 1QW9A 3N91A 3QXTA 2KI6A 1CF1A 3PG2A 4NPYA 5B1KA 3S0PA 5IHUL 2QGCA 4ZXBD 4OCXH 1VFOA 3ARFC 1NBZA 3WI9A 3VFWB 2NUTA 5I19L 3V0VB 1PNDA 4PV8B 4G7VH 2P8MA 4PBDA 4B95C 1QKZH 3KWTA 4D3CH 3RY6A 4R2GB 3S3SA 4IOSD 2WLIA 3KGRA 5AB2A 3RFRA 3QXDB 3O8XD 4HJ0C 1H8LA 3ZOAA 5DGRA 1DVZA 4LHJB 5LJYH 5I9QC 4ZAKD 5F7EH 2W60A 4HCRL 2LTQC 1KJ2L 4S0TD 1GXEA 2PNDA 2J56A 3FO2A 4U6YA 4WLCA 5EUKB 5EA0L 3UACA 2NZ9C 2BZDA 1FPTL 1XF5A 3K72B 4K8RL 4MA7H 4TLSA 4X4YB 1S3RA 3IXTA 1CIDA 4CW1B 2OLDA 1KCWA 3RILA 3Q6FA 3PP4H 4OZHB 4NN7C 5I5IA 3TO4D 4EN3D 1QFOA 3B43A 3EJSA 4FF9A 2CA3A 1U95B 3MV8B 3V7AE 2EH8H 3CFMA 5E99H 1T83C 4Z7WF 4MWFB 1P1ZA 4UT9A 4JPVH 3QJSB 5E4IA 3EJUA 4KK6D 3VH8B 1N6QH 5E9DA 1RSFA 3HG3A 5I82A 3SKUD 3ZDZE 1DJHA 4G8GD 5ITBH 2R69H 2D7TH 3ETBJ 3WN6A 2QGDA 3LV3A 2LFGA 1Q9LB 5C0JA 5JHMA 3JT0A 1GA2A 3LNEA 3H42L 3S6CA 2YD2A 1I7TA 3GLEA 5EPMB 3O2DH 3F05A 5JHDB 3L3KA 4LSSL 1A22B 3KPRE 3QNXB 4MDJA 4B9PA 4EF3A 1XGYH 3RUGA 2BDNL 1EBAA 2WYTA 2IDCA 3Q2WA 1KTDB 2B0SH 3GMNA 5T1KD 3FQUB 1EO8L 2WJ7A 3WNNA 3PP3H 3MUZ1 5DRNB 2P4AB 1DBKL 4YQXH 4NUGH 4JFZL 1FHNA 3GHEL 3ULAB 4NKMA 3AREC 4RZCA 4NUQA 4LAQL 2FH8A 4WRLA 3H2WA 3CLEH 3VD1A 1OCWH 4I89A 4AEHH 4ONGH 4J3OD 2JSFA 2NX5E 1MAJA 2BCKA 1HYSD 4R5VA 5CLTA 1PLGH 3K74B 4JFDD 3UJJH 3ARSA 4M7LH 1I53A 1F4AA 5F1OB 1H6EA 5F7HA 2PUQT 4NZDA 3TYFA 4UTAL 3BAJA 2DMBA 5IK3A 1QEWA 4F9LC 1XD1A 5JPMA 3ENEA 3S8WA 4XI5D 4HX1A 3OKOB 3HPLB 5HGHA 4X83A 3F12A 4HUVA 2WXFA 5B3SB 1N8ZA 4PJHB 5HDBE 1M7IB 1IILE 1A9BA 2X10A 2YQ2A 1F1DA 5GGRY 2DQFB 1YEJH 1TZIB 4XZ4A 4L4VA 4PJFB 2FBJH 4GKZB 1CLYH 3KBFA 4H2CA 4Y2DB 3QUMB 4U1GB 5DJYB 4XNMA 5IBUB 4Z7UB 3VWJD 4FFYA 2NY6B 5JLZA 4XNZB 5D5ME 2H3NA 1E9PB 3LXBA 7PCYA 3IMSA 2WVSA 3GSRA 4KUZH 4OCMC 4PJXF 3GJEA 2A6JA 4YK4C 1JVKA 1OM9A 2H32H 1J5DA 4HIQA 1JYNA 3KLAB 2HVJB 2E7LA 1V7MH 4BH7B 2Y3AA 2VRAA 4S1QL 3C8DA 3TBSA 4R4NC 3EG9A 3SCMA 3FQWA 2YJLA 4TSBH 4K5PA 3AZUA 1N4XL 1UYWL 4X80L 4HIJB 3S37L 4DPRA 2F7IA 2DJ4A 5GGUA 3WGUB 4FHKA 4PP1C 1QBBA 5KVGL 4GPVA 1ZLWH 2H9GA 2OTWB 5JHLH 5ESAB 2EIKB 3RWHB 3C9NB 4CUCA 4UQAA 2IDFA 4PVNA 2MNUA 4OZGE 3RY4A 3K5SA 3HG0A 1E5CA 3UL4A 1W0WB 3BN9C 1J9CT 4LLUA 3SDXF 5I15L 2ODIA 5TK2A 4HJEA 1V5JA 3QO0B 4Z7AA 5I1EL 3MRLB 3CSGA 5AVYB 2Y36L 3Q0HA 1FLTX 4G8IB 5D8JL 2J5LC 3BP7B 1FAIL 3UPCA 5IB4B 1J9TA 4Y5XA 4DVBA 1NGYB 15C8H 2OFQA 4NNYA 5CJXC 1WGOA 3KLDA 3NJFA 4NJAH 4U1NA 4Y16B 4ZTPL 2FGWL 1BM3L 1GYCA 3HHSB 4MD5A 1JXGA 3M46A 3HI5H 1SYVB 1RD6A 5G55A 4PRDB 4OKDA 4WWKD 2FJSA 2NY2D 2YLHA 4PJIB 4CILA 2DIJA 2WKLA 1ZT7B 1OTUD 5HXMA 3ULSB 1A2YA 1HHGB 3Q05A 2NYYD 5E6IB 4Y9GA 3NOIA 1JYWA 4XO4A 2WUBH 5EO1A 1CL7H 1T4WA 2C9XA 4LKXA 4R97B 4I1PA 4NDMB 3WEBA 3BVTA 1XF2B 3RRQA 3K2UH 4GO9A 5DQ9A 1O7VA 4P5MA 1NKGA 2EVIA 3I6KA 1LLAA 2IH9A 3JV6B 2BNUA 4XPBL 2YA0A 4TS6A 2HWZH 3O3DB 2GY7B 2X38A 3BT2L 2CKNA 4MAUH 5TH2B 3F5WB 3U9PL 4L8CA 2K4AA 4BFGA 5D6DA 5KVGE 4X50A 4PP2A 1FQ9C 2WLMA 1Y0LB 2JLPA 3DMMA 3IAQA 3EUDA 3KW7A 3MGTB 4Y1TA 4XP1H 2NQDA 4Y19A 1QFUL 4GRMA 5ALCH 4AYDC 3LHAA 4MXWL 2ZCLL 3NG5A 1W72A 3D0VB 3HTLX 3NGBB 4IJTA 5D7KD 2V5TA 4QPEA 2R7EB 4NGHL 4WFEE 3W0WB 3PXJA 1UM5L 1JGDB 4YHKH 2I5YL 2VITA 3FQTB 5T33L 5IB5B 3BIAX 2I9LA 1DQQB 4HALA 1USZA 3M8OH 3CN0A 4N0UB 4WK4B 5E9DE 3RX7A 3RVVD 3FFDB 4U4IA 1AXTL 3KLQA 3H54A 5A2JH 3MX0B 1XAKA 4HFUL 4Q0XH 4ATTA 3WMSA 4JUTA 3PHQB 1AXIB 4OV5B 4FFYL 3TBVA 3L7EB 2EYRA 3HG5A 2EXWD 3PF2A 5GGVL 2EACA 4LCIH 3VXOB 4LT7A 2P80D 4UZSA 4FD0A 5EB9A 4D7PA 1A7QH 5JW4Q 3GSXA 3HRZC 2PWGA 2B9BA 3DX9B 1W8EA 2QTVA 5D70L 4JM2C 4U6HA 3RUGE 2OK0L 5HYJD 1SEBA 2NY1D 1EWHA 1P5UC 3FW6A 4ZUTB 3DA0A 3O2VL 5F44A 5HYSA 9CGTA 1VGEL 2DY2A 1OAUH 3LZFH 2IBZY 4G43B 1CT8A 1ZWIB 3FB8B 3D2UD 4TNWK 2VZVA 4EI6B 2DYPD 2ZAIA 3W37A 1T22A 1HXKA 3LKSA 4X4ME 2A9DA 2AJ3B 2NXYB 2VAAA 