4DP2X

The 1.8 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp2X00
3FU9A 2PP7A 3RYMA 3CVDA 1AZUA 1HAWA 1X9UA 2MRYA 4A66A 2XUWA 3NP4A 1EHKB 1ZDQA 3UADA 1V54B 5B7FA 3GXUB 3FQ1A 5AZUA 3X1EA 5I6PA 3AG4B 3T6ZA 3ASOB 3SBQA 1KDJA 1OCZB 1OOWA 1CUOA 3NJHA 3PAVA 4DP6X 1SDDA 1AR1B 3TA4D 1JXDA 3UABA 3UACA 2BP0B 1VLXA 2IDSA 4KOCA 3FU7B 2FT6A 2WO3B 3NJMA 2CUAA 2P80D 4P5RA 5PCYA 4BDVA 2PCYA 5EHFA 4UANA 4YSEA 5F7BA 3NYKA 2IDTA 5B7MA 2HZHA 2R7EB 2DYRB 2EIKB 4YSAA 3QJRB 1WAEA 1MDAA 2XU9A 1B3IA 3OMAB 1GS8A 3BVDB 4DPCX 4DP0X 1MG2C 1WA1X 2XV2A 2BWIA 3QJQB 2UXTA 3CDZA 1BQRA 1OF0A 2YAEA 3SBPA 3NP3A 2FNWA 4EF3A 4FA7B 2TSAA 2HX7A 4GY4A 1BQKA 3ZDWA 2GB2A 5I5JA 3NSCA 4UAHA 2VMJA 2EILB 3JT2A 1URIA 2BO0A 4YSDA 1MZZA 4HHWA 3WG7B 3DKHA 1NWOA 2BP8A 2NRDA 3AY2A 1YLBB 2I7SA 2XYBA 3IN2A 1NIBA 3FPYA 5B3SB 1ET8A 1KBVA 4G72B 5B1AB 2XLLA 2YXVA 4PCYA 1F56A 1KCBA 1WS7A 1BXAA 4G7QB 4AKOA 1X9RA 1JZFA 4KOBA 4DP9X 5AFAA 1L9SA 2VM3A 5TK2A 1ILSA 3JTBA 2CCWA 3PPSA 1TEFA 3TBCA 2DV6A 2X87A 5E9NA 2YAHA 2XV3A 1OCCB 1PLBA 1A65A 1GR7A 2PPAA 3QJVB 4E9SA 3ABKB 2PP8A 3NJIA 1M56B 2VSKB 1ASOA 4RH4A 2GSMB 2ZWNA 1DYZA 1XB8A 5I6LA 1HFUA 1NIFA 2DWSA 2XXFA 4E9QA 4E9XA 3FSWA 1AG6A 3FT0A 1JXFA 1ILUA 1IBYA 4E9YA 3OD3A 3OMNB 2IDUA 1ET5A 2X88A 1AZRA 1KDIA 1R1CA 1NPJA 1L9RA 4DP8X 3IEAA 3S3CB 4DP4X 4YSUA 2JXMA 5B1KA 1QNIA 4AKPA 1T5KA 2QPEB 3KW8A 4A68A 1PY0A 1PLAA 3QJTB 1OCOB 1NPNA 3PXLA 3NJKA 2HX8A 1W8EA 4AKQA 1E5YA 3S3BB 2VM4A 2BZ7A 1JZGA 2J55A 2WSDA 2AVFA 1I53A 1IKOP 2BWDA 1CC3A 2ZXWB 3X1FA 2FQEA 3UAEA 5PAZA 4BWWA 1SFDA 1PCSA 2CBPA 1PZAA 4A2FA 4PAZA 3HB3B 2YQBA 5I6OA 3H56A 4A2DA 1SF3A 1L9PA 1SJMA 3C75A 4QKTA 2IWFA 2VN3A 3MBWB 1BAWA 1PF3A 1W6LA 2UXFA 2XVBA 3QQXA 3S8GB 2HLEB 3OQRA 1L9QA 1AIZA 8PAZA 1SHWA 1ZPUA 1WA2X 3X2QB 4W9ZA 4BXVA 3OMIB 1TEGA 2J57A 3N2JA 1PZCA 2YAOA 1RZPA 4YSPA 1L9OA 4G7SB 1DZ0A 3EH3B 3UAAA 2AANA 1SDDB 2ZOOA 3N55A 4TXVB 3FS9A 1BXUA 4DP2X 1OE3A 4YL4A 4BDVB 2XWZA 4WKXA 1M9WA 1ZDSA 2XX1A 1NINA 5F7AA 4DP5X 3IBOA 1AS7A 1SHXA 4UF7C 1RCYA 2PPDA 2DWTA 1BEXA 3HEIB 3OM3B 3TU6A 1SNRA 3PAUA 1QLEB 3FYIB 2DYSB 1L9TA 2YXWA 2VW4A 3CDZB 3X1GA 1PNDA 4NB7A 4YSOA 3U25A 1JOIA 2QT6A 4HZ1A 4E9TA 1A3ZA 3IN0A 2I7OA 1WA0X 4A67A 4YSSA 2EIMB 4BWTA 4BXSV 1SF5A 1NIDA 3T6VA 4BWUA 2PP9A 1W6WA 3WNIA 6PAZA 2Y1AA 4G7RB 4DPBX 3NJLA 4G70B 2BP8B 3CVBA 4HCGA 1XB3A 2PPFA 3NJGA 4HAKA 1JXGA 1N68A 2JKWA 9PCYA 5LDUA 2Y69B 1BQ5A 2BHFA 1BYPA 1M57B 2HXAA 4P5SA 2VW6A 1NIEA 2IH9A 4DP7X 3NSFA 2QDVA 1A4CA 2XX0A 2YAMA 1SFHA 3FPXA 3H4FA 2A3TA 4CSPA 2ZONA 3ZBMA 2BW5A 2FQDA 3NJJA 4HHGA 1JZHA 2GI0A 1NIAA 4ENZA 1TKWA 4M3HA 2FWLB 2JFCA 5I6KA 4YVUA 1AS6A 1OE1A 3T6WA 2XV0A 4X4KA 3FU8A 1J9TA 3FQ2A 4YVNA 3SBRA 2UXGA 1QHQA 4GP4B 5D4IA 3SQRA 2GBAA 1AAJA 2CJ3A 1ADWA 3FSVA 5I5IA 2FQGA 3CVCA 3ZIYA 1PNCA 2YAPA 1XB6A 2GC7C 2EIJB 3WIAA 4G71B 1V10A 1CURA 4KO9A 2UX7A 3G5WA 4GYBA 4E9WA 1MG3C 1AQ8A 1ZIBA 4AX3A 3AZUA 1NWPA 1OE2A 2IAAC 3NSYA 4MFHA 3QJUB 2VSMB 1MZYA 4CSZA 4KNTA 2H5UA 2TSBA 2OJ1A 2IWEA 4BK5C 5ANHA 4A2GA 3S8FB 1J5DA 2B08A 1J9QA 1FA4A 2PPEA 2OV0A 2CALA 4KO5A 3ABGA 2IDQA 1PAZA 3FSAA 1HAUA 2GC4C 2QPDB 2AFNA 2GHZA 3X1BA 3WNJA 1AACA 4A2EA 4AI7A 2WO2B 1ETJA 5B7EA 2W8CA 3TASA 4NERA 2YAQA 4HIPA 1J5CA 2H3XC 1NZRA 2IH8A 5I5MA 2W88A 4JHVA 2BP0A 5FC9A 2AZAA 3UGEA 1ID2A 2I85A 3NJFA 1E65A 1CYWA 3FU7A 2FT8A 4K9JA 1J9SA 4DPAX 2FTAA 4E9VA 4YSQA 3ASNB 1CYXA 3D12B 3MX0B 5D4HA 1WS8A 3EH5B 2R7EA 1RKRA 3X1NA 2IWKA 3DTUB 4L0PB 2CAKA 4FAAB 2P80A 1KBWA 2XXGA 4Q89A 2MTAA 4HCIA 5TK4A 3QPKA 2UX6A 4DP1X 2YAFA 5I6NA 2Q9OA 5AKRA 4HCFA 5B1JA 4KO7A 3FYEB 5A7EA 4YSRA 4KNSA 4ZK8A 1IC0A 2J56A 1A4BA 1BYOA 2BW4A 1NICA 4WTQA 4N4YB 1JERA 3GDCA 4AZUA 4N8UA 4GXFA 1EZLA 1KGYE 5B1JC 2J5WA 3PAZA 1FFTB 3KW7A 4W1TA 1GSKA 2PCFA 1GY1A 2PLTA 5I28A 1JZEA 2BZCA 2AZUA 1AANA 1GW0A 3PCYA 1ET7A 5B1BB 7PAZA 1GS7A 2FT7A 3S3DB 3T9WA 2VW7A 2QDWA 1PZBA 2IDFA 3ZX1A 1ZIAA 3BQVA 1N70A 1UATA 5I26A 1A8ZA 2OCCB 1IUZA 3WKQA 3AG2B 3QJSB 1XMEB 4F7KA 4F2EA 3FSZA 1RZQA 5IY5B 1NTDA 4JHUA 1AS8A 3H4HA 1AZNA 1TU2A 4KO6A 6PCYA 1ZV2A 1AOZA 3V9EA 3GYRA 2PPCA 1KV7A 2B3IA 3ABLB 2UXVA 1PLCA 1AG0A 1GS6X 3EF4A 1E30A 3NT0A 3L45A 4GP8B 1J9RA 1NDTA 3AG3B 1AZCA 1JVOA 1A4AA 3ERXA 4HALA 3T6XA 3FQYA 4GP5B 1JZIA 1OCRB 4JKNA 2N0MA 2FQFA 3PLYA 1FWXA 1E5ZA 2LLNA 3NSDA 1GY2A 3WI9A 3EH4B 2EINB 1OV8A 2HX9A 1JVLA 1ASQA 3AG1B 1KYAA 2Q5BA 3DIVA 4KNUA 2FJSA 1GYCA 2HRHA 4A2HA 1KCWA 1PMYA 2DY2A 5I6MA 3EHBB 5D4JA 1JZJA 1E67A 2RACA 3AW5A 3TBBA 3WKPA 2HRGA 4YSCA 4F2FA 1ASPA 7PCYA 2GIMA 2E86A 3ABMB 1AZBA 3CG8A 4E9RA 4NAJA 3CZUB 4QLWA 1BXVA 2YARA 1V55B 4M4RB 2H47C 4Q8BA 3NJNA 3V9CA 3IE9A 1IBZA 4YSTA 3T71A
chains in the Genus database with same CATH superfamily
