4DP7X

The 1.08 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 4.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
b'IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin A, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp7X00
4N8UA 4G7QB 4NERA 4FAAB 3OMAB 3NP4A 1JERA 1GY2A 1KCWA 3BVDB 1AS7A 1CURA 4UANA 3FQYA 2IDFA 1J9QA 1UATA 1J5CA 3GYRA 3NSFA 1CUOA 3UAEA 4RH4A 4KOBA 2OJ1A 3FU8A 2BZ7A 2EIKB 1IC0A 1AZBA 1BQKA 3X1FA 1NIBA 3WNJA 1WS7A 4DP2X 1WA1X 1PLBA 1MG3C 2PPEA 1TEFA 4BK5C 2JXMA 5F7BA 5I6MA 3WKPA 1KGYE 4DP1X 2E86A 1W8EA 3JTBA 4KNSA 1KDIA 2J5WA 5B1JA 1SFDA 4KOCA 1X9UA 2P80D 4GYBA 3QJRB 4AKPA 3ZX1A 2B08A 1BYOA 3OD3A 1SJMA 1V55B 4HHWA 1GYCA 2FWLB 1SF5A 1A4CA 5PAZA 1PAZA 2YAQA 1JXDA 2I7SA 5I6OA 1GS6X 3IEAA 1ZDSA 2H47C 3ABKB 4Q8BA 4E9SA 3FSVA 1M9WA 1PMYA 2XXFA 5I6NA 3CDZB 3NJJA 3ZBMA 4F2FA 1I53A 2XUWA 1L9PA 2HLEB 5I5JA 1E65A 1ET8A 2IDSA 1NTDA 4AKQA 1ASOA 4ENZA 3JT2A 3UACA 2MRYA 1AG6A 3V9CA 5LDUA 1L9TA 1E5ZA 5B3SB 1AS8A 3PCYA 1BQ5A 4K9JA 4L0PB 3OMIB 2YAHA 2Y69B 3NYKA 3UAAA 3IE9A 3X1EA 3SBPA 2CAKA 2FQGA 3WKQA 1L9RA 3CVBA 3WG7B 4YSUA 2VSMB 4YVNA 2GSMB 1KV7A 2HX8A 2OCCB 1A65A 2QDVA 3FT0A 3FQ2A 3KW7A 2EIMB 4A2FA 2XXGA 2VW6A 2IWFA 2HRGA 4DPAX 3NJIA 2PP8A 1OOWA 1PY0A 4KO7A 4X4KA 2QPEB 1ASQA 3SQRA 1WAEA 2WO3B 3IN0A 2A3TA 4UF7C 1JZEA 2TSAA 2BZCA 2FQEA 3WIAA 4E9QA 2FQFA 3H4FA 4YSAA 1JZGA 1SFHA 4MFHA 3S8GB 2UX7A 4WTQA 5F7AA 3X2QB 2HX9A 4HAKA 4TXVB 3N2JA 2AVFA 3CDZA 1SF3A 1OF0A 3H4HA 3OQRA 3NJGA 4BXSV 5I5IA 1F56A 2GI0A 4HCIA 3FSAA 1ZPUA 3RYMA 2BP8B 2GHZA 2Q9OA 2YAMA 1ZIAA 2YXVA 4JHUA 3TU6A 4YSDA 1NDTA 3ASOB 2CJ3A 3FQ1A 6PCYA 4N4YB 4GP4B 5TK4A 1NWOA 2BW4A 1AIZA 5I28A 4NAJA 1N70A 2VW7A 3C75A 2PPCA 2AANA 5B1JC 2XX0A 1WA2X 4DP7X 1N68A 3CZUB 4AI7A 2ZONA 4A66A 1AG0A 2Q5BA 1BEXA 2N0MA 1V54B 1M57B 2J55A 1XB3A 1NINA 3PXLA 4P5RA 3TASA 4E9XA 4EF3A 1ZDQA 1NIDA 4BXVA 1MZYA 2JKWA 2IDUA 3SBRA 3ZIYA 1TKWA 3KW8A 1JXGA 1ASPA 2OV0A 5B1KA 3SBQA 4AZUA 4DPCX 3ASNB 4DP9X 1KDJA 1J9TA 3HEIB 3T6ZA 2XYBA 3NJMA 2YAEA 3L45A 4JKNA 4DPBX 4A2HA 4KNTA 3AG4B 2GIMA 1HFUA 3NSDA 3AY2A 4PCYA 1QHQA 3S8FB 1L9SA 4FA7B 1EZLA 2GBAA 2FQDA 4YL4A 1AOZA 1J5DA 1IKOP 1YLBB 2HX7A 4AKOA 2B3IA 2XU9A 4DP0X 3FSZA 1GSKA 2PPAA 1PZAA 1RCYA 2XV3A 1QLEB 2BP8A 3CVDA 3ABLB 4YSQA 2YARA 1SHXA 4M4RB 4A2GA 5E9NA 9PCYA 2PCFA 2AFNA 4KO6A 2IDTA 4HIPA 1PNDA 1W6LA 4YSRA 1QNIA 1PZCA 1ZV2A 1AACA 2VN3A 2XX1A 2R7EB 3NJFA 2W8CA 1OCCB 1SDDB 2FT6A 5TK2A 1A4AA 1RZPA 2H5UA 1PZBA 2DYSB 1URIA 1NICA 3NSCA 4DP6X 4G71B 1AZNA 4E9RA 3FSWA 1BYPA 5B7EA 5A7EA 1BXUA 3T6XA 3ABMB 3T9WA 4BDVA 3T71A 2X87A 3S3BB 2IAAC 2BHFA 3PAZA 4YSEA 4GXFA 1JVLA 2XVBA 1XB6A 3EH4B 2PP7A 2YQBA 5I5MA 2FTAA 3FU9A 4YSTA 2DV6A 4ZK8A 2IWEA 4WKXA 3QPKA 2W88A 4E9YA 2EINB 1ET5A 4G70B 4CSZA 1R1CA 3WI9A 2J57A 2VM3A 1ADWA 5D4IA 3H56A 1JXFA 4M3HA 4HZ1A 1IUZA 3IBOA 5FC9A 3ERXA 2QDWA 1B3IA 2I7OA 1PLAA 2PP9A 3N55A 4QLWA 3QJVB 3FPYA 5I26A 4HHGA 1EHKB 3TA4D 1MDAA 1L9QA 2LLNA 3U25A 1A3ZA 3CVCA 3GXUB 3PAUA 2BWDA 1OCZB 1ZIBA 2XWZA 4A2DA 3NJLA 3GDCA 2CCWA 1J9SA 2ZOOA 1JZFA 3HB3B 2R7EA 1RKRA 2J56A 1SNRA 1VLXA 1SDDA 1ETJA 3FU7B 2BWIA 3UABA 2DYRB 2FT7A 2IH8A 4DP8X 2EIJB 4A2EA 2UXGA 5D4JA 3EHBB 2HZHA 2IWKA 2UXFA 5B1AB 3EH5B 1TEGA 1FWXA 2WO2B 3D12B 3PLYA 4PAZA 3X1GA 1KYAA 2UXTA 1RZQA 4BDVB 1NIFA 2DY2A 4E9TA 2YAOA 1AQ8A 2PLTA 1GS7A 1AZUA 3DTUB 2AZUA 1NPJA 3TBBA 1A4BA 1BAWA 2PPFA 8PAZA 1ILSA 5ANHA 1MG2C 1GW0A 3T6VA 5PCYA 2IH9A 3S3CB 1ET7A 3QQXA 1AS6A 1T5KA 1HAUA 1NZRA 3NJKA 4E9VA 4DP4X 1X9RA 3FYIB 1A8ZA 2TSBA 1KBWA 1JVOA 4AX3A 6PAZA 3T6WA 2UX6A 2EILB 1IBYA 2FJSA 1BQRA 1SHWA 2YXWA 1NWPA 3MBWB 