4DP7X

The 1.08 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 4.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin A, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp7X00
2GC7C 4EF3A 1OF0A 3ZBMA 2VM3A 2DWTA 1NWPA 2BP0A 2BO0A 3QJUB 1EHKB 3DTUB 1ASOA 3S3DB 5A7EA 4DP6X 1E5YA 2ZONA 3UGEA 3ZX1A 2IDTA 2HZHA 3T71A 1FFTB 3OM3B 3AG4B 3TA4D 1KDJA 2HRHA 5B7MA 4P5SA 4A68A 3IE9A 2B08A 2VW4A 3ABLB 4HAKA 1J9RA 1CC3A 3FU9A 1AZBA 2PPDA 1NIDA 4MFHA 3EH4B 2GI0A 2VW7A 1NPNA 2BP0B 2YAQA 1E30A 2GB2A 3BVDB 2CCWA 1NIFA 3AY2A 5D4HA 1WS8A 1N68A 2IWFA 3NJFA 2PPCA 1MG3C 1RCYA 1MZYA 4TXVB 3KW7A 4K9JA 2B3IA 3EH5B 2AZAA 4NB7A 4DP9X 2AZUA 2VN3A 4HCFA 5I6NA 1AZCA 2CUAA 2YXVA 4YL4A 1W6LA 2WO3B 1A4BA 4HHWA 4ENZA 1WA2X 5D4IA 1ILUA 4KO6A 6PAZA 1PZAA 1SFDA 2JXMA 2DYRB 4DP7X 3WIAA 3GYRA 4YSRA 2FQEA 3N55A 4W1TA 3EF4A 4A2FA 2GBAA 2HX7A 1UATA 4L0PB 2NRDA 4KO7A 3CDZA 5AFAA 1URIA 2WO2B 4Q8BA 1ET5A 4AI7A 2FQDA 3T6XA 2CAKA 2XYBA 4GP5B 1BXUA 2QDWA 3D12B 2UX7A 1AG6A 1OE1A 2BWDA 1N70A 3X1EA 1WS7A 1MG2C 2YXWA 4KO5A 2PP8A 1SHXA 1ZV2A 1TEFA 1ADWA 1PMYA 4DP2X 3EH3B 4F2EA 1ASPA 5FC9A 1KV7A 1IC0A 3T6ZA 3CDZB 4AKQA 2J57A 1HAUA 2IDUA 4HALA 3CVDA 3DIVA 7PCYA 3FYEB 2YAMA 1A4CA 1WA1X 4W9ZA 1JVOA 3S3BB 2QDVA 2IDSA 3QJVB 1WA0X 5TK2A 4AX3A 2BW4A 5AZUA 3RYMA 1X9UA 2XU9A 1A4AA 4BDVA 3AG2B 9PCYA 1XB6A 2CBPA 2LLNA 5B7EA 3WKQA 1BQ5A 5F7BA 5B1BB 1GY1A 1ETJA 5I28A 3CZUB 3OQRA 2UXGA 3ABMB 4YSDA 1V55B 4DPAX 1AR1B 3FQ2A 3WNIA 3ERXA 3NJGA 1E67A 4PAZA 3SBQA 3UADA 3QJQB 3MX0B 1JZHA 4GYBA 4E9VA 1ZIBA 1FWXA 4HCGA 3AW5A 1TU2A 3FPXA 1F56A 2YAHA 4YSSA 2FT6A 3FQYA 4HIPA 4E9QA 4YSEA 4DP1X 3IEAA 3QJSB 4DPBX 3PCYA 4GXFA 1BXVA 4KNUA 2XX1A 3PAVA 2EIJB 2DV6A 1NPJA 2FQFA 4RH4A 1L9RA 4WKXA 3SQRA 1XMEB 3OMNB 5B1JC 2HRGA 5I5JA 2WSDA 1PZCA 3WG7B 2QPDB 1GS6X 3H4HA 7PAZA 1B3IA 3PPSA 3OMIB 2UXTA 3CVCA 2J55A 5I26A 3UACA 1SF3A 3PLYA 2AANA 1MZZA 3CVBA 3FU8A 3FSWA 2BZCA 1FA4A 1AS8A 1A65A 2UX6A 1JZGA 4GP4B 3PAZA 2FT7A 2GSMB 3HEIB 5IY5B 1QNIA 1PCSA 5D4JA 1ZDQA 4YVUA 3L45A 1J9SA 4CSZA 4HZ1A 1MDAA 1AG0A 2W88A 3T9WA 3FS9A 4DPCX 1GS7A 2ZXWB 2QPEB 3UAEA 1NIEA 3NJHA 4E9XA 2GIMA 2ZWNA 2H5UA 2GHZA 2XWZA 3C75A 1CYXA 4M3HA 3AG1B 4A2GA 1GW0A 4E9TA 4GY4A 4A66A 3PAUA 1JXGA 2CJ3A 4JHUA 3ABKB 5E9NA 1IBYA 1WAEA 3SBPA 4JKNA 1OCOB 1SNRA 3X1NA 1L9TA 1L9OA 1HAWA 1W6WA 4KOCA 1JZFA 1PLCA 5I6KA 2BWIA 2FWLB 1J5CA 5B1KA 4AKOA 3S8GB 1A8ZA 3TU6A 2FT8A 4A2EA 1SF5A 5B1JA 2IDQA 2YAFA 3S3CB 1JERA 2YAPA 3MBWB 1HFUA 2JFCA 3QPKA 2HXAA 4AZUA 3NJKA 3GXUB 3OMAB 1PY0A 1SDDA 4YSTA 3WI9A 2IWEA 1M57B 4NAJA 1PAZA 2VW6A 4DP0X 1QHQA 1GR7A 4E9SA 1BEXA 2IDFA 4F2FA 2PPEA 1AZUA 1NZRA 1V54B 3NT0A 4QKTA 2YAEA 1IUZA 1PF3A 1R1CA 5B7FA 3WKPA 1KCWA 1KGYE 1AZNA 2X88A 1X9RA 2GC4C 5B1AB 3G5WA 1ET7A 4G70B 5I6LA 3FT0A 2XV0A 2YQBA 3S8FB 3ZIYA 1GY2A 1SJMA 2CALA 3FSVA 2PPAA 2XXFA 4A2HA 4A2DA 4HCIA 2E86A 4G7QB 5I6PA 3ZDWA 3X2QB 1CYWA 1GSKA 3QJRB 1BQKA 3KW8A 4BWWA 6PCYA 1AOZA 2HX8A 1W8EA 2EIKB 2H3XC 1BQRA 2OV0A 4HHGA 2QT6A 5AKRA 4A67A 5TK4A 2HLEB 5I5MA 4BDVB 1OE3A 1KDIA 2FJSA 2P80D 4YSCA 2YARA 1QLEB 3NP4A 3NSDA 1ZIAA 4JHVA 2XLLA 2PP7A 1BYPA 1RKRA 1ET8A 4YSOA 4FAAB 1GS8A 1E5ZA 4G72B 4N4YB 2H47C 4KNSA 2UXFA 2Y69B 3NJMA 4YVNA 2A3TA 1IKOP 2IH8A 1A3ZA 1AZRA 2BHFA 1OE2A 1KBVA 3AZUA 3HB3B 2PCFA 3ASOB 1XB8A 1GYCA 1I53A 4BWUA 1KBWA 2IAAC 1IBZA 2R7EA 3FU7A 4YSAA 3OD3A 3NSFA 2AVFA 1NWOA 2W8CA 2I7OA 3FPYA 2UXVA 3H4FA 2BZ7A 1CUOA 2EINB 2PP9A 4E9WA 1J5DA 1OOWA 1RZPA 1PZBA 1SFHA 5I5IA 2ZOOA 4UF7C 1DZ0A 1NTDA 1OV8A 2VMJA 3X1BA 3U25A 2VM4A 2XXGA 1AS7A 1J9QA 4DP4X 1YLBB 1VLXA 2R7EB 1TKWA 3FU7B 1AACA 4AKPA 3NJNA 4G71B 2YAOA 4M4RB 5EHFA 5I6OA 1AQ8A 2EIMB 2FNWA 5ANHA 3UAAA 1JXFA 1L9PA 3ABGA 1PNDA 4YSUA 1ZDSA 4ZK8A 2FTAA 1OCRB 1AIZA 1RZQA 1ZPUA 3FQ1A 2IH9A 2BP8A 1AANA 4DP8X 3GDCA 2VSKB 3CG8A 3PXLA 1DYZA 2DYSB 2JKWA 3NP3A 2RACA 2XX0A 3DKHA 1E65A 2XV2A 3EHBB 2MTAA 2J56A 2OCCB 1AAJA 1JOIA 2N0MA 1JZEA 1KYAA 4WTQA 1JVLA 1BAWA 4E9YA 3WNJA 2I85A 3TASA 1ASQA 1NICA 3BQVA 3T6VA 3NJIA 2J5WA 1BXAA 4GP8B 4E9RA 5LDUA 5B3SB 3NSYA 4YSPA 2X87A 1OCCB 3JTBA 3ASNB 2BP8B 3IN0A 4P5RA 2Y1AA 2VSMB 1ILSA 3QJTB 2TSAA 4X4KA 2DWSA 1AS6A 1V10A 1KCBA 1CURA 1ID2A 1PNCA 3V9CA 2IWKA 3T6WA 3IBOA 2BW5A 2HX9A 1M9WA 5F7AA 3V9EA 3H56A 2TSBA 3X1FA 3NJJA 4YSQA 4N8UA 1NIAA 3FSZA 2PLTA 1SDDB 1L9QA 2P80A 4DP5X 2MRYA 2FQGA 8PAZA 3FSAA 1SHWA 1NINA 3NJLA 1PLBA 3QQXA 4QLWA 3SBRA 4UAHA 2DY2A 1BYOA 1NIBA 2AFNA 2PCYA 2PPFA 5PCYA 4BWTA 3IN2A 3TBCA 2Q9OA 1XB3A 4KOBA 1EZLA 4BK5C 4KNTA 2XVBA 2EILB 4BXSV 2I7SA 3NSCA 3TBBA 3X1GA 4UANA 4BXVA 2OJ1A 1JXDA 1JZJA 4NERA 1L9SA 4G7RB 4F7KA 3UABA 3FYIB 4KO9A 1JZIA 1M56B 5I6MA 3JT2A 1TEGA 4Q89A 4PCYA 2XUWA 2Q5BA 4G7SB 5PAZA 3AG3B 1NDTA 1PLAA 3N2JA 4FA7B 1OCZB 1T5KA 1J9TA 2XV3A 4CSPA 3NYKA
chains in the Genus database with same CATH superfamily