5ISZA 5BS0B 5KWYC 1ZDQA 1MCLA 3DSFL 4C4BA 5J6SA 4TYUA 4BCZA 1E6OH 3R19A 3WY2A 2FUTA 4ENEC 3RURA 3IJYB 3TN0A 4BCYA 5J56B 4HPOH 5LQBH 2GJ6A 2PWFA 1PD1A 4FXLA 1PTZA 3DURA 4PGEA 4KFZC 4AIOA 5CZVH 2MTPA 2RGSA 1NWPA 4QKTA 1MFMA 3LNFA 4IBYA 4DP9X 1WT5C 5CILL 5EIQA 4RAHA 1BW8A 3B2VH 4X5LA 4CSZA 2IPTH 4Y89A 3LQZA 1KGXA 3SOBL 3K6SB 4U3SA 3RTLA 1CR9H 2AI0L 3RBGA 4WO4A 1ACCA 2BNQD 2C9VA 1LK2A 3BX7C 4YFLI 3K8LA 3ULVF 4ZUVA 5I0WA 4YHZL 1KYFA 4L4VE 1DJWA 1XR8B 3GXMA 3FQ2A 2XN9A 5HD8D 4DGWC 4C57C 1UWEL 5MEQA 4IOIB 2AXWA 4Z7VB 5FWQA 4UQ3B 1SBSH 1SJHB 2PXYD 2QKSA 4ZTOH 2LU4A 2OP4L 5C08A 2CM6A 5ETUA 1TQBB 2VABB 3B9VA 3MV9E 1X5YA 1ML0A 4ODVH 2BIHA 4L1SA 1XB6A 1S5IH 4FJZA 4R0LA 4RAVB 1JXFA 1IC0A 4IGBC 3P9MB 1F2QA 1R3JB 4DZ8A 3VD4A 3L3GB 1MRCH 4I1RA 2Q6WA 5SX5H 3V52H 2BP0A 7PAZA 3V0EA 3BYYA 2X4QB 4JQXC 5EUOF 2RD0A 5CSZB 1Z5HA 1X4XA 2WNXA 2Z31D 1FP5A 2GVYA 4NRXB 3FUNA 5E8PA 1RIHL 5JW4R 4ZMNA 1RZJC 1BGXH 2YGQA 4X5WA 3L6FA 4QRRB 1KCUH 2JI1A 2E9GA 4LCUA 4YHNA 5AOLA 3TWCH 1T1XB 1B0GB 3G04A 5E8DL 3MI6A 4BKSC 1KDIA 2LHAA 4EI0A 4J8QA 5C1MB 3FTGB 4LEXH 6PCYA 2BINA 4ANKA 1MF2H 3UZVB 2XDHA 5KAQG 3WNIA 1WIOA 4OF3A 1T89C 2WINA 5ITFA 2ZWZA 1W72L 5L6YL 3QDGA 1TMCB 4HSQA 4I2XA 3OB8A 3VFGH 5FOBB 3VCLB 1UJ3A 1RZ7H 4M8QB 5A43C 4PBWD 5EU4B 1WEJL 5C0IB 5BZDA 1QBMH 1MHEB 2W91A 4FZEH 4JFVA 4NUMA 1YJDH 3U30B 2E27L 3K81A 3PIQB 5AW5B 5HDQH 2AXHA 1NCAL 3Q8BA 4G6KH 4KMTL 4TNFA 4YHLL 5J3HC 2CO7B 5DEFB 1H0DB 4ODUA 2OSXA 3ISWA 4WNQA 2A77L 5MERA 3WTUA 3NK3A 4FNTA 1W0YT 1C5DB 1N59B 5EBMA 5JORA 2YQBA 4PH8A 1DN0B 4WZ9A 2UYLA 2B20A 3TPKA 4B41A 4MHHI 3DV6B 5F7LB 3QDMA 5IVNA 2VZTA 4IMKA 2C8NA 1D9KD 4Y4HA 4D8PA 2YIHA 3L4CA 5IY5B 2BOBA 3BAYA 2ZOLA 4L2YA 4JZNA 3CU7A 3WS3A 1P5VA 3OM3B 1ZAGA 3CQPA 2APFA 1AQ8A 1DSFH 2M1KA 3BXNB 5DJ6B 4G42A 5BQDA 3ZKMD 5LNDA 1I1FB 1SXNA 1N19A 3DIVA 1DUYA 2FT6A 2ZZUT 1IGJA 4YDVA 3BEWA 1QSED 2N1KA 5D7SH 3UZEC 3D52A 4TULL 5FCUL 5ESVB 5CD3A 1TU2A 1H3UA 1QQDA 4HKJB 3UC0L 3GJFH 4IBUA 1QYGL 2VSCA 4XNQA 4Y19E 4M5ZH 5SX4H 4K3DL 1YQVL 1PZSA 1DO6A 1TOXA 1E42A 2JIXB 3O0RL 4ORGB 4XCEA 5TF1H 4UYPA 4AK2A 4J4PC 2YPVH 3RBSA 4F3FB 4HQQL 1G1CA 4LSPL 5DUJA 2YEZB 1U8OB 2XN2A 3FSAA 3HZMB 4OJFL 4NQQA 4R4FL 1V7NH 2L8AA 1HESA 1LDPL 1CVSC 3AXLB 3T65B 2GSIB 3E7JA 1PIGA 4YGVB 2LOEA 4MKTA 2XBZA 2XV6B 1WBZA 4PGCA 5CJBA 1XGUB 1KB5H 1XZWA 3BVNA 4BWTA 5IJDC 1JOIA 1K72A 1NCCH 2GEEA 2HVKA 2ZKHH 4JLRB 4MTMA 5C0CD 1JZIA 2BNRD 3K1KC 4X98A 5B3NA 2IXQB 3DUHA 4MYWB 4HYTB 3UGUA 2VLME 5HHNA 2IPKB 3CVDA 4KK8D 3T2OA 5CWSA 2ROYA 4X6DA 1AKJA 4YL4A 3RL1B 4ZW5A 2D3NA 2JH2A 1QI3A 2R2HB 1FFOB 5C71A 4IRSC 4N2LA 2VWEC 4LL9A 4WTZA 1A7OH 3QIUA 4FN0A 3K8KA 4BHUA 3OR6A 2YRBA 4BA0A 2DQTH 4FI6A 4TQHA 1QWNA 3LIZH 4FFVD 2GJ6E 4TSAH 1I9JH 2F5AH 4CL7A 3OC8A 5A16A 1VFBA 1OIOA 1ONQB 1Z9OA 2J1WA 3QUZC 3RPIA 5ID0A 5GSRA 4P59H 2RCSH 3NEEA 4AL8C 3AGWA 4PJ8B 1Z9SB 2XIIA 3UO1H 2H5UA 2V2WB 1KELH 1TFPA 2QHRH 4QNPE 3O6FC 5D71H 2DN7A 2NY3D 1CBJA 3REWA 5A7EA 1FZKA 3CXFA 3TEZA 4IQHA 4FG4A 2DQ6A 4M48L 3T8XA 4GW5A 3IBOA 3H56A 3ZRCC 4A38A 3LKPA 1E28B 3FUMA 5INDB 2PCPA 2DBLH 1U9KA 2ITDA 2XN9E 1M3IA 3OHMB 5AUMB 2EDEA 1I7UA 3EYSL 4PCKA 5C08E 3JXAA 4JO1L 4PJ9D 4BZYA 1RERA 3EJCA 4LSVL 5T3ZL 4CA4A 1T7YA 4MAZA 3UC2A 5L8KB 2Z0UA 4K5NA 4OSUL 4B53A 1Z5YD 1Q72H 2JXMB 3OAUL 4RMUA 2W92A 1E4WL 1UB6B 1A6ZB 4MA1C 4RGOL 5CCJA 3LNGA 2E75C 5T1DL 3CVHH 1S7RB 4JO4L 4RCAA 4BE6A 2WANA 5EBLB 3LIUA 5FM5M 3LH2H 2B9AA 4WFGE 3UAJC 2ZKYA 4OGQC 1HEHC 4LLWA 3QH3B 3TJHC 4I85A 1P4BH 2COVD 1RZKL 4D0DA 5TTRA 3QFJD 1DFBH 2IAMC 3EHBB 3HI1A 2ATKB 1B0WA 1H6TA 5GS2D 3EF7A 4YSEA 2UUDK 4WHYG 4WW2A 3UTQA 3O3BB 2YWYA 4TVPH 4PLJD 2F19L 4I2XE 3IU4L 4QHLA 5HGGS 2PPCA 3HVNA 3UGXA 4HOWA 4HS6B 3HG1D 3WNJA 4FG0A 3RX5A 3GK8H 1F4XL 3O6MH 3HEIB 1VFAA 4AYEC 