3EH3B 2CBPA 2CUAA 5D4HA 1GS8A 3DIVA 1AANA 1OCOB 2YAFA 3NP3A 4G72B 4GP8B 4P5SA 3UADA 4YSCA 2PCYA 4QKTA 2RACA 3UGEA 4CSPA 1GY1A 3ZDWA 1GR7A 1DZ0A 5I6LA 2DWSA 3PAVA 3FS9A 3G5WA 3PPSA 3MX0B 4YSPA 2ZWNA 1OE3A 1XB8A 2QT6A 4A67A 1FA4A 5AZUA 1JZHA 1NPNA 1CYXA 1KCBA 2BP0B 4JHVA 4A68A 3FU7A 2DWTA 3DKHA 1KBVA 1NIEA 3S3DB 1AAJA 1AZRA 2QPDB 2AZAA 4F2EA 3CG8A 1E5YA 5B7MA 3ABGA 2XLLA 4GP5B 1FFTB 1V10A 3NJNA 4W1TA 5B7FA 1JOIA 1HAWA 2UXVA 3V9EA 1PF3A 2GB2A 4KO5A 2XV0A 2YAPA 3QJTB 4YSSA 1ID2A 3QJSB 4DP5X 1OCRB 4BWTA 4Q89A 2HRHA 4YSOA 1OE1A 4KO9A 1TU2A 2VSKB 2BW5A 2VMJA 3TBCA 3FPXA 4HALA 1W6WA 5IY5B 4GY4A 7PAZA 1CYWA 2H3XC 1AR1B 3QJQB 4G7RB 1PNCA 2P80A 3X1NA 2XV2A 3AG2B 4UAHA 2IDQA 4NB7A 4E9WA 4BWUA 3NSYA 1J9RA 1BXVA 2Y1AA 2NRDA 3AZUA 4W9ZA 2HXAA 5EHFA 1CC3A 4HCFA 1AZCA 4YVUA 2JFCA 3AG1B 1PCSA 2X88A 1WA0X 1M56B 4F7KA 2BO0A 3AG3B 1DYZA 3FYEB 2CALA 3NT0A 1IBZA 3NJHA 3WNIA 1E30A 2WSDA 2FNWA 1JZIA 1JZJA 5I6PA 4BWWA 1E67A 3IN2A 2VW4A 3OM3B 5AKRA 1WS8A 5I6KA 7PCYA 1BXAA 1OV8A 3AW5A 2BP0A 4HCGA 4KNUA 2VM4A 2ZXWB 3EF4A 1XMEB 1L9OA 2GC7C 1MZZA 1NIAA 1PLCA 3BQVA 5B1BB 2MTAA 2GC4C 3OMNB 3X1BA 2PPDA 2I85A 3QJUB 1ILUA 2FT8A 1OE2A 4G7SB 5AFAA
chains in the Genus database with same CATH superfamily
1F6FB 2R1WA 3GSVB 2OL3L 4HGWB 1HHJA 4UIMB 1AS7A 3WNPA 5J1SC 4PV9B 4X5PA 1NC2D 3EG9B 2Y36L 5KTEH 1A9VA 5IMOA 3MRPA 5IG7B 4F9PA 3RVUD 5E56A 1FZKA 2A4ZA 1BQUA 1QSED 4XPTH 4YXLH 3IFOB 5GRYA 1C16B 1NCAL 4U1KA 3NZHH 2ALWA 2R2CA 4JJ5B 4JX0A 5DLMH 2DLFL 3I2CL 2NNXA 4HS3A 4LCIH 1FYTE 2XY2A 2HMID 4DZ8A 4XMUA 4LSUH 3LXAA 5TD4A 2NY5L 1MCOL 2BH0A 2Z8VC 4JM2C 2ITFA 4QJ3B 5IJVB 3JTBA 3ZLQC 2CRIA 3MGTA 3UPAA 2VLKE 3NCMA 1GJIA 1S3RA 4TVUA 3SY6A 1SFDA 3OWRA 2MEJB 3KLDA 3M45A 4W4OC 5ANME 3WTXA 1JRHH 1UZ8A 5FYKU 3VI3F 3VNZA 4ZUUB 3FB5B 1DEEA 1V55B 4JAMA 4IBUA 2VDLL 3MRBB 2D03H 4MZ2A 5PAZA 1CICD 1PAZA 2WLKA 3B2MA 3L3HA 3MZGB 4JY5L 1NGQL 3PJSB 2WKOF 1UXWB 4R5TA 5D1ZC 1CWVA 3CLEL 1MSPA 2ENPA 3VFVA 3IJSA 4RAUB 5HI5C 2OTPA 2AJXH 2CR6A 1M05A 4PWFA 2XTJE 3AB0C 2CLRB 3RTQB 4GRLD 5GHWH 3RVWC 5DFVC 3Q8FA 3FOMA 4OJFH 1DDTA 1BFVL 1HE7A 1EFXA 5B21A 1T66D 2IDSA 4LASH 4AKQA 1X5KA 1RLWA 3T04D 3S88H 3US0A 4BFRA 2MHAB 3L9YA 4D8PA 2HAZA 4CMMA 1F2XK 4QYOA 3CDFA 5IFHL 2EJ1A 1L9TA 1PJWA 3EFOA 1CG9A 4EIGB 3N42B 2GSIB 2JE8A 2NY0B 4PRIB 1FLRL 5FGBC 3H55A 5IEKB 2I07A 3UAAA 1INQB 4MBRA 4CC1A 3R4RA 1ZV9A 4JFFB 2KLRA 3QUYD 4LCWE 3GEWB 4YAQA 3PHOA 4LLVA 4XHJD 3JWOH 1T1ZA 4XXCA 3SDCD 4AJWA 4I89A 2CDFA 2XG5B 3KW7A 4L9LA 4B9GA 5HGBA 4GSDH 5EUOA 4ZW3A 5AG9A 2Y7MA 3HHRB 4NN5B 4G6KH 1IAOB 5FOJA 4X4KA 1IZJA 2GFBB 4PJXF 1TVHB 3CZKA 5HDLA 3SZ6A 4PJAB 4JFVA 3HE6C 3SQRA 1S8DB 4GXVH 5IW1A 5BVJB 1X5AA 3DYPA 4JO3H 2D3LA 4NNPH 1CL7I 2BNRD 2OMTB 1UH2A 2HT3D 5HI3D 1JN6A 5DD1L 2BY2A 1A6AA 4A7GF 4TLKA 3WY2A 5A1AA 1SXZA 2H0PA 4F20A 5EG6C 3GLZA 1ES0B 1E5UI 1JJUA 1Q9WA 4AMKH 1JZGA 3VYOA 4YOKA 4XNMB 1WRFA 4W9FC 3HIZA 4POYA 2UX7A 4PSPA 3SGKC 3UEZA 2CHXA 1G7PA 5EUKA 4ODWB 4Y9FA 5CO1A 2PCPA 4NQXB 4HXAL 3ZYZA 2VR9A 5TTRA 2V2TB 2VL5A 1AIFA 3UIZA 1WZ1H 4OCWH 3RUGB 2XWRA 2YXVA 3HFMH 3KGTA 4E41B 1X5MA 5SWQB 4P2RA 4L0ZA 1A3QA 1GYWA 1JGLL 4S2SA 4NOFA 1P4IH 5DK0A 3VXQA 3EYVB 1P4BH 3JV6B 1AIZA 3WNOA 3RFZC 1EERB 1BVNP 5I76B 3PIQB 2I27N 3QXWA 4MA3A 2O5ZL 3VD3A 1WA2X 4DP7X 1O75A 4BGDA 4XCYA 5HPMB 2WJ5A 1B0IA 3MV9A 1BEXA 2GTWB 1EEYA 5HVFB 4KHXL 4JG9A 1IFHL 5EIIA 3QZWA 4PUBH 1MY5A 4Y8AA 1YUKB 5L88L 1TYEB 2JKWA 5HDQH 3D69A 1FL3B 2WWOA 4WWKC 2BRQA 2FYVA 4XO4A 1FORH 3ARFB 5IHZA 2BY3A 2VL4A 4M62L 4Y16A 4G80A 3KPSB 4XX1E 4DPCX 1X6LA 2QVFB 2DH2A 5SWZB 5GSVB 3T6ZA 4C8XA 5G4NA 4JPKL 1MFAH 