2DBJA 3R7RA 3ABZA 1OLZA 1F02I 5B3NA 3KNBB 2QGCA 5JHAA 5ENWA 4XNMA 4QCIB 1C5BH 5D8JH 5BUGA 2X6BA 4N5UA 2YD5A 1EWHA 2XWTA 5BQ7A 1NAKL 5LCVL 1TZIB 2UZYB 5J3HC 3KHQA 2WLIB 4UNUA 5D2LA 1WFJA 3N06B 1KF9B 3WUWG 4P23B 3TV3L 5JORB 1W80A 1RZJH 3C8HA 4PJ8B 4APQD 4OGXL 3UDWC 4X80L 2O5ZL 3QC5X 1W72A 2WV3A 2ITFA 2YQ2A 4TVPD 4AC4A 1RL1A 3CJJA 4OUUA 3BQUB 4EZKA 1Y07A 3MRDB 2BP0B 2X2IA 4I77H 4MJHA 4QO1A 5FA3B 1CF8H 4A7GA 3TEYA 4S0HA 4KZEL 2VITA 3TBWA 1BW8A 3DX7B 3BPNB 3RX7A 3E6FA 2VR3A 3MV9D 3TWYA 4DGYH 1KTLB 4S11A 5T3ZD 1M1XB 1ZA6B 3PL6A 3KW7A 4R4NC 3OKOA 1OM9A 1P84J 4PRAB 5INCB 5DGQA 1R5VB 1UZ6E 1MIEH 4JBSA 3A0OA 5ILTL 2ADJB 1MCDA 5HHOE 4TL5A 5JOEA 4ORGB 3U6XS 4X99B 1ZMYA 1W6LA 2IJ0C 2WO3B 4CAGA 2EIZB 3K2IA 2H3NA 3OKKA 2J2ZB 3OG4B 3B5TA 2F8VA 4WUUD 1O9ZA 2ATAA 1F00I 1QPKA 2EECA 4LARL 2BNRD 4NHUB 3QCTL 3ECQA 3SYQA 4JQIA 2J8UF 4DP7X 2CXGA 3ILPB 3MBWA 4XCYA 2BFVL 3WIAA 3MRIA 2CDFA 1S7RA 4DAGL 3MO1B 3IDNB 4MX7A 2WXHA 4AGMA 1MW3A 2ED7A 3DYOA 5GGSB 4EIGB 1WUNT 2JVUA 2NR6D 2V8MA 5E00B 4ZW8A 5T3XL 3P4MB 4CUCA 4M3JA 1SMDA 3QJOA 4L37B 3ARBD 2G9HA 2X9XA 4R4FL 5GHWL 4ZUSB 3BDXA 3GGWA 1ZSDA 4I3SL 1DSWA 1GKEA 4U1NB 3CNKA 3GHBH 3WUWA 3HRZC 2IG2L 4OD1L 3IXAB 5IMLB 3RBGA 3F84A 4KJWD 3US0A 2VSCA 1KLUB 1S4IA 5TD4A 1LVEA 3LS4H 3ZQ9A 1CFSA 3AT9A 3CDGB 2HMIC 2KT6A 4X7DC 4R26H 3T8MA 4U0QB 4ZW5A 1ASPA 1ED3A 2W0LA 1FO0L 5H35B 5T3ZL 1EHXA 2OSYA 4YUEH 2B0SL 4Y1TA 3ZDZE 3CFUA 4XE0A 5I1GL 4DKEH 4PJAE 1E9QA 3ZR5A 25C8L 2VWEC 5M7QA 4CVWA 3K4ZA 1D9KC 3GSQA 3MACH 4KK5D 1MSPA 2XTJD 1CI3M 3VO0A 4AX3A 4N9GA 4EDWL 3RYMA 2O5XH 3GKWL 1S7XA 5MI0C 5MENA 2NY6D 4FFZA 4GKZB 4DF9A 3GRBA 5TDOA 1GHFH 2WCPA 5C3IA 5C08A 4H1LH 4PB0H 3UG4A 1V55B 4X6FB 2VAAB 3Q43A 4XB7A 4UM9B 3VXME 4MRBA 3UP1A 1TJIL 1KJ3L 3UTOA 1QTYT 3R7QA 5I16A 1OTUC 3AGWA 4OY9A 1IM9A 3HNVH 1JF1A 5IHHA 3LQAC 1FPTH 4L4TE 1JHKH 3KZ8A 5FF6B 2H4EA 2XVLA 3B7UX 3PWVB 1BVZA 1U8JA 5DD1L 5IWLC 3KE0A 5T5NG 1XF5B 1GGTA 4ZUWA 3UBXG 3FQYA 2Y25A 4DZBB 4U2ZA 4PJIB 3ZTJH 1IL1A 1NGWB 4Y19A 1I9EA 1S9WA 4E9QA 4XP4L 5HI3D 3DWTA 4TPRL 1CQKA 4GRLC 4ETQB 3ULVD 1KCRH 3SGEH 3WFBH 1BFOA 1GAFH 5D2LE 3RUGF 4MXVF 4BIKA 2EIJB 3DHPA 3IS0X 5EUOB 4DKFH 1U58A 4Y1AA 3LQAH 1TT6A 1ZT7B 4POZC 1GOFA 2QFRA 3EG9B 3US1A 4IRJB 5C9JB 5B1JC 5FXCH 3BEVB 2HAZA 2ZUXA 3CFKB 2VAJA 3UTTA 3DUUB 3AS1A 4LPUA 2WQ8A 2GJ6B 5F6IB 2YXMA 1E28A 2WWOA 4J8QA 2EAEA 4XO5A 2DOCA 1B3IA 1XH0A 3PPSA 4HKBB 3CVCA 4MJJA 4OLZL 4N2AA 2F53A 3PABA 3QWRA 3V6ZB 1MI5A 1QRKA 3APFA 3SD5A 3QNYB 4QRTB 4WVRA 2V7HA 1FA4A 1RLBA 4HISA 5T1MA 3GSWB 4BKLA 2AEPH 5TJWK 1UZ6F 4JFEB 3WHE0 4YE4H 4DPRA 5IMMB 1OIOA 1PCSA 2GSIB 2NX5B 2ZE0A 3BFOA 1K8DA 5I1EL 2RGSA 4MAUL 1ES0A 1RZ8B 1XGZA 5AALA 5AOJA 3T9WA 2P26A 3TZVB 3U4BH 2QPEB 4XP6L 1DQQA 3RGHA 1I7UA 2CO2A 5E23A 4ZNCD 3B2XA 2WTOA 5DHDA 3V6FB 5DJYB 2BSBA 4AEFA 3I6KB 4P07A 4OTXL 3BGFC 1FF5A 1OARL 1JN6A 1FSKB 3MNMA 4U6YB 1SXZA 3MUJA 4HXAH 4LU5H 5KYWB 3RDTC 1GGYA 3ULVL 1D5RA 3AY4C 4F93B 4NQEB 3GO1H 1E3ZA 5TE6H 2IMNA 1EBAA 1J0JA 3HNSH 4M7LL 1JRHL 2GABA 3UBXA 3S8GB 4MAZA 4UB0H 5E7FA 5EDSA 1UJ3C 5C0FB 4JRWA 1KG0A 3UC2A 1OT1A 3VFUB 4UV7L 3KPSE 2A9NL 4N1HB 3KR3H 4UTBH 5TE7L 4Q2ZB 3UO8B 3R0NA 1HFUA 2B1HH 2WKOF 2WLNA 3H53A 4P3WA 1OK8A 1G7JB 1TQCB 1IGMH 1E4KC 4IIQA 1U3NA 2Y1YA 2FHCA 4Y4KD 1DQJB 3ARGD 3ULSB 4PRHD 3FAWA 5KS9B 3E8UH 2WXKA 5AVYB 2GUOA 3ZDZF 2IDFA 2GT9B 4Q14A 5DMGD 1AZUA 4XBPB 1CD0A 4WFHD 1IZKA 4B96A 2IPTH 4NZRL 5HBBA 4RFNC 3WKPA 3GXIA 4X42A 1KGYE 1LEKA 2ZYRA 2Y5QA 3BW9B 3GSOB 4HKJB 4MQ7A 4Z9KB 1Q9WB 4G70B 3P73B 1HK6A 1G9ML 5L4IA 5GGQL 3HI1B 4LSTL 5E4OA 1YYML 1GY2A 2CALA 3U9PL 1KYFA 2P44B 3OWRA 2IAMD 3QQ9C 3KBFA 2NXYB 4LCWB 5EBLA 5MENE 1SJHB 4YIQA 3QFGA 3RZWA 1TJXA 1HCFX 1YEJH 1N59A 2A73B 1JZ3A 1FHGA 1CYWA 5C08E 3CGTA 1W8EA 4XBEH 1PZ5A 3D3VD 1WZ1L 4K4KA 4WFED 1QACA 2ZXDA 5J1TC 5CWSB 3O6KL 1AD9B 5E5MA 4FLOA 1DUZA 1OE3A 1KDIA 1EZVX 3D08A 5T5FH 4P2YA 1WAAA 2DDQH 4Z5RA 2E7MA 1QLEB 4ZODA 2NXZC 5BS0D 2NUTB 2Z92B 3EJYC 1TZAA 1ZV9A 2A0LD 4N4YB 2D8KA 1CD9B 2L7EA 3BUTA 1V3KA 1X3DA 2YPKB 4YVNA 4JR9L 5D2LF 1VGKB 2HG5B 1HI6A 4WI0B 4AVKA 1MCPH 1KLGA 3V0WL 4GT7A 4S1SH 3L1OH 3EGXA 4RETB 3VWKD 1KYOK 1M2VB 1Y18A 2OJEA 4JPWH 2ZWKA 4Y1AE 5K93A 3W9DB 4GUCA 4B9ZA 1KBWA 3MLRL 5D1QA 4AQAA 4JZJA 3I75B 2WJ7A 4Z0XA 4NO2A 2BSSB 4LNVA 3MRKB 1GYWA 3UTTE 3ALWA 1BBDH 5IM7A 2W8CA 1B4RA 5CGBA 3L9RA 4A7GF 2F8IA 3A47A 1D5MB 4LVHC 1KSRA 3EYVB 1PJ9A 1IO4C 5I5IA 1OD9A 1SFHA 4AMWA 2F53E 2UVFA 1UUNA 3CH1A 4UF7C 5DSCB 5DLML 1OV8A 2QLVB 5GGTL 1FN4B 3KXFD 2H3KA 4U31A 3CE1A 3HUJB 2DYPB 7FABH 3GEWB 6FABL 2KZWA 3V6BR 1FH2A 3DVGA 1OGAA 3HPLB 2PW1A 2PN5A 3IMSA 4FKEA 5KANG 4ZBJA 3WJMB 3FN0H 4FXGC 3LSOB 3KH3A 3NPSB 4WO4B 3PWUB 4Z7OB 5IJVA 1N10A 5KSUA 3AREB 1JXFA 2VT0A 5IOPA 1IEAB 2B20A 1X5AA 4YDZA 2DBLH 2YS4A 3D50A 1IFHH 3KWVA 2R2EA 1OCRB 2B5IB 1QA9A 1T5WA 4GRWB 1ZPUA 3GMLB 5IF0A 3VD9A 1RIVL 5J8OA 4FQ2L 4NYLB 1JV2B 4XBGA 1LE5B 3RFZC 2VR7A 4UUJB 2F9BT 3VW3H 3ZT6A 2WBJC 2YGQA 1AAJA 3CFMA 3UJJH 3ARWA 2FZ3A 1HH6A 4QJ3B 3EO9L 5FX3A 1PDKA 4CJ1A 3ROOB 4MNQE 4CDHA 4LLAA 3QFJE 4FMFA 4MJIA 3SKJH 2C9QA 5F0LB 1I3VA 4FG6D 4RGMC 3TCTA 1EMTL 3U82B 1JZ7A 1NMCC 3HZMB 3TBSA 5TQ2H 1BBJB 3WIHL 1YEDA 5L6YH 2HRPL 1CK0H 4OJAA 1D6VH 1I8MA 3SQOL 1OB0A 5CCGE 5HJDA 2Q3AA 2L0DA 3LKNA 2BSTB 2WGNB 3OC5A 4C54A 3S5LB 1SXCA 4P2RB 1FZJA 1F5WA 