2ZP0T 1Z5HA 2PP7A 1U93A 3CSYB 1WWAX 5JQHC 2AJ3B 4N68A 1XGRA 2WCSA 2G75A 3GMMB 2VNCA 4DERA 3B9AA 3BSZA 4UTBL 5C08A 4FFVD 4RX4A 1C1EL 3CLEH 4P2OA 4XR8C 4AE0A 5DHVA 5FPIA 1C9SA 1MJUL 1FYTA 1V7ML 4OCLC 1M71B 3JXAA 4HS3A 4AGLA 1F11B 4F80A 4NBYB 3RIFF 1MHEA 1OSYA 4YDJB 5JHDD 3UYRL 2PYEA 2Y5QA 4P5RA 5IVXE 4NO3B 4G5ZL 4UANA 5DMKA 3FUIA 4ZQKB 2VXUL 2HZHA 4OFDA 2JJWA 1CXKA 4JFPB 5JIHA 1FO0B 1X5JA 4U1IA 3RWGA 1GS8A 2XETA 1S7QA 2OMWB 2O5XH 3T2OA 3MN8A 4P3DB 4V2CB 1KIRB 1X4ZA 4D9RE 3ZTCC 5DK0B 4OKVA 4EF3A 4FA7B 4YQXH 4NQED 3SD5A 1DQJB 5JXAH 3ARXA 1A3RL 3EFOA 4XCFH 4M5ZL 4MSWA 4KX7A 1QA9B 4WK4B 2CR0A 3GEFA 3JT2A 2RD0A 2D7PA 1W80A 1BPLB 4KKPA 4AE1A 1T1XB 1PX4A 3HG5A 1D5IH 1NOAA 4PR5B 3AY2A 1HEJC 2Y36L 1KFGA 2BCMA 1BAFH 3K2UL 1IGTB 4WJKB 1NIBA 4IGBC 4PJ7F 3QIWB 2CLVB 2VABA 5BS0D 4J7RA 1YQVL 5CGYC 3WHE1 3CFBB 3TVMA 3I74A 2D31B 4LDEB 4RRPA 1OP9A 2D7MA 3DWTA 3OB8A 5BS0E 4FCAA 5IV2B 4PJ8B 3PPSA 4GQPH 4TMPA 1F58H 3HHRB 4FG6C 3S96B 2X1WL 4NBZB 4MA3A 1WFJA 3A6BH 5E8PA 3VXNB 2AQPA 3VXMD 1KV3A 4HSAC 4E9SA 1N0XL 1DVZA 2DIJA 3MUUA 5AALA 1T22A 3L2MA 3E2HB 4LKCA 5DK2B 1KCRH 2FEDC 1JS4A 1IIKA 3ECWA 3PG2A 4MS6A 4WGKA 3KHQA 1VZGA 3IFOA 3LHAA 3SDYH 4KROD 4IJ3C 3B6SB 3Q3GB 3VXTA 5AB0A 4W9GC 2I9TB 1U2HA 4ZUUA 5D1ZD 3MJ6A 3S7GA 1AZRA 3IPFA 5CBEB 4G43A 2YK1H 5EIVA 2X44D 4BEIA 1FCCA 3D2TA 2LLLA 1XGQA 2NW3A 2Z0BA 4NRYB 1QW8A 4E0RB 4F3FB 3CNKA 4QRRE 2FAUA 2D0FA 4BCYA 1JWMB 3VRIA 5I1DA 4K94C 4KVCL 3SDDB 4X6DE 5T3XH 4CN1A 5SWSA 2LR4A 4ZOAA 3SY6A 1KJVB 1WRFA 3B5HA 3MV8A 4N2NA 1U0QA 4L8BB 4DGWC 3MNWA 1FBIL 3GSWA 3A21A 2DQEH 2WSKA 3DO7B 1WAAE 1VGEH 4PGDB 3P77B 4PRIB 5EF2A 1ECZA 1IKOP 1C8PA 1AGBB 2Z35A 3QEUB 4BFIA 2IG2H 5CN3A 1NM4A 2R56L 1KLFB 1D6EA 1MCFA 1JMZA 1VENA 3NPSB 1QUNA 1QHOA 3QIUC 1UXLA 4H26B 3UJIH 5I6OA 5EC1B 2R27A 5CIPA 5I8CB 4GNKB 4I3RH 5I75C 5T1KB 2XTLA 2VN3A 5JYLA 4EUPH 2BSSB 1T21B 1FF5A 3E3QC 4PVBA 4G1MB 1JD7A 3D07A 2WC7A 3DGDA 5LLIC 4MMZC 2ZXDA 4ZQTA 4MAYB 2DIAA 5DRNA 4NAQA 4YSPA 4QT5A 5BZDA 4OI8A 1I3RB 3E38A 3Q2CA 4GAGL 4PJ5A 3EH3B 4OLWH 3HMXA 4NQCD 1F8TH 5E6RB 4JY4A 3ZKND 3CZLA 3K2MC 5TPWH 2MCPL 2J7LA 3KE0A 4XXDA 5DMIL 3T4YB 4NQCE 1YJDH 4OGYL 1K8DB 5AAMC 2VLKE 2IALB 2FH8A 1RZIB 4JREB 1ZDSA 3HI1A 1A7RL 1EA9C 4G7YH 4F7MA 1I8MA 5E2TL 3H3PL 4E5XG 2R23A 2VT0A 3CZNA 3TU6A 2C3HA 2WZ6A 5I0YA 1PKQA 4AUJA 4RWHA 5INDB 3CDZB 1IGJA 4YBLB 3OKEA 2P24A 5CSGA 1G87A 2NY3C 2ZTBA 2Z1KA 1X4XA 4GW5A 4HKBB 1Q72H 3BGAA 4JHAL 4ZTPL 4YSSA 1E4KC 4DKDC 2V2XB 1S7UB 1DUZA 1B0RB 1Y6MR 1MSPA 2BHUA 2ZWZA 3L1FA 3CVBA 4G6KH 4G70B 5CINH 3A6CL 4HPYH 2O61B 2H6PA 1U33A 5CJOH 4U49A 5I8KH 4U1JA 1B2WL 1GC1C 4P48A 5I82A 4O9HL 5LBSH 2PUQT 4JFQB 4J4PD 3C08L 3QUXB 4OGXH 5H2BA 3CHPA 25C8H 1MQ8A 3VH8A 2IH9A 3A4EA 3FOLA 4PJ7E 4DP7X 1CD9B 1SOXA 3NSFA 3MLRL 3GM0A 1SFHA 3FPXA 3G7TA 4PGCA 2EP6A 2C4FU 2ZONA 5F88A 4NI3A 3QDMA 2BOCB 3HA0A 3PU7A 4E5XB 3EO9H 4H88H 5C09D 2X2YA 3APNA 4ANUA 5I6KA 2L04A 4IDLA 4WVRA 2KDGA 2B59B 4HPOL 4MNQD 4E41E 4ZS7H 3AC0A 2X4PB 2GY5A 4Y5VB 5LGHH 4Y9CA 2E5EA 1GJIA 2CDGB 3QI9C 2OTWB 1YNLH 4FNRA 4KAQH 3K3QA 3E2HC 4FLQA 4OZ4A 5GSVA 4PJCF 3CDGA 2Q20A 2ROYA 2EIJB 4HK0A 2CGRH 5G4MA 2WAHA 4TVSa 4D9LH 2J73A 1MNNA 4XCCL 1KTDA 2IFFL 3NIDE 3HE7B 4J23A 4P23D 1WBYA 3ZW3A 1R0AL 5IB3B 4G8GD 3JWNG 4EI0A 4FZEL 2O72A 4NI6A 5KVDL 4YHKL 1KBKA 1HEZB 4YMPA 5DR5L 1KJMB 1DTUA 1MLBA 4ODHL 3RP1A 4A2GA 3DX0A 1MFEL 4WHDA 1UXSA 4K3JH 1BSIA 1J9QA 1N5YH 1EERB 2XBTA 2DLFL 4H20H 4GSRA 2O5ZL 5DC0A 3O2DH 4RAVA 3T4AA 1DQVA 2PMZA 3LZQA 3WNJA 4U6YB 2HUHA 4XNQB 5I16A 4LSRH 4JPWL 3E9TA 2AMGA 1NANH 1PPIA 3QG6B 2FIKB 3GEWB 3D09A 4NERA 5AVZB 4PJGF 2EE3A 2WLIB 1E4XL 3ENEA 3UZEC 4WO4B 4MAUL 4BZ2L 3BO8B 4AYGA 1NBVL 2G0LA 1H3XA 2J6WA 2ZYRA 4MCYB 1VFOA 3U0PA 1XCWA 1IEAB 1SEQL 1J0JA 5D6CB 2QJDA 2XQ0A 4IYKA 1YUHA 2BNRE 4K73A 5LAXA 1C12A 5JPMB 1MFDL 1LK3L 4U31A 1KGWA 2FEEI 1USZA 5HDBF 2CK0L 1X6NA 3HRZC 4LSDA 4DUWA 4MAYC 4QTIH 3UZQA 2GSIA 3QPKA 4IKNA 5JHMA 3VYOA 4ELMB 4ZMWA 3V55A 4BCXA 2AK1H 2GJZA 4IM8A 1OF2B 2BIHA 1MCIA 4DO5A 2VR3A 4KNSA 3U7YH 4H5SA 4HUUA 3P9WB 1Z2KA 2DWDA 5BVPL 4IBTA 4GKZA 4RQQB 4N4YB 2DM2A 4PBVC 2BSBA 1A21A 3B9KA 4TUOA 2VO8A 2Z7YA 3BH9A 5CN1A 4UTAA 3AREA 4N2HA 4OQTL 1KIQB 1L6XA 1MJ7L 4XNBA 2GSGA 3SBWC 1G0DA 4O58H 4HSCX 2GT9B 4ZYKA 3G9VA 4BRJA 1JZEA 1HXYA 1IM9D 1TQBB 2MPAL 1E5AA 3C5ZD 5JDSB 3PCYA 3UPRB 2A2QT 3WLBB 3WN5A 3M1BA 1DQLH 1FC2D 3F5WA 1QLFA 5EU5A 3ZHNA 4GG6F 1BP3B 1FG9C 3MUZ1 4J3OF 2MNWA 5HGAB 3HNSL 3MA9L 1A6PA 4LK4A 5D55A 3U0WL 2IEPA 1A1NA 2FUQA 1KCKA 1J88A 2J43A 3ISYA 2C1OA 4HS8L 5G4OA 4EIGB 4MKMA 5AB9A 2AKRA 2F9BT 1HESA 1JPFA 1P6FA 2AITA 3KD4A 3FSZA 2LW3A 2P46B 3WS6C 4GUPB 4JKKA 2QL1A 1J05B 4IRSD 3BXNB 3QUXC 1AS8A 3ZUCA 2UVEA 3F7VB 4R8WH 2IADA 3CH8A 1AH1A 2J2ZA 1LP9E 4PJIF 1KWGA 4M1GL 2YFOA 4L8DB 2K9UA 1NBQA 1H6EA 1Y6NR 1UM6H 2X40A 3O6FA 4FQQB 1I8LC 5EBMA 4OT1H 4ZNEE 1YG9A 3AU1A 5C0JA 1SGKA 1EEZA 3GMLB 3D25B 5IBLD 4RZCB 1CI5A 4DO6A 2YOCA 5DUPL 1ZHKA 3VYPA 1CTMA 4I18C 4P59H 5AVUB 1TZHA 3MRKB 3WNMA 3ZRCC 3NESA 2OTUB 3TZVC 3EYOB 4AH2B 3LKSA 1S7VA 4NHCL 3N9GL 5GS0D 2BP3A 2QTVA 5D6DA 1D7FA 3DXAA 4PJCE 1LL1A 4UM8B 2BMKA 2IH3A 1RUAH 2GUYA 2BS71 3MQIA 2FJSA 3MV7A 3V95A 1IL1B 3P9MA 4R7NA 2DY2A 4PI2A 5D1XD 2WXJA 1TQTA 2W0FA 3MSPA 1T7WA 1LK2B 2VSDA 4TM9A 1AMYA 2V9RA 3VXRE 1XR8A 2CGZA 4OI9A 3V4PB 3DDFA 4ANVA 4NDMA 1WFUA 5ID1A 1U42A 1AZBA 3HS0A 2OMYB 2PW1A 2QQQA 1N3NB 4GRLD 2WXOA 4XC3L 