1T2JA 1EEUA 1N5AB 2YAEA 4WJ5A 1BZ8A 2Z6FA 5HVHB 5ILTH 4JL2A 3OKLA 2XSKA 4AL8L 1HFUA 4LOFA 3F7KA 5EOCH 2KH2B 3M1BB 3EOAA 3K1DA 4P2CG 3QI9B 2A2QT 5L4MA 3DVNA 4FFZL 5EF0A 4Y4HA 3NRPA 4BQ8A 4YBLC 1DDHA 4NYLA 1XXFC 2DBJA 2JQAA 1VFMA 2PYEA 3P9MB 4DP0X 5J06A 1U3HD 4HKZB 3L13A 2BIPA 1NOLA 3BP6B 1LO4H 1T1WB 4LHUG 4PB0L 4YFLF 1OB0A 3MKGA 3TLRA 4EXKA 1JTOA 4S1DD 1UZ6F 5DJAA 3ZRCC 2ZOKA 5JORA 1RUPL 4C4KO 3AS0A 2ZJSH 4IBZA 4W93A 2F15A 1JXJA 3BKJH 4D2NA 2X2UA 4NQCB 5KVDL 3NIDB 1NGXB 2XHNA 3UEQA 3WFBH 1J88A 4KH2A 5CZVH 1WBZB 4BH7A 5C3IA 3M6DA 4DVRL 4NRZB 4KMTL 5EUOE 2OBGA 2B9BA 3QB7C 3KBPA 4FQXD 1FAIH 1XGTB 4ZAKC 5IMLB 3OHMB 1W0YT 3VMPA 3OV6A 3OKEA 2I9LA 4G1MA 4NRYB 3BZEB 1U6AL 2HT4D 1AZNA 5IVZA 4ZW7A 1CLYH 2OJEA 3NK3A 2NY2D 2WVVB 4ZJ9A 3QJXA 4WSKA 3IETA 5E1AB 4BDVA 3SE6A 5JNYA 1F18A 5DC0A 3HZMA 4JE0A 1UM5L 2ZUWA 3GMNA 4HCRL 1EZUA 5FK9B 4GXFA 1SVZA 3QC6X 4HS8H 5D7SL 2W65B 5T3XH 2GJZB 2LR4A 4AYSA 2WGNB 3NCFB 5ENWB 2WBJD 1J7VR 1L0PA 5BNXD 4MMXB 1IJNA 1MHPH 4R96A 4EVNB 4PGEA 3TVMD 5EZOH 3DVGA 1OKEA 5FYKE 2G0KA 5K59E 3FN0H 4TUJA 2AXFA 1K6QL 4JUSA 4E9YA 2QKIB 1IKNC 4G70B 3GM8A 4CADA 5LQBH 3WNMA 1XIWD 3DRQB 5G5DA 5DWPA 1Y18A 3OZ9L 2ZCKL 4IRSD 4P2RE 4WO4A 1MUJA 4E68A 3ARGD 1JXFA 4ABQA 3GGWB 5E94B 5DUBB 1E5BA 2I7OA 4TS6A 2PP9A 2X1QA 1A3LL 5JPMC 5JDJA 1H5BA 1KACB 4KVCL 4ZXBD 1Y1DA 4JG5A 4JUTA 4QT5A 3D18B 4XVSL 2ENYA 3A67L 5AB2A 1YMMD 1OLLA 3L4UA 5CUSH 1L9QA 4NSKB 1D5ZB 4NUGH 4MA7H 3MV9E 1OCZB 3MI6A 4Z7UF 5AAPA 1U8IB 4NENA 2JF1A 2WQUA 2XPZA 1V7NH 1Q94B 2YUVA 3GBNH 4FFYA 4X5XB 3WLWC 4URKA 2YGVA 1KIUB 2F6AA 3AITA 1RKRA 3T0WA 3QDJB 1SNRA 1QQDB 2DQUL 4ZUWA 3TPKA 1ADQH 2J1KA 3QPXH 3FCUB 1U8NA 5LB1A 3W11C 2AGJL 1MCDA 4M6NH 1OGAE 2DYPD 2IWKA 2V9QA 4LARL 2VISB 2VLLA 3B83A 2PCXA 2XZCH 4UTAL 3KYMB 1KYAA 3WKMH 5CINL 1DLHA 1P7QA 3T4AC 4E9TA 4AK1A 2X2IA 2Z1KA 4RGOL 3IT8D 5L8KB 2GJJA 3MA9H 1RIVL 3B1UA 1T5WA 1DUZB 2J8UF 4NO0A 5EOTA 5FGSA 3LIZH 1E2WA 2WTRA 1IZKA 4TMPA 1DBAL 3JTSB 4FTVB 4MX7A 1UJTA 3P2BA 1CD1A 4GAAA 4K3HA 4QJ4B 1GL4B 1GHFH 1MLCA 3U7AA 1UKSA 1RQ5A 1M3JA 2PYEE 3TYGH 1TVBB 1T7ZA 4OF8A 3RVTD 5DHDA 3GB7A 2CCVA 1XF5A 3TA3D 4U1JB 4CGUB 4CW1A 1GZHC 5F7KC 3GMRA 2IMMA 1OTSC 1UVQA 3Q6FB 1KN2H 4QRRA 3RL1B 4F33A 3FU5A 5EPMA 2CJTA 5F1KC 2MCMA 4UTBL 4XAKD 2X6BA 1NMBL 3V4VL 3QQ4B 1BX2B 3CBJB 3GIZL 1UG9A 5T1DL 4RQQA 3LSOB 4Y2DA 3Q2WA 3W82A 3RA7L 3GC3A 3HMWH 5IVOA 4JO1H 3RP1A 5DHXB 4UDTB 2ZWNA 2MKWA 4L8SC 2MTPA 4NO5A 4AQ8C 3HPJA 1KCBA 4XVTL 1P2CB 5EBWB 1TFHA 4HA1A 5LBGA 2NNAA 3GKWL 4JKLA 1U92B 3S37H 1PDKB 4GMTL 4PU2A 1K2DA 1BP3B 1CXLA 4F2EA 5HYIA 1A1OA 1JGDB 4Y0GA 4MKMA 1IAIL 2VLRA 2QPFA 3NZUA 5FFLA 3N44F 4N2HA 4JHZA 2F19L 1HZHH 1JUFB 3FT9A 3MJ9L 3LV3B 2LU5A 2V0AA 4F57L 3OHXA 1OGTA 4ECNA 3O6FB 2P26A 5GQBA 3P40A 5DD5L 5I18L 5ICZB 1HEHC 3CUPA 1SMDA 3QAZC 2HRHA 4IDLA 5H2BB 1PZUB 2GW5A 3QG6B 4POZD 4AQEB 1NUFA 4DGVL 2WZAA 4P2AA 1I85C 2VLME 1VENA 2YGPA 5GS1B 3BE1H 2E46A 1FNSH 1NSNL 5F7FA 5DC2A 5GSRA 5T1KD 3O3EB 4CGTA 1WD9A 3S5ZA 3BFWA 2ATPB 3L5JA 3QFDB 1CC3A 3EBAA 5IOPA 2FJGB 2V5SA 2PW1B 5JHDA 3RQ3A 1H3XA 1HQRB 1BZ9A 4DQOL 1G6RA 5LJYH 1UADC 3HCVA 2FWOB 1DQIA 4WUUB 4B0MM 1DYZA 4NDMB 2P8MB 1EMTL 3QISA 4MMYB 3DSNB 2WLMA 5LAXB 1JZJA 3LKQB 2XBZA 1U8PB 2VR4A 4GFXA 1HXMB 5D93B 2NY3D 4U3SA 3GJEB 3RIKA 2JVUA 2E4TA 1X7SA 3FW6A 4I0PA 5SX5K 3MO1A 2E9BA 4NN7C 1WH0A 4O5LL 3RWHA 4AT6B 4WFED 4XP4L 2V2XA 1A66A 4MSWB 1FNEA 3K6IA 2Z91B 5HHOB 5GGRB 4JPIA 3GTTA 3RY5A 4EUPA 3CC1A 3SGEH 1CXHA 2Y06H 1ERNA 3CHOA 1CD8A 4G6AC 1OPGL 2H0JA 4MA8H 5DO2D 1NGWA 3MACH 4N0FB 5C8JB 3TJEH 3PWUA 4JEGB 1IGCL 2QQNH 4OIBA 4U1MA 1KJMA 3FQNB 4QRRE 