1HX0A 2YXMA 3QDHA 1UOVA 3RFZA 5ALBL 4GG8B 3SHSA 1IM9D 3B3BA 4JL2A 3WTXA 1F4WL 4GAYA 1FV1B 5AKTA 2CHXA 2VW7A 2XZQH 1Y6MR 1YEFL 5GRVL 4E5XB 5F0PB 4G5AA 4AH2B 3QIBA 4RH4A 3ILQC 1VLXA 1JD9A 2DQIH 2Y6SC 5J1SC 4IKNA 3NP4A 3NZSA 1XGRB 5DA0B 2NCMA 2YMXL 5T3ZE 4BQCA 4HIXL 2EABA 1VHPA 5I76B 1LVEA 3QDME 4KUCF 3A23A 3T4AC 4U0QB 4OCLC 5EV7A 3P0VH 1DBJH 3OKLA 4YSPA 2WNKA 2YAPA 2YPLB 4F7PA 3JWOC 5I1IL 2IBBA 4E36A 4HS8L 2AV7B 4YXHL 2WLLB 5DRZA 4DEPC 2QPUA 1IGIH 1E4XI 2J8UF 4U1HA 5D72H 4M8UA 4ZRGA 3ZQWA 4PJCF 3GINA 5GS1B 1LO0H 3QYMA 2WNGA 3S3BB 5IIEA 3TX4A 1QLEH 3ORJA 1ORQB 1ZPUA 4DWHA 5CUSL 3BFQG 3R7RA 1PAZA 3AQXA 4M43H 3T08A 1S7XB 4UV7H 2X40A 3IWUA 1J1XL 3EYVA 5I6XC 3G6JF 4LOEA 1DR9A 3ZE2E 3FRUB 1TVDA 4IMLB 4FS0A 4LL4A 5GGSA 4TQ8A 3QNZB 4CU7A 4XMUA 1B4TA 4H7VA 4JM4H 4ZOEA 5JIMA 5EO0A 3WIIL 2BJMH 2G75A 5BVJB 3LS4L 4EKJA 3RTQD 4I18A 4IBWA 2WUCH 1CFNA 1EO7A 2CG9X 4M3KB 2CHZA 2BVEA 4X6BB 2C4FU 1BVNP 3RKDC 3FHEA 1ZLDA 3DUUA 2ARJA 3HE6A 2ZSVA 4GKSA 3TIDB 1Q9OA 2MQ3A 5FYKL 1JSYA 3H4HA 2AJSH 4WK2B 3DSNA 3WLBB 4AUYA 3SDYH 5K1JA 5IG7A 2X2IA 1IGYB 2FWOB 3D0LA 3S35X 4F37F 1GKOA 2ZUQC 2P7TB 2R4RH 3GZQA 4GAJH 4JG1L 1MEXL 3SPVB 1CFVL 2F1EA 4KRPC 1CU4H 1DVTA 4GNKB 3RGBA 1KFAL 2XQBH 3ARDB 3CDYA 3II1A 4ZMTA 3MOAH 3UTTD 1OGTA 1BIHA 4L29A 4KHTH 3ZL4H 4LRIA 1NAKL 3O41B 4WAFA 4ODSH 4P5TB 5T1LD 5PCYA 1IBFA 1U8PA 1JYXA 3E6HA 5C86A 3AUVA 5FV1L 1A3ZA 1ADQH 1U8HB 2F54A 4I3SH 4GQQA 1XBDA 2C3WA 2BSRB 2BY0A 1J48A 3GSNB 4X6DE 1F6FB 1FRGL 5JOEA 4DETA 4I4WA 2W07A 3EGXB 3SGJC 2BSED 4ZPVA 5DJXA 3W11D 1F18A 2ZX5A 4KZDL 2GAZA 2VISA 5FLUA 1LP9B 3OD3A 4L0PB 4HULB 4NCC2 4H20H 1CURA 1FSKC 1QHPA 1SM3L 2B77A 1BCIA 3SYPA 4O2FB 2OYLA 5KVGH 4I3GA 3MRHA 2AMUA 4ODTL 3S2AA 1RJLA 1YRKA 2OR9H 1UXSB 3TBWB 4GXVL 5D1ZC 2APWA 5F89A 5B39A 3FO1A 1XH2A 5JIIA 2D73A 3RNKB 2WVVA 3F7LA 5FYKU 1JWMA 5MI0B 4ODHL 1G6RB 2OTPA 2FQDA 1Z9MA 2R23B 3QG7L 4ELMB 3PNWA 4UT6H 4PG9B 5SV3A 1GIGL 3IN0A 2EXTA 1DBML 5KN5B 4HD9A 1WWBX 2DM2A 3PV6A 1GGYA 5HHMB 4NQSA 3MSPA 1MQKH 4L4TA 1NGXA 4UT9H 4GLRI 3B4NA 1AGDA 4PGDA 1B3JA 2AQSA 4GXUM 3V6FA 5EF1A 5FYKE 1AH1A 4OF8A 2EIBA 3L54A 1UWGL 4JUSA 2IGFL 4I7ZC 4MFHA 1U8QB 4A2HA 3MXVL 3OBAA 2VR7A 3KPSD 3SJVB 3IGAA 1RUML 3QK0A 4XT1C 3CZSA 5E8EA 1LJMA 3KL5A 2VXUL 3FOLB 4QHMB 1NBQA 1OAXH 4QDGA 3JTTA 4KHXL 1YQ2A 5D1XD 3IFNH 2X1WL 4R90L 3LEXA 4BK8A 5IROA 1EXUA 1KXTA 1SYSB 1XGQB 3LZPA 3ARGD 4S1DD 1L0QA 3B3IB 2XETA 2AKRB 1C1EH 5AAWA 1GS8A 3GSWB 4X9FA 3P73B 3N1QC 4GAFB 4WJG3 4DN3H 3BRFA 4H8HA 3R0MA 3GKWL 2Q3XA 1A6WH 3F7QA 4EUPA 5FUOH 1E30A 3ECBA 5D93C 4ZFGL 2BSDA 4AQEB 3QQDA 3UAAA 3KHOA 4IS6A 1KJVB 1DQJB 4XNDA 1S7UB 2C26A 5FFGA 3GSVB 3SDAB 2VIRA 4XN2A 1R34A 4P2OB 3BVDB 4N0RA 4NO5A 4Z7OF 5IKCB 3MA9H 4OT1H 3CU1A 5IFAL 1QPXA 1LEGB 2Q3ZA 3WKYA 5HJBA 4OZIF 1U8IB 1FL5A 3V4VA 3VYOA 1SPDA 2QPEB 4Y2OA 1SY6H 1GGTA 1VF5C 4Z77A 4XCCL 3BH8A 2JCCF 4FRWA 4S1SL 4EIZC 3AB0C 5DU7A 1U2YA 3N42B 5D7JB 4MQXC 1NBVL 4J6RL 1JI2A 3ECQA 3QHZH 3DBSA 3BIKB 2RFXB 4YIQA 9PCYA 4PJEA 1U3HA 4P2QB 4G6JH 4K71C 4BDVB 4Y5YB 5CKAA 1D7FA 1QACA 1JN6A 3QT2A 1NFAA 2WBKA 2FQGA 1UD4A 1BFOA 1YMHA 3GMPA 2F1AA 4WSKA 1NCGA 1ZS8A 2CDGB 3EDFA 3TONA 3WFCH 4H1LB 4NN5C 1MVFA 4N1CA 4NRZB 4QCIB 4XVUC 4EQ3A 5AD0B 2GG1A 2ITCA 1C8PA 1G7IA 4KAQH 3X11A 1XH3B 3LD8C 1CE1H 4NRYB 4AY0A 4TQIA 1RIUL 2B5IC 1MRDL 4OM1L 1AGCA 4J3OH 3OZ9H 1SXZA 4QT5A 3TEWA 1S2EA 3SIKA 2E56A 5AZ2L 4X8CA 3CDGB 3OPZL 3NPSC 4WY7H 3E3QC 5LGHH 1J5OL 2NMSA 3HG4A 4H0HB 2DQMA 4K9EL 2V0AA 4BYHA 3IJ7A 1R6VA 1DE4A 2X53A 2ZXDA 4Y1AB 3QI9A 1PZCA 1CJYA 4F9PA 1H15B 3I2CH 3Q8FA 4UB0L 3CHSA 2G0KA 4Z0XB 5FO8A 3EO9L 3S34H 4OGXH 3C8HA 4N0CC 3SKJH 3BP5A 1BZ7A 3QWQB 4LEBA 2HX9A 3NFSH 1F3JA 4HKBA 1IAKA 3EJQA 4QD2E 3SSGA 2FD6L 3VXMD 1JG9A 3B9KC 1UXWA 3LCYA 3SDXB 