2J6EA 3NRQA 4NRYB 4TQ8A 5L2JB 3AU1B 3CPLB 3DC0A 3IDJA 3OHXB 4DUVA 4LCUA 5F72S 3SDAD 4BFNA 3B2VH 5IQMA 5K1VA 4ETYA 3P30H 3CVHH 3ZDYE 5F7AA 1G7MA 5EU5B 4WWNA 3DJTA 1P2CA 5FAAA 4XCCH 4KRPB 4L4VB 5EF0A 3VXTB 1JGUL 1KBGL 3N43B 3LXUX 3BP6B 3Q8CA 2PLTA 2DM2A 3FBKA 5GGRY 2OTUA 2R4SH 4G6KH 5C09D 3VM7A 3NJLA 4WDIB 5D96C 3QE5A 1RFDL 3F7KA 4HAGA 1FZMB 1YY8A 1HJBC 4BWTA 4V1DB 1I8KB 3KNBA 1EUUA 3C12A 4P05A 4QCIA 3PGFL 4MJ5B 3HE6D 3PL6C 5J12C 2QTEA 3B4NA 1W72H 2ZXQA 1TZIA 2UZYA 3A23A 4F7KA 5SX4I 5DZJA 5JW3H 5L8LB 4AIZB 4P23A 1EEZB 5JORA 4X98B 5EEUA 1A6WL 1WAAE 4EMZA 5J13C 4AYMC 3AG3B 1AFVL 2XZAL 3D25A 4MNGB 4X4XB 4NM4L 3BO8B 3GXNA 2HJFA 3BCFA 5DA0B 3BQUA 3BC9A 3MRDA 4JRXD 2BP0A 4YFLF 4ONGL 3ECVA 5FA3A 2EIEA 4LSSH 4S1DC 3C08H 3DX7A 4HAFA 2GHWB 2WVVA 4QHKI 4L4JA 4Y4HD 1KTLA 1ZA6A 2VKWA 1F4YH 4W9JC 3MA9H 3V5DA 3LZFH 1FFTB 1A5FL 3TA4D 4EXPX 2R9HC 1TUPA 2ADJA 3ABLB 5E1QA 5KVMC 4JQIH 4BFFA 4ORGA 4X99A 2NY5L 1XBDA 2BH0A 2PPDA 3AC0A 2PR9A 1T22B 2JIXD 2J2ZA 4FEMA 3B7YA 1TETL 5DS1A 1F11B 4FQXD 1XXDC 3HRPA 3A4AA 4H44C 3LYRA 2JKIS 1TTFA 5DQJB 3ILPA 1OGAE 1NUNB 3LVTA 3K5RA 3NIGB 4PSPA 3KMDA 1ZA3B 3F2LA 1G1CA 1RU9L 3MO1A 4JO2H 1PG7L 3F7PC 1B0IA 1B4LA 4Z7VB 1A7RL 5GGSA 2D0GA 1L9MA 1MCBA 3IDMB 4BK8A 5C07B 3OLGA 3CHRA 1ECZA 4HPYL 3HVNA 1I7RB 2L7UA 2MPVA 4L37A 1YN6A 4IQHA 1OQXA 3CLFH 4HHWA 1NLBL 2ZUVA 1G94A 4W9GC 5AKSA 3ZUCA 4U1NA 1SFDA 2JXMA 2YOCA 4IEFB 1KLUA 3GYRA 5T5NF 5CS7A 2OK0L 3EBIA 2CBQA 3CDGA 4W1TA 3LS5L 1NOAA 4NO0A 3NA4A 5FGCE 5H35A 1TNNA 4Y8AA 2A6KA 4Z6AT 3DV4A 3IE4A 5GQBA 2F7OA 1IFRA 4AI7A 3IFNH 3K6SA 4TUUA 1X5IA 3GJEA 1WUZA 3MGTB 2OXGB 3WFCH 4AUYA 2B15A 3GBMH 5D1ZI 4FFZH 3D0AA 2O6CA 4FLSA 1UCBL 1DEDA 1EJ8A 2Y7OA 4M29A 5AW6B 5I18H 3ZRSA 3FB7B 2JNZA 2D7NA 4P9MH 1FIEA 4PP1C 1G9NL 4FNTA 4NUMA 2AXFB 2AEQH 4CKVX 4JK0D 4QJ5B 4NC1E 4GKZA 3ZDYF 1KCUH 3AQYA 3ARDB 1DQDL 2VZ3A 5C2UB 4GAGH 2AHIA 3FUHA 3T6ZA 2QELA 2BP3A 3TFKC 1I1RA 1WC7A 2VAAA 5DZPA 3GXMA 2VZVA 2YKKA 2Y0SA 5DJAA 2BIIA 3MRFA 1JHTB 2Y7LA 4EO5A 1F8TL 2YAMA 4PLJD 3S34L 3QJVB 1SHMA 3BT2L 3RILA 1TJHL 2CUHA 2ZJSL 2ZUQC 2NLJB 3SOTA 1QSEA 5EMYA 1YCSA 1RUKH 3RP1A 5A2CA 3O3AA 5FF6A 3PHAA 2VXVL 4Y2DB 1CGVA 4UOJA 5E9DA 4E5XG 3G6JA 1XF5A 2ESVE 4U0RC 4DZBA 4V2BA 5F3BB 3N1QC 2VJXA 4GO9A 3SODB 5EG6C 1NGWA 2UXGA 2ARJQ 2AQQA 2R69A 4YHNA 5B22A 4ETQA 2DQIL 1WAAF 3K1KC 4A55A 5EUOA 3TWCL 4KKNA 5E2WL 1RK1A 3WV0A 3FU6A 3SE6A 4YLBA 1ECYA 3EG9A 3TOPA 1D5ZA 4IRJA 1WLHA 5AW1B 2DJSA 3M45A 3QDJB 4TN9A 3CFKA 3MA7B 4JHWH 4HJEA 2CU9A 1IGJB 4GUPB 3KL3A 4J3SA 2XWEA 3ZTCC 1JV5A 1FZOB 4ANWA 4PV8B 4F92B 4HKBA 1CBVL 3KYMB 2I5YL 2K6YA 3FT2B 1S78D 4XPTL 3QNYA 4QTIH 4BQCA 1BVNP 3OXSB 4QRTA 4KMQA 3F5WA 3GXPA 5BRZD 4M48L 4DPBX 2CG9X 2P5EE 3RVWD 3GSWA 2V9QA 3QIBB 3ARVA 4TUJB 1DTUA 4ZFZB 4TTGA 3QR2A 4XNDA 4JDVA 2EDMA 2GQHA 2NX5A 3BKYL 2NT0A 1J0YA 1HHJA 3SY0B 3IMBA 1JNNH 4YBLC 2J25A 2VSDA 4YHOL 4KKAC 1FC1A 3CSGA 2W95A 3LIZL 2WSDA 4LVNC 5GGUA 1Q1PA 2CUIA 4IIQC 3NACL 2WQRA 2G0KA 3M17B 3V6FA 5DJYA 2W81C 5DO8A 4R7NB 1SF3A 3BX7C 3I6KA 3PWPE 3FCBA 5CZXC 4BRVA 3PHQA 4UNTA 4XNYL 1RUMH 2QL1A 1JZ6A 2BZCA 3VQLA 4U6YA 2VLMD 1BZ9B 3POHA 2BXYA 4XN1A 1T6VN 1SXBA 3BYYA 3BHBB 3T3PE 5D4JA 4NQEA 4ZMLA 3AS3A 2XZCH 4E5XA 2CNYA 5BZDB 4BFRA 2MQ0A 3FUNA 4XWGH 1RIHH 2ZNWA 5C0FA 3S88H 4U1MB 1TQBB 4N28A 3VFUA 5DMKB 3WENA 4P2CG 2HFGL 3OR7B 4HJ0D 1FUNA 1ZHKB 1CYXA 2K7PA 3ECBB 2JKXA 4Q2ZA 1I4FB 4HK0A 4NRXB 4B3EA 1TVBB 1QNZH 4GAAA 1QBMH 2YK1H 2IFGA 1ROCA 3ULSA 4AGLA 3B6SB 4JDTH 1JPST 2EDQA 2PWHA 4V33A 3AADB 1MH5A 3I9PA 3SBPA 2GT9A 3LKOB 1L9TA 1HAWA 1I75A 1L9OA 4R2GD 1UACH 4XBPA 1KWKA 3WEXA 4NS0A 4AKOA 2D3NA 3TU6A 3RVVD 4F91B 3GSOA 4HKJA 2E27H 4G5ZH 2NUPA 4JPVH 4JRYB 1NANI 2CBMA 5HDBE 2IDQA 1MVYA 1S5IL 3HI1A 2WBKA 4UOQA 3T1FB 4AZ8B 2JFCA 2GBUA 3HJEA 4X6DA 3FW6A 5I0DA 4JREB 3T0BA 4YSTA 1PY0A 4LCWA 4OLVH 1M57B 4RDQG 4DVBB 1LEGA 5I9QC 1MIML 2QQNH 5KVFH 1JNJA 2WLKA 2FEDD 3AFLA 4CU6A 5BOZG 3GS4A 3MV11 5CSGA 5ABAA 4KJQD 3TN0A 2CMRL 3FOLB 5D1QC 4JZJC 3NBNA 4RMQA 3KLAB 5CWSA 3IDXH 2VZSA 1ACXA 2EE6A 4PRPB 4Y5YB 4RGOL 4LPYA 3VACA 4E41D 2ZOWA 5DHEA 3EDKA 2YQBA 2BHYA 4F9LA 4JL1A 5G4OA 1QSEE 3IRCA 3SDDB 4NZTH 3D2UB 5D7JB 3N44B 2Z92A 4HBCH 4OGQC 1S3RA 5E9DE 2NUTA 3ARFB 3RTQA 4ELDA 4WF7A 3G6JE 3FC8A 3SYOA 3G5YB 4RLDA 2ZX8A 3X2QB 1OALA 2XN9B 1F18A 1VGKA 3D4CA 5T1KD 1FFOB 4OGAC 2VM9A 3HG3A 3PNRB 3N42B 2EE0A 4L0YA 3QJFB 1M2VA 2O72A 2JTYA 3IFPB 4M6OL 3W9DA 5HYJB 4QXUL 3DO7B 4BINA 4IGBA 2ZUTA 3I75A 1AR1D 3OAZK 5L0QB 1AQHA 1RULL 2BSSA 1CDCA 3MRKA 5CGYC 4HH8A 4M8UA 3UJIL 1N0LB 3RGBA 3EYVA 5A2JH 2DQTH 4OQ1A 3REVA 1L6PA 1OT4A 2A2QT 2UZIL 3A22A 3OXRB 5D2NB 1NA8A 1WSST 2Y1ZA 3FTWA 5E2TL 4LT7A 4FHJA 4APQB 4EZJA 2AAAA 3S3JA 1A6AA 4GG8B 3VVVA 5K69A 4WO4A 3PWUA 1UOLA 2ED9A 4M6AA 2M2DA 5DHMC 3AREA 5AW3B 1FNSH 3FO0H 4P9HL 3UOAB 5FW6A 5AKVA 1GTFA 4OQTL 5CU9A 1WDAA 5C3TA 3MDJA 5HD8C 1MDTA 2AKRB 1LO0H 3GMLA 1QFWM 3EZJB 3O3BB 2K9UA 4OUOA 3MV9B 2EIDA 1FO0B 2ZOOA 2HVKB 4NYLA 1LE5A 1A6VL 4O2CB 3O41A 3NCBB 3V7AG 3CFBB 4UQDA 1G7LA 3PFQA 1XCTA 2EZ0D 4K3EH 2Z0UA 4U49A 2VMCA 