1Q9KB 3RNKA 3F58L 3FB6B 3S36X 4GBXB 2YKKA 3GRWA 4YE4H 5DHYA 2P8PA 2CG9X 1R9FA 3WO3B 3EDDA 1JL8A 5CM1A 2NY7H 4PH8A 3QNYA 1G7LA 4MMZA 4X4ZA 5TDNA 4F2MB 3UPRA 4ZMOA 2GJ6A 1XAKA 1BJ1J 3H9SA 3QP3A 2JJSC 3S0PA 4O4YL 2CPCA 2J5WA 4X9FA 2YEQA 3QAQA 2VLJD 3L16A 2Q8AL 3T4YB 3U30B 5J12B 5LXVA 2PMZA 4AQ1A 4XNZC 2J71A 1AXTL 1CGYA 3WSQH 3WMPA 4RWYL 3LNGA 1KNOA 4FCHA 2WXLA 1F8TL 4XVUC 3WYRA 4M5ZL 1JPEA 2QADD 3N41F 1I31A 5JIHA 3ARBD 4WCYL 2MQ0A 4HIEB 1X5IA 1S9WB 3BPNB 1EXHA 1C5BH 2P5WB 1CFBA 3MFGB 4HGKC 1NANI 3BWAB 4G9FA 4TULH 4FQIH 4NQDA 3TFKC 4EN3D 4HWBA 3OKKA 4OZ4B 3VGFA 5CD3B 2X1PA 3KL5A 3MLYL 4HH9A 5BRPA 3MRMB 4TV3A 4FP8H 2YPLB 4Y9BA 2AMGA 2R56H 1MCLA 3N9GH 5KYYB 2DDQH 1CBJA 5CBEA 3KDPB 3EYOA 1E5ZA 2Y5QA 4PEEA 2MJWA 4JPSA 3HR5A 1B2WL 4PV8A 1QR1B 2AERT 3NYKA 1NGPH 4PLKD 5JUEL 2YPVL 4WDIB 2BNQA 2H3NB 5JHDE 3RX9A 4PJBA 5EBMA 2HX8A 3MNWB 4J2QA 5JLZB 4QLRA 4B9PA 3KZ8A 4Y2OB 4RSYA 3ROOA 1BD2E 2YHGA 1B0GA 3B2UD 4W9IC 5DYOA 3RFRA 1NCDL 2FR4A 2VO5A 1QW8A 1WIPA 2XVLA 1J8KA 4HKXA 3QUXC 4NC0B 2HH0H 4AYEC 2HKHH 3U4AA 3G9VA 1CE1L 2K8MA 4GT0A 4FHBD 4XX1G 5DQ9A 4OQ1A 5JZ7C 1WAEA 3V4PB 2MFNA 2E3VA 4RISH 3EDFA 1NOAA 4TVSa 1MFEL 5ITFB 4P57B 1MFNA 2A74C 4ZW5A 1KLFA 1E40A 3S2CA 3L5WA 3QQ3A 3B8YA 1YYLH 4U49A 1LK2B 5IF0B 1J8HB 1ECZA 5IQMA 4PJ5B 4AC2A 1FVCA 1F6AA 1T0NA 3NJXA 4MZIA 5BPPA 2WNKA 2APFA 4FHJA 1E4WL 1SF3A 3UJTL 3TESA 1HOEA 1D7FA 4R0LA 4HPOL 3QJHB 3FSAA 2EH8L 3CMOH 5AVVB 3BD4A 3CLFH 3QO1B 1YECL 2OSWA 4MYPA 4JDVA 3FQ1A 4UM9A 2HFFA 3M46A 5K5YA 1Z0MA 4XP5H 4LPUA 3HE7B 1KJ3H 3U6RB 1CK0L 2IF7A 1N6VA 3VQMA 4CJ1A 3VFSA 4D9QE 2AEIT 5FHAH 4QRQB 2BVUA 2AANA 2F5AL 4OJAA 4UTCA 5E4IA 2Z7UA 2WLIB 2BJMH 4G3YH 1RJLA 2AQNA 1EK3A 1R24A 2XI9A 2Z35B 3RWGB 1ULVA 2KDYA 2GJ6E 2VQ1A 4KFZC 4DKAA 1T0OA 5E2JA 4UNVA 5D1XA 2O5YL 5IZ7A 2BOBA 4MTMA 1ZLWK 1NIDA 3D2TA 1ZGLA 2CM6A 2AQPA 5HI5D 3DECA 1I3GH 1BG9A 4DH2A 3ZIYA 1JD9A 3FCSB 2WZ0A 4B95C 3QUGA 4MS6A 2OJZL 2QTEA 5AW2B 5BOPA 1JFQL 2ARJQ 4QYAA 4YBQD 3TCLB 3VSTA 1MVUA 3QS3A 4TNWK 3CVHB 1MJ8L 2Y0SA 1Q38A 1AY1L 5DCCA 1TIUA 1TO5A 4PJFB 3SPVB 3ECBA 4G9FE 1MKFA 4NQDE 4NS0A 3WEXA 1BPVA 1QABA 1UB6B 4GAGL 4XZUA 2F7RA 3K8LA 4TUKL 1FNLA 4OUUB 2VKWA 4AM0B 1TQWA 1GPOL 2AVGA 3DX2A 3CFCL 4EXPX 3R1GH 5JHLA 3DV4A 4JN1L 1A6PA 5CCJA 1ZT4B 1YLBB 3Q7JA 1MXDA 4HIJA 3D0LB 3LQMA 2Q6WB 1OP4A 4Z0BH 2QHRH 5GGTH 3BT2L 4K7PX 4OFYA 2WN2A 2R39A 4K2UH 1ODUA 2BP8A 1OTTD 3PF2A 3QZNA 4OCRL 4O2FB 1AGCA 1MCPL 4P3WA 9PCYA 2BNQE 5JDSB 1JK8B 5I0VA 1G0DA 3DO3A 1PZCA 4PJBE 9CGTA 3N50A 1A6UH 1V7ML 5EIIG 3VSQA 1JNHB 2ADIB 2F53B 3QZWG 4BRVA 4NKDA 4NKIL 5CJOH 5E6ID 4WJKB 3QGVA 2EDEA 2MKLC 5JOFB 5TPWH 4LLQB 1LDSA 4PRBB 3ENEA 2A7BA 4CU7A 1PZBA 2JIXB 5I1KH 1URIA 3OJMB 4UU9A 4HS6B 5IQOA 4RGND 5DTFB 2C1PB 3FSWA 1T3FA 4XBEH 5CEXB 5CJXA 4OCSH 2QTVA 1AO7B 1V3KA 4F8LA 4F24A 1TOXA 3VTTA 1RZKH 1AI1L 3BAIA 3O11A 4P23C 4WNQB 2TRYA 1UJ3C 3PAZA 4HLEA 4D8OA 5D7LB 5FEBA 5C0FA 2NY6C 1FO0L 2AMUA 4R8WH 3ULUH 3BN9C 4NFCA 4PCTA 2EDOA 1S6NA 3GUFA 3H9YA 2A73B 4GRWB 2XA8L 1HEJC 1UOWA 2LFEA 4I1RA 4KRNA 3KLAB 3OAUL 5F7LB 2ADJA 3I6KA 3K71B 2VO8A 2P52A 4KDVA 3C8KB 3GSWA 4LB8A 2D3JA 3L7FB 4BCZA 2ADFL 1WK0A 2IADB 3LN4A 3MOAH 3OSKA 4FXLA 4FXGB 5GIRA 3RX5A 3CPUA 5DYFA 1TZHB 4KZDH 4NRXA 3LHPH 5DUPL 2GK0A 4CA4A 4UB0L 1FPTH 5EFIA 5EIVA 3PQYD 2C3VB 3HVNA 3VSVA 4G11A 5KSVA 3QIWB 2MH4A 1HT6A 2F68X 4LNVA 3WHE1 4C56B 2R8SL 4HC1H 1ZGLM 3AC0A 1RK0B 1TTCA 5KBPA 2HFEB 3NRQA 5F6IC 2AJYH 3PG2A 3Q2NA 5D1XE 4RAVB 4AEHL 2R23B 3HC4H 5BZWB 5IHUH 3O2WL 1PEZA 5L2KB 3H85A 1EDHA 1NFDB 3HHSA 3NUKA 1UM6L 2J1YA 4K94H 3SPJA 1SN5A 5KYXA 3LH2L 2ZKMX 5CR1A 3ARUA 1Z0NA 