5LNGA 2ZF9A 4JFFE 3PABB 4YC2C 1AGFB 3DX6B 3FTZA 4JM4L 3GMPB 5B39G 5CXPA 3RWCB 4AEIH 1WO2A 5KVDE 3ZRFC 2R8SL 2ZYIA 3CFQA 4CKVX 1F2QA 4XNUL 1S9VB 3IJ7A 5C92A 5MEPB 3ASOB 5AVTB 5I5RA 3RWJB 1S9KC 1OCZB 3MJ7A 4PJGE 1E43A 5F0LB 3RGBA 2XPYA 2Y9RT 3QCVH 3MOBL 3WY3A 2IQ9L 2ROXA 4XP6L 1F2XK 4L5FE 4YFEA 2VKWA 2FT6A 1L6ZA 1R24B 1NC4B 1Q0EA 4X9BA 4FFZH 4F33A 1NBZB 3LNFA 3UFIA 4CBZA 3MXVL 5EHFA 4IJTA 5ITBL 1E3ZA 1U8LA 4PY7A 3NYKA 5HYSG 3WIIH 3L3IB 1RJZB 5IBTH 5JXEA 5HYJD 1ZVSA 1XIWB 4V1DA 1A6TB 3HHSB 5AW4B 5HDBE 5C3IA 2CG9X 4DPCX 2KHAA 1IAKB 3B7UX 5LCVA 1EBAA 1EFQA 4F7EA 1J1PH 4WKZB 5IHBA 4WNQA 3L4VA 4Z78B 1CFMA 4ATWA 5KSAB 3KPSB 3HLAA 2UYLA 5B39B 3V9FA 2O30A 2GB2A 4H8HA 5IBUG 1GYWA 2XTJC 2BIMA 4WJG3 4DKEH 3ARDD 3MFFA 4ECNA 1MF2H 5DJ6A 3DKHA 3P3RA 1EZSA 2H26A 1ZHBB 2FWUA 3QUZB 3VI4F 1T1WB 2VAJA 4MJ6A 4JMXA 1CLOL 4P0DA 4WEBH 2B15A 3NGBB 4N0CC 4YXKH 2NYYD 5T1LB 3ZR6A 5AD0B 2VM3A 1KGCD 1F3DH 2VZVA 5HYSB 3QUYA 3VWKD 5IF0B 4JE4B 2ZJSH 3ELAT 4WY7L 4CADA 4CU8A 2APVA 1UG9A 2HT2D 2B4CL 1KTLA 1QQDA 1RJLB 1P4LA 3EYQC 4JDVB 3AT0A 2W80C 3TJPA 3S88L 2OYMA 4GG6E 1RAMA 3CQPA 2CHXA 5GGVH 1MIMH 3FFCD 5ADOL 5CEZL 5EEYA 1QSFA 2MH4A 4ZXBA 3NJIA 1A4JB 1FZOB 2DQMA 2R59A 2EO7A 4H4NA 4D0BA 4NQTA 3FFCE 3HC4H 3BZFA 3JVGA 5IBUB 1ONQB 3WTWA 3TO2B 1SM3H 4HEME 3KM2A 3JV6A 4P3WA 4W9HC 3TN0D 3OMNB 3D6GA 2DQHL 5BV7B 1ET5A 1JV2A 3V5DB 1MWOA 2EC9T 1YN6B 2VAAB 5CILL 4X7SH 1DL7L 1OP5K 2IANB 4FA8A 5KYNA 2UZXA 4B5ZA 4YSUA 1OZTG 4PJIE 3LSOB 4O02B 4PREA 4PMFA 4ZTOL 2E3VA 2BJMH 5LXVA 4QI3A 1NGQL 4BCZA 3FBKA 3DV4B 2HG5A 3KL3A 4Z7VA 1RUKH 3LCYA 1NPNA 1X5LA 2JTYA 2ZYSA 2HKAA 2UWEB 2YA2A 4FZ8L 4MJ2A 3WJMA 4C8XA 1X7QA 3HNVL 4A1RA 4ODUB 5JLZA 4HT1L 3S35X 5JHAA 3BT0A 2J71A 3ILDA 4RVBA 2VDNL 2EYSA 4Z7NB 2YRBA 4AXWA 4K8RH 1Z1WA 1SXSA 3ZOAA 4Z7UF 4I0PA 1A0QL 3QFJE 3T2NH 3DX9A 4EI5B 2FDBP 1ROCA 1HQRA 3ATFA 3P30L 1UJ3C 5IG7B 3HE6C 3TEYA 3EIFA 4YDVB 5EIIG 4U6HB 1U3JA 4HC1L 4PV8A 2ODHA 2E8YA 1ND0A 3B2VH 1BJ1H 1I8AA 3D85B 5EU6A 1AIZA 3QORB 4J8RB 5G55A 1WA2X 4OCNC 1AP2A 1M7UA 5F0MB 2W95A 5LCVH 3FU6A 1ULVA 2YC1A 4BV1A 4BH7B 4XMLH 2AEWA 1J18A 4W81A 3US0A 2I5YH 3HBQA 4NFBA 4OCXH 4FDWA 3BP6B 5I17A 5D1QA 2DM3A 4CGTA 1HYSD 2ZP9A 1YRKA 3CVHH 4RIRB 3GBML 2CPUA 1K72A 3EJCA 1W8OA 3VE0B 3PWNA 3C60C 3MRIA 4FQCL 4MDIA 3TBWB 4FABH 1ZVNA 5DJZA 1Y18B 2YBGA 4U0RB 3W0WD 1FGVH 2WSPA 3APDA 3VX1A 1P7KB 4TRPH 4NQSA 4O4YH 1IEBA 5EIIB 3MDJA 4ZW7A 1BCIA 3DGCR 1E2VA 2DWTA 3F7YA 1FE8H 3PAUA 1R6VA 3MYJA 1CICC 3PDOA 3RY6C 2Y7LA 2GJ6A 5AYQA 1JPSL 4IBWA 4NNYB 3QEGL 4YHLL 1U8HA 2WXIA 3V52H 4QTFA 5T5FL 2AEOA 2FHCA 3PDGA 4PGBA 1QWNA 5I8OH 4M5YL 5HYEA 4JN1L 2KZKA 5ALCL 3A24A 1PGRB 2DI7A 3TH4T 3WN6A 4HCGA 1NFDA 2R2BA 3H9SA 1JCKA 3KPNB 4NHUA 4F57H 3IGFA 4LSSL 4NWUH 4PJHA 2FVNA 2NR6D 3C6LC 4NPKA 5TFSL 2ICES 3KPQB 5EH1A 5K33A 2B0SL 5GS0H 4K71B 3VI4E 4FXKA 5JIIA 1NAMA 1L3WA 3HFMH 5DRWB 1AZVA 2SEBA 32C2B 4MVBC 3NDYE 4BGLA 3FONB 3NFPB 2I24N 5ICXB 3I75B 3R1GL 2B77A 4DTGH 5E5LA 1YO4A 4IK6A 2CPCA 3EGDA 2ZNXA 5EUOA 2AK4A 4AM0Q 1KMGA 3B83A 3AUVA 4WHTB 3T6WA 4P4RA 5HPMA 4RMSA 4A04A 1J9TA 4DSYA 1VIWA 4QOKA 1PY4A 3JV4B 2YBRA 5DSCA 3WIFB 2BSTA 4KK9D 2CRMA 5IOPA 2XN9B 2AP2A 2WZPD 1G6RB 2DM4A 2BHZA 4PG9A 5IFJB 3O3EB 1INDH 1RZ7H 5CEZD 3ULVL 5C0RH 3S35H 4NO0B 4KO9A 3OTTA 3TCLA 1P5VB 2GBUA 5FX3A 1ZIBA 5IJVA 5CEZE 4HUWA 4P2RB 3VXSA 3O4LB 2XFXB 1IIIA 3D3VE 4L5FH 3QDGA 3LIUA 2E59A 3O41A 3TO4C 3O6ML 3IMBA 3WMSA 1CS6A 4R4ND 2Z4QB 4LVHB 2E6JA 4ZTEA 2B1AH 2CWRA 3B9EA 3V5KB 4HOZA 2NXZB 4WUUA 2BFVH 5EFIB 1KXTB 5I1JL 15C8H 4U7SA 1CL7I 3IM1A 2Z31C 3HR5B 1MFUA 3ZUNC 3RDTB 2EUWA 1HCVA 1R47A 3VWJC 5H37H 3NFNA 2ZAIA 4LLDA 1NL0H 4QHKJ 1KPVA 1EAJA 1MNUH 5HI4C 1A9BA 5TTRA 2EKSB 5E7BA 5A43C 1D5RA 5L8JB 2W8CA 3BP7A 1NGWA 2A74A 4HK3J 4PVMA 4M6NH 5AOZA 3ZLQC 1YEJL 3GJEB 5IB4B 4NENB 5JOPE 4Z7UE 3AXHA 3H6AA 1JNHA 1E9OB 4HXBL 4JJHA 5DUBB 3SDCB 1K5NB 1CXHA 4HD5A 3GO1H 2Z64C 4RCAA 1IAMA 2DQTH 1RZFH 1WIUA 5D2NC 1XTMA 4XO5A 1L3NA 4PSRA 2XWJB 3GJFB 2F1AA 4X5PA 4DPAX 4F37K 2ZOKB 3KPRB 4G5AA 4OJAA 1VACB 4XCYA 5JW5B 4JFDE 3MV9A 3ZQXA 1AD9B 3F12B 1HILB 2XXGA 1J0KA 1CZ8H 4RDBA 4DFIA 3SKOB 3IJSB 2A4CA 4XRCB 4MJIB 1JVKA 2FB4L 3RBSA 4J3OH 4PWFA 3II2A 1U58B 1Q94B 4OF6A 5B8CA 1BZ9A 3L7FB 4C83A 4Y8AA 2NSMA 2WVSA 3RJOA 3IBEA 3MXWH 1D9KC 3FO0L 5JUEH 4ADGA 1FCGA 1A2YB 2ZSWB 3LNGA 4WUKL 3VMOA 1JGDA 5AZ2H 1JERA 1JRHI 2QV4A 3QO0A 4HCRL 2AAVA 4U0RC 3MLXH 2VIRA 2C1PB 1CD0A 4JZJB 1GOHA 1NGPL 2H9GB 3BI9X 3VU2A 1RJYA 3NACH 5FKAB 3FB6B 1VA9A 3MKGA 1XBRA 2E9JA 3SKNA 5CD5D 4CN6A 5IKCA 5HHOA 3E1F1 1GY1A 1GJWA 4HOMA 1V7NL 3DIDA 2BOBA 4JG5A 1IVTA 5SWQA 1QFWI 3ARFC 1C8QA 1QATA 4H2CA 2O5YL 2CKBL 5ESAA 2LFGA 3OWEA 5DS2A 3DIFB 4JQXA 1YNTA 2DF3A 2X9YA 3DNKA 3DPBA 3TA3D 5I1EH 1DANT 4JPVH 5K39A 4ZMTA 3L3GB 3BWZA 4NUGL 2ADJA 1CFSA 2ZSVB 5INCA 5ENWB 2YKKA 1JK8A 4QGTA 2V9QA 1F4AA 3PAYA 4XHQA 5EZOL 5C2BH 4TVPL 3L4CA 2GUOA 5C07E 1S9XB 2Y72A 3I2CH 1UOVA 2Y7OA 6PCYA 3RL1B 1XMWA 3BWUF 2HT4C 1B0GA 5I1GH 1IAIH 2A6JB 5KVMC 2CHWA 3MLZL 3OBAA 4PLNC 3O3DB 5F1IA 2X2HA 3D0VA 4EN2A 