1A1NA 3DETC 3ZE1F 5C2BH 3MV8D 4N85A 4DJMA 3IYLW 1P1VA 1YN7B 4I3RH 1VFUA 3QHTC 3WAJA 2CA4A 1QUNB 4EKXA 1A6VH 1BJMA 2CPCA 4TLTA 2MQGA 4PS4H 5KS9F 3MLUL 2A9BA 4KPHH 4Y9FA 5D7LA 5DJ2A 1JYVA 4DPAX 1R1CA 3IJHB 3GUTB 1WH0A 3QUHA 4MNGA 4F24A 1XF3B 2ID5A 2K78A 3VB8A 3OR7B 3W82A 5LKNA 2J71A 1JPEA 4KRNA 5B8CB 3GI9L 4UQDA 4U6TA 2HP4A 3VFWA 4YS4A 4XMXA 5JHDD 2F54E 3V0VA 1RXLA 4PV8A 4L9LA 5GZOC 1RFDH 3A3YB 4YBQD 5DMGC 5E7FA 2YARA 4AGMA 5CGMA 1JHLH 3GSOB 1AGFA 1PKQA 2WKOF 2AXGA 3GXNA 4OVUA 3U4BH 3FF8A 3QXDA 3SE6A 1WV7T 1QZ1A 1JRHL 3ZYOA 4XBGB 1JWUA 1JDAA 4UCFA 5CBEB 5GZNA 4XH2A 3LOWA 3LZLA 1CVRA 5CHNB 4NKIH 1J86A 5EUKA 2Y22A 3JV4A 5E6ZA 2IQ9L 4KKPA 1D7CA 1KJ3L 3K72A 4X4YA 2BERA 1FAKT 4JPSA 2B8OT 5HBBA 2KHAA 4CW1A 3V4VL 4K7PY 3IVKB 1YEDB 4M03A 2G9HB 3OMAB 4OZHA 3SKOB 1C12B 3MFGB 1JGEB 4TUKH 3U4EB 4WTZG 3DJSA 3BWUF 1W72H 4MWFA 3UYPA 4MAYB 4Q2ZB 1BG9A 5AOIA 1CGYA 2YS4A 1HNYA 3VH8A 3RAJL 2V7HB 3UBXA 4JREC 4OFVA 4WJ5B 1OARH 1BLIA 4L4TE 2X9XA 4G72B 5FA3B 2PPAA 2UWEF 4ALAL 4GQZA 1MFCH 4JHWH 3HHRB 5F1IA 3EOBA 3O2WL 2X87A 3QFDA 3V6OA 3TEYA 4JO2H 4JDTH 1U91B 4RFEB 5F6HJ 2G60L 1XMEB 4KI5D 2X4SB 4MMXC 3LXAA 5H94B 4G7YL 2B39A 2X1QA 1INEH 2WGXA 3BLPX 3EOTL 5DJDB 3CMGA 1Z7JA 1AS6A 2XN0A 1DEDA 5DRNA 4OF0A 2FL5A 1G7PA 4QXTB 5JOFB 2AJVL 2YUWA 4RMTA 2BP5M 2Y5TB 3IDMB 1KGJA 4Y4FC 2VJXA 1GTNA 2W95A 1HQRB 2OMUB 4TQPA 2XVGA 2Z4QB 5C0AB 3TZVB 4RZKA 2X41A 3S9DB 1DANU 1JZHA 3NMEA 3BUPA 1YVLA 1INDL 1TFHA 2NNAA 3B5GA 2X0UA 2X2YA 4O5LH 2ICWJ 3BSGA 3GC3A 5E0QA 1OP3H 3ME0B 5KSAB 6TAAA 5TK4A 2ERJC 1THAA 2FWLB 5GJSH 4FZ8H 5C2UB 1U93B 4XP6L 3OWEA 4MCMA 4HJ0D 2Q87A 5CLYA 5I6OA 4UQIM 1ZA6B 4EDXB 4KO5A 4YBLC 1OGAD 3PQYD 4LSUL 4K3DH 4PJHA 2NZ9D 1E4JA 1UZ6E 4V1DB 3V4PB 3O0RH 1RJYB 4POUB 3DX0A 5HI4D 2QSVA 4PJFA 1VZHA 2W8CA 1F86A 4Y2DA 3I6GB 2OL3B 2ZX8A 3GFUA 4OFKA 4PJEE 4XE5B 5TGBB 3FTWA 2XWBA 5IQLA 4OJFH 4Z7UA 2QMKA 4R4FH 4UMGA 1KCRL 3NZHL 3U7AA 3O0LA 1M71B 4R7VA 1KLGB 2XWRA 1GC1H 5ANHA 3TOPA 1HOEA 5D2LF 3P1VA 2VKWA 4GB9A 5F1NB 2VLKD 1HYRC 1T7WA 2G2RB 2VDNB 3KLAA 1S78D 4BH7A 5E6ID 5FYLD 3US0A 4J12A 1VEMA 2AJXH 4HGMA 2EDHA 4Z0BL 2G3NA 3MRIB 2KQMA 5T5FH 3FZUC 2XZCH 4HIJA 4NJ9H 5AWNL 5EG6C 4JPKH 1IAII 3CQFA 3WLWC 2X28A 4CVZB 3ULUF 1R0AH 2FR4B 4LQ1A 3PUUA 2OMTB 2ZSWB 1F8TH 4FULA 2G4EA 4XNAA 3GTTA 4U1MB 5EU5A 2OTWA 5ESAA 2LW3A 3NIGE 3C9NA 1RHHB 3RIKA 2AQQA 3Q8EA 5DJZB 2AERT 1ZY9A 3PGCB 2QKIC 4PWIA 3ARED 2F8XC 1TQSA 4F5CA 3QO0A 2WBJA 4NQEB 5CP3H 2YD6A 3MRLA 2N0MA 4PY8J 1FL3B 2WYIA 3FC8A 3ZTDC 4F33B 1CLZH 5B3JE 4FC3E 1VCBC 4IYKA 5IB4A 1NGYA 3FFCB 3IFPB 3S3CB 3X1FA 1TTRA 2OV0A 2QPDB 4XAKD 3VXSB 1MJ8H 2EYTA 4B9CA 4OIAA 5FX3A 2EH7H 2VR4A 2PETA 4Y16A 4OD2B 2XCMC 5F9WC 2IANB 3UIZA 4X7FC 3PCYA 4RMVA 1OB0A 1MNUL 1RVFH 1SFDA 4NT6B 5DQDH 5F96L 3T4YA 2B4CC 3G6AB 2CKBB 1SYVA 4JANB 1G9NC 2VN3A 1FNGB 3J07A 4JPIB 4PRDA 4KDVA 4JN1H 4Y4KC 1ZT7A 1F13A 2BP8A 1NMCB 5D7LE 1KT2B 3ULSA 5J6HB 1U30A 2VAJA 4E9YA 1EJFA 4NQDA 1EZVY 1MJJB 4GT7A 3ZO9A 1G9MC 4MNGE 2A6IB 3CFQA 5FGCE 4QTIL 1OL0A 2KPWA 1ETB1 4MA8H 4D9RD 3DI3B 4CBPA 5J7CC 4OKVA 1FFNB 5CGBA 1AGEA 1KTCA 1XF2A 4B60A 4S10A 1JV5A 1KLUA 2G9KA 3JV6A 2DF3A 4APXA 5ICYA 1AY1L 5FYJE 4OSUH 5IJKA 3O3DA 2UXVA 3FB7A 4M5YH 3F6JA 4JO5A 1NIFA 1TT6A 1ZVSB 2V17L 3CC5B 3LMJL 3B2UC 3TVMA 4K2UH 3F5WA 4QRQB 5GGTA 1UD6A 1CF8H 4KJQC 4XMKL 5EBWB 1R3LB 1Y0LA 3NCYS 4R4ND 4ABWA 1G43A 1RIVL 4BIKA 5ID1B 1MELA 3B7YA 4ELKA 3ESMA 4P4KC 5JYMA 5F71A 3VQ1C 2WQSA 2BIIA 4PP1D 4OZHE 4WV1C 2R7EA 2X42A 3W0WA 1OLLA 3T2QA 2XA8H 1JGDA 2XQ0A 3OG6B 3WO4C 5CGTA 1X5HA 3WN5A 1MCCA 3BN9D 2E8ZA 4N0UA 3ZTNH 3FFDA 3ZDYF 3V6ZB 4LCYB 4JDEB 3MX0A 4AG4H 4E9LA 1BJ8A 4OV5A 1N70A 5IMLA 1UOLA 2XU9A 1F58L 4G8EB 5HGBA 5ADPL 2W9EH 5J4MA 2YJQA 2H2PC 4YDJB 2AQPA 3MCLH 3FT0A 3R18A 3V6OE 