3AS2A 5H94B 5DMGD 1BEYH 2CD0A 3OLIA 4XMZA 1RZQA 5CS7A 4GAJH 1J1PL 2EXTA 2YSSB 3GXMA 2ERJB 4N1HB 4YQXH 1QTYT 4XPFH 1DBKH 4BZYA 5AW5B 2WP3T 3B6SB 4GKLA 1XX9C 3GRGA 1YEHL 5J5EA 3DSFH 2Z31B 2YGQA 2V7HA 3PJLA 3CTTA 5F9DC 4F7TB 2UWEF 4KROB 1ROWA 4YBHA 1XGUB 3C9NA 5JO5B 5TE7L 4YR6A 3T65A 3WFDL 4E9VA 5F7DA 5F88B 1OANA 4TPRL 3P4MA 5D70L 2RIKA 2JKTM 3D2UA 3V95A 5IUCA 3MJ7B 3PWLA 2L7EA 1UT2A 4WI0A 2GTZA 4GUCA 1M1SA 5C6TH 1U8JA 4FJZA 4LP5A 4MCNA 4OKDA 4U7SA 1WFNA 3CN2A 1TQSA 4PJHA 4P46D 4ZAKD 4ZTOL 4L8DB 3T0BA 4YC2B 5C0AD 2CBPA 2NW2A 1HIMH 2XQBH 3ZE0B 4MCZB 3KDMA 3BP4A 3QYCA 3DROA 3LZPA 4N6RA 1H19A 1IC7L 1GYAA 1MRCH 3CHPA 1BQHA 4YSCA 4G82A 3V4PH 4FFVD 4DN3L 1KJ2L 5C08B 2PR4L 2PW2B 5D7IA 3V7AE 2WTPA 1UUSA 4YSPA 1T1YA 5ID1A 1DE4B 1RUQH 4PB9H 2ZWSA 5ABZA 1EA9C 4Z7WB 1FA4A 2V17L 1I9IL 3CLWA 3CJJA 4BE5A 2B2XH 2BVYA 3LRKA 3ZTCC 2EDBA 5J6HB 5MEOB 3DKHA 4XXWA 1XZ0B 5TH2B 4IKJA 3RPBA 4JVPA 5MEQB 1WZLA 3QUZC 4HK3J 2EIBA 1FJ1B 4XOCA 5MERA 3CH1A 1HHHA 3TEXA 3U4BL 3WL9A 4PRPB 4IOIB 1AHKA 4MJ4A 5DFTA 1I8MB 4OH2A 1UWEL 2BVEA 4P4RA 3ZHDA 4XT1C 2B59B 2BS9A 4YSSA 1UHVA 4CVWA 2DMCA 3AVEA 1JZ4A 1QRKA 1RFDH 3JWNC 3WFHB 4B6ZA 4ODBD 4XWOC 3EXLA 2NDGA 2X4OA 3ARDA 4FF9A 4U1GC 5JW4R 1W6WA 4MB5A 5DHVA 2EYSA 5CCGE 5DJ8A 1WEJH 1MFMA 1B6UA 3AG2B 3I3EA 3VG9B 4NT6B 1GKEA 2FEEI 1IKFL 3EBHA 4JGMA 4TM9A 5I74C 5E03A 2H32B 3V6OA 2HXAA 4PTTA 1MEXL 3LZRA 5KYWA 1AZCA 3UZEC 4PM1A 1ZXQA 5FM5M 4IGBD 4BH8B 1KYOJ 1TG8A 3UERA 2FEDC 2XIBA 1M56B 5A7BA 1P6FA 4N2OA 5EO0A 3CVHH 3TO2B 2GSGA 1E30A 3RAJL 1GAFH 2HT2D 4OD1L 1BFOA 5SV3A 2WPGA 2VLKB 5HHVL 3UTPE 4P4KB 5EEUA 4BSWA 4L37B 1EEZB 5ANMB 2VXSL 2WLNA 3T6QC 1YY8A 5F44A 4HJGB 3U79A 5GRJL 3HHMA 5IQ7L 4I3SL 4IK7A 4ZS6C 3MUJA 4A6YL 3BAEH 4LOUD 4D0CA 5MENA 1KBBA 4K3EH 4J3OC 1B88A 2BERA 4K5OA 4IHOB 2KZKA 3K74B 4N0YL 3MRDB 1OTSD 3TNNA 4G7SB 4DEWA 4K9EC 5CGTA 3X14B 2KBGA 2JB5L 3D6GA 4QKXB 4UMSA 4HZLA 4UANA 2K9FB 4FOMA 3NDYE 1SOQA 3U0TA 1CUOA 3RY6A 4E9LA 3TEZA 5I73B 4PJHE 4ZS7H 1ZV5A 4LSVL 3S4SB 2F7QA 5LGHL 5TGBA 1AZBA 1WV7T 1EUTA 2VITA 1WA1X 4JHBA 4D0BA 3FBQA 1MG3C 2XIDA 1GGIH 1IEAB 4M1CC 4HD9A 4L3EA 5C0EB 4J12A 5DD0H 3BGFC 5C0BD 1CZ8L 1RUKL 5D7IE 5HDBE 3MXVL 3BOVA 4ONFH 4ZUVB 3PGCA 5ETUA 1TJHH 1L3NA 3IRCA 2YMTA 5DI8A 3ZZSA 4RZKA 1HDMA 2XFGB 5FYLE 2F9BT 5DURD 1UQSA 4JY4A 3CZFB 2WANA 4MA1B 2FWLB 4WVRA 5I1GH 3IVKB 3GSOA 1WITA 3OKDA 2ZX9A 2H47C 1G7HA 2TRHA 4E9SA 3HA0A 1WLHA 4GSQA 5EU6A 5I1EL 3GFUA 2IXQB 4EUPG 4AYMC 2EIEA 3DX7B 3O2DA 1L9PA 2BFVH 5D2NC 2PXYC 5AAWC 1DVUA 2R2BB 3LPGA 1DQKA 2N1KA 4U6HB 4R7LA 1GYVA 4UV7H 1BMZA 1R3JB 1V27A 3I3BA 4MNQA 4YHMH 4QD2E 4XCNB 5E9DD 3MC0A 1QNZH 2KT6A 3CHRA 1WE5A 1D7CA 2NT1A 4P5MA 2HWZH 1IT9L 3SKJH 2A6KA 2IAMA 1XGYL 1Q1JH 3U36B 4R97B 4U1HA 3QRFM 3GMPB 1KCUL 2EDRA 2WOBA 1QWNA 2YK1H 3M7FB 1GRWA 2DIBA 4L8BA 2H2PD 2VH5L 4R7VA 4YLBA 3V6OE 5IMOB 3MRPB 1FZKB 4YSUA 5HVHC 1HEZB 4U1KB 1Z9OA 2GSMB 1JHKH 4XPBL 5D71L 3V0WH 1KGIA 4G5ZL 4HS3B 3ZK0A 2XG4A 3PL6B 4EBQL 4DZ8B 3FUFA 1FV1B 1PZDA 4B9JA 4WI8A 2NY4D 4KVNL 5IGXH 1S2EA 4KO7A 1WCBA 3E8UH 2FB4L 3MGTB 1QLRA 3N1PC 3US1A 1OF2B 4LCUB 4YK4C 5KBNC 3APCA 3P0VH 2AJVL 1DEEB 4JAMB 1ZLEA 3RWIA 3DIDA 3VWKA 3KR3L 2FD6L 4V33A 1RZFH 1ZRUA 4K55A 5MENE 1MNNA 4G8GA 3L3JA 3DX8B 3ZU8A 5D2LA 4MNGB 2H1PL 3KPPA 4Q6IC 4ANXA 2WWMD 1MQ8A 3KWXA 4PHXA 2HG5B 4WI9A 5KVFH 1OP3K 2G3MA 3IMBA 1M05B 2JQMA 1V8HA 3O9WA 2IH3A 5AOLA 5GZNA 2B4CH 1UASA 3BPOB 3W38A 4UBDC 5T5FH 1D5XA 5I5IA 4JDTL 1EFXB 3D4GA 4HCIA 4H2AA 4C58B 5I30L 2XV6B 3V52L 3JWDL 3L5XH 3D3VA 4Q2ZB 2G60L 5L6YL 4J4PA 5JQ6L 4Z3HA 4D8PB 2VDQL 4CMMB 1CDYA 1KEGL 3SE4A 4NBYB 3IMTA 4QYOB 