4QWWD 4PJDB 1NDGA 2R0LL 1RK1A 3ABLB 4XB8A 4LFHD 1NCCH 2UXVA 3MJWA 4MDRA 4PGEB 1L5GA 2DEXX 1XCQB 2Q8BH 4YDKH 1A6UL 3BN9C 2ZOLB 3OGCA 3KMDA 3N50A 4W9JC 3B3BA 3NCMA 1A4AA 3LY6A 4P5TC 1PZ2A 2IVFC 3SOBL 2EVJA 1YYMH 5I8EB 5SWZB 4R83A 4D2NA 1PBYA 5IVOA 3TYGH 4WTZG 5CMAB 2G5UA 2HX9A 4C56B 2EO1A 4OLZL 2V5MA 1Z9OA 2FX9L 5ILTH 3LEVL 1KCWA 4HKXA 3UTTD 3ULVD 3UIZA 1JFHA 3HI5L 5CEXA 4QRPB 2ICWI 1T7ZA 4POYA 4TPRL 3BSZL 2WKGA 4Z3GA 2VUOA 3V7MA 4L9DA 4OD2B 3TBSB 4DIXA 2DYPD 2UZYA 3ESMA 4JFOA 5LXGL 4Y4FB 4IMLA 1XEUA 1ES0A 1KTRL 3ECBB 3QYMA 3BSGA 2XPZA 4PRAB 1EJ6A 4R9HA 3BEWB 2NXZC 3DX1A 4JFDA 4G80A 3IPEA 3TV3H 3X12A 4UZSA 3RDTC 5B38G 4RA3A 2BY2A 2ZX8A 3DUSB 3KPOB 3I02A 4JFZL 4AQEA 5LQBL 2XNAA 1ZDQA 3MNZA 3OF6A 3ZDYF 2K78A 3P11L 5J6GB 4G9FD 4GW4B 3VGDA 3H42L 3LQZB 1HS6A 3O8XC 3SPJA 3VGFA 3L9BA 3PGDB 5G2NA 1I7TA 2WQUA 3UACA 3IKCA 3WFDH 1U8CA 1MVUB 3W56A 2VL5A 5ES4B 3LV3B 1EFXA 3HCVA 2V3DA 3NJMA 1GZQB 1KPUB 4QHLA 5IWLC 3AXLB 4MXVF 3O9WD 2YGPA 4BSVB 4NRZB 3L6FB 3QUGA 1OT4A 5JHDB 3QJRB 1Y0LB 3I50H 2XWEA 3LXUX 2JB5H 3OMAB 4NJAL 1L4IA 3V0VA 1I7ZB 8CGTA 3UIYA 3S34L 4KJPC 1LLAA 2B9AA 3KJ4C 3L1OH 3QB7C 4POZC 1Z9NA 3SBPA 2OSXA 1J1XH 4ZNCD 1S7XB 4IGBA 1PG7L 2GK0A 5HHPB 2EDTA 4TULL 4BUQA 5B38B 5I5JA 2X0VA 2VMJA 3SCMD 4Y5YB 1BFTA 2EILB 4P9HL 3SE6A 4DCQA 4YDIL 4WNSA 2FGWH 4NQEB 4LF3B 5FYJL 2EDHA 4HHWA 4HUXB 4GH7B 1K6QH 5DWUH 1JWUB 2YWZA 5ICYA 3NEXA 3BZ5A 1ZLVH 3CK0L 2V8LA 3NCYS 5FK9B 1UZ6F 4OLUL 4PV9A 3QNZA 1IC4L 2CZNA 4M61A 4OFKA 4HG4J 5CEZH 2YXVA 3P2BA 4JDEA 2PCFB 4PLJD 5CP3H 4NQDA 1CBVH 3DSFL 2EEXA 3DTXB 3A6OA 3IXAA 4ODSL 4PWJA 1MQKL 4FQPA 3GZQA 5J1SC 2BSRA 1A65A 1FRGH 1KJ2B 4TSBH 2BNUA 2NZIA 3GSQB 4H1LG 2Y6SC 3IFPA 1E5BA 1FVCB 2DQUL 4OLYH 3D69A 1S9YA 1ZLSL 5IW1B 3QQDB 4PN6A 3DYOA 5BXFB 1DVFC 2VXQH 4RWYL 4Z6AT 3DHMA 3VXMB 5DD3L 3SPIA 3IRZA 4J3BA 1HFUA 1NCGA 2R39A 2DWSA 4EBQL 4XPHL 1OZUA 5E2UH 3UZVB 2P9RA 2QQKH 4PTUB 3VB9A 4E9YA 1MW2A 4H8WC 4OJYA 5JDJA 3AACA 2ZXQA 4GFTB 5CWSB 2IAMC 3G3LA 3RFRA 4KROB 3OAZK 3IEAA 4PB0H 1AO7D 4X5LA 4TVPD 4ETQA 5DMGC 1HL8A 4K3GA 5IQLA 3NZ8B 5D1ZB 4HAFA 2QSTA 5B1KA 3S98A 4K7PY 1TUPA 2VMEA 3U9PH 4Y2NA 1O7VA 3FN0L 3PWLB 2NNAA 4KV5F 4PM1A 3I6KA 3MHZA 4Q4IA 4Q52A 1J8HA 5FCUH 3RA7H 1F4YH 4NC2B 5CLWA 3ABZA 3QIUA 4R96A 3MREB 2LU7A 1SMDA 4Z0BH 5FO8A 2WUBH 2HLAA 5CZKA 1GPOH 3DOSA 2NY5C 1JXKA 1Z9MA 1KEMH 1XCTA 2FJHB 2QPFA 4O2EB 4MMZA 1B0WA 1R3HA 1CFQB 4ZMNA 2VDML 3G6AA 4P4KC 2Y7NA 5FECB 1A4KA 1G7IA 5A40E 3HMXL 3HG0A 1O6TA 1ODUA 1A6AA 1YC7A 3G5YA 2IWFA 4I2XA 3H2QA 2C5DC 1ZLWK 3ULSB 3VSQA 4B95C 3QGVA 4KQ3H 4HLJA 3QQXA 1BOGA 1M1SA 4UT6H 1L9QA 2D3LA 2CBTA 1ED3B 1ZPUA 1U92B 1W8NA 1OPGL 1HEHC 3QFDA 1PYWA 4P2OD 1TEGA 3VFRB 4H40A 1RZPA 5I1AB 5AAMA 1L9OA 2C7UA 2ZPKL 3CX5K 5J12C 3V4VB 4AW7A 3BUBA 1JHLL 1DE4A 3U1SL 1UYWH 3KPLB 4Y19A 3FOMB 5JW4Q 5DJ0A 3GNMH 3GXNA 4IKLA 3ZDYE 1C5CL 3P3YA 4FQHB 4XZUB 2WYHA 3IGUA 2PYED 3PUCA 4BSWA 1G94A 1AQDA 4L4VE 1T2XA 1NSNH 5IJDC 3VW3H 3ME0B 5C6TH 2FJFB 3BAKA 5D70H 1SVBA 4IK7A 3JZ7A 4PJBA 1I4FA 4RMTA 4AVKA 2V7NB 4WJ5B 1UUNA 4X99A 3IMWA 5HJ3A 4H25A 1EWHA 4MXVE 4WKZA 3CFDA 1T0PB 4DW2H 4IKIA 5D4QA 2ICWA 3RPIA 1E4KA 5E94A 3GM8A 4R4FH 1KB9J 3G6DH 3ZTJH 3TONA 3KWWB 4QYOA 1PW3A 1DBBH 2VITA 3C6EA 1ZA3B 4YHZH 2BWQA 1NJ9B 4XO3A 3OR7A 4HZ1A 1EJOH 1HIMH 4P2YA 4CJ0A 2ZKXA 3FT3B 4AGPA 1JBJA 1A3LL 1G7HA 2MTPA 3VRJA 4DF9A 4BFNA 1F90H 5KVGL 3BZEB 4CNIB 3L5IA 1GKEA 1PL3A 3CC5A 4JCLA 5CZVH 1LO3H 2CXGA 4HYTB 1F42A 2ZUYA 4HAKA 4WGVB 2ATPA 2P3YA 1ACYH 4NZRH 5DFVC 4KXAA 3RWFB 9PCYA 2BHFA 4M5TA 3HR6A 1NIEA 1UZ6E 4XO4A 5FYJD 3LQAC 4WRLA 2XSKA 3T2LA 4N2LA 4CSPA 5E0FA 4NO2A 4WFEE 3GSVA 1UCTA 2FQDA 3ARBC 3DRTA 4A6YA 1MFCH 2X4QB 3QI9A 5AUMA 3RVWD 3L3KA 4Z7WE 2W91A 1TOXA 1NIAA 4Q0XL 3BWAA 4K9EH 3ARQA 1LO2L 2ARJA 5E00B 3NJVA 4KMQA 3QO1B 3PWPE 5DJ2B 5GJTL 3FQ2A 5C09B 2ZUSA 3SYOA 2CCLA 1OTUC 4GAYA 5D4IA 4MNQB 3RVVD 5FR3A 4KI5C 5E5MA 1XF4A 4DJMA 4M8VA 2X4UB 3K6FA 2BRRH 3RVXC 5SX5K 2JCCA 4IEFA 3MRBB 4PRNB 3L5HA 1HJCA 2UX7A 2PTTB 1MG3C 1DQKA 5GGSY 5E5RB 2Q8AL 5C0FA 4XP1L 3AB0C 1OSPL 4WWID 1NWPA 4WW1B 5LG1A 3T3PB 5SWSD 4YIQB 3TYFB 3L3DB 4B60A 3LRSA 3MV8D 2FIRT 3RUGB 4LSVH 1S7WA 1NOLA 3NCXA 3IJEB 4Q74A 4JHWH 5J11B 4UV4L 4P23B 4BK5C 4XNMA 3QCTL 4TN9A 4G8GB 4AQ1C 2B08A 1FA4A 1U9KA 1DFXA 1F4WH 3UZEA 1PZUB 1FL6B 1PX8A 4KV5E 5I19L 4APQA 3C8KA 2DJ4A 4UOZA 1FN4A 4DVBA 4DZ8A 4HA1A 4ONGH 3ZKSD 2APXA 4PLKC 5IMLA 3SKJH 4CMMA 1CE6A 4F58H 3CSPA 4OIIL 5LG6A 5DD6B 3O11A 3IS1X 1HZLA 3FZUC 4AMWA 2XT1B 3HBZA 1OLZA 3VD5A 4WI3A 3D18B 4N2DA 1R3LA 1RQ5A 3ZKXB 1IGCL 4W4OC 1MWAA 5GS2H 4X9GA 3HRZA 3ETTA 1JK9A 1Q9LB 5D7LE 3LZNA 5D7JD 2I85A 1KG0A 3BLKA 1UACL 1NCHA 3MCYA 1VFUA 5FO9B 3U6XA 3VI3A 1N8ZB 3GLZA 1Q1PA 2X4TB 4JR9H 4LMQI 5IEHB 4PJ5D 3HZYA 1ZE3C 1WP6A 2Z8SA 3H55A 3KYOA 2D7TL 4XN7A 3T1FA 1S7RB 3U0TB 3LH2L 5J1TC 5LHDA 1URLA 5GZND 4OFPA 5AWNL 3NZHH 1NAKL 3FB8B 1NCDL 2UX6A 5IM7B 4UTAL 2CBMA 5IMOB 4ONHB 1T1YB 3KJ6H 4XCEA 4MNGE 1OO2A 4UNTA 4KO7A 4NZUH 5A7EA 1YEFL 3DX2A 3ZSSA 4S2SA 3SBWA 1BV8A 3JVFC 4D3CL 3UGUA 3W11D 3DUUB 1JD9A 