3ZO0A 4DGYH 5I75C 2X3BA 2H1PL 5B1AB 1UA7A 3DX9A 3POCA 3ZXAC 1Q8MA 2BW5A 3MC0A 4GO6B 1CGSL 2JFCA 3VFVA 3MTXA 3X3GL 4ZUTA 3P2BA 3UDWC 2TSBA 2BWIA 2KDYA 4G43A 1OHZA 3WNLA 3S3JA 2XG4A 4EI6A 4CVXA 3U6XS 4NFCA 2VERN 1HILB 2YEVB 3WIAA 1THCA 1LO5B 4DKFH 3EAKA 1U8KB 5BS0A 5AB0A 3ZDZF 1VCAA 3KXFB 1UD2A 3IJYA 1ET5A 4M6ML 4M7ZC 4HOXA 1NC4B 1KG0A 4KROB 2OZNA 2C3HA 3UMTA 4YOKA 5K9OB 5LCVA 1SQMA 4B7IA 5AAPA 4HEMA 4NP9A 1T1WB 4XZUB 5L4IA 1SEQH 3OQ3B 4YMPA 4IOFC 1I1AB 2A9ML 3H9HA 3BKYH 5HTSA 1ET7A 1FDLH 3QZWA 3GPEA 5AVTB 1N5YH 3ETTA 2OMYB 4L5FL 2HCZX 1GZHA 4PJHE 1PZUB 1WAEA 4ZODA 4PWFA 1F0LA 2HJKA 5D1QC 4AGPA 4PJFE 4KQ3L 1BQ5A 4G11A 3GIZL 4QXGL 1QHQA 1A0QH 2QQNH 4HBQA 1V54B 4IOIA 4Z7VA 4UQ3A 4Z7UE 3NPZB 5CZXC 4L1LA 1B9ZA 4PJ5B 2ZCKL 4F27A 1VGKB 3SPHA 2Z93A 3DOIA 5E4OA 2VABA 1WFOA 4LPCA 4IOSA 4PW9A 5AYUL 1HZHH 4EIBA 2E47A 4MD4B 5DMIH 5SWZB 4RAVA 5JA8B 1ZK5A 3C5ZC 3X3FL 3S37X 5JIPA 3RDTB 5IMOB 1CFVH 1EJOL 2AAVA 3L3GA 4RMRA 5FKAB 4UDTA 3AW5A 2OXGB 4F1SA 2L7EA 2X4QA 5D96B 1BJ1J 4F80A 4GUCA 4NRXA 2O6FA 1C16B 4G71B 1KJMB 2PPFA 4UM9B 5PAZA 4QRRA 2D8KA 5HDBF 1K3ZA 1BFVL 3LPGA 4PW4A 5GGTL 3TO4A 5LN8A 3D85B 3NJKA 3HE7B 2XJLA 1PYWA 2OYPA 4EBQL 3NT0A 3D18A 4OBSA 1HHHB 4JKLA 3FTGA 1E3ZA 2OJEB 1I8KA 3TYGH 1ETA1 1Q0XL 3KBPA 2HRLA 3UZVA 4LEOB 2Z8SA 5D5MF 4F5CE 5A3IC 4FMKA 4NZTH 3JWNC 3AWFA 4AQ1C 5B21A 3CVBA 5IBTL 4BQ8A 5FOBA 3VCLA 4M8QA 3C6EA 2B1AL 4LRNL 5AW4B 1ETZB 3GGWB 1RK7A 3VG0L 5IGXL 3FBKA 1J8KA 4ENED 3DLQR 3KNBB 3QUXC 4AJ0A 5E1HB 5BO0D 5KAQF 3PIQA 2PMZA 5KYXA 4N2DA 3K6DA 1KIUA 2GT9B 3GB7A 2MKLC 3AWGA 4A67A 1CD1B 4DQOH 3SDCC 2WIMA 2EC9T 2UY7B 3NEXA 1Y07A 3MXWH 2CO7A 4X4XA 4XAWH 5DEFA 5DI8B 5F8RC 4KGLA 4X7DC 4PJIE 1CXEA 3R8QA 1BA9A 4GS7B 2FNBA 4GUOA 3TWYA 3WY3A 4W9JC 1C5DA 3L3OB 3HC3L 4FMVA 4NQDE 8FABA 3SQOL 1J5HA 1LTXA 1DN0A 5EHFA 4F7TB 4LPYA 2VQTA 2X4NB 4LO9A 1ZHLB 5CLZA 3DV6A 3QORB 2BS9A 1PZ3A 3C5SB 5L4MA 4WFHE 1AMYA 3N44B 4K94H 3X13B 5IB3B 3B9EA 1AJ7H 1DVSA 5T3XE 5K93A 2E6PA 4AVJA 4JFDA 2E86A 3H9YA 4HXBL 3D08A 1BJ1H 4KTEH 2PR9A 5BUGA 1XR9A 4MB1A 1RSYA 1KYOK 5A1AA 4M9PA 1I1FA 5CCHE 4IGBD 5I18H 4TNEA 1RMFL 5JW4N 1AE6H 3MLZL 3OSKA 5GS2H 2WP3T 5DD1H 2D03L 3T71A 1XCTB 1PSKH 1KN2L 2FYYB 4ZX6A 5LCVL 1UM6L 4HUUB 4TTDC 4NYLB 3US9A 4FXKB 4PLKC 3NSXA 1MIML 2JLLA 4YSCA 1UTDA 4F20A 2WBWB 1URZA 1DVFC 4PJCB 2JIXA 5C0EA 1TJGH 3EJTA 4NHCH 3NDZE 3W39B 1VENA 4DTGL 2JTYA 4JKPH 3W0WE 3WY4A 5AZEH 1BZEA 2Q2EB 4FABL 4U2YA 1O6VA 4C4UA 2B15A 2Q2LA 2MEJB 3VDCA 2NXZC 5EZOL 5IFAH 2EZ0D 2OMXB 3S8FB 4N0UE 4XXWA 5EEWA 4OIIH 2ADIB 5EF3A 2HKHL 4ZFFA 4N9GB 3T65A 4Z7QB 2GSIA 4CADA 4UIKL 2KQNA 1I3RB 5H8DA 2BHZA 1QBAA 2CLRB 4L48A 1G7HB 1XGUA 5EIIG 3H3BC 5J89A 5TDOA 3X2QB 4V2CB 5BZXA 5E5RB 3AUWB 3K8MA 5C0BB 5LG1A 1IQWL 1R9FA 3Q6GL 3UBXG 5J3HD 3PWUB 2FJFB 3OX8B 1NBCA 3UJTH 1TKWB 3ZTCC 2IXQA 3WS6A 1E90A 1OF0A 5GS0H 4HH8A 4PBVC 5CSBA 2IPKA 5IBLC 4MRCA 4FTDA 4I9WD 3RL1A 3VXTB 4CNIB 4UDUA 1UCBL 3I84A 1Q94B 2R2HA 2YD1A 1ZLSL 4EI5A 1T5XB 5BS0E 2BC4B 4DERA 2HUEA 5FV2A 3ZMNA 3FYIB 5EORL 3TNMA 4P8QA 1S3KL 5LNEA 1E8YA 1X44A 1ZHBA 3DTDA 4PB0L 1A8ZA 1ONQA 4FHJA 3OPZH 4ISVB 3MBEB 2WY3B 3EHBD 1Z9SA 2GIYA 4HEME 4IRJC 3BP4B 4K9EH 3COOA 1E4HA 2HFFB 2V2WA 2E7CA 4KH9A 5DTFB 4ZX5A 2WLJA 3RUGF 2E46A 3Q1EA 2CGYA 1ZANL 4X2UA 1IL1B 1YEGH 3CDZB 4P05A 3AXHA 1ECZA 3OV6A 5E0FA 2XWTA 4PTTB 2I60H 3IFOA 3A22A 3LQAH 1UZ8A 1U8CB 3KGUA 4TQEL 5INDA 3H6JA 4D94A 4JFOA 5LVEA 1XHHA 4WHCA 2KLSA 5B1BB 4Z7VE 5JDJA 2VL5B 4M1DL 4N25A 2WV3A 4J4PD 2C34A 3T6XA 3HNSL 3NSYA 4PJGB 1RZQA 1EVTC 5DHDA 3VA6A 1YAZA 5DT1L 2CD0A 1NSNH 5HHOB 2YD0A 3U7WL 5IHLB 2IG2L 5F1KC 3DGGB 4P3CH 2JE8A 1UB6A 4HG4J 1A6ZA 4ZJ9A 1T3FB 3X12B 2DJMA 1DP0A 3VD2A 4AEFA 1MDAA 4HBCL 2HUHA 1S7RA 4Z3EA 1HH6A 4JFSA 1R3HB 3KPNB 4QRRE 2ZNXA 