1DFBL 4DEUA 4K23H 3MLWH 4LSDA 3EFOB 1RIHL 1BYNA 1CG9B 3NOIA 1S7UA 4NAJA 3T3PE 5JR1H 1N70A 5DD6A 5K9JL 2OK0H 4HEMA 1JI2A 4CL7A 1I1YB 1CGSL 4L3EE 4JG1L 5GISH 4LLVB 3F00A 2R0ZL 2MOVA 5JXEC 1M57B 2FE0A 5KSUB 1R75A 4XVUD 4L9LB 2Q3XA 1T7VA 2FCBA 1MZYA 4M3JA 1UM4H 1IGYB 1U33A 3UBXI 3S96A 1HSAA 4FEMA 4JKWA 2OX5B 5IM7B 3N06B 1CFVL 1TJIH 4AYGA 3TFKD 4XHQA 1T03L 2DQTH 2VR6A 2XACC 5IW1B 4OFQA 5LN4A 1AXSA 1CDUA 3LRMA 4IIZA 5EU6E 3QEHB 1ZEAL 3EBGA 1WBYB 2A9NL 4PJGB 1T4KA 1A6AB 3BUPA 1A4KB 4MAYD 3MV7A 4KI5E 4JFZL 3SIKA 3NSDA 3MV8A 1Q9WB 2YKLL 1OARL 5GJSH 4MNQE 4UUJA 3P9LB 2CHWA 2E74C 2X53A 4ONOA 4P9MH 5EUKB 2UY7A 2WQSA 2FQDA 2ZXBA 3BQUB 5C09A 3Q5YA 3EGXA 5ACZB 2H32H 2B3IA 1JHTA 4LRIA 2VL5B 1AIFB 5E8NB 4XCEA 2CLVA 1PZAA 4Z3IA 1BBDL 3VX1A 2FZ3A 4BINA 4S2SB 5L4FA 3SE8L 1BZ7A 1LGVA 1Q9OB 4WUKL 2QELA 4OZFA 2ALAA 4TRPL 1SZNA 4NXSA 3VXQB 1SY6A 3I9GL 4WI2A 1YEFL 4PY7B 2E7CA 2P43B 3IFNL 4G6ML 2JKJA 5F9JA 4PTUA 3N42F 2Y7NA 5IBTH 2L04A 1KN4H 3MV9B 4QRSB 4XC3H 4CVUA 3H6JA 4FC3E 4C83A 1EEYB 1HKFA 1ND0A 5EB9A 2XKUA 4J3OF 2WQXA 4OGZA 4KJPD 2R1XA 1CDJA 2FGWH 4Y9CA 4WHDA 2BIQA 5LBSL 4DVBB 5HYJD 5E51A 1INEH 1ZWIA 1GIGH 5IHZB 2O5XH 3ULVC 5I9QB 4Y16B 1OGAB 4G80B 1J0KA 2FHFA 4G8GE 3MRNA 4LP4A 1O9WA 4I3RL 1R3KA 1NBVH 1BZQK 4PVMA 3UC2A 4ZK8A 2AK4D 5DMYA 4P2QE 1KTLA 2BY1A 3SB3A 3F5WA 3UGUA 1QSZA 1T89C 4IU3A 1CLVA 3WXWH 2A6JB 2XWJB 3D3VE 5HI4C 1JNLL 3WI9A 2LLLA 1UKQA 3L3IA 4R2GC 1ZHBB 2HTLC 2OYMA 3C6LB 2F58H 4CBZA 1DDHB 2WUBL 4NYLB 3MLXL 5FC9A 1FSKB 3BFOA 3ERXA 2BDNH 1KXVA 3O0RH 4QLWA 1KT2A 3MOBH 5JPNC 2DICA 2DLHA 5EU7C 1UA6H 4HEME 5DJAB 3CFTA 3E9UA 5JORB 3DV6B 1MDAA 4XZ4A 1GC1H 4P5TA 3KPNB 1BVLB 2WXGA 3WN5A 3C60C 3V7AG 2XN9A 1LDPL 3HG1D 4CUCA 5HJ3A 5HD8C 3N85H 3KPQA 3IWVA 4B9IA 1R33A 5EZIL 4AGQA 2EVJA 5AW0B 1JBJA 3TN0D 1SDDA 2YWYA 1M1XA 3VFMA 2WMPA 3NCYS 3STBA 3DO4A 2FT7A 2WZ5A 2DD8L 3OKEB 4KX8A 1VACB 2I9LB 1TQTA 3BJLA 3WIIL 1LP9B 2JJTC 4Z7NE 3EHBB 1G1KA 2OJEB 4M5SA 1F3DJ 5B1AB 5HGAA 1TEGA 1SEBA 3C5ZC 1T0MA 5DVOA 5GS1C 2QVIA 5FO9A 3P54A 4BDVB 1DCLA 2O26U 3IETB 3RI5K 2QVKA 2WKLA 4LSPH 4Y5XC 1AQ8A 5I15L 4PRHE 2WLZA 32C2B 1RUMH 2WINA 1BM3L 3TV3L 4AYDC 3MV7E 1ZLVK 2PPFA 3G6AA 7TAAA 1WD8A 3QUMA 3MV8E 5GXBB 1MG2C 4FQJH 4UIKH 3ZQWA 5I1DB 3ZKMD 3BAYA 4R96B 3DOHA 4PGEB 3A4DA 3DVGB 3FRPA 3L3DB 5C09E 2FUQA 2NT0A 1XT5A 2C3GA 3K80A 2AJUL 2A9MH 2XIIA 4GS7B 5I8KL 3VCLB 1GTFA 1Z3GH 4TUJB 2R0WL 4M6AA 1S7XA 1FZMB 4O02A 1XSKA 3QORD 5IVXB 1AGEB 5G5DB 1FVEB 1RXLA 3S5LB 4JFED 1AQKL 4WO4B 4Y4FB 3B9KD 4YH6A 5D93C 4WU7B 1LO0L 1S9VB 3EYQD 1DN0A 1QSVA 2PABA 3O6LH 2G5RA 1AANA 2VDKL 4ZTPL 4YLCA 4G72B 1RLBA 1HKLH 3HG4A 2GUOA 4P23D 3ZDWA 2EE3A 5DRNB 4BGLA 4N2CA 4NZJA 2I60L 2E59A 2NY6D 1TQBC 1IC4L 1I9RH 2A6DA 3NIDF 3VRIA 3VDBA 1S7QB 4MQXC 3IF1A 5GS0H 5IJVA 1BLNB 3H3KA 1DCEA 4JM2A 4U1SB 1N3NA 1WTLA 3D0VB 4U3CA 1BFTA 1WWWX 4HWZB 5D1QA 4LU5L 5KJRH 2GY5A 4UOQA 4RX4A 1OOAA 1E5YA 5FO2A 3UROR 1NKRA 3BIKA 4GP5B 5DFAA 1FFTB 1Q0XL 2JWYA 4XMPL 1QBMH 3BLBA 1VRSA 1P7QB 2P8LA 4Z0XB 4I18C 2ZKHH 3ROLA 2O6DA 3NSXA 4G8IA 3KGSA 4Y19B 4R5XA 3G5YA 1A7NL 1NFIB 5B22A 3QH3B 3WFCL 3V0FA 3AAZA 4G6FD 1RHHA 4KRPB 5DGRA 1NDGB 2OPCA 5CLYA 2VSKB 1JDAA 3S9DB 4OLXL 5IY5B 5KVGL 5T1MB 2ESVD 1T6WA 4G7RB 1K8DA 5DQJA 5FA3B 4YPJA 4UAHA 3X1NA 3MRIB 3GB7B 4ICXA 3D09A 2KYIA 3QYMA 1UVQB 1BQHG 3N43B 4KTDL 2LU3A 5EPMB 2MCPH 5CEZH 3HPLA 3SDAC 2XN9E 5DA0B 1T7XA 2ZCLH 5FGBA 4BZ2H 1S4IA 4F15C 1E9PB 1EX0A 4XGZA 1TETL 5IBLC 5A2BA 1MNUH 1X4ZA 1ZKAA 1QTSA 3QFGA 4KK6D 4Y2DB 2Y4SA 3G5XB 4M8RA 4QWWC 4KGJA 3ZKXB 4DHLA 4OCYH 2N01B 3Q5TA 3W39A 4MJ6B 1UZ6E 3KJ6H 4NO5B 5KSAB 1NGYA 4O9HL 