1G7MB 2F2HA 3NZSA 4YHPB 5AYUL 2NW2B 1IBFA 4P06A 1U2CA 4EIUA 1QFUL 1QD0A 4IRJB 3VD1A 2C7FA 2HFEB 4P2QA 4KKAC 2BVPB 4YO0A 3QEQA 4PW9A 4DK3A 5ACMA 1FL3A 3T04D 5CZXD 1GSKA 4U2ZA 4OQ1A 3F58H 3ZDXB 2CA3A 1PKOA 1T3FB 1YCSA 3GBNH 4ICXA 4Z7WA 2DN7A 2EZ0C 2NCMA 3BUQA 2DIBA 3RFZB 4JFHE 2JSFA 5KS9A 5GJSL 4TTDC 3WS6A 1JYXA 1T6WA 1KJ3H 2JI3A 3C5ZB 1IM9B 5EA0L 5L0QC 3ZXAC 4XMWA 2OJEA 2VTFA 1IGIH 2RIKA 1MJ8L 3BQVA 4QHMA 4UBDC 3MRLA 1YC8A 1EUTA 1QG3A 3BRFA 4PCTA 5ID0B 1I8LA 5IVNA 3QDMD 1WV7T 1RZQA 2VDKL 5AL8A 4DGUA 4J27A 4G6AC 1U30A 4ZX4A 2OZNA 3QNXA 4JRXE 3UBGA 4ZPTB 1QRNE 1J10A 3FU0A 1W0VA 5DRZB 1IBHA 4I5BA 3KWVA 4I18A 4KUCF 2CMRL 4UINH 4IRSB 1PSKL 1HCZA 3QUHA 4FQIL 4G1EA 4Q2ZA 1WUNT 1U3NA 1ML0A 3G9AB 3LIZA 4KU1A 4LMQE 3TZVA 5I1KH 2EYTA 1N19A 4KZEH 3V6FB 2V5TA 4UT7L 3WFEH 1A7NL 2XG5A 4PRPB 3NN8A 3VVWA 5L9DH 1B4JH 4ZSOE 4LVNB 2WKOA 4J6IA 3NT0A 1WISA 1QNZH 5I71B 2VJXA 3PP3K 5DHXB 4HLZG 2VXSL 4I3SH 2EH8L 3T77B 1EEQA 2P5EE 2X0WA 4KBPA 3OX8A 1INEH 4MRCA 4X98B 1W72H 3T8XA 4XTRC 3BVVA 2JI1A 1WH0A 5FAAA 2NQ3A 1UWGL 4MZRA 3W9DA 1WZ1H 4MB3A 4XWGL 4NKMB 3TPKA 2ZCHL 3DJ9A 3BDBA 5KJ7E 1RL1A 1UA6L 2WN3A 1SYSA 3PGCA 1T0MB 5F1KC 3Q2LA 4PUBL 4YSCA 2F5BH 1AMXA 1HU8A 5D1XB 1XH1A 2W1NA 4NUJB 4NAJA 4S0SD 2J12B 4QLWA 3SD2A 4TUKL 4Q56A 1H8NA 4R90H 1IBZA 5FKPA 3IAGC 2JLPA 2X53A 5K69A 1UKTA 5D5MA 4IOIA 4L3CA 3SJVA 3QAQA 3EXJA 4GRLB 2Y6TE 1QEWB 3BDYL 5B22A 2WGNB 2RFXA 2YFNA 1XGYL 2F7RA 2ID5A 3EO1A 3G5VB 4JO3L 5KYXB 1O9ZA 2VLRA 3LZPA 3EDEA 5J1AB 3EZJB 2K8MA 1JNNH 1MDTA 4MQTB 3WLWD 3EYSH 5J5EA 2WO3B 2A6DB 2AJUL 1LNUB 4CVZB 3OGOE 2CDFB 1KCSL 4MJ5A 2MQCA 4JG1H 5PCYA 4LSQL 2L3BA 2ZX7A 4BDVA 4MXQC 3TJHD 3MOQA 3Q13A 4YSEA 1TJHH 4JG9A 3WO4B 3RG1C 1HOCA 2EIKB 3R19A 4P9HH 1SY6H 4WSKA 4B9IA 2EIZA 2EQDA 5E0QA 1XZ0B 2EJ1A 4AEHL 4ZUWA 2YA0A 2AJYH 5HYJB 2ORBL 1TVHB 5HD8D 4HS6A 3GUFA 3LQMA 3SE9L 3WOVA 2BSED 4YHNB 4Y1AD 3CFJB 1TDQA 2A77H 4MD0A 4OGAC 3VGHA 2Q3XA 3BE1H 1A7QL 3B9KD 1ORSB 2YPKA 3DGGB 2G5BB 2XTSA 2FEEL 1OAXL 3ARED 1ZT4A 2F61A 2IIJA 2WBWB 3K72A 4MMXB 3RE0A 3MRJA 2C3WA 5FDYA 3IVKB 5E4OA 4MWFA 5EB9A 1N7ML 3R7RA 4WFHE 3ARDB 2FLBT 3GHEL 5J56B 2EDOA 4P46A 1B3JA 2LT9A 5I15H 2DQGH 4N8VA 4TS6A 1AXTH 2NXYD 4TUJB 1EMTH 2V9UA 1HCYA 4U1HB 5F1NA 3G6JB 4IRJC 1EO8H 2CDEA 2X4RA 2YWYA 5ANMB 2HJFB 5GGRB 3VFVA 4EKXA 4JK0D 2GG1A 3DBSA 4X7DC 2R4SH 2CCWA 2H3NA 1BAGA 4XNXL 5E9NA 1W0WA 4JY5H 4AEEA 5FO7B 1QABA 2WWNA 2NTFB 3HN5A 1FNSL 1FFNA 3VWKB 4HIHA 2PPAA 3N06B 4XVJL 4R3SB 2R83A 5E8OB 3TPUA 1S2EA 2VDOH 2P8LB 4FFWD 4PJXB 4IOSA 2VISA 4UIKH 2W07B 1HHJA 1GVIA 3EGSB 1ERNA 3GSRA 1N9PA 1R5IA 3BCDA 1Z9LA 4Y16C 1WPCA 3QDJD 3O6FD 1NGZA 4KUCD 4BQ8A 1VKXA 1XR9B 1NPJA 3UH8A 4LCCB 4C4KT 1ZSDA 4MXWL 2A7BA 3FXIC 4F2ME 3TN0B 5C0CE 3GSNA 5DO2C 5K93A 3S3CB 5I74C 4F15B 1K85A 4RRPM 4Z7VF 1QNIA 1WUZA 5E2WL 1HX0A 3IJ8A 4N0FA 5JW4N 3WE1A 1U91B 4UV7L 1P6AB 4FKKA 3EZ8A 3VJ6A 4AM0A 5I1IL 3DXAD 1J8RA 4HGMA 2IQAB 1MVFA 5DA0B 3MV7D 5I71C 4MD5B 1AHWB 1UJ3A 3HE6A 1BXXA 3SYQA 2GBVA 5EWIH 4K0OA 4Q9BA 5SV4A 3EBHA 5IW6B 3UTSE 3FRPG 4GRWB 3HB3D 1NCWL 4QF1B 1N59B 1Q9OB 5C3TA 4RAHA 1RIVL 2WLLB 3TT1H 4LRIC 4MQ7B 4FNQA 5KVFL 5CBAA 3TTSA 2BY1A 1A22B 1UXWA 4OZHB 4HUCA 2GAZB 3MRPA 4JHZA 3UDWC 4ABVA 3U1SH 1GGIH 4OD3L 1KC5L 3U79A 1P7BA 3GSUA 3SDAC 4PRHA 1HQ4A 4M8QA 2Y1ZA 4R97C 3SYCA 3UBXG 4L8CB 1P53A 3Q1SH 4PY8I 1ZS2A 3C60A 4JRLA 2C3XA 3RX8A 1U6AL 3D52A 2F5AH 3K4ZA 3QRBA 4XXWA 3D34A 3N1MC 4UQ3A 4WIQA 2AXGB 4F93B 2K4WA 4M9PA 3WFBL 1FZJA 1GZHC 3II3A 4M1DL 4XCNA 3ZIMA 3LRGA 2NPLX 1KIUA 3L4YA 3QH3B 4ES9A 3FRPB 5F3BA 2VLJE 4L1TA 2NY4C 4LPTA 3VM5A 1CICA 1YMMB 5JOFA 4V1DD 5JXED 2JQZA 3CDYA 3RY6A 1HSBA 4XMXA 5F9JB 3KR3L 2DEWX 3DURA 4WTXA 1DN0B 3GFUA 4LCYA 5M94B 4QYAA 2CUIA 4UF7C 3T0EC 2APTA 3A0OA 5FUCE 3ZQWA 1S4IA 2OFQA 3IGAB 2ISDA 1R3IH 2VMDA 3NJXA 2BM3A 3GBDA 1E6JL 4L1HA 1I1YB 3LXCA 3U30B 3W0WB 2DYSB 3UBXB 5IUSA 1I9JH 5AAWC 2CGYA 3U36A 1JOIA 2WNXA 2BCKB 1K9TA 3DA0A 3GLAA 4XBEL 1RMFH 3G04A 1MVYA 3C6LA 1NAML 3B3IB 1Z6JT 2AJZA 1DO6A 4HIXH 5TE7L 1GZPA 3U9UA 1NFDF 2YSSA 4GSDL 1GTNA 4JFEA 1T5WB 3LRKA 2VZTA 2ICWJ 5GGTA 1OAZH 2J6EA 1IV8A 2VRAA 3Q5YA 4K2UL 3UTZA 1IC7H 2AV1B 3IRPX 4JM2C 2DOCA 3AAZA 3QUYD 2NY2C 2VW6A 1P9MC 2WTRB 4IHOA 4M93C 3LNIA 2PKDA 2WUCH 2P26A 3CFNA 2HPTA 1E9QA 1L0XA 3VFOB 1G5GA 1MAML 2YHGA 3HG1E 3NJJA 3BEVA 5E2VH 5ISZB 2KLRA 1OP5H 1QSFD 3OAUL 2MCAA 1WCQA 2VGLM 2WQ8A 5JO5B 4HJJH 4F7CB 3S36X 1U95B 3MLWH 5KSBA 2A1WL 4XT1C 2H6UA 2XZQH 4K23L 1KFAH 4YBQD 5JOEA 2UXGA 4FQXC 5DJCA 4LHUD 1HKLH 1T89A 2I25N 4I9XA 3W2DL 3VSUA 3PJSB 1MPAH 2NNCA 3W82A 3W57A 3TO4A 3FQNB 4WDIB 1A14L 1KCLA 1LEIA 2F6AA 2K7QA 1F5WA 1KN4H 3TBTB 4CVXB 5GQBA 4GLRI 3MBXH 2YD2A 3KH4A 4WHCA 2DICA 4AX3A 3AZUA 1KEGH 3DJZA 3UBHA 3L81A 4WWKB 3E6HA 1YPZA 2ATKA 5CEYB 4Y4KC 1YYCA 4Z7QF 2Z31A 2ESVD 3L9RA 4JPQA 3GC3A 3VWJA 2BVYA 1EXHA 4F15C 3BQUD 3L9YA 3AXIA 4NYLA 1LWRA 1L9NA 5TF0A 2H5UA 5E03A 1A9EB 1UWYA 3QHZH 4W6YB 2ESVE 2IPKA 4X6CF 3QQ9D 5I1CL 3QZNA 1N12A 3FCUB 3RNKB 4JPIA 1A6VH 2A83A 4X4XB 3RKPA 4I0PD 4AQAA 2K45A 4WI8A 2QQLL 5KUMA 