5D2NC 2X1XR 3CJJA 3B8YA 1GW6A 3QH3A 3WUWA 1IV8A 3MNDA 1MFUA 4EDWH 2PYEB 4D9QE 3EJJX 3AJ7A 4YDMA 1NEZA 2ATKA 3PJSB 2AC0A 1G4MA 2RIKA 1EPFA 3N6YA 3MLRH 1J8HB 1QWHA 4NPKA 5ILTL 3D4CA 4JM0A 3B9AA 1T2JA 3MMEB 4NSKB 1A1MB 3V0JA 1BWMA 4MCZB 1KZYA 4IRSD 3D06A 4HS6A 1XXDC 4XOBA 4FQXC 3BVWA 2WZ0A 3F00A 1HINH 3T2NL 2BIMA 4DOHB 2C9SA 5G5DA 3RU8L 5TE4H 1U36A 2QDVA 2P80A 3FQXB 1OW0C 3VG9C 4GG8A 5DD0L 3QUZD 1SBBA 5C70A 3CPLB 4JFED 4RWYL 5HYJA 4HIEB 2CLVB 3DPBB 1FV1A 3THMH 4NZUH 4M6NH 4OZIB 2BWQA 1UOKA 3O6FD 3S88L 2VDKH 4BSJA 4E5XA 4WUKL 1H8OA 2M83A 3HS0B 3O11A 2XLLA 3QYCA 4UINL 2ZOWA 2EVGA 3TNNB 3WXWL 3L1OL 1YG9A 3GBDA 5T5NG 3VYPA 2OR8A 1QFWI 5I1AB 3O2WH 3R8BB 1BVLA 3M45A 3SGKA 3L5JA 4RLDA 2GSMB 4MS6A 3HR6A 1P4IH 3JV0A 1M4KA 3ARDD 4WI5A 3HN8A 4NENB 4GKLA 5KTEH 2AV7A 1K6QH 2WLLA 3MZGB 4TNVF 1TZAA 4X42A 4AQAB 1NUNB 2HFTA 2VZOA 2VDRB 3O4LA 2E4FA 1XFPA 3L5WB 5AVSB 1S9XB 2VDQH 3I3DA 2XWXA 4MNHA 4JY5L 3EYQD 2JB5L 5LXGH 4TOYL 4S0SD 5FK9B 5H4ZA 3T5WA 1LO4H 4HUMB 1S7XA 5BZWB 3IEAA 3RVTC 4PLOB 4FLHA 1O75A 5CGYC 3RWDB 2I7OA 1AYRA 1PGRB 4AE1A 3FRUA 1TQVA 4RRPA 3AS0A 1AOZA 2HKAA 3G5XB 3UAJD 4H88L 4BJLA 3JVGC 2C7UB 3TJHD 5H37H 5C97A 4HPYL 5BVJA 1PCSA 2IAMD 1ZOXA 1BF5A 3D39B 4XPAH 1W9XA 2H7WA 1UA3A 5ANMB 3OG4B 5K1NA 4OLZL 3KPPB 5CD5C 1U42A 1A6TA 3TIDA 2R1WB 4UMSA 4YE4H 4U3CA 3WLBA 3R1GH 4UUJB 3MU3A 5TF0A 2CNYA 2FWOA 4GBXC 4X6FB 1OK8A 5ERWA 1AI1H 3U0TA 1MLCA 1UD3A 5C8JB 4E68A 5IJBC 2BIOA 2DV6A 2CCWA 4G3YH 3S3DB 4BV1A 4XC3H 1BDYA 3ZE1B 3M86A 4P5TA 4Q6IC 4AZ8A 5SWSD 4OD1L 2FK9A 3C2SA 3A6CL 2DLIA 5KS9B 1U8HA 3IGFA 4PG2C 1SXCA 3ILQD 2D7PA 1F1AA 1JMXA 2YSSB 3MUGB 4JN2B 1IE4A 2BSRA 1FNAA 2ADYA 2R8SL 3GSNA 2OJZH 4LLVB 4WCYL 5CEZL 2H41A 2HYMA 3IDNA 2R51A 3MNZA 3MJ7B 3EGXA 2P8PA 5FYJH 3MFFA 3T0EC 5JQ6L 1HHJB 1HNGA 2ZQKA 3I9IA 3KG5A 4NM8H 1VAHA 5CEYB 1LP9A 1S9WB 1XTMA 1JTOA 1LHZA 4UQEA 1D5IH 2BVQB 3S3PA 3DVIA 2JKLA 4QTHB 1FGNH 2GTWA 4O2FA 3I50H 4HUXB 2C3XA 1UXSA 3TBWA 1N2RB 1ZEAL 5DEJA 2MCAA 3RNKA 4MMZC 1GGIL 3CXHJ 4KC3B 2A9AA 3QIWC 2R23A 4NI6A 4ELMA 1RUPH 3QWRD 2D0HA 1DQIA 5KN5A 4R7DA 3BPLB 3N04A 4QXUH 4F93B 5G2NA 3BSZA 3D3VB 1LMKA 4P46C 1P84J 1CGVA 1BIIB 3RZCB 4P2RB 5D7HA 2FZ3A 1KY6A 4WEBL 3T09A 4XCYB 4LSTH 5D7JD 3ZL1A 1BAFL 1U8QA 3CFIC 3QZWG 2OMBA 5EU3B 1XIWC 3SJVA 1E2VA 2NY0B 3OMNB 3RKDD 1NGWA 4P23B 3WNOA 1XF4B 4P2QD 3FH7A 2VDLL 4ERSL 5IP4A 1AACA 1NFIB 2BRQA 2DQJH 1AANA 2RMNA 1XGQA 35C8H 4WQOA 2ZTBA 4KRPD 4QNPF 2NY7L 2AKRA 1MCDA 3JWDH 3GSWA 4MNQD 3C60C 5IFHL 2CPUA 1M3JA 5CEZE 5BV7B 1T20B 4ZFOB 3U1SH 4AQEA 5ACMA 4IIQB 3ZT5A 1DQJA 1S7UA 3EFOB 4OCYH 1XO8A 1MZYA 3EJPA 4MJ6B 5D7IA 2J7LA 3QULB 5TQ0L 3P4LA 3SDAA 1IM3B 2BZCA 3GD1C 4P2OA 3T6ZA 3SGDH 2AVFA 1XH0A 2Q8BL 4MD0A 3W9DA 3LSOB 4YAQB 3GT6A 1SUJA 1LEGA 5DJCA 2LLGA 4DO6A 2ZYRA 1U8IA 4KXZI 2G3MA 1IEHA 2OI9B 3P4NB 3QAQA 1Y6KR 2C1PB 1T7XA 4W9HC 1E8XA 2VSDA 4LOUC 4OLVH 3SQBA 2KPNA 2UZXB 2VJ8A 1DVQA 2FSEA 3CBRA 2VLJD 1KPRA 3NACH 1CG9B 3EGDB 4NUPA 3EH3B 2F18A 3IXAB 1BZQK 4GUPA 1P2CB 5D1ZD 3BIKA 2RFXA 4TPRH 4WEEA 2DBJA 3N1FC 1F41A 5FXCH 3WAKA 4Y5YA 3UERA 2EADA 1ID5I 2AITA 5DJ0A 4GMTH 3KWXA 3QUMH 3O3EA 1B4JL 2GW5A 2UZYA 1HL4A 4XRCB 4XXDA 1W16A 2CIKA 3DTXB 5AW0B 1ULVA 3NH7L 5GRUL 2DMKA 4H1LA 3AM8C 4XX1G 2YPLE 4FL4C 1EZUA 2XNAB 3DHMA 4P99A 1F1GA 4M7JL 4JE0A 3GSNL 3BE1L 3OHXB 5EF0A 3VGHA 1HCVA 2CRZA 1CGSH 3I3BA 5F0LB 1FC2D 5EIVA 5I23A 1WQVT 3MLWH 1OE3A 3BDYH 5D2LB 4AJYV 3VFRA 3OKEA 3N55A 5LBSA 3HZVB 4RBPK 3G5YB 3CDGA 4ES9A 1HWWA 3C2AH 4L05A 4GSUA 3WKML 3MZTA 5IREA 3NCBB 1QLRA 4ZK8A 2ZYIA 2FSDA 4Y1AA 3CN1A 2EUVA 1JNHB 3TV3L 1H15A 1NGZB 3TC9A 2FLRT 2ZJSL 4GG6A 4L8DB 1FNSL 4RAUA 2GBVA 2XG5B 2VM4A 3EOYG 4Z0XA 3N41F 5AOKA 1QSFD 1A9EB 5IHZA 2UZIH 4APQC 1KB3A 2D4FA 3BSZL 5AAMC 3BO8B 4MX7B 2CH8A 1P7QD 