4NQEE 5F88A 3ROOA 1B0RB 1RZGB 4KMTL 2VUOA 1TDQA 3OJDB 2EIMB 4WUUB 3OAZH 2OJZH 1R24A 2XC8A 1W91A 3HZMA 4JFPB 1A3QA 2BNRB 3TEXA 1BBJA 1YMHB 5CNHA 2HWZH 5JW4R 4LSUL 3TV8A 2AQ3A 3CG8A 2WINB 4QHMB 2AI0H 4FJYA 3GT6A 4NRYA 4YEEA 1AKPA 3ZSTA 2HJLA 2WWNA 5L2JA 3AU1A 3CPLA 5JR1L 3ZL1A 1TVHB 3OHXA 4EJ1C 2C3GA 3H3KA 5DRXB 1MJ8L 2IMMA 1OGTA 3RWIB 4JZNB 4P23C 4PJ8C 4HDIA 1FYHB 2X4OB 4L4VA 3VXTA 1WIUA 4DUXA 5CEZE 3BP6A 2YA2A 5B3SB 2YOAA 1UT2A 4YE0A 1WCBA 1H0DB 4M1DL 1HHIB 2OMNA 2CRIA 1XGTB 4H4NA 4TQHA 4WDIA 4X6DE 2NTSP 4I13B 3BQUC 1E2VA 1FZMA 1K5NB 1T5XB 4NO3B 5F93C 5I1IL 2IBBA 4V1DA 4MYWB 2G2PA 1KCBA 4ZTOL 3SKUD 1DBJH 1S5HB 3BPNC 3QQ4B 5CSZB 1P4BL 3O2VH 4MXWH 1UT9A 2XTJB 3OBAA 3QDMD 4X5PA 4RBPK 4G8FB 4OU3A 2ENPA 5IHZB 4ATTA 5IJKA 4AIZA 4X98A 2FH8A 4W4OA 2P80A 2DD8H 3D4GA 3DMMD 2EDKA 2WTRB 3UMTA 4ZG1A 3G6JF 3X14B 4AM0A 4QY8B 3BJ91 2GIXA 4MNGA 3MQIA 4X4XA 3E80A 5IB5B 1WWWX 3BO8A 3MRCB 4EBQL 1FVDB 4BSJA 4J6RL 4NKDB 1MCWW 2EYSB 5CIPB 1DL7H 2FD6L 5EUOF 2XQBH 2VMFA 1FIGL 5H94B 1QEWB 3DVIA 3F65A 1J9CT 4LIQL 4K9EH 1ERNA 4FMVA 1TEGA 4PCYA 5IHWA 3X3GH 1JWMA 4TYUA 5CD3B 2C9UA 1AP2B 1G6RB 2Q7NA 2DIAA 2EACA 3CC1A 3L4ZA 4H0LC 3LN9A 5K39B 4EF3A 4KKZA 4JG1H 3ZBMA 4YJZL 1AQMA 3TNMB 1T22A 5C0JA 1F97A 4HOWA 2OAAA 1UKTA 3WAKA 3MNVB 4NQTA 4PS8A 3MZGB 3V9FA 4AG4H 4PWKA 2XNAB 5AW8B 1A14L 2BRRH 5DQJA 2VN6A 3INOA 1UYWL 1ZVSB 1L7IH 2W94A 4HFUH 4LGSB 1AI1L 1ZA3A 2BSCA 3PAYA 4AQ8A 1EFXD 2E4FA 4TQIA 3QUZD 4RBPH 4TV3A 3ZX1A 1OAUH 2ZUYA 4Z7VA 2EDFA 1AGDB 2YA0A 1EHAA 3UJTL 4KPHL 4URTB 1H3VA 3DX6B 1ORSA 2OR9H 5B7MA 5C07A 3RQ3A 1C1EL 4KHTH 3FB5B 4R97B 1CC3A 2DF3A 2DWEB 1NM4A 2J1YA 3FB8B 3EJUA 2BVOB 3NDYE 2YAQA 1H8LA 4FMKA 1ZS8B 1QWHA 4KFZC 4ZQTA 3TS8A 4P06A 1P4LB 2V5TA 4HLEA 4IEFA 5JW4M 1LO2L 1BQUA 1IBDA 1UFGA 3BZDA 3O3EB 5FO9B 2PPCA 1ZRUA 5AZEL 3TT1L 1UM5H 2RCSH 2B3IA 5K9JH 3SGDH 4KITB 4CC0A 1ZVHA 5GRJH 1KFGA 1F2XK 4OD2B 4YH6A 3D34A 2ADYA 1OM3L 1UOVA 3MGTA 3ZZSA 5I6NA 3ARPA 3TFBA 3W56A 1OCWL 5J6SA 1QATA 3WNIA 1OTTD 3QDGD 5KYYA 2AXFA 3IMVA 4MJ4A 2BSDA 4PJ7B 1I3RB 2QLYA 5GRUL 3ARDA 4LCCB 3OSKA 1UATA 5AWNL 1B88A 1G7PB 4Z95H 5DD6B 3LKPB 1KIUB 2XZQL 1Z5LB 2FX7H 3EHBD 4QI3A 4P4RA 4MA8H 2WW8A 3UPCA 4TL4A 3BAEL 3WSQL 5LVEA 1O0VA 1QMUA 1JHTA 4IRJC 4V11A 4X6DF 5DO2D 2EUWA 1BZ7A 4ZPVB 4Y4KB 1PD6A 1AG6A 3ARGB 3FULA 4PRHB 3ZL4L 1VCBC 2AJSL 1QWNA 4IK6A 5F6IC 3A4EA 2HKAA 3H0TB 2R69H 3Q48A 4KZDH 4N1EA 4Q0XH 4Y2DA 4V1DE 1E6JH 1CT8A 5DUPL 3VMPA 3VDAA 3V6OA 4ZFFB 2XJKA 1NMBH 1HEHC 1Z9MA 5F3BA 3BLKA 3DECA 5ETUA 1KV7A 4GMTL 1MJUL 5C86A 3Q01A 1TPXC 2B9BA 5FGSA 1GVIA 2GAZB 3CVDA 3QHFL 5DT1H 2V9RA 2IAMB 4LO9A 5F7HA 4XN4A 4E68A 5JQIB 3S3BB 3F58H 1BDYA 2C9XA 2OMYB 3LZPA 2YN3A 3QDJA 4N8VB 3G5VB 1NMAH 4MA7L 3OB8A 2WHVA 1BOGB 3LMJL 1G6VK 1IGJA 1W0YT 3OKNB 4WCYL 3T65B 5KYUA 1FZOA 5GRYA 1FSKC 1OZUA 4PJCE 4HW6A 5E8PA 3IJ8A 4XH2B 4UV4H 3CZUB 5FM5O 3WFZA 4IBUA 3NCXA 1OLLA 1S9VB 3QIBA 2X41A 5FR3A 3QSKB 1J48A 3D39D 2EVFA 5BS0B 3UADA 4QRRD 1BVOA 2J8HA 4JFDD 4KK9C 3E3QE 4WHDA 3V0JA 3MXVH 4ANUA 2Y2TA 4PJDB 5K9QG 2MCPL 2A4ZA 4PV9B 3OWEA 3HG2A 5I1CL 4MWFA 1YQVL 3I6SA 3HKFA 1TQCC 3EDFA 5C1MB 2GKIA 1ZT1A 5LJYH 2DLTA 3M17A 4AENA 2HT2D 3I74A 4ZZKA 5AAMA 1MFDH 1YEHH 4R7NA 4FJ6A 4H88L 2FJHB 4KJYB 1J11A 3OAUH 5D7KD 4WJKB 5ECGA 4GBXA 4RDQF 3FT4B 1K85A 4Z7OF 4ZFGL 4IW4C 3R06B 5C92A 2Y36H 2G5BB 1KEML 1ROWA 2DWYA 3BP5B 4RAHA 2Y24A 3BHBA 4TUKL 2NZ9C 4DKTA 2PWGA 5LAPA 4B9CA 2JE8A 4GRWF 5H37G 3DVFA 5CAYB 5IMOB 1FG9C 1JGLL 4U1MA 3EUDA 1VIWA 3JVGA 3NESA 2GBTA 4WK0B 5DMKA 1V05A 2X05A 1TO5A 3GLEA 3KXFB 2AAVA 4M6NL 1A6UL 3ECBA 1A3RH 1PKQA 2DW5A 1I4FA 2ALWA 1UXWA 3D07A 4U7SA 5EB9A 3TH2T 4ABVA 1K5WA 3WTSA 2Q1EA 1TVBA 2IALB 3ESVF 4HWUA 2WQUA 3Q3GB 3QXDB 3I6GB 4JM0A 2NY0C 4RMTA 4MASA 3WHXB 5AG8A 2CLZB 3B6SA 3GI8L 2K6WA 2TRYA 4O4YL 5CEZH 4TLKA 1EXHA 3LKOA 4JFUA 3L45A 1HXMA 1KXVA 2AXGA 4BQ8A 2AK4D 2Q86B 3QGVA 4G6ML 4WENB 4F9LC 2K70A 3VSQA 2I60L 3WKMH 2L7JA 2VJ8A 4JRYA 2ODIA 3NJHA 3IGAB 2H5UA 2XXMB 4J4PA 3RTQC 3T1FA 4QTHB 5HI5C 4A2GA 4MXQD 4BYHA 3T0ED 5DUBB 2ADGB 5LCVA 2YFOA 3QPQC 3Q1EA 3QC6X 4DVBA 4WEUD 1JF5A 4JHUA 3K7UA 3UEQA 1OWWA 1WBYA 2R0WL 1NEZB 2BWIA 4IGBC 4DK3A 2FWLB 2JELH 2VRAA 3FOLA 1KWGA 2EYTA 3GIZL 1A8ZA 3KLAA 4D9RE 4XPHH 4P59H 4C56E 1IGIL 2FT8A 4GSQA 4PRPA 4Y5YA 3WO3B 4KKPA 5FCUL 4ZMAT 1A6PA 3MRPB 4CW1A 1T7WA 5SWZD 2IQAA 1RZIB 4FYRA 4ZTPL 2Q76B 3IJSB 1YEIL 3T0DA 3D2UA 4FKHA 3SDAB 3WI9A 4LAQH 2CKBL 2GY7B 3ARFA 4OR1A 3M6DA 1E4XH 3C5JB 5IBLC 2HTKD 5H37A 2D7OA 2YO3A 2XN9A 5FHAL 1CXKA 4YMPA 4R96B 5E1IA 1R1CA 1AHKA 1NBZB 2DKMA 5IJCC 3NPSC 4RMUA 2ZG1A 4WO4C 5C09B 2D31B 3AREC 4S1QL 2EO7A 2PKDA 1V8HA 4UINH 2FSDA 2ZG2A 5E56A 1INEL 2OMWB 3H6JA 3ZY7A 1CDIA 4Q6IB 1I1CA 4XAWL 4N9OB 2B5IC 3IDGB 4H25A 4YC2B 1ACYH 3NFPB 2GTQA 2BX5A 3WU1A 4DEUA 3FO2B 4WZ9A 1A7QL 3HE6B 2E86A 2BJMH 3EO1B 1N0LA 1U8HA 4HJGB 1AH1A 2APVA 4EI0A 5CF3A 5HPOA 4OF8A 3GPSA 3OXRA 5D2NA 2HX8A 2EIKB 5DFWH 4N0UA 2VXSH 1IC7L 4APQA 4XRCA 5TK4A 5CJ8A 5I0ZA 4WJG3 2DL2A 2E7HA 3H9ZA 4PGDB 2WZ5A 5EOCH 4GRWH 1KELH 4UT9L 1O5PA 4AGOA 4MD5A 3K81A 