3QUMH 1G7PB 3U4AA 5FUOH 3TFBA 4FNLL 2XG4B 4TNGA 5D2NA 4A2MA 3G5XB 4LVEA 1BIHA 2ERJC 2VWEC 4NN7C 4DQAA 4HIPA 5EF3A 2CO6A 1V3MA 3I9IA 3CXDH 4NGHH 1J5CA 3DO3A 3G5ZB 3MJ8B 3VXUD 1QLEH 2WIIA 4J6RL 3SY0B 5EU6D 4A7TA 2MQGA 4P5MB 4MBRA 3TH3T 4K7FA 3VXUE 2ADYA 4OLVH 2VDNB 1FSKC 2X4SB 5DD5H 5F1SA 3KXFD 2LTQC 4XGZA 1TVBA 5D1QD 3ASNB 1HH9A 3D12B 4Y5XB 3ZT7A 3QRFM 2YQGA 3KPPB 5D72H 1MRCH 3KXFE 5FW7A 1D9KA 2YD4A 1KUMA 1UTDA 1TPXC 4LLUB 3ZE2F 1I9IL 5EN2B 5TK4A 1E6OH 4YX2L 1YEKH 3M1CA 1QKZL 1XXFC 4JBSA 2Y0SA 4EZMA 4NNPH 4FNUA 2HTLD 4XP9H 5DGQA 5A2CA 1I1RA 2E7LC 4QXGL 2BSCA 3WENA 1U8OB 3TGXA 2GTZA 2J6EH 3ZL4L 4LSTL 4OUUB 4DVRH 4L9LB 2EXYC 2B1HL 2J8UB 5K9KB 5FW8A 1E8ZA 1A64A 1OW0C 2DQIL 5KBDA 3O0RL 4JRYB 4X9FA 4GQ9L 3GDCA 1E9PA 1FAIH 5A1AA 2ATAA 2GJ6D 3ARFA 2DH2A 4LARL 4JHBA 1NCAH 1IBGL 3K91A 1COBA 5GRXG 5L88L 4PRBB 3VGAB 3O3UN 4PJAF 4LXFA 2VC2H 3FQWA 3AROA 1Z5LA 2VLLA 3M17A 3RVTC 3TJEL 4Z77A 4NUPA 2OZ4A 4KGJA 1RFDL 1N4XH 2ZQKA 5DTFB 2ICEC 1TTAA 5FV2A 3H9SD 1M3JA 5EUKB 2FT7A 3PWVB 4LFHG 3GTTA 3MTRA 2OXGB 2QDWA 3KS0J 4UNUA 1KPRB 2OX5B 2OM5A 3N41F 3S36H 1UM4L 1KB5B 3MA7B 3DUHA 1JZ6A 2PYFA 2GW5A 4EOWL 1A3QA 4AUYA 3NH7L 3EFFA 3BPOB 2V7HB 4HJ0D 1VEOA 1WQVT 4XPTL 2VDPH 2AK4D 4XXCC 3QHTC 1RK0B 3MI6A 3CDFA 2W60A 3SO3B 3VB8A 1HDMB 1EEUA 4QOKD 1IGFH 3FTGA 4NKIL 4P5TA 3IDYC 3INUH 1K4CA 1VCBC 4ODWB 1U8KB 3BVXA 3NTCH 1UKQA 4LGPB 3CN0A 5IHUL 3KNBB 4GKNB 5DF0A 3HAEG 4DH2A 3L45A 1NDTA 3FL7A 1JVOA 3ERXA 5MEOB 1MHCB 3X3GL 3VXSD 4RBPK 4NNXB 3TWCL 1FWXA 3P4NB 1AHKA 1TF4A 3PF2A 3QDGD 3RB5A 3CDCA 3F84A 2MOGA 1LQBC 1AYRA 1QBLL 4ODXB 2FK9A 1MHHB 4F1ZA 1G0XA 5C0AD 3K71A 1PDKA 2L4OA 1DQQA 4OLXL 5K1VA 3L5WA 4NJ9H 4WUUD 3V6ZB 2RACA 1TCMA 2ZG1A 4GG8A 4RFOH 3WKPA 3I6GA 5C0AE 4NT6A 3ILEA 1NBCA 3UTTB 2DJUA 3OSVA 4Q9CA 5D7IB 2X89D 5LWYL 1T6VN 2JK5A 4Z76B 2K6ZA 2HN7B 3LKOA 1KN2H 4X6CE 2B9BA 1EGJA 3O8XA 5T1JA 4YPGA 3T71A 1MFAL 4GEJA 4OBSA 3JQOB 1W91A 2XWBA 1YEWA 3CVDA 2D7NA 5BMFL 2VB5A 4TSCH 2EE2A 5D2LF 1XT5A 5DT1H 5F6HJ 4MHHG 4TF4A 3HAEB 4B0MM 5BO1L 2EDEA 5IWLA 2R69H 3FHAA 3H3BC 1XL4A 4W9DC 3P40A 3WKYA 3T6ZA 4U6VL 5D8JH 3ESPA 3PNRB 3BIKB 3MO1A 5SX4I 1M6OA 1H9DA 4H8VA 3MCLH 4G9FB 4MMYB 4DKFL 1T04A 2IV8A 4JGNA 3L08A 1CL7L 1CR9H 1KNOA 4AZ8B 3MV9D 4JFWA 3K0YA 4MNHB 1MAJA 2W9DH 1K8IA 3HVDA 5ESVA 3FCSA 1AQMA 1UVQB 2X9WA 1CGSL 5MP6H 3BPCA 1B3IA 1UD6A 3O9WB 3MZGB 3K7UA 1HCFX 2OZ4H 3D39D 3WHXA 3Q6FB 3S4SG 4C58B 3ZE2E 2D03L 1M7XA 1WHPA 3L5XL 4F24A 5IGXH 5E99L 5HHXH 3D39E 1UHVA 4WFGD 5FHBH 2XKUA 4OM0L 1Q1JH 4KK5C 1ADQA 5D71L 2J8HA 4JO2L 2F8XC 1ANUA 2FUTA 4LAQL 1UWEH 2R15A 4KHXL 4OCYL 4YE4L 3W5MA 1URIA 2IOIA 2HRPH 4WFGE 4OW6A 2NY6D 1QR4A 2KQNA 4Z18A 1PZ5A 4BFFA 4ETYA 1DFBL 3GMRB 2A6IB 3BJ91 4ZO9A 2HJLB 4G83A 4LLWA 5T1MB 2Q10A 1L9SA 2XPGA 2Z4TA 4JFSA 1OAUH 4LNVA 5C0IA 3AMLA 2DQCL 5TQ2L 1DVFA 4JAMA 2K3TA 4PJAE 2ZCLL 2X87A 1JPTH 1OGAE 1TJGH 3KYNB 4K94L 1BM3H 1I8IA 2H32B 3CFKB 3SGEH 3UYPA 1LO0H 4HZLB 2HT3D 1GR7A 5HGDA 5I1HH 4R5TA 1JRHL 2P28B 3BKMH 3S4SB 1I9RH 1Z3GH 2IAMA 3LEYL 1RHHB 1A47A 2XDHA 5ICUA 4AJ0A 4B9PA 2VSKB 5GGSA 2GSMB 4F8QA 3Q9PA 4XI5D 5FYLE 1DYZA 3P4MA 5AW5B 3L17A 1F41A 3FT0A 2NY1D 3AS3A 2ZAHA 1SMOA 2CKBB 1IEHA 2Z0UA 1QFWL 4YFLI 2X88A 2CIKA 4X5WA 5J13B 1ETB1 3GGWB 1BD2D 3T3ME 1WE5A 2J72A 5KUKA 3BKJL 4PMEA 1JGVH 2OI9C 4Q97A 1G9HA 2G0KA 4NPYB 1TNMA 3OLIA 4AIEA 3BT2H 2QPEB 4AKPA 1BD2E 1DR9A 1AO7B 4PJFA 1OANA 1EHNA 1IB5A 2F19L 5H8DA 3QZMA 3FAWA 1GRWA 3CX2A 3OKDA 4M03A 2VM4A 4M7JH 2N0KA 1JHKL 1SLVA 4P4KA 2VDQH 5DHYA 1REIA 2CJTA 4ES8A 4FN0A 3CLFL 5ALBL 1VRSA 4GUCA 3ILQC 2W0PA 3IDNA 1BFOB 5KANI 2WQRA 2B1OA 4G9DB 5TDPA 1PZAA 4B9ZA 4A2FA 3DMMC 3LS4L 1YEEH 2BVOB 3OHXC 4PTTA 2OXHB 5IHHA 5H94A 2O6PA 4A2DA 4XNYH 2DTMH 2AEPH 2PWDA 4XX1G 3L7EB 4QKTA 5LGKA 2GJPA 4AG4H 3WFCH 2XVBA 1W6LA 1C16B 3MPCA 2BHYA 4KDWA 5F7MC 3IJYA 3OF6D 2XC8A 3QG7L 1MLCA 1ECYA 1U93B 4UILH 3NRPA 1AKJA 1EVTC 1MCBA 1XGRB 3ZL1A 2YAOA 1DZBA 4JDTL 5D2LE 1A5FL 4NQXA 4B96A 3I6SA 1H5BC 4KMTL 4P2OB 1ADQH 1S7SA 5DHVB 4QXWA 3EYFA 4YWGL 1SXBA 1EX0A 1FYTB 3O2VH 1JV5A 4TXVB 1Q0XL 4OLEA 3FTVA 1X5FA 4HS3B 1MHEB 1FPTH 1GC1L 1WYJA 2P5WE 2PYEB 4RRPG 1GYUA 1IC5L 4OZFH 3KWTA 3UTQA 4ZJ9A 3WXVL 1LD9A 3EBGA 2DQJH 5EDXA 5DMKB 4NM4L 1K3IA 5DA4A 4N1EA 1WLHA 5B3NA 4U1IB 3RWGB 1ZS8A 4S1RH 1SNRA 1S7QB 1OD7A 3DVIA 1E28A 5FB8A 3QWQB 2EDFA 5CGYD 4HV8A 4OKVB 12E8L 3P9LA 5IW3A 3MACH 3KM1A 2WYTA 5KW9L 5E1IA 4MX7B 3EFOB 3TF4A 1MFMA 1OT2A 2N1TE 1Z3RA 1TZGH 4MSWB 4FG6D 4A6YL 4G7RB 1P7QA 3BFWA 1DBAL 5MEND 5E6IC 3ARBA 1BEYL 2BDNH 1Q0YH 4RGMB 5TE6H 5DJDA 2VKXA 2VABB 5FYKU 1M57B 2FEDD 2XKNA 3K2KA 5MENE 4AENA 3KL0A 3LZFH 3TVMB 1A02N 3QULA 2HVJA 2QQNH 3WD5H 1LTXA 4RAUA 4EIZC 4XMPL 3A5VA 3RZCC 3OAZH 4RGNE 3HG2A 2MKWA 1TZ8A 2ZXCA 4MA3B 3MLPA 2DKSA 5E8PB 3TFKC 3OAWA 5I9QB 3C2SA 1OE1A 1FL5A 1FNHA 3VFMA 1T22B 1JTTA 2DLGA 1XSOA 4LKCB 4AYID 2DBJA 2YRLA 4GP4B 4NZJA 2JCCF 3UJJH 3IFOB 1QSEA 1AFVH 5JW3H 3R0MA 3VXTB 3K8KA 5HGHA 1XEDA 5GRVK 3O81A 1A8JH 4ZUUB 1ESOA 1WAPA 1MRFH 4G43B 1MEXH 1WWWX 5F70A 2H0FA 1AQ8A 4ORGA 4AQ1A 