1WC7B 3HJEA 4M61A 3ARBC 2Q5BA 4WFFE 3RP1A 2X4OB 1E4XL 4MAYD 4YHOH 3VM5A 1GGBH 4BKLB 4N5ED 3ROOB 2AEQH 4M6OH 2F2HA 4HLZG 1YPZB 4XPFL 5IW1B 3GUTA 2YWZA 2A9NH 2ZUVA 1KBKA 3QDAA 4MQXD 1B2WL 1EMTH 2A1WL 3BIBX 3OR7A 2HKFL 2HT3C 5FYLH 3LZQA 5B8CA 1SJMA 2YAQA 3ATBA 3FB6B 1REIA 1TIUA 3HC2A 5JR1L 3FUHA 43C9A 3AVEA 3VI4B 1ZLVH 3VWKC 5BVPL 5IQOA 5C0RH 5T3XH 1X6NA 3GSOA 4BWUA 2R56L 4JO8A 4D7BA 1YEKL 3MYZA 3T8MA 1KULA 3Q2VA 4FYTA 4U7SA 3KVPA 5CBEA 3IPFA 3EJZD 4XVUD 1LP9E 4OZFB 1EK3A 3BZEA 3RGVC 4XVJH 5BOZG 2WLYA 5IOPB 3LKOB 4UQCA 5BZZA 3RI5F 2Y7QB 4HEPG 1BZDA 4WNSA 2X89A 1UKQA 1YEDA 3IVKA 3QISA 5CU9A 5IMKB 4PRPD 3SKOA 1IVLA 1OT4A 1C12A 3DX6B 1JGEA 3U4EA 2RACA 2ADFL 4GRLC 4ELME 5J57B 2HT2C 3L95B 4Q2ZA 3V7MA 2ZOKB 1J1OL 4N3TA 4HUNB 2V7HA 4ZBJA 5HHME 3TXAA 2PO6D 4YXKH 3ZMRA 3VGBA 4X6DF 5FA3A 3OKNB 1M9SA 4P0DA 3K2KA 3R06A 3OKKB 3TBYB 3PU7A 4O9HL 3VSVA 4JY4B 5E2WH 3SJVE 5FPIA 1GJUA 4D9LL 1GZPB 3EFDL 4XXCC 4L8SA 2X4SA 3DETD 5H94A 4LCCB 4JPWL 1RI8A 1Z0MA 3ZDYB 5DS2A 1S5HA 3DJ9A 2N7BA 2QL1A 4QHNB 5DJDA 3BP6B 5I5MA 1GZQB 5I8CB 1D5RA 3P3YA 5G4OA 4DKTA 4I88A 4RSYA 4QXTA 4LHUB 4X6CA 4AGQA 5JOFA 3IMRA 3ULVD 1GGCL 3MOQA 3QUKB 3TEUA 1HEJC 5LBSL 2BWDA 1J9RA 4PJAA 3TZVA 2Z4QA 1I7RB 1QTPA 3NFPB 4P4RB 5A40E 3SE4C 5C09D 1MPAH 3RDJA 3WL9A 1CMOA 2EXSA 3N40P 3NTCL 5EFIB 4LLQA 3ZTJH 3QAZC 3ME0A 5KSAA 5GZOD 3QRLA 4P9MH 5DMGD 2XRAL 3BFOA 3L4UA 4LLAA 1ITCA 5JQIB 3MRRA 1U93A 4N2MA 3WENA 1MWAH 2X1OA 4HV8B 4K5OA 1F6LL 4HGWB 4PSPA 1TMQA 3QZMA 4ODXA 1ZA6A 3WUWG 3RNQB 1NEZG 32C2A 4PJDB 3LZRA 1KYUA 4UAOC 1M2OA 3NSFA 2H3XC 3LDBC 1I8UA 2W9DL 3CHXA 1JF1B 5DQJB 3UPRA 5ICZB 4LQFL 1YN6B 2K8QA 1I1YA 4P2QE 5C6TH 5TGBA 1YYML 4WU5A 1HI6B 1XGTA 2OSLB 2XTSA 5EOQL 4JDVB 4WI4A 4L0YA 1M71A 3T0BA 1KLGA 4Q9QH 1AZBA 2XA3A 1DVUA 1T1YB 4NWUH 4ZMPA 1JAEA 2BY1A 4JRXB 5F1NA 1NDGB 5GRXG 3HN3A 4WW2F 2G2RA 1Y18B 4ZOAA 1VPOL 3CNKA 5HGDB 3GQFA 3O4OB 4FXGC 4CMHB 1G1KA 1KC5L 1RUAH 3OXSB 2AHIA 4Q6KA 1BVKB 4GRWB 1WISA 2QZQA 3FQYA 3QWNA 2ADJB 3FO0H 4M29A 1L0YA 3L4XA 2KT6A 3QRGL 1MFNA 3MRIA 1OAKH 2BXYA 4WSGA 4A7VA 3A67H 5DZ9A 1DJSA 2FHBA 4IU3B 4XMVA 5HSFA 4CVZA 5F88A 3AY4A 1Q9WA 2OMTA 3OKYA 3WJMB 4FNPA 4B6ZA 3CX5J 4U1MA 5I30H 2E7BA 4WI2A 1AXSA 4YBHA 3FTZA 1RHHA 5A2BA 3MREB 1I9EA 5DJZA 2WZ5A 3WHXB 1NGQL 2IEPA 3KVQA 1S6NA 4XMTA 4Y1AE 2ZUUA 3FUJA 4Q56A 5IV2B 4NQEA 3W5NA 2GIMA 1TJIL 1FL3A 4Y4FD 1MHHB 4ILDA 5EORH 3V95A 3RHWF 4GG6E 1KOAA 5CINH 1J7VR 4F33A 4NNXB 5LBGA 4DGVH 4PREB 3FFCA 3IFPA 3S98A 1EEQA 4HJ1A 2WCGA 3I75B 3QC5X 4YPJA 3VXSA 3L48A 25C8L 1O7DE 2WCSA 3KPSA 5A2LH 6FABL 4NHUB 1PY9A 4OD2A 4RQQB 4BZ1A 3FQRA 1Q0YL 4ZXBC 4L9DA 2K6WA 1NOLA 1UM4L 4JFPA 4HHAB 2DDQH 3G6AA 2CKBA 4UM8B 1MW2A 1FNGA 2AQ3A 3QA3A 4JPIA 4QRTA 1XL4A 3CFKB 1NCDL 3J8F7 2DWDB 4XR8C 1G94A 4LKCB 3ARGA 5E95B 3QDJD 4O58L 1KT2A 3DOHA 1ROCA 3NJIA 3C08H 3CH1A 1MJJA 1KIRB 3WFEH 2P5WB 3MA7B 4IBSA 1T1ZA 4JCWA 4NWTL 2ICEA 3H3PL 1T03L 2W38A 3IDJB 4JHVA 3D51A 4MQTB 1HIML 1G1OA 4GKOA 4B50A 1NMAL 4EN3C 2O5ZL 3VD3A 3G08A 4NO0D 1FCGA 1INQB 1Z9NA 2YK1L 2APTA 1J05B 5DURB 5DK0B 1HNFA 1ZVSA 3MJ8A 4OIFA 1NGPL 2WAQA 4HJJL 4QRQA 3BGFB 3HBQA 4JRLA 2YKLL 4IBZA 2XWCA 5DUPL 3AY2A 1R3LA 1T4KA 5ID1A 3CSYB 3BRDA 5CXPA 1AO7B 2FDBP 4XVTH 3WLWD 1OE2A 4ODWB 3KXFD 1A4KB 4MMYA 1I1CA 1NC4D 2DQUH 3GKZA 4GSDL 4Q14A 1QLFA 3CC1A 5AYQA 3MJWA 1GPOL 3PAUA 3PWPB 3KPQA 2DIEA 4QJ5B 3LS5L 1SOXA 4DKEL 1KCSH 3NRQA 4PWGA 1YEEL 1A7PL 1CD8A 2UXTA 4LCYA 4OCWL 4PY7A 4JDEA 3V6ZA 1QTSA 4ZD3H 4LPVA 2QADB 5JIHA 4G8EA 3BVXA 5JDSB 1I8MB 1H19A 4YDJA 3H85A 3SCMC 2DPKA 3GMRB 3VTTA 5E1IA 5AVQB 4ATWA 4J3OC 4NPYB 5CS7A 2GYSA 4Z1PA 1CLVA 4KVPA 2VDNL 4KOBA 2P44B 2J6EA 1M6OA 2NUTB 3ZSTA 1EHLH 1ID2A 4HISA 2P8MB 5MEPB 3EYUH 3L7FB 1OTTC 5JO5B 3KLHC 2IMNA 4QRBA 2P52A 1IBGH 2ZWYA 