3IU4H 1CDGA 2JJVA 4JRXB 2PP7A 5HGHB 3DX1A 1YAIA 3QCUL 1AY1H 2AW2A 2R0KH 5IBTL 5DC9B 3O3BA 2EKJA 3MV9A 4Y4HB 1FO0A 2HVKA 2JB5L 4HV8B 4JKWA 3U4EA 3S9DB 3QB7C 3OHXC 4GLRI 1SQMA 4YHIB 2ZX9A 4Z7VF 3IS1X 4O2CA 3TX4A 3CFBA 4NCC1 3IGUA 2YWYA 5DDHB 4KRPC 4LHUG 1TU2B 1RZGA 1IC4H 2BK8A 1XSKA 2ICES 2JIXB 4HGWB 3OJDA 4WUUA 1SBSL 3X13B 2X6VA 4JFPA 3PDOB 3CFQA 4KDWA 1YMHA 4PGCA 1GGBH 1PKQE 5A6IA 5D7LE 4WNSA 4EIBA 5E1GA 2WINA 4QHMA 1ZLEA 5TE4H 3GNML 1MLCA 2D4FA 5FS5A 5ICXA 4DGIL 2J1KA 1TVHA 5C71A 2D7QA 4EEEA 4R8WH 3BZEB 3P9LB 5E6ZA 4ODSL 5IJKC 4X8JB 4XWOC 4JZNA 3ARBA 4WK2B 3QUXD 4YHYB 4W4OC 3MRMB 1MWOA 1KIPB 5FCSH 5FYLD 2X4OA 3UO1H 1MEXH 4EVNA 4IKIA 3GS0A 4ZK8A 1A4JA 5CR8A 2XFXA 3FQ1A 4NBZB 5IR1B 4Q52A 1DO6A 2J21A 4PVLA 1WVZA 1XGTA 3LHPH 2P52A 3GDCA 3MBXL 1OP3K 4DQOH 1K5NA 2RACA 4P49A 3JWOC 3ZU8A 2OCCB 1S5HA 3FHAA 1NOFA 4WTQA 2Y9RT 3B7SA 2F1BA 3QQ4A 5CSZA 1D7BA 1CXFA 3UYPA 1R6VA 4ZMOA 1WWAX 2NY3D 2Y2YA 4PJ5E 4UIMA 3WD5L 1NCGA 3H7LA 4G8FA 5IHZA 4HG4J 2BVUA 1DDHB 4GP8B 4UQEA 2VQTA 1N3NB 4D9QE 2JCCB 3Q5TA 5C0GB 3JWOH 4QY8A 3X12B 1QVOB 2DLFH 5IP4A 2YR3A 4NLHA 5DYOA 4EOWL 4LHUA 1INDH 4PJFB 3ES6B 2MHAB 1ID2A 1N67A 3MRCA 1FVDA 2GVYA 3K2KA 4HZLB 4NKDA 4XP5H 2EYSA 1F1GA 4YBHA 2VO5A 3MROA 3QW9A 4NPJA 5JIPA 2EVHA 3ZE2B 4AQ8C 1A6ZA 3NZUA 4E9LA 4QRQA 4WKZB 5J1SC 3X1FA 1CICD 1KYDA 1E9OA 4GNKB 1ZOXA 3FU3A 3FQXB 2ROYA 4NKMB 1NUDA 2ZICA 3EFDL 5FYJE 5CD3A 2Y3NA 1AP2A 1G6RA 3QCVH 5K39A 1OAKH 5GJSL 4PJXE 1OP3H 4UAHA 1CL7I 2N56A 1XSIA 4N6QA 5C0RH 5IZ7A 1I7ZB 1OAQH 2DQGL 4WJ5B 3MNVA 5D2NE 2I9LB 4N0UE 1NGZB 4NQDD 3BDYL 2XNAA 4UOW0 3TBYB 3TBBA 2IOMA 3TCLA 4AQEA 5AAWA 4UANA 2DQJH 1S7QA 1ZVSA 3P54A 3RVTD 1R5WA 5C0ND 5KUMA 2LU4A 4TVPE 1BQLL 4YXKL 1AGDA 2B4CL 5DFTA 3THMH 3WS3A 4LSRH 4OFYD 4S0TD 3ESNA 3FB5A 1IV8A 1BMGA 1MAJA 4NENB 5BRZB 2DWEA 2FBJL 3P3UA 2BVOA 3MV9E 3LEYH 2KZBA 5ADPL 3ARDC 3TM6A 3T2NL 2C9RA 1P4LA 3CLEL 3O3EA 1EV2E 1ASOA 2WXGA 2EUXA 1CGXA 4N8VG 5C0IB 4ODWA 1TTAA 3MN8A 1I9RL 3WXWL 2HZHA 3HI5H 4OD2A 3NQKA 4P5SA 2H26B 4MLIA 2BNQE 4W9CC 3U30B 2ZCKH 2VDPH 2AV7B 4Y2DC 4GEJA 1LD9A 2PTTA 3V6OC 4XE5B 4QYAA 5D6CB 5IG7B 4KTYA 5LQBH 1RHFA 4BE6A 1G5AA 5F2FA 1VF5C 3BFQG 2G2RB 2D0FA 4LCCA 3MHZA 4JDEB 3DV6B 3LKPA 5DD6A 1KIUA 5DS8B 5JZ7D 1Z5LA 4UILL 5K9KB 4AE0A 3ECUA 3S5YA 1XSJA 4U3HA 3MLVH 5FM5M 3V8OA 5LGKA 2ERJB 3EO0B 4K7FA 1MW2A 3ARGA 4M62L 3O0LA 1IQDA 5L2KE 1O5DT 2WWKO 1QP1A 2X4UB 4KGLA 4OZFB 3H0TA 3P3RA 1KC5L 2FJUB 1ILUA 5C0CD 2B7DT 4R2GB 5FGBA 4OZHE 5DJ2B 3CN0A 3GMNB 3WGUB 3FQNA 2OFQA 5E8OB 1FNEB 3QIBC 4FF9A 4IMLA 5E8DH 5DEFB 2H0FA 2VLJD 1EHNA 1URIA 3PP4H 3V4VL 3VH8B 4O5LL 2DKUA 5CEYA 2GAZA 3EJSA 3MCKB 3J7HA 1SEQH 2GTWB 3L54A 1EXGA 2IAMA 3OKLB 3ET9F 4Q4IA 4AYEC 4IJ3C 1HESA 2KZ1B 4YXHH 5J89A 3VRLE 1HOCB 2YXWA 3D48R 3G5VA 1KTBA 4N8VA 4LSPL 3KDMA 2BDNH 5AAMC 3D3VA 3OKNA 3VI3B 3N42F 1X4ZA 4G8AC 4GBXC 1VENA 4PYHA 4XH2A 2B2XH 1FYTD 5FC9A 4E41B 1B6UA 3NGBB 1AYOA 1QFWI 2WVTA 1HKFA 1S9VA 3O4OB 3W11C 3EBAA 5ITFB 3ALPA 3VXQB 2ZXGA 5HGGS 4HPHA 5BS0A 1OANA 4W9ZA 4X5RA 3CQFA 4KHXL 2EVIA 4KK8D 1TQBC 3FSOA 3JVGC 4OV6F 4PJDA 4Y9CA 5ANMB 3BIAX 2NNXA 2Z9TA 4X7EC 5DHVB 1Q72H 1PG7W 4M93B 5T1KB 5CINH 5IQ7L 1J1OH 4FABL 1U6AH 2KPNA 1PZDA 3WKQA 1HNYA 4Z23A 5CSBA 1J8KA 3ZK0A 2WYIA 3VWKA 1DJZA 3GPEA 4M5TA 5B1BB 4BELD 3GD1C 3MOQA 1I1YB 4LSDA 5B38B 2OMBA 4MBRA 1QEXA 2NCMA 2JJWA 3SJVD 4DPAX 1AR1B 3VSTA 3FT4A 3GSUB 2EXTA 1UXSA 1KXVC 3R06A 3ZKND 4YDLB 5LLIC 2G5BA 4NCC2 3NABL 3LXCA 3OLIA 5GPRA 1LMKA 2GJPA 3G9VA 3DRTB 1BVKA 3TJEH 2E9GA 2ZXBA 1LGVA 2Y1VA 4J4PC 4K8RC 5IMOA 5ESAA 3U48A 5HSFA 4GKSA 5T1DL 2PO6D 2A7BA 3BVVA 4OJFH 3BAJA 4XP9H 3ZKMD 2IALA 4KQ3H 3Q3GA 2FWSA 3HBPA 3I6GA 3QQ3B 4DP1X 3WHXA 1ZGLB 2CLZA 3K2MC 4IS6A 4GXFA 1G1KA 3A6BH 4PI2A 4YHPB 2PYFB 2FGWH 4F80A 2H1XA 4DQAA 1JNLL 1NEPA 4MQSB 4K8RH 1U36A 4Y5YC 1E27B 2QVFB 3GDBA 4W6WB 3MSPA 1CYGA 1NCBL 2Q86A 2SEBB 4P04A 4U1GB 5KSAA 2VL5B 2HFEA 4IMKA 4U2YA 3O6MH 4ODHH 3ZKSD 3RGVD 1A9VA 4X6EB 2DKSA 3T4AB 3TV3H 3ARFC 3GTNA 4QTHA 4OGXH 5IBUB 1L6XA 5IB1A 43CAB 4PJBB 3FB6B 2FE0A 1B0WA 2XBDA 3RY4A 2Q10A 5BW7A 4GQ9L 2B1AH 4YVUA 4AEHL 4IRZL 3KPOA 3QXUA 4N20A 4FFVD 1XD1A 3J2PA 5L0QC 5C9KA 2ZXWB 5FYKU 2W92A 3MRPA 5H37H 1RZIA 2O5YH 1Q0YL 3BLBA 5D72H 5FKPB 2YIHA 3SOBL 3SDAA 3VA2C 1DR9A 3RWGB 1M71B 4IBZA 2ZCLH 1J7VR 5ILTH 5D2NC 4K23L 3VGGA 3C5JA 2VR8A 3ZMNA 2VDLL 4APQC 2DLIA 5JOPE 4AC2A 4LARH 5IEKB 1E6OL 4GKNB 5FYJH 1ONQB 1K6QH 1PPIA 1U95B 3L4CA 3WNOA 2D31A 1XR8B 3AXLB 2VISB 1UGKA 2VDML 2OMWA 4YHZH 1PS3A 5HJ3A 1A6TA 2CRMA 4G8EB 3IDGA 5JIDA 3D3VE 3WTUA 3HE6A 3EO1A 4AIOA 2RR3A 4HJGA 5HGDB 4E9SA 3QDMB 1YEWA 1MW1A 3SPVB 2WZ0A 3CFNA 3OKDB 4M7KL 4TVPH 3GHPA 5GHWH 5JO5B 1NL0L 4QHKJ 4Y2LA 4ZRGA 3FUMA 1SLWA 3DMMB 1BJ1H 1KCWA 4G7YH 4DGUA 4L1TA 2IBGA 1MCIA 2V2XB 4PGDA 3VD4A 4OT1H 4DTGL 5A2IH 4NUGL 1FO0H 2P3YA 1CLOL 4GSUA 4I2XE 5G5DB 4HG4K 3ULVF 1WIPA 4J6IA 2V4LA 1EZSA 3DTXB 1XTMA 4MCYA 3ZDWA 1A7PL 4Y4HA 4YLCA 1ZEAH 1IAIM 4K5LA 2LFEA 1H6EA 4N86A 1R3IL 2H3XC 4PLKD 2OV0A 3JV5A 5HHXH 1F1DA 1Q8MA 3HS0B 3ARBC 2R1YA 5DDHA 3KLHD 4S2SB 4AYBA 