2QKIC 2DQFA 2CCVA 1XGQB 1IBBA 2NW3B 3IFNL 3QAZC 1RUMH 1J8HD 2L7UA 2AVGA 2NQCA 3VRIB 5I1DB 2O26U 1A6WH 1VFAB 4N0UE 3QIUD 3ILPA 5SWSB 2IWEA 3BAWA 1KENH 3GRGA 3BGFB 3MV8B 5EMYA 1ZLWH 3MNWB 1MWAL 2A9DA 3GSWB 1A6ZA 1HYRC 1OXYA 2GC4C 2X6CA 2YQ3A 1WT5C 3EHBC 1SN5A 3ZDZF 3X1BA 1ZJBA 2EXTA 5IFHH 1AACA 3GJFK 1BM7A 2Z35B 1ZHLA 1BZEA 2CHDA 4BFIB 4OCSL 1D6EB 1KYOK 3WJJA 2VJ0A 3BLBA 1O6SA 1B9ZA 3GKWH 3VTAA 5IQ7L 1QUNB 3CN3A 1LE5A 1J5OL 3APFA 1F6AA 1PU0A 5CIPB 3IDJA 3C6SA 4FQ1H 4XPAH 5IIEA 3RI5K 4GQQA 2QGDA 4OZIA 5CS7A 3SZ6A 3OVUB 3QT2A 4FI7A 1LE9A 1L6PA 1FLRH 2FT8A 3HPLA 3L3OC 2ZUVA 2AS5M 4L05A 4Y19D 1GW6A 5JHLA 5DURB 4NCC1 5DRNB 1FVEA 2R7EA 3TP4A 43CAA 2K8QA 4QT5B 3V8OA 1NMBH 2VDMB 4DGYL 5BZDB 2OL3A 2VXVL 4Q89A 4PJ5B 3IDMA 4G59C 4WHYG 4DP1X 2YAFA 3EH1A 3F04A 4JY4B 2YPVA 5F2FA 4DEPB 2VE6A 4LT7A 1JN6A 4JRFA 4XXDB 1OAKL 2NY3D 2Y7SA 1QX1A 3D33A 5FYLH 2J56A 3DECA 2W81C 2E4FA 3KPTA 4LCIH 2BW4A 5I66A 4ABWA 2ED6A 4KFMA 5KVEL 1DBML 3HI1B 4IU2A 4Z8FH 3GXPA 3DYPA 4F7MB 4FTVA 1I8MB 3WKML 1PZ3A 4W9LC 3MRNA 1NCJA 2R23B 2FH6A 5B1JC 2UY6A 2OMTA 5IHZA 3CZKA 2MCMA 1PKQB 2HA1A 3PY9A 4MD4A 1JFQL 1IGJB 1QR1A 3HZMA 3OKEB 2P24B 4EJ1C 4F91B 4XAWH 5KS9F 2ED9A 1R33A 2AGJL 3BUTA 3SGDH 2YPLA 3MNMA 4GSUA 4GW5B 1PFOA 4P04A 5B1BB 5BRZA 3O3AA 1LDPH 3MOAH 1DUZB 2Q1EA 1UZGA 2HKHH 4ODBD 5ELIA 5AW6B 3R06A 3NFSH 3MJGX 4F27A 2IDFA 4YH6A 3R8BB 3WFZA 1WIPA 2H6PB 3LIZL 3MRCA 2G30A 4U1JB 5I26A 2Q86A 3A22A 1RUQL 1YJDC 4M62L 1XMEB 3N43B 5H2BB 5HI5C 5E9DA 3VH8B 3FOLB 3P0YL 3QI9D 4DGVH 3LKQA 1NUGA 4EO5A 5SX5H 5I73C 2NT0A 3LRLA 4PGCB 3QPXH 2BNQA 4WW2C 5F88B 2ZG2A 4TQ8A 2KZBA 3SE3A 3QDMB 4H7VA 3FFOA 2NYKA 2J4WH 1ZK5A 2CO2A 4B5EA 1TSRA 5E1GA 2VR4A 1VESA 1AXIB 4KUZH 2WKOF 3ARVA 2EE9A 2X5PA 2H45A 3LNDA 1PLCA 3VFUA 2BVTA 5HI3D 1XO8A 1M2VA 1P4UA 3FC8A 4JO5A 1K4DA 5IT2L 2XQBL 4LGRB 4WSGA 4OZ4B 2WD0A 5GSVB 3FQYA 3CDGB 1YEDA 4HK0B 3GZOA 1BX2A 2EEAA 2FQFA 4PSPA 2IPUG 2FO4A 4L3EA 1KTDB 3AG1B 2ENQA 4F5CE 1N64H 1DJHA 3IGLA 4HUKB 2XZAL 2YRZA 1ZGLA 1WBYB 3CFEA 3V5HA 4OCRH 4JFTA 1XF5A 3C09B 4PRID 2GTWA 2Y06L 2DDQL 5I18H 1N18A 3F65A 2EXWD 3TBBA 1MLBB 3VU1A 1UXSB 4PRIE 2AAAA 2IJ0C 4UQ9A 3B1TA 1NLBL 5JHLH 1YAZA 4LASL 5F6IB 5L2KA 4RAVB 1QBAA 1DBJH 3T4AB 5MERA 5IROA 3L4WA 5I16B 1F4XH 1XX9C 2W9EH 1X9UA 1OCWH 2ARWA 3H1ZA 1OARH 1TLKA 5C6WH 1UT1A 4BKTC 2H1PL 5AZUA 3CXHK 3FQ1A 4MAYD 4YLCA 1FJ1A 2VCOA 3AG4B 3SBQA 3D08A 3T0XA 2ZNWA 1JDCA 1J87A 3I84A 4JFYA 3X11A 3U0PB 2NX5A 2OAAA 4ZUTA 1YUHB 3MC0A 5LAXB 4P07A 4YOKA 1C12B 1U8QA 2DD8L 4ELMF 3SQBA 1G1OA 4ZRGA 3PQYA 4AC2A 3MLUL 2DYRB 1GH7A 3LDBB 1WAEA 4OB5H 3LB6C 3NVQA 1ZXKA 1LEGA 3U7AA 3M45A 3UZQB 2GSIB 3QXAA 3KBPA 2YMXH 4M3JA 2XA8H 2WCGA 1NCBH 4G82A 4ERSH 2GJZB 1MHPL 3NP3A 2TSAA 4YLBA 4FJZA 2WLNA 3BOVA 1RPQA 1FFPA 4OM1H 4H5SB 3SODB 4HUUB 2NSXA 4DEPC 4FL4C 3PWJA 5TDNA 5LAPA 4FD0A 2XRAH 1IFHL 4P2QD 1DVXA 3VD9A 4N0RA 2DWDB 1MZZA 4GKZB 5GGUA 4MCZA 3MTXA 3Q06A 3QNYA 1YLBB 3B9KB 4TUOB 3BH9B 3S96A 3F3HA 3AREB 4YHMH 1CE1L 5DEGA 2GSGB 5KN5B 2X1OA 1AY1L 2XLLA 4XE5B 3TCTA 1BREA 1X9RA 3CFCH 3CHSA 4ZYKB 2LFEA 1UCBL 5TK2A 5AVSB 1HXYB 3H9HA 2NXYB 2C9SA 3QUXD 3WN5B 3TBCA 3M1BB 5KVEE 3F5WB 1QLFB 2G3MA 4YDLC 5EU5B 3TBYA 4EDWL 5IQMA 3BGMA 3ZGIA 3NMEA 3RY5A 1A1NB 1J1OL 4HJTA 4Y16A 2C1OB 4R26H 3DX7A 3FT9A 2AKRB 1AJ7L 1QI4A 3ABKB 4LDLB 3GSNL 2R2CA 3WYRA 1JPFB 4WU7A 4FYTA 1SDAB 2YKLL 2XV6B 3PP3H 1SXCA 4LEOA 2M26A 4U6XA 2VZ3A 3HMWL 4S1QL 2P8PA 1JXFA 4LHJB 1RZKH 1IBYA 2E7HA 1KELH 1DLFL 3TZVD 1SLWA 2VMCA 3OD3A 1U8JA 2IADB 5EEVA 2H6OA 2FEJA 2J2ZB 3JZYA 4DP8X 4NX0A 4HGWA 4WEMB 1THCA 1VEMA 3S37X 5MI0C 5FLVA 3O6FB 2FJUB 4RISH 5EBMB 2WP3T 1MCQA 3AU1B 3T09A 5C0JB 2OMUA 2AMUA 1EEZB 1EIBA 4AEFA 3K5SA 2VDKB 2AQRA 4XP5H 3L3HA 3V8CA 4HF5L 3C2AL 1MY7A 4FQJL 1ZHKB 2JJTC 1TZHB 1YEIH 2VMFA 2JLLA 4B0MB 4LRIA 1F4HA 4L1SA 3LKSB 1IGYA 3OB0K 1S7VB 5BVJA 3GPEA 2J55A 3UDWA 4L37A 3DXAB 1S3KL 1V3KA 2BMKB 2IH3B 3MBEC 3MV7B 3LZLA 1BW8A 3P9MB 3SDAA 3VD0A 4R7NB 3EJUA 2Z7WA 3PGFL 2W0FB 1FO0H 2AW2A 4XMKL 3HB3B 4Q58C 4X9YA 2YQBA 1UGNA 1XR8B 1KT2A 3LPWA 4IHBA 2E9IA 5KJRL 3EFDH 4NDMB 5ID1B 2A9ML 5TQ0H 5DVLA 1R9FA 2OMNA 3FCGA 3HS0B 2PW1B 4JMNA 4JPSA 5CJBA 3SJVD 4I13B 3TEZA 3CHOA 2AEQL 3OQRA 3QUKA 3TC9A 1GZHA 1YEHL 1MAKA 3GI9H 1KGUA 3WEXA 1UH2A 4RDQG 5E6ZA 2NMSA 3EG9A 4DQOH 2VLRD 5GISL 4XVOA 3RIFK 1QFWM 4LAJH 5DZJA 1G9NH 3BC9A 7FABL 3UAAA 1HKFA 5EEWA 1UURA 2AANA 1WG3A 1MKFA 3MJ7B 2R29H 3JWNE 5HVGB 2N4IA 3T0EA 1HH6A 3FQTA 1B88A 4HWEH 1OE3A 1T7XA 4YLQT 4F33B 1P7HL 4YL4A 5IP4A 2XTJD 2FSDA 2HWZL 5F9OL 5AAWA 4PY7B 1U8LB 2HH0H 2ZXEB 1TQSA 3U4BL 3S6CA 4ELKA 1ZVSB 4ELME 4V1DB 5FA3A 3HKFA 4LNRA 5GGTL 4BFOA 4TQEL 4D9QE 2BC4A 3K8MA 4S1SL 4F7EB 2FZ3A 3RU8H 4PS3A 4YUEL 1M1XA 4N0CD 4QUOA 4WNQB 3L1EA 4FMVA 4Z3FA 4YSOA 3HLAB 3AU0A 1MCOH 2UYLB 4JM2A 4EDXA 2Q2LA 4YDMA 4HIIA 1WA0X 1UASA 4HQQH 4NLAA 2EIMB 5DZPA 4X9HA 1MW3A 2R4RH 3UPAA 4Y9GA 3MFFB 1W6WA 4LP4A 1KLUA 1IAOA 1ZRUA 5DJ6B 3HN8A 3EYQD 2NUTA 2EYRA 1CJYA 2H26B 3MV11 2PPFA 4QY8A 4FFYA 4ZUSA 1D5XA 2EEDA 1P1ZA 5D7SH 3NG5A 5E51A 2JKWA 2PXYC 