2BIMA 1IQDA 3HPJB 1S7WB 1J5HA 1VEPA 1OAQL 5GRXG 2BP0A 1GGCH 1J5OL 2VDMB 1RULH 1UH3A 2HKAA 3HE6A 3BD3A 4WWPA 2DIEA 2HJKA 1K2DB 4HIHA 5FYKH 3TBSB 4PY8J 4WTXA 5DFWH 2MSPA 5MEPA 6FABH 2ICWB 2F7PA 5DHEA 3DX9B 3IDNB 1NL0L 4OD3L 1OGTB 2C9AA 3HI6L 4QO1B 1PLGL 3BUBA 4J23A 1JERA 2DQGL 1U8KA 3ECVA 5EBGA 3MYZA 1F4XL 4N22A 3SGKA 4FI8A 4MB1A 3UDWC 2IDFA 4YMPA 3CUPB 4RDQF 4E42A 3WIHL 4S11A 4PJDA 1MFDH 3M1CA 2OMXA 2OJ1A 3BWUC 3PDOA 2R29A 1IC0A 1BQKA 2EAEA 3S35L 4DK6A 1KXHA 5T3XD 1IGIL 1YJDC 3BD5A 5CD5D 5GSRB 1U21A 1IM9A 4M6OH 5KBMA 4BFGA 2GEQA 12E8L 4ZBJA 3VI4A 2A9BA 3L95B 4OCMC 3LZOA 2C8NA 3VXUB 5JHDB 4S1QL 3ZE1F 3ULVF 3US9A 5F7YC 3IDUA 3ZTEA 3B5HA 1IARB 1BD2B 3WLBB 4X5WA 3BAKA 5LCVL 2DLEA 1RZ7L 1IAII 2J1ZA 1EGJA 5D1QE 1WUNT 25C8H 3DRTB 5FXCH 1NMAL 3GSXA 5I6OA 3R18A 3GBDA 4WWKA 4N8CL 4U3SB 3ALPA 2XZAH 5C07B 3KWUA 2O6FA 4C55A 1VFAB 2XKNB 3TIDA 4OQTL 3CBRA 4Q0XH 4I0PB 5KSBA 3EJZD 5D7KE 2IOIA 3MO1B 3TYFA 4DO4A 3C12A 1W80A 2K8QA 2RHEA 3PREA 3RWHB 3VFTA 1AKJB 1XCTA 3CX5K 3RDTA 1W16A 3L4CA 4CC4C 3GO1L 4JPIB 3B2VH 5K1JA 3SKMA 3WHXA 1AG6A 2D7NA 3G6DH 1QA9A 3V9CA 5LDUA 2NUTA 3RTQD 1YNLL 3EW3B 3MNVB 3Q2LA 1NGWB 4G8EA 1TYRA 3PGFH 2XBDA 1EXUB 2Y69B 3MQIA 4IOFD 4ONHA 3RNKB 4MHHI 3OKOB 3WG7B 3V5HA 3NVQA 2Z93B 1F02I 2YOCA 3MJWA 2P8PB 3GT6A 4EI0A 1BOYA 2OZ4L 5A6LA 3LQAH 1L4IA 4JFHE 1FH5L 3GJFA 2YO3A 4KDTC 2Z4TA 5TDNB 2NY0D 4PRID 2DWYA 5GPRA 4ESKA 1PIFA 3WTSA 1MY7A 1PY0A 4YS4A 4FRWA 2W38A 2YMXL 3IDMA 3NCEB 4HKBA 1BQSA 3M1OA 3MUUA 2OL3A 2WBXA 3OX8B 1S9KC 3OKYA 4EQ2A 4KC3B 1AHWC 3CFEB 4UI2A 3MODH 5DJDA 3UP1A 1HL8A 4FQ2H 4E9QA 2FJHA 3LH8A 2W9EH 4Y2NA 1DVFB 5C6WH 3PWNA 2R4SH 4YSAA 1GGYA 4KY1H 4FABH 2AEPL 1N5YL 4NKOA 2E7LA 1FCCA 1KC5L 4ORGB 5AUMA 1EPFA 4MD0A 1YYMH 1C08A 3U0PA 3X13B 4G9FB 5IQ9B 3O6KH 4FLOA 1DUYA 4NQDB 3WHE0 3OQRA 4PP2B 3MUY1 4DETA 3C87A 1SQ2N 2V9TA 3ZE2E 3QJZA 1QVOB 1UCBL 2HJFA 4HH9B 2CCLA 4WU5B 5GRVK 5F2FA 4EI5B 3MROA 1G94A 1GOHA 1HL5A 2AKRA 1NDTA 5K93A 1D6VL 5E1IA 1Q72H 4LSQL 4PJDE 1UWGH 2IG2H 4GW5B 4NN6B 5GJTL 2I9TA 1IKNA 3UAJD 2AW2A 3OR7B 4MNHA 2VQUA 2BW4A 1A21A 1NAMB 3ULUF 3FSOA 2BRRL 1RUAH 3X3FL 1MI5B 1U8MA 3HR5B 4FFYH 1OZUA 3D7PA 1F2QA 4AI7A 4R4NC 3VI4E 3U0WH 1W0WA 4E41D 3A21A 2BNQB 3FUNA 1AG0A 2NNFA 3O81A 1DN2A 4HBQA 4PJBB 4EN2A 3AQDA 4RMTA 2DI9A 4OLVL 5H8DA 1A7QH 1G7JA 4BSVA 3ROOB 2V3EA 3EO1B 3MRLA 3P9WB 4FYQA 4ORZC 4LT7A 3U46B 2HVBA 1GZPA 3ZDXF 2FR4B 1NLBH 5I66B 1RZJC 3GMQA 4FFWC 1TKWA 2EXWD 2JCCF 3A0OA 4PJEF 5DD3H 5IP4A 3FB7A 4JG0H 2PXYD 1YAZA 2OV0A 4NLAA 1QLEL 5DQ9B 1KBPA 1MHHA 3ATBA 1NUGA 1D5MB 4QXTA 3BPLC 3HZYA 2ZE0A 2VABA 1TTUA 2AABH 1AGBB 2PO6C 2ZCHH 4KNTA 4U1LA 5FR3A 4PW4A 2CO7A 5KSBE 1BV8A 2NMSA 1TLKA 5KTEL 1I1AA 4JZJA 1KZQA 1RJZA 1KLFB 2X89A 4HUWB 3L5WB 3WE6A 3QQ3B 3ARFD 2P4AB 3QIBB 4XPTL 4YXLL 2CRYA 5T1LD 5E2WH 4Z76A 4KUZL 3NZHL 1FVCB 1F6AB 1T0NB 5SWZD 3LKOB 4FA7B 5DLML 4YL4A 4OD2B 2ID5A 1FGVH 4LCIL 4XR8C 3SKNA 2ENJA 1MWOA 4QTIL 3QJOA 1X44A 1CQKA 3FO2B 3AM8A 1P5UA 4LSUL 5LVEA 3QQDB 4OKVA 4WK2B 1OAUH 4LAQH 2VUYA 4YSQA 3ABLB 4U1IA 4PWHA 2C9VA 4UM9B 3QI9D 2EO7A 2VN4A 3OGOE 4IEFB 4PUBL 2QMJA 3DHJA 1S7VA 4L4TA 3HN3A 3VFSB 3K8KA 2W8CA 1E2VA 3G9AB 3AT9A 1DTUA 3MHZA 1DVXA 1D9KB 1MCNA 3MOQA 3MUGB 3VA2C 4TTDC 3V0VB 2B1OA 2DYSB 1IIKA 4FERA 1NJ9A 2AJXL 2G3XA 1GGTA 1KF9B 2HVKB 4HLZG 5T33H 4DP6X 3GMOA 4NQCD 5GHWL 5CFHA 4DKEH 1X9QA 4KXZH 1WPCA 3PNWA 3UG4A 1SOXA 1O7VA 3CFUA 2DRUA 1D5BA 2WQWA 3S88L 4LASL 2YLHA 3OWEA 4ZMTA 1QEWA 3DGGB 1ITBB 3LMJH 5FS5A 1DJGA 1XB6A 2XJKA 1ZJAA 2GJRA 1LTXA 1OW0A 4UBDD 4F8TA 1W72A 1SOSA 4Y4KB 3TJHC 5BS0A 3CHQA 4BA8A 4GW4A 5DSCA 2IWEA 3ECBB 3GXFA 