1U6AL 4GP5B 4IK6A 5IVOA 5CFHA 1YMMB 3ABLB 1KBGH 4XI5C 7FABL 4L3EA 5IHWA 4NOBA 1RAMA 3WEAA 2W60B 5ENWA 1OAZL 5F7UA 2E9WA 4LCWD 1LO5A 2BVTA 4KO6A 4U6YB 3A4EA 4QYOB 4AEIL 5C0AE 1KXVC 1S7SB 3MUJA 1IIKA 1XF5B 4Y5XC 3IXTB 2HT4C 2WXIA 4U1JB 1IBDA 1NAMH 2J2ZB 1R47A 4YZWA 3OAYH 2WSPA 4AXWB 3D85D 4JY5H 1D2OA 3DHPA 3G5VB 2Z6FA 1WFMA 3LEYH 5K9OA 5JOPE 1CXHA 2QMJA 4EXKA 1T1WA 3B2UD 4LLMB 3VXPB 1I1AA 1EBPA 3M07A 4Z3TA 2QJDA 4KJQD 4N90E 4BZ1L 1UH3A 1Z3GH 4V1DE 1EXGA 2H26A 3GRGA 1WA2X 3VSUA 3LV3B 2CKBL 4JFXB 4P4KD 3S2CA 1QFHA 2UVFA 2ZE0A 1EFQA 1I7TB 1BXVA 1M7UA 2ENSA 3LY6A 5ICUA 5FR3A 4BK5A 1BX2B 2VXSL 3L3KB 5DHXB 2K3TA 2V3DA 4PJ5A 3BN3B 3OPUA 1VGKA 3QQXA 1D6VL 3P3SA 4FAAB 1MHPH 4W9KC 3SO3C 1AQKL 1H3WM 4A68A 2D9CA 3QR2A 2VDML 1MW0A 5CIPA 1S7QA 5DF0A 5SWZA 3QUYA 1G7QA 1OE1A 4BQ6A 2F8OA 3NQKA 5FWRA 3RDTA 5IMOA 3WFZA 4PJBB 4K7FA 5FKAA 3CN4A 2OXGA 1T0PB 4P9HH 4YL9A 2H2PD 2O5NA 3VGFA 5I1CL 5EULV 4BUGA 4C83B 3CSBA 3BVUA 1ZTXL 1BFSA 3U7YL 4AYGA 3UYRH 3RIFF 1KJMA 1I9RL 1MFAH 3P2TA 4KNSA 1NCWL 1UZ6F 3HE7A 3N9GL 4G8AC 2HG5B 2WOYA 5BQ7A 4ZOCA 1JP5A 3IDUA 1HHHA 1SHMA 4CC4A 4EIGB 4A04A 4PJEF 1FNFA 1XWVA 1E7UA 1AVAA 1K2DA 1QEWB 2Z92A 1IBYA 4FQ2L 3S97C 5JPMB 1HE7A 4WWKC 5AVRB 1GTFA 2NY2C 4OGAC 1HK6A 4NQEE 4HX1B 1BEYL 4AVIA 2MCPL 2PW1B 4CN4A 3F12B 4KUCD 4LXFA 2BVUA 4M62H 1N8ZB 4KXBA 4ZMXA 3TF4A 1S4IA 4YX2L 1M42A 1A9BB 1EANA 1MCEA 1MCIA 4LSRH 3VXUB 3FFCE 1ETZA 3DDFA 3GGWA 3CVIL 2BSTB 3VXSE 2HRGA 1SFHA 2AXFB 3GUFA 5EC2B 1MXGA 2BVOB 1JIBA 1IC5L 2CLZB 3MCKB 3ZMEA 5E23A 2IANE 5JLZB 1CD1A 4QLWA 1R5IB 2H3NB 4KBPA 2ZUSA 1KLFB 1QX1A 2WP3O 4O51B 1EV2E 1KY7A 4IOFD 4HWEH 2VC2L 3HMXA 3BZDA 1IAIL 3V0AC 3GJEB 3HC0B 2PCYA 3VXRB 1JPTL 3ARXA 2EDYA 3NABH 3NIGF 3L3OA 1ZS2A 4DW2L 5C7XH 1KDJA 2J6EL 2GJRA 2IAAC 3CFCL 5I8EB 1OSZA 1ZHLA 5D1QD 3QORA 4TMPA 3C5SA 5DD3L 1TO5A 2IV9A 3X13A 1PZDA 4R84A 4NZRL 2DQEH 3ARFA 5CZXD 2CRIA 1B4LA 1ZMYA 4RMSA 4UOW1 4EOWL 3FCUB 2JI2A 3QXWA 5B3JF 1P4LB 5C0BD 4GXFA 2KBGA 3MLYL 4G9FD 3I74A 1WFIA 1RZFH 4C56D 4X5QA 1ZTXE 3ZKSD 4P5RA 4V11A 1FN4A 2RALA 3C5ZD 1KGWA 1ZIAA 1R3IL 3JZ7A 4P2AA 3HRPA 4Z6AT 4J3SA 2WLKA 1CGTA 2FYYA 1GYWA 4FHBD 4HUUA 4DVBB 4NYLA 4FXKA 1HSAB 4XVSL 5B38A 4NNYB 5EZIL 2ZF9A 3MBXL 5FHAL 4XP4L 1CS6A 4Z5RB 1BF8A 1GC1C 4PD4J 1FG2B 3HNVL 4ZNEA 3DARA 3HC4L 4Q4EA 1A7BA 1TQCB 4A39A 3NA9H 4PJ7B 5L7XH 1OPGL 1SDAB 2NY1C 2P26A 3MBED 3HJ0A 2OMXA 2XV3A 4CMMB 1JXKA 4NFDA 4DGIH 5A3ID 4JJHA 5GISL 4N9GA 4IU2B 4R0LC 5E6SB 2AEWA 4R7LA 1MNNA 2GK0A 3GLAA 3HMWL 4UOJA 3L5XL 5J12B 4PS3A 1L9MA 2QQKL 4EMZA 4LKXB 5GRJL 1VIWA 2AEOA 4H25B 1LDSA 2HFEB 5DQ9B 4IDJL 2WO2B 4J28A 4J2XA 3SDCD 2V9QA 4A2LA 4DEWA 2MIZA 2PR4H 3C6SA 3PWUA 2FJFA 3OX8A 3VUAA 4YNYA 2VN6A 2ZOUA 4OZHF 5HHOD 1L3NA 4OLXL 3AREA 3V10A 2VXQH 2DD8H 2JWYA 1J11A 1MAKA 4LFHD 3VMPA 4L8CB 4L3EE 5FDWB 3IK2A 4URTB 4FQJL 2X6CA 2ZKXA 5I1JL 4CNIA 1D5MA 1Q94A 5DRWB 1IC7L 1S8DA 3BQUB 3DHJA 3DMMB 1T5XA 1XL6A 2VB5A 3MNWA 3BSHA 4YWGH 2X3CA 3T3PE 2BC4A 1UJ3C 1GYUA 1GOHA 4ZQKB 1ZE3H 2DWXA 4N5UA 4YSUA 4NQXB 1GRWA 5FGBC 4FNLL 2EAEA 3UP1A 3GF8A 5AKVA 3LTVA 2Y5EA 4LVHC 4PRBB 2BO0A 1WPCA 1NQBA 2DIAA 2VITB 4ISVA 2MNJB 1E0OB 2E6JA 3BP4A 1NTDA 3HB3B 3HNTH 4G7QB 3WE6B 1C7TA 5DTFA 3FDWA 1SDDB 1ZXQA 4HIHB 3QS2A 1MFBH 4ZUUA 1IL1A 3CDZA 3HPJA 5DWUL 2EDBA 3BRGC 2XWJB 4K3JL 2FO4B 4PTTA 3TBVB 4X0NA 1G6RH 4PLKD 1BZ8A 2EYRB 2J20A 2KZ1B 3L5HA 3HLKA 1U8CA 1NLBL 1UH2A 3HMXL 3CXDL 5F2FA 3MODL 4IMKC 4JFTA 3P11H 2VL5A 4Y4HC 2Q8AH 4Q97A 1WFNA 4PJ5E 5IT2H 3N40F 4A7GA 1EQWA 1SEBB 2NXZD 2EDOA 2HTKC 2X4UA 2YKKA 4TF4A 4BSWB 2YEQA 4JR9H 1HXMB 5SWZE 1PLAA 3TT3H 2ZXAA 2HX8A 3DGGA 1CT8B 3BKJH 5J1TC 5KBDA 1MJ7L 4NPJA 4UT7L 1MREL 5DA4A 1RZKC 4IRZA 1P6FA 3KJ6H 1CDGA 2QSTA 3ILDA 2VAAB 3LKSB 3M6DA 4QGTA 2YFOA 5ISZB 5HDLA 2BW4A