2A1WL 1H3GA 4NOFA 4Q6YA 4HGWA 4ANKA 1PFOA 4S10A 4KJWC 4UYPA 3CIAA 3X13A 4FQXA 3L1FA 5I76A 4I0PD 4GQZA 4OVVA 5HVHC 3UBHA 2HP4A 4QXTB 4LPCA 1QTPA 4KNQA 1DE4B 3DO3A 3SKMA 1TQSA 5AW5B 4HVBA 1R0AL 4O02A 3S4SB 4N0RA 3ZDXB 1EFXB 4PD4J 4ANVA 1I7TB 3Q2LA 3QUZB 2CHNA 5C7XL 1MHHB 3TTSA 4TSBH 4UDUA 4KK5C 2ZNXA 1XB8A 1GYCA 1DLHB 2XTJC 3BZEA 3P9LA 5DRNB 1UB5A 1VGEL 3LRGA 1RZKL 4YHLL 1ZCRA 1DSFL 2BXZA 4ACTA 2NY6C 1JPGB 4CBPA 2CK2A 3L3JA 4MQTB 1U8OA 3H3BC 3L3IB 4M43L 3Q5YA 3B8SA 4FTDA 3IMRA 4E9WA 4PRDB 5IR1A 3IAPA 2CIIB 1J8HD 2X9YA 3NCFB 4Z77A 1WISA 2YPVL 2L8AA 2N7BA 4FLQA 3MLSH 5HHNB 3EYQD 1NFAA 2KQMA 5EORL 2KH2B 3OQ3B 3HTLX 1NDGB 1M7DA 3L6FB 5C0AD 2BVPA 5CXPA 2DTMH 1PZ3A 5AVZB 3QDGB 1ZPLA 4CA4A 4JL2A 1GGCL 5EULV 2P43B 1N3NA 2OYPA 1IJNA 3GEFA 4U1LB 1IC5H 2JCCA 4LDLB 5HI3C 5C0GA 3K3QA 1R17A 1H6FA 3QIWD 3ULVC 1BD2A 5DK3A 4UZSA 5I71B 3EYUL 3UBFA 4XP6H 5DQDH 5IHUL 2PXYA 1QKZL 2J56A 3EHBB 3ES6A 4PJFA 5AAWC 3RG1C 2N0MA 4HZLA 4I4WB 1A7NL 4WEMB 4R83A 3Q2WA 2ENJA 2ZKHL 1V3MA 4EI6A 4AJWA 3QEQB 5DK2B 1G6RH 1DQIA 3LIZA 4X0NA 4WKZA 3BQVA 2J1ZA 3NJIA 1BXAA 3Q8BA 5LDUA 3JYBA 5EBWB 3T1WA 3FQXA 3NSYA 4R97C 3ULVH 1VKXB 4NKMA 4RX4A 1F0LA 4B0MM 3ISYA 2MKLC 2R8SL 3JTBA 1BZ8A 3CFDB 4I3RH 1KV3A 1SLUA 1EX0A 5I1DB 1XXFC 5TTRA 1BZDA 1ULVA 3T6WA 1I7ZA 2X1XR 2BVYA 5FYKD 4TF4A 2ILLA 1HYSD 5F7FA 3S35X 5LKNA 1NGZA 3JTSB 3TBYA 1HWHB 3BAWA 4ZXBD 2OA9A 3MJ9L 3UZQB 5EUKB 3ZTNL 4BD4A 1PTZA 4GIAA 4OZFG 4PJDF 5C97A 1EAOA 1OHZA 4JFOB 4N90D 1KFAL 3CZLA 1JXJA 3GQFA 4OM0H 4XGZB 4CU8A 1MCOL 4JHBA 1N7MH 1INQB 1T03L 3PQYD 1DQML 1JK8B 1DJSA 4NENA 2VDKB 3SBRA 4DN3L 3VWJD 2ZOTA 5D55A 5GGQH 4QRSB 1Z3RA 3U0TB 4R3SB 3D39B 4LSTH 5EWIL 4DO5A 1XH1A 1UWGL 4ODVL 4LCCC 4QRRB 4JFDB 3IXTA 3NCYS 2E9IA 4NERA 2RFXB 5C0IA 1JWSB 3V95A 1KENL 5E0FA 3KLSA 2GK2A 3IRZA 3MLTA 4Q89A 3FTSA 2Q5BA 4G7SB 1VFAB 5GS0D 3VXOB 1WZ1H 3ARGC 4ELKB 2H26A 3VTMA 3O4LD 4LMQE 4GQPH 4OIIL 4KDTA 3R19A 5DMGC 2AV7A 4HPOL 5FGBC 1BMWA 3P0YL 1KCSL 4XVSL 1YC8A 5KVDE 2H6OA 5E8NA 3GIVA 5IG7A 1EHKB 5FYKL 3MCLL 1I8IB 4DK6A 1UT1A 5DQ9A 2CDGB 3GI9H 3EJPA 4XXCA 1CDBA 4KX7A 4PJGA 1TTBA 2QJDA 5CN1A 3DV6A 2HCZX 3CWGA 3PWJB 1QQDB 5K9KA 2IAMC 2NNFA 35C8L 1VHPA 1WFOA 7TAAA 3NZSA 2CKBB 2B08A 1M2OA 3NEOA 2CO3A 2YUWA 3KWWB 4BGDA 4Q9QH 3EH4B 5E94B 4J2QA 1G7IA 1TCRB 4P3CL 3AS2A 2X4UA 4OZFA 5IJDC 1T4KB 3JV0A 3QG6A 3NPZB 5ADOL 3VAEA 2NW3B 4PW3A 5DJ2A 3GMNA 2FO8A 2AK4B 5FK9B 3OZLA 3KDPB 5E8OA 1W16A 4HWNA 1FNEA 1MZYA 1DQVA 4KJPD 3A6CL 3IB4A 5CZVH 4KKLD 2G60L 1TYRA 5AB1A 4PS4L 4HIHB 1DN0B 1L9NA 3FH5A 4JG0H 3OTTA 2GTWA 4JO1L 1HH9B 3SYAA 3T0EB 3VCLA 4D7BA 1FBIL 3OKLA 5E5RB 4HJUA 2JCCE 1JDAA 2APBA 4QIRA 5T8IA 1BD2E 3VWKC 2X3AA 5EA0L 3RI5K 4PW9A 4B41A 3OZ9L 5D71L 2Q7YB 3V0HA 1PZAA 3X11B 3VI3A 3BZ5A 1QX1A 3U7AA 5E7BA 4M8QB 4GI8A 5L8JB 3BESR 4KAQH 2PUQT 4L0PB 5TPWL 5SWZB 2WO2B 4N2DA 5DJXB 4Z7WE 5IBUG 4ZJ9A 5EEXA 3GUTB 5JOFB 3Q1SL 2NW2B 4TVSa 1S7UB 4F24A 4GG6B 5BVPL 1N70A 2CJSA 1G7QA 1SN5A 1WEJL 2YD8A 3OHMB 5DHYB 1FP5A 5FDWA 5AW0B 5K5YA 2CKNA 4XOCA 3RURA 5DHVA 5EOTB 1MCEA 4U6VL 3EFFB 1EAPA 1JPTL 1O6TA 4KI5D 4ACPA 1DN2A 2Q2LA 2HRPH 3KL0A 3L4XA 1ADWA 4A04A 3BKJL 4IIZA 5LN8A 3CFCL 5AOLA 3TEZA 1JUFA 4Z0BL 5AZ2L 3JT0A 3GSUA 4D94A 4Y2OB 5LGYA 4O58L 5KSAC 1MFBH 2YMOA 4GEIA 3FYEB 4N2FA 4D0CB 1HT6A 4IMKC 2AJ3B 5DD0L 2R51A 4JJOA 4OJDH 1H3TA 1COBA 3ZLQC 2IBZY 1KY7A 4UT6L 3AG2B 4BDVA 5IVXA 4HU8A 4XTRC 1MFEL 3H2PA 2HPTA 1JGUH 1MHCB 1HHKB 2XETA 1ETB1 4NQUA 3SE4A 1FLRH 2QKSA 2K3TA 3C60B 5DZNA 4FG6C 5BW7C 2PCPB 2Y5TB 4ANXA 1RFDH 1ZGLA 3QQ3A 2EEBA 4FP8L 2ARJB 3EFOB 1CFQA 3FQ2A 4GMSH 1JDCA 2XIBA 4IU2B 2P8LB 3QA3B 4KY1H 4YHPA 3H42L 1E0OB 1O6VA 1E27A 3DJRA 4L1HA 5MEOB 3PGFH 2O26U 2VDQH 2SEBA 3BP4A 4OZGB 3SDXE 3D52A 4LNRB 3FAXA 4B7LA 2VL5A 2AK1H 3CZFA 3SDAC 1VRSA 3T4AA 2HTLC 4FQLL 2QSTA 5KYXA 4NHCL 1E8WA 1KGUA 1KN4L 2Q3XA 3RWJB 5BMFL 4OJYA 4MA1B 2XFGB 3FFDB 4K5OA 4EQ3A 2X7LB 4PJGE 3EYSL 1V7ML 2OTWB 1MRCL 4LHJB 5J6GA 4LZKA 1DFXA 4EDXB 3F64A 3HVDA 4QRAA 3CK0L 1NAML 2V5SA 3Q13A 4ADGA 2WXJA 3NTCL 1EFQA 4BA8A 5L8KB 1AHMA 3ZMEA 2OMUB 2UUDH 3B9KD 3WG7B 1CXIA 1GS6X 3HE6C 1QG3A 4QYOA 5FKPA 3UFIA 4HIEB 2A38A 2UXTA 5FO7B 2AS5M 5A2KH 1TMCB 2ISDA 1M71A 2Q3ZA 4D3CL 1QR4A 5AVUB 3QUXB 3VB8A 3NN8B 4TLSA 1F4HA 1NGQL 3N1PC 4PD4K 4G7VL 2PYED 5MEPB 3NQIA 3RWDB 1ZDQA 4HF5L 2VCOA 1J9SA 1DBML 2HUEA 1ONQA 1RMFH 1ZHBA 4QXGL 1U95A 2W88A 2JCCF 5I74C 4KKQA 4UZUA 3S4SG 1J1XH 4FFWD 4NJAH 5BNXD 1CZ8L 3AXLA 2VISA 4NAMA 4QNPE 1JI2A 1H3PL 2XWZA 4FQIL 2EXYD 4MA3A 3MV7E 5I1KH 1AXTL 3CN1A 4PJFF 5MERA 3CDYA 5E6YA 1IGCL 3JV6B 2RQ8A 2XSKA 1GW0A 1WRFA 4XCFL 4Y4HC 3B43A 1TQUA 2XCMC 3HG1D 3OKEA 3P11L 4HPYH 4KMLB 4NNPL 4PVMA 3VI3E 2NY3B 2ZCHH 1ESOA 3QDMA 1WAEA 5CJQL 5JO5A 1SNRA 4WSJA 4ZT1A 5JHLL 2JKLA 1DFBH 2COVD 3HS9A 4R84A 1SJEB 3DMMA 2WO4A 3LEVL 5B1KA 1P7KB 3WE6A 1C5CL 4EIZC 3LS5H 2OQJB 1XEDA 4FQXC 4JKMA 4JKKA 3DBXB 3K2UH 1UTDA 1ZV5A 1FE8L 3GXUB 4Y4FD 2CO4A 4NAJA 1JTOA 3DTXA 4YFLI 1LL1A 1UCBH 4CRPA 1I9IH 2F1AA 3ATAA 3KG5A 4P2OD 1CICB 1KJ2L 3QNZB 4EZLA 2H32B 2EABA 5C0EA 2ICWB 1RUPH 1N64H 