1L7IH 4MJ6B 5IJKC 2ZUQC 3L5JA 1Q9WA 4ENEC 4FQ2H 4XODA 2BRQA 3QUYB 4FC3E 4FQXA 4ZMXA 5I1LA 2K3HA 3ET9F 4CADB 4LGSB 4HXAL 4I9WE 3U7WH 4ZZFA 2C26A 1KTLB 1QQDB 3MR9A 2ZKWA 3O0LA 3S37H 3WN5C 1P4LB 2JFCA 1U2YA 5C0NC 1ZHNA 4IOSD 5FFOA 4XMUA 3RTLA 1QSFB 4ZXBB 5IB5A 2BIPA 2G2PA 4N9GA 1LXMA 3T0VA 4D0BB 4PB9H 4MJJA 4Y4KA 2JJSC 3BZFB 3CBJB 4M7LH 3BSHA 3MLVH 4I87A 5A2KH 3MCG1 1JGEA 1R3JA 3JV6B 3WL9A 5DUJA 3P02A 4K3EL 5FUZL 5JYMA 1QYGH 4KK6D 1OAJA 1JV2B 3VSTA 5HVHB 5DMYA 3CH1A 3FQXA 2RCSH 2WOYA 3DI3B 3NSYA 2UZXB 1QBMH 4PREB 2E47A 5FA4A 1HHIA 4GI9A 1BFVL 3L2LA 4FYRA 4YFDB 3CUPA 4JO8A 4G8FB 2KLSA 3H6JA 4Z7NF 2HG5B 4Z7VB 5T3ZL 4AYFA 5I24A 4JO4L 3HE6D 4M7KL 2UZIL 2VL4A 2CALA 2H1LM 1CFTA 2JELL 3CU7A 5E1AA 3WJMB 2WYIA 5CLYA 5FS5A 3O6LL 4FLHA 1X7QB 4I77H 2FWOA 4ZO6A 5JLZB 2HUEA 2GHZA 4WI0A 5AB2A 3PXJA 2EYSB 1CLYH 4AXWB 2WLYA 1JI1A 5D6CA 4OZGA 5DGRA 5CO1A 4I0PB 5CFAA 3RWIA 1RULH 2PR4L 3KLLA 3DX9B 5BRQA 2H3XC 2LAGB 5C0DA 4PRHD 1HQRB 5GHWH 2CJUH 4EN3C 3QXVA 2R2EA 5IFAH 3IDXH 4BFGA 5CLZA 4PV8B 4ZUVA 3LXAA 5EBLA 1ZTXL 4XC1L 3C60D 1ND0B 5E4IA 3SE8L 1JGLL 4AIOA 4CDGC 1DVTA 2E7DA 5EU6B 1IBDA 2GIYA 4R7LA 1FORL 1JAEA 4KQ4H 1IKNC 1HL4A 2OCFD 3BLPX 1AP2B 1KIPA 3PIQA 3QRGH 4NBXB 4UT9L 4UNVA 2E7LA 2YC1B 1JMXA 3X1NA 3DTUB 1VADA 2Y2YA 3LN5A 4KH2A 4W9KC 3QCUL 3HC3L 5I17B 5D1QB 1UEYA 4BQBA 5DD0L 1OW0A 3QJFA 1CICD 1VPOH 2I26N 1AGDA 3GI8L 3SYAA 1A1OA 5FOBA 3PWNB 2G4EA 3LTVA 3MRIB 4K8RC 3NSJA 2D9QB 1FV1A 2Y07H 3HS8A 4MDIB 4PGZA 3ULUL 2NNXA 4DEUA 5DJZB 1IC0A 2OMZA 2R0KH 4MA7H 5KBLA 1QZ1A 1PFCA 5ADPL 4TNVF 3KPMA 4ODVL 3MGAA 3AQZA 1Q90A 5CJQH 2K70A 1KACB 1DBKH 1BVNT 4NQSB 1IEBB 2ICEA 4KHTL 4PJEA 3ULUF 2NZ1A 3F7YB 3KPSE 2J5WA 2FR4A 4Y0GA 2FATL 3MYJB 5DQJA 1T03L 3PDOB 3C6LD 5JR1H 1UA3A 2GJ6B 4LLYA 1E8YA 4ZD3L 2W65A 3ZYIA 1U8HB 4M43H 2X6VA 1QFHA 4JFED 4MASA 4PGBB 4UQ2A 1AYOA 1S9WA 4NP4L 3STLA 2XXCB 1SPDA 5DS1A 1JHTA 4MVBD 2Q76A 5T1LD 4XBGA 4K7PL 1BQHA 3FCTA 3WSQH 3N40F 3BPLB 4X83A 2C4FT 4XXCA 1NFDB 2R2BB 3E9UA 3H9SB 4LPVA 2CQVA 1NCUA 3DJTA 3DDGA 4KVNH 4M02A 2OCCB 4NHUB 5EOQH 3MJ9A 3CN1A 4PJHB 3N1GC 4AL8H 1BF2A 2H0JA 4IU3A 4FXKB 4G7VL 1NAMB 3IT8D 2SEBB 1YHPA 2VQTA 3H4HA 5EOTA 4QXTA 1DCEA 4JKWA 1YEGL 2PTUA 4LEXH 1GAFH 2GTQA 5EORL 2BY0A 4ZPVA 3EGDB 1MI5A 5EUOB 1KTKE 2AK4B 1CLZH 4Z3JA 4DGIH 5C1MB 1MIEL 3BFQG 4P4RB 5HPMB 3N85H 4QOKB 5F44A 1Y07A 2YBRB 5DSCB 2BSTB 3FAXA 3TO4D 5IOPB 5JQIB 4Q7DA 2FGZA 4ZXBC 2VR9A 4DAGL 1WIOA 3M8OH 4PG9B 3FB7A 4KY2A 2IANE 4CMHB 1ZV9A 2VR6A 4IQHA 4GP5B 2QV2A 1FGNH 4XVTL 3ESVF 1K3ZA 2FECI 3TCLB 2Z31D 3VWJD 5AZEL 1JVLA 3JWNH 5IJVB 1P2CA 1EGJL 4HUWB 3VXSB 5GS0C 5HVHC 4ZMOA 3QDGB 2UWEE 4IBVA 3O41B 1BLNA 3MUY1 4RSYA 5K9OA 2AJXL 3Q48A 4N0YL 4GQZA 1E4WL 4Z7QB 5DQDL 1VAHA 4GB9A 1ASPA 2AV7A 5HY9A 4BA0A 1QWUA 2HKFH 3X13A 4WUUB 4UI2A 4Z7NE 3ARWA 3N5AA 4UNIA 1BXVA 2HPOA 2YOAA 1EXUA 4GAJH 5GS1C 3HBPA 2YEZA 3NFNB 5AG8A 4A55A 5T3ZD 4LLDB 2WBJC 3V79C 1KPVB 1E5CA 1G1CA 1A9BB 1GMEA 1ZANH 1ZD6A 3BP7B 4X0KA 1NGWB 2A74B 5F72S 3EOTL 3A3YB 3UADA 3O6KH 2KQMA 1DDHA 1S78C 2R0WL 2FD6L 2CSPA 1P84K 2X28A 1D7DA 3BKCL 2J1XA 2NUPA 2WWOA 3GXUB 1JNHB 4L4TA 5I6PA 1KDJA 3WEMA 4G6ML 2F53A 4XWOC 4W9FC 4G42A 1MCDA 3E8UH 5CJ5A 2IDSA 4MBOA 3U83A 1IAKA 3RI5F 3MV01 3HBGA 1D9KD 3GRWA 1U8IA 1ACXA 5IESH 1R75A 4X80L 4XCYB 2OMVA 1VGKA 2G5RA 3MV9B 4NN5B 4UU9A 1F6FB 2JB6A 3CZSA 2AI0L 2N3JA 1WA1X 1EZVY 5AL0A 4N28A 3AMKA 3AS0A 1ZLEA 3X14A 2KZWA 2CJSA 1BQRA 1W9XA 5HDQL 4HU2A 5FM8A 5I6XC 3VFSA 5B8CB 4PP2A 1BZ9B 4C83B 1BQKA 3OJ2C 4R5VA 3ARFD 4TOYH 3B7TA 3B9DA 5TGBA 1E8WA 4NOBA 3FULA 1UENA 1UZ8A 3VD3A 4BH8A 1CO1A 1JGDB 3ZO9A 4F92B 2BP8A 3QO0B 2EDLA 3BUPA 3ULUD 2I7SA 2VIRB 3BKYH 1GXEA 4H8WL 4IRZL 1RJYB 4LSPH 1BMWA 3NRQA 3T2QA 5B1AB 5A2AA 2NY6B 3SKNB 3ULUE 1BXAA 3M6DA 2MHAA 5HHOB 1G9MH 2IGFL 1E7UA 2BOBB 4N8CL 3KEDA 3PREA 5SWQB 3VG9C 3NA9L 4KTEH 5F71A 2COQA 2EEBA 5ESAB 1G43A 3ESUF 1BDYA 2PCPA 2HT4D 3OQ3B 1YNTB 1ZEAH 2VLMD 1Y1DA 2KBGA 3DPBB 5K39B 3MRMA 4BFRA 5GSRA 3ROLA 4J3OC 5IJBC 1HINH 1BGXH 1EDQA 2VDRL 2WQSA 2Z92A 3QR0A 5ABDE 1CFSB 5CCKL 5INCB 1UJTA 3N41B 4C54A 4FXGC 1JK8B 5FHAL 4KPHL 2CHNA 3BN9D 3V4PH 3FSWA 1KBGL 2GUOB 4RBPH 4W93A 1LEKA 4P5TD 5CUSL 2NY5L 4L2YA 3HNTH 2HFGL 4NRXA 2OMXA 4RZKA 5TDOA 1B0GB 3EBIA 5AVXB 3V0WL 4P8QA 4B7LA 2NY1B 5F1IB 5C2UB 3D0VB 4X6FA 2XN9E 3HFFA 5D9SA 4OSUH 4PJFF 5BPPA 8FABA 1NDGB 1RK1B 1T5KA 3KW8A 3LKPA 4F9LA 4P2RD 2YN3A 5ERWA 1L5GB 3O4LD 4P9MH 3OXRA 3NQKA 1SEBA 1NEZA 3IMVA 1P4BL 3OGCB 4N2IA 3TNMA 3DMMA 3BIBX 3O4LE 2X4OA 1TG8A 4KVPA 2OR9H 2ADFH 4L1LA 2NXZD 3D4CA 4LCWA 3ZKMC 2DMBA 3KGTA 1LJMA 5DJAA 5DC9B 5KYYA 5D7EA 3RDTD 4PVNA 2EVIA 1QO3A 4HKXB 1GGBL 4O51A 5CEXB 3VTTA 3QSKB 1CGYA 4KFZC 4BZ1H 5L6YL 4AVIA 2C9RA 2GCYA 4GRMA 1DEDA 2CKNA 4ANXA 3O8XD 2A9NH 2UZYB 2V5YA 4JFOB 4KX8A 1BAWA 4IMLB 4K5OA 1CFVH 1ES0B 1ZGLP 1H5BA 4Q6IA 5KTEH 1EJ8A 4G80B 3X12B 1AE6L 3MRGA 2PWHA 2Y7QA 5F7EH 3I02B 3LHPL 4AQEB 2P4AB 2XNAB 3MNZB 1C5BL 3CC1A 1FFOA 2X12A 3VRLF 1QUPA 3FUHA 1H3PL 2A74C 4UDTA 4ODTL 4UQIM 1MREH 4KJPD 3IB4A 4POZD 4A7GA 1I7TB 3D2UA 3IKCB <