4X6CB 3BWUF 4LEOB 5DZNA 1ED3A 2ZOTA 5KEZA 5EOQH 2EINB 1FN4A 4V11A 3BSHA 3FAXA 4P06A 3SCMA 3JWOL 2RQEA 1BVZA 3DV4B 4AE0A 4PP1D 1FZOB 2QDWA 4GSDL 4OZFG 3QR2A 2NUPB 1A22B 4JM4H 1N6QH 3QJVB 1BVOA 4DOHE 1P1ZB 4G6KL 3FJTA 1TQUA 3THML 4ADGA 5EH1A 1GYUA 4BUQA 1AGCB 1QW9A 1I85A 2VC2B 1JYWA 2Q8BH 3PAUA 4TQPA 3VWJB 3G04A 5DS8A 1KPRB 2XWZA 3H3PH 4JO3L 4NNPL 3L5HA 1U8QB 1H15A 4JLRA 1ETJA 2C3WA 3A6CH 4AMKL 3AREC 1A9BA 2D7OA 2IH8A 4UU9B 4I77L 4LDOB 3GHPA 1HXYA 1T3FB 5D4JA 2Y3NA 3MBEC 1KXTA 1U2CA 3P4NB 3RZWA 4KZCA 2C4FU 4OCWL 4TF4A 3HFML 4DO5A 2WYZA 1A4BA 4APXA 4C4UA 5C0FB 4QRAA 5HHQB 3WFZA 4Z95L 4Y5VC 2VN7A 4O2CB 3T6VA 5PCYA 3INUH 1P4IL 3L7EA 4EDWH 1NMCC 3FH8A 3RWJB 1JPGA 1P4BL 2BFGA 4WEMB 3IAQA 2Q7YB 3I6KB 1X9RA 3P30H 4TUUA 2MOGA 2V2WA 3L9BA 4FMVA 3FU6A 3MRHB 3GSWB 1C12A 1THAA 2UX6A 4JKMA 2WVSA 4GKNB 2FSDA 2VZ3A 1SMOA 4RDBA 5GIRB 3LN4B 4W9JC 1I9EA 2FJSA 1NM4A 4ZSOA 1O5PA 3CSGA 3WE1A 4NGHL 4FTVD 5EFIB 3WS6C 2LVEA 4P9HC 1KLUA 5HDQL 4OZGF 3SQBB 3FQWB 5IVNA 4L4TE 3N5AA 2DQ6A 1J1OH 3JQOB 1EWHA 2N7SA 1KJVA 1I7TA 1JNNL 1P5VA 3HG2A 4M7ZB 2NYYD 2WP3O 2XTJC 3NG5A 3BVWA 2R9HC 2DMKA 2WKGA 4MAZA 5ILTL 2YEZB 1BVKA 2CGRH 2G5UA 5IQNA 5EOCL 2QJDA 5F0LB 1HINL 1IGTB 3BUDA 5I1JL 3C6SB 3EO9H 5LGJB 1QHOA 2F5BL 3V0HA 5J9PA 5KBLA 2SODB 5AW9B 1CFTA 1LLAA 3FUJA 4F1SA 2DL2A 1T22B 1VADB 2RMNA 5BS0E 3FRPG 4X8JA 1LO4L 3DHMA 4H8WC 4U4IA 5C9KA 5E23A 4LCCB 3T3ME 2DQJH 1VGKB 1N8OE 2J88L 5C0RH 4GQZA 4PGBB 4F37F 1YO4A 1XF1A 3BKJL 1DVSA 3BUYA 3GD1C 1NAMH 3T2NL 1YEJL 3I75A 1YUHB 3RIAF 5ES4B 4H0LC 3WFBL 3C9NB 3T65B 5CZVL 4YR6B 5JHAA 1LQSR 3AABA 5E0FA 2CHNA 5F7DB 3IXTA 5AZEH 3MGOB 4FCAA 3P4MB 2ZX8A 5AD0A 3D2UB 1FAIL 2Z7YA 4KQ3H 2MWCA 3FQ4A 3PWLB 4N5UA 5E8PA 4OUOA 3O6FD 1U8JB 1K5NA 3NSYA 2AQ2A 2N7AA 5CSZA 4UTAA 1EUUA 1CLYL 1AE6H 4HCFA 1KOAA 1UEYA 3ZJAA 3HN5A 3NJVA 2J8OA 2NW3A 3OJDA 4U6YA 4LVHB 2XWXA 5FKAA 2FJFA 1FHNA 3ILPB 1CFMA 3A6BH 3QHTC 4OGQC 3KVDD 1TTBA 2CGYA 5E6YA 2KMWA 3I85A 1OM9A 4AJYV 5D7IB 4B9CA 5HDBB 3SDXF 2EE9A 4ZMVA 3PYCA 2OMYB 2VW4A 3EO0A 5BRQA 3GIVB 1PU0A 2PR9A 3KPOA 4X50A 3RWEB 2Y6SC 5LQBL 4WUUD 4F9PC 3IAGC 2PYFA 5AVYB 4P99A 1E4HA 1PD0A 5FF6A 4OIIH 4ES8A 2CJUH 3KPRA 4AW7A 4M43L 5T1JA 4WI6A 2VR3A 1L0XA 3QJUB 4UTBA 3VGHA 4OGYL 3V4VA 1B9ZA 5B8CC 2R15A 1WIUA 4N8UA 5HYSB 4XX5A 1F97A 3BVDB 1K4DA 5KBKA 4MA7L 3EGSB 1UATA 4BV1A 3N3EA 1DJIA 2J73A 2X4OB 2YD4A 3GBNL 4RH4A 4ZSOE 3KM2A 5FDYA 5ICUA 3UTZA 5FFGA 5DHVB 2EIKB 4ONGH 1ADQL 3GSRA 1C5CL 2VZUA 1A7PL 4FXKB 3ULUD 5I19H 2VAAB 1G9NH 1SHMA 3T77A 5J11B 1HHIA 3SKOA 3TBYA 5CLWA 2K4WA 1JGIA 1BHGA 4KHTH 1A0QH 3WKPA 3PHQA 2XZCL 4Z7OF 5JW5B 2ZWYA 3WKML 2VN6A 3MJ9A 2Y22A 1XF3A 3H7LA 5AAMA 4DWHA 3W5MA 5DVMA 3ZE0F 4PJCF 2GSGB 3GI8H 2E76C 4PLJC 2ZF8A 2KQNA 1XR8A 2LU7A 3SE9L 4FNSA 1JGVH 1RP9A 2CKBB 2VDOB 5DJ6B 1GHFL 1J5IA 4QNPE 3ABKB 4NM4H 1KMGA 4ZOBA 3U7WL 3TYGL 3VXOA 3K81A 3ZDZE 4OFDA 1EJOL 1D7BA 3NABL 3PWJA 3J7HA 5SWSB 2E9GA 4H2CA 2BSSA 4Y88A 1ZE3H 5KJ4A 2PWEA 2IC2A 2W9DH 4XNUH 2FIKA 5I5JA 4BE6A 1ET8A 5MENB 3UPCA 1XWVA 3VAEA 4JK0D 1KN2L 4XXCC 1XF2B 1E6OH 1JAEA 1M53A 2GHWB 3AQYA 4OIFA 4M61B 3B9DA 1NBZB 3OF6D 2MRYA 4XAWL 3IJ8A 2VC2H 3B9VA 2D7TH 3CVIH 4OV5A 1F11A 3HZVB 4ZMQA 3UCRA 3HMWL 3U0TB 5IBLD 2HG0A 2B3RA 1B2YA 3SODB 5LDSA 3RIFK 3KEHA 2W0FA 2X70B 4MWFA 2D9QB 4QWWD 2VZVA 4WKZB 2YPLD 2Q7AA 1TZIA 3F64A 2KQMA 1A65A 2GBTA 2QDVA 2OR9L 3IDXL 4GSUA 3MLZH 4LEXH 5I1CH 2N59A 3S37L 4A2FA 1B4LA 4NQSA 4OF7A 4J6IA 4L3EB 2BSTA 1CICA 2ZNWA 2ED7A 1XIWB 4PRNA 4KX7A 3I9IA 1HZHL 1FGNL 2QV2A 1BMGA 5E4EC 4OF6A 3IYLW 4YDJA 5KS9A 4ZO7A 1UQSB 3BH9A 3MRFB 2YR3A 3NCYP 4ACPA 1JK9A 3GSOB 3NZ8