3V0GA 3HS0A 1AZNA 1KIRB 3KHOA 3KGUA 2AXJA 3LV3B 4YHYC 5L7XH 3G5WA 1NH6A 4S2SA 1KPVB 1DQDH 2XBZA 2XPGB 2H9GA 4Q9RL 3H7BB 2ADIB 4O02H 5KVDH 1PYWB 3W3BA 3FSVA 5E4IA 5IVXE 1BG1A 1BEYL 4PJ6A 2IXQB 3UTQB 2XWRA 3D4ZA 4NQDB 4JO3L 4LGRB 5EIIB 1F8TH 4FFTA 1DE4A 1SY6A 4IBVA 4JRLA 1KJVA 2VLKE 3VGDA 1BQKA 3BT2H 1TJHH 2X1OA 3S4SA 1EFXA 3CFEA 1I7TA 3VG0L 2QT6A 4XC3L 2WCSA 3MRNB 3QUKB 4A6YB 1DLHA 2YLHA 4HUMB 4B9YA 1OT2A 5DRNA 4OLYH 4QHLA 5CUSH 4OCSH 2OW7A 1NKGA 3IAGC 4QT5B 1HXYB 2VDOH 3EBHA 3L1EA 5IUCA 4FLRA 1YEEL 3NFSL 3K80A 3NSXA 4F5CE 1MUJB 1RKRA 1UVQB 4Y16D 3SKOA 4AOFA 3V4PL 2CPCA 4PRDA 1KZYA 1XH3B 1IKOP 1WBXB 2PXYC 4XNZB 4C58B 3DOSA 4PJGF 3C2AL 3BVTA 1R3JB 4HFWB 3FTVA 4G9FD 3V4VB 2LAAA 3ZJAA 2YC1B 3AZUA 1RUQH 4LCYB 3FMGL 5HHNA 2PCFA 4PLJC 4BH7A 4HXBH 1Z6JT 1R5IA 2G3ZA 4JGMA 1PFCA 3SE8L 3UG3A 2CPUA 4ODTL 1K2DB 2EO1A 3KVPA 4R5TA 2WANA 4MCMA 3DX2A 4XPTH 5F9DC 1I9JH 4Z3FA 1NDGA 2ZTBA 3M86A 2EQDA 3GMRA 4YLQT 1WPCA 5CFHA 5CD5C 3RVXD 2W07A 1T3FB 3AXHA 3QDGA 2APSA 4PLNC 3FCTB 5MEQB 4HUWB 2F15A 2PP9A 2OMTA 5HDOA 1OP5K 3WEAA 3H55A 4LHQB 4H8QA 4YHOH 1NTDA 3LIZH 4J3BA 2P42B 3PU7A 3MJGX 4K2UL 5FFLA 5GS2H 3CMOH 4UQ3B 4PJHE 1VLXA 1Y0LB 4X6BB 2AJVL 3EZ8A 4HD5A 3NJNA 4QNPF 4KU1A 5DK2A 4N0YL 3UAAA 5C0CB 4I18A 5EBWA 4XXDB 1JZ2A 4GXVL 1T89A 5F1NB 1RZQA 3VI3F 1S78C 2MMXA 4MCZB 3CFDA 4DP8X 3O6FD 1PU0A 5CJOL 2ADFL 3BSZA 2H1PH 1LO5A 2FHBA 3E7JA 2VLJB 2ZKWA 3HCVB 3NFNB 4X5XB 4ZW3A 5I1DA 1C8QA 1OSZB 3AROA 3QDME 1F4WL 2WNKA 2A77H 1ZGLP 2MPAL 1GSMA 1U8CA 1DUYB 1HINL 2Z7ZA 3APCA 4G59C 1BAWA 3RU8L 3UH8A 5HDQL 3NMEA 1YMMA 3PY9A 3UZQA 1KGJA 5EUKA 2FDBP 4XVUD 2DLGA 3KYNB 3RJOA 4F8PA 3F7VB 5TQ0H 4A39A 4NRZB 1SOKA 1BYNA 1C7TA 1KYUA 5KBDA 4HQQL 4WGVB 1OCCB 2OSLB 4GKLA 3U30C 5KSBE 4GSDL 4KDTC 1CO1A 4TQEH 2WWMD 4A7VA 1QPXA 4LEOA 3M1CA 1MFCL 1KGWA 1OP5H 1JK8A 1FYTB 3GJFB 4IBTA 2DLEA 4OGYL 5B39G 4FQCL 4QRSA 1CMOA 1CR9L 4X7CC 3D39A 4XXCC 3SPGA 4LGPB 2QQQA 4QRRA 4JFDA 1KTRL 2XKUA 2HKFH 1SJXA 3ARUA 3WTYA 4N6RA 1E3FA 5IVXF 2C26A 3D18B 3LQMA 1MIMH 5I1HL 3S37L 3RIAF 1NC2A 2PWFA 2X4RA 5HGAB 1VFAA 3BIBX 3VXOA 3P0VL 1NANH 3KPMB 5KVEE 1PLBA 5DR5L 2Y22A 2ZKYA 1YNKL 3C6LA 3QHZL 1V3LA 2AABL 1F6AB 3CSYB 4F15B 3GK8H 4RGOH 4XPGL 1Q94A 3SJVB 4ZMTA 5F9OL 1U8IB 2RB8A 2CHDA 1EZLA 5DVOA 5EF1A 1KGIA 3RVVC 5HHMD 4HUVB 3NSCA 1I8IA 4OJCA 2C9PA 3EADA 2CDGA 3KBEA 1RH8A 3VE0B 2BIPA 3RPIB 4BJLA 3NA9H 3PWJA 3MRQA 2Q6WB 2PO6B 1QQDA 2WXFA 2BC4B 2XKSA 4LSVL 4B53A 4OZFH 2WXIA 4ORZC 4K71B 5IUSA 3UIZA 3KAAA 4XMWA 4AYGA 4R7VA 5AD0A 1P0SE 1Z2KA 4ABUA 2EUVA 1M05B 4QXUH 3KWWA 2VDLB 4PREB 3FNKA 3HMXA 4DGVL 1RK0B 4HWEL 5E94A 3TC9A 2VMEA 1TCRA 1HIMH 3PJLA 2EH7H 3MCG1 3IMUA 1SEBB 2AK4A 5FK9A 4WV1B 4P9HC 4LCIH 1NSNH 2VDMB 4PJEB 3RGVB 1ZS2A 2UZIH 1VERA 4FI8A 3ARSA 3KLQA 1Q38A 1FNFA 3KLDA 4HIHA 1DN0A 5I17B 4LASH 3BUDA 5B39A 2IBZX 3JV4A 3QDGE 3U1PA 3FU9A 3OX8B 4OM1L 5E51A 2AJYH 3VFGL 3FF7A 4WEBL 3K4DA 4JPKH 4M93C 1J12A 1UM6L 2JI1A 2NY2D 4HS3B 4XXWA 2AEWA 4JN1H 3W5NA 5BRQA 4G8GE 1BAFH 2GB2A 2Q7YA 2B9AA 1NIFA 4PUBH 1A9BB 5TDPB 2XWXA 1A7BA 1AR1C 4M8QA 4UT9A 4K9JA 2EVJA 3MLZL 4YDLC 2VZUA 3H9HB 3N1GC 6TAAA 1QSZA 5KYNA 3CCHA 4BHUI 1HQ4B 3KEDA 5TH2B 4TLUA 5DJXA 5IJBC 1F3JA 1RZFL 5DHVH 1IAII 5JOFA 5IW6B 5MP6H 1GRWA 2LTQB 2NW2A 1DDTA 3ENEA 4ZX4A 4WQOA 1BWWA 4JM4L 3HBQA 1NCDL 3GZQA 4KO6A 3SE4C 2QKIB 5EOTA 5H2BA 1SXSA 1J1PL 1CFVL 4HS6A 4UQCA 3M07A 3ISWA 2FL5B 4HIXL 3C6SB 2JKSA 4LSUH 4PCSA 1N8OE 4OCYL 1ADQL 1DVQA 2HT3C 2R4RH 5HHQA 5E99L 4PM1A 1YMME 3FUEA 4Z7IA 4Q8BA 4TQPA 3CC5A 1N8ZA 3QISA 4X0KB 1YHPA 4AUUA 2VLRD 5JR1H 3ZHNA 2EVGA 1K9TA 4D0CA 4L3CB 2EDYA 1YPZB 2CLVB 4BRJA 2AJ3A 2ETWA 1MG2C 1WK0A 2F8OA 2V5MA 4FZEL 3T4AC 3IDYB 3L2NA 1ZK9A 3CFIC 1IGFH 5LBGA 3UTSE 3BFWA 1E4WL 2DJUA 4DUWA 2EZ0C 1OQOA 3FOMB 3BKCL 5E1AB 5IB4B 3PHSA 1CVRA 3TIEB 3VSVA 2XG5B 4M1DH 4DP2X 3F00A 1DBBL 1N19A 2Y5TA 4JFDE 2XWCA 1E7VA 4XC1H 4IU2A 3QNXB 2P8LA 4U3XA 4XAKD 4WUKH 1H6TA 1GZHA 4GH7B 5GRVK 5EIQA 1FNGB 1X5ZA 3HHMA 43C9B 1T7VA 3QO0B 1LXMA 4ALAC 3BOVA 1WA0X 1SYSB 1P4BH 2BW4A 3PYCA 1A4AA 1XB6A 2LLNA 4AJYV 2Z3FA 3ZDXF 4Z76B 3QRGH 2W59A 5JNYB 1N4XH 3IT8D 4FEIA 5E0QA 1V7NL 4E42A 4QXVA 4ZO6A 4AY0A 4NNXB 4XPBH 4EQ2A 3MMEA 4YSDA 4GS7C 1U3HD 1U2YA 2RBLA 4XO9A 4Z3GA 3FFDA 2X7LA 5DC2A 5ESQB 4JY5L 4O51B 4UQ9A 3K5SA 4ALAH 2NQCA 3FQWB 3SY6A 4EBQH 1U3YA 3U7WL 2F0CA 3NUKA 2Y7SA 4I0PB 4OH2A 2HPOA 1JZHA 3FQRA 1U92B 1G4RA 2RHEA 2X4TB 1H8SA 2F74B 4E9VA 3QQDB 4WI3A 1A66A 1WD8A 2CJUL 3I3BA 2F68X 4UT7L 1XGUB 4LIQH 2OMUA 3K1DA 3U4KA 2VRKA 3JTTB 5TGBA 4HIPA 3UIYA 4HIEA 1U8KB 4Z78A 5FO7A 1FDLL 4LDEB 2IPUG 4ZFOA 2MJWA 2AK4E 3NN8A 4ZMZA 3DMMC 2DV6A 1NPJA 4GQQA 1AGBB 4KK6D 3QULA 4JG5A 4LLDB 5EIIG 3S35H 3SGDI 2DWXA 5CLWA 2FYYB 2HRGA 1J8HB 2D0HA 3BZFB 3MV8E 1KIQB 3H4HA 2EDNA 1EQWA 2R56L 4KKCD 3RAJL 1KXQA 2F5BH 2J55A 4HWBA 4KPHH 4DN4H 4L5FE 4HS8L 5IOKA 5BO1H 1MZZA 5J6HA 3PFUA 4KTDH 2WN3A 1A65A 2HB0A 3FO1B 4KX8A 3SGKA 3NAAL 3CU1A 5F0PB 5C0AB 4F33A 3EDEA 3DXAE 1IX2A 3HS0C 4IOIA 4LBEA 4KZ0A 4ZPTA 4XVTL 2P5WD 5H4YA 5CLYA 1S7WB 5EC1A 1D2PA 1ITCA 1NUFA 1LO2H 4LLYB 3QIWB 4RCAA 5JPMB 3SDYL 4BH8B 1RURL 3DBXA 4OAWA 2BPBA 2R0ZH 2AERT 2CLRB 3L4VA 4AK2A 4D8OA 3QZNA 4N1CA 5EEYA 4TULL 3DX4A 5CBAB 4OI7A 1BF2A 2C1PB 3QG7L 4TNWF 4ZOBA 3B7RL 4JKNA 1CICA 1OCOB 3V0IA 2UWEA 4NWTH 5ISZD 3QNZA 2Z4QB 4D0DB 3C5ZA 1JZFA 1PLCA 2H32A 4OLXL 2ICWA 4PWGA 1UURA 3WUZA 1B4JL 5KVEH 4NPYB 5E6ID 1KIRA 2A9BA 3LV3A 5GRUH 4NN7B 3DVNB 1JDDA 3TO4D 2ZX7A 1SF5A 1KPVA 5SWQB 3DGGB 4AMKH 1SY6H 4TNVF 3H7BA 4AEIL 5I1JL 1EAJA 1JERA 1QYGH 2ADIA 2IPKA 3ESMA 1G0YR 1HHHB 1JPSH 3TT3L 3WTWA 3BAEH 4FZ8L 3UTQA 4NQDA 4PQXA 4EE2A 5EIIA 4ZXBB 3QHTC 1A8JH 4R0LA 5GISL 2ZIDA 5IB2B 5EO9B 1SLVA 5C0BD 4XPFL 2X09A 4QWWD 1WD9A 2IANE 3MRNA 3QUKA 3U2SB 4OFYA 5KTEL 1H8OA 4A6YA 3PQYB 4TNEA 15C8L 5IVZB 1TNMA 1IT9H 2A6DB 2BCKB 3FT9A 3V0DA 1OTTC 4MRCA 5F7EH 3VWJB 1HXYA 1MJUH 2GJJA 4KC3B 4KTGA 2QVTA 3S48A 1MUJA 1UVQA 3IETB 3U1SL 2ARWA 3APNA 5I19L 1M3IA 2J7LA 5JUEL 1I8AA 5I6PA 3T08A 1XH3A 3I84A 4TRPL 1YVLA 1MNUL 3EHBC 1WBXA 4NZFA 4TNWK 2PW2A 4K94L 3ZKXC 3DK0A 3V4VA 1IBGH 4C4UA 1XF1A 3MLXH 2YC1A 4LCYA 3WMQA 3BT0A 1MHEB 3S6CA 2EKSB 1DVFD 3O4LB 1GC1L 4LOUD 3ZHKA 1K2DA 4PTTB 1H9DA 4FNSA 4WI6A 3NZHH 3OKMB 3KGSA 4I18C 4WWOA 5D7SH 4TNVK 3VM5A 4EUPB 2OMZB 2VC2H 4EN2A 2V3FA 1T89C 3NP4A 1JGVH 2CGRL 1YECL 1GS8A 3I6LD 1E5ZA 3FCTA 2VO8A 4HUWA 4LK4A 2Y69B 1SN0A 3L7FB 3BWSA 1AO7A 2EH8L 3NG5A 1F3DH 1CCZA 1OPGH 4H40A 5SX5K 4XPAH 4NEHB 4OD3L 5DD3L 4NJ9L 4OVUA 4RESB 3OL2A 2AQRA 4MLSA 3KPLA 5FYLE 2OZ4L 3CHOA 3T77B 3WNNA 5DF0A 1U8PB 4I9XA 2BFGA 5L4MA 2F5AL 1E4HA 3VU2A 1NWOA 1TO4A 5AEAA 3BSZH 3FCGA 3FPYA 4QOKE 4OB5H 3ULUD 1IGYB 2G0LA 1KEMH 4R7LA 4TSCH 1CUOA 4TUKH 5F1NA 2XWJA 1EUTA 4I7ZC 5LXGL 4MCZA 2J44A 3B56A 4J8RA 4L3EE 5ES4B 3O8XD 1JZ8A 2ITEA 2VLJA 3HCVA 2YGVA 3B1UA 1NGYB 3MODL 4TKWA 4X5XA 2XA8H 3X1BA 5FFGA 1KPRB 5GS3A 3LPFA 1A6UH 4Y5XB 2BVTA 2MQGA 4H0IA 4IYKA 3PXHA 3ZZQA 3BIKA 3VVWA 2NT1A 4M4RB 2EDHA 2HLAA 2VDKH 3GWJA 2HT2C 4PBWD 3N41B 3LXBA 4NRZA 4O4YH 4YN3A 2GI7A 2FX9L 4FQHB 4J3OD 3C6LC 2OSLA 3RL2B 2A83B 4PRID 1X4YA 1DLFL 1ZE3C 1T0NA 2BM3A 3OF6D 4R7DB 1JXKA 5C0DA 4WFGD 3GJFA 4G6MH 5TF0A 2XX0A 3DKHA 3HHSB 3RNQA 4EZMA 1E4XI 5BJTB 3H9SD 1PEZA 2UWEE 1RUAL 5I8EB 1QZ1A 1U4FA 1MVUB 5IV2A 4TVUA 1ZLWK 2F2HA 4IHOA 1KJMA 2V3EA 4BZ1L 3FFCB 4HC1L 1TTCA 2R0WH 4LDOB 2X6MA 4RAUA 5HGAA 3ASNB 5CP7B 1TG8A 2J8OA 3KPMA 4HHAB 4P5RA 4JY6B 4L9LB 5FUOL 2VOTA 5DVNA 1IGIH 3TCXA 2TSAA 1F6AA 3CSYA 1HCVA 3SJVA 3L7EB 4P2QD 3SKNB 3STZB 1U8IA 3V9CA 2CUMA 2LQRA 2EUZA 4UTAL 3AU0A 3GMPB 2C3WA 2YMXH 3AM8A 4ZUUA 4FNRA 3FDWA 5LAXB 1NAMB 1FL6A 3OGCA 4F7MA 3VE0A 2LVEA 2M8XA 3VI4E 2YEZA 1NQBA 4N8UA 3HMXH 5FHAH 5HHVH 1PZSA 3KJ4C 2Q6WA 4F58H 2BC4A 3DO4A 4I0KA 5LGHL 3EOTL 3ZKQD 1Y6NR 3JWDL 2AJXL 4XXWC 4W9HC 1CFMA 4NQCE 1M6OA 3BGAA 1M05A 3VFTB 4PREA 2PCYA 3GM8A 4DW2L 1PX8A 2IOIA 3IJEB 3TBCA 1Q0XL 2Q8AH 1QRNE 1ND0B 4HUCA 5EZJA 2F7IA 4D8PB 1U8LB 3H3PH 3IKCB 3PWNA 5C6TL 3WNMA 1A7QH 2DH2A 2WQVA 5BVJB 4G7RB 4QTFA 4WV1A 2VR6A 1TTGA 5D8JL 3UAFA 2E8YA 2UY6A 3VXRD 1EVTC 4N24A 3T2QA 3ARZA 5SWSE 3HLAB 4HETA 2FJGB 1QTSA 1IC7H 1PLAA 4X6CA 4GXUM 4L5FH 3G04B 1OCZB 2HTKC 2Z8VC 5ICZA 3OX8A 1BFVH 2GC7C 1MREH 4UOZA 1Z9OA 4F2MB 5MHSD 3BSGA 2D7TH 2Y06H 4UT9H 1AO7E 2W91A 3VG9B 3ZE1B 1E5CA 3QJUB 3O0RH 3DTUB 5TDPA 1E8ZA 2WCGA 2V2TB 4X4MA 3QXAA 1JWUB 1CF8L 4LEXH 2EEXA 3HI6L 3U7YH 4EKXA 1YJDC 1TLMA 4L3AA 3UGEA 5L88H 3IWUA 3LN4B 2MCAA 4DGYL 5TH2A 2VUKA 2VQ1B 4NI3A 2KUTA 1IGTB 2DQDH 4N8PA 5IW6A 2JSFA 2P49B 1B0GB 3QNFA 1MIEL 3FJTA 3HZVB 4XMKH 1KJ2B 4XVOA 2PYEB 2QKIA 2D03H 2AQPA 2VLJE 5D4HA 3VFWB 3NJVA 3GSXA 3NSJA 1YJDH 2HMID 3BJLA 5B4MD 4K7PY 5FM8A 4PRBB 4GLRH 3C6SA 3A3YB 5CKGA 4Z7UB 3GSRB 3W9EA 5EN2B 2F54D 1GZHC 4JFFE 3I9AA 2YGPA 1K72A 1FQ9C 3LY6A 4IDJH 3ZYZA 3GNMH 3T2LA 3NJXA 4OZIB 4R90H 5HGBB 2X2HA 2CUAA 3VFSB 4L3CA 3HG1B 1YPZA 2CLVA 3HG0A 2R15A 2O30A 3SZKC 3VD2A 4NT6B 3A6OA 5IIEB 2UWEF 1NFDE 4KUZH 3CZSA 1QR1A 3FOMA 4MA1C 4KQ4H 2FAUA 3FF8A 4Q9CA 5E2VL 4HCRA 5I23A 2XG5A 1L0XA 3GHBL 1LWHA 1CGSH 3EAKA 3MBXH 3LS4L 4ZMPA 1UUSA 1ET5A 1GJWA 3CSFA 2C3VB 1TZHA 3QNXA 1FNGA 4GP5B 4RMVA 4Y4FB 1TYJA 3V4PB 43C9A 2I25N 1R3HA 3BWAB 4AIEA 4DKEL 1SYSA 3CZKA 5DJDB 1YN7B 4XP1H 4LL1A 2DM4A 3IDIA 3F01A 4P2OB 2VDNB 4NUPA 3ZTDC 3F6IA 3UERA 4XMVA 5JNYA 4GKOA 2WLLB 4NKOB 3LQZB 3S8WA 4AV5A 1A1OB 2O5XL 3IU3B 4AMXA 3II3A 1FORH 4DEPB 3W81A 4NNXA 5IKCB 1UEYA 3C09C 1BX2B 3RTLA 1AXSB 1QOKA 2X5PA 2D7PA 5EU7E 4LVOC 5ESQA 2OW6A 4O51A 4POZD 4PB0L 3DHUA 1GMEA 4I0PA 3P3SA 2YUVA 5HYQB 2VLLB 2X4TA 1IIIA 5GGVY 4DT2A 5TK2A 3QQDA 5AZUA 1VB9A 1D5BA 5B7EA 1QSFA 2GCYB 5ACZB 1BQ5A 2GG1A 5FYLH 1FPTL 3JTTA 1X7QB 2E7BA 1NFKA 2NY3C 3SGKC 1U8KA 3EFDH 1Q9KA 1QI5A 2FSEA 3EUUA 4KRMB 2ROXA 3LKQB 4AW4A 1CE6B 4Y1SA 3LPOA 1QABA 4FNUA 2B4CC 4JO5A 1JPFA 3L3OB 1E67A 3DJSA 3HN5A 1CGWA 1AGBA 2DQGH 4Y16B 1Z0NA 3MXWH 3MX0B 5EEZA 3WFBL 3VGEA 1M7IA 4HWBH 4X6CE 1ZIBA 1VJSA 3KGRA 2FYYA 4DKFL 2MEJB 5AG9A 4FE9A 3AW5A 1J8HA 1AE6L 4PRNB 1AIFB 3K72A 3GRGA 4G9FB 4FC3E 6CGTA 3QI9D 2R1XA 4UM8B 1HQRA 2ZSVB 2B4CH 3D30A 1CL7H 1JPEA 2XVKA 4W68A 5I82A 3MJ9A 1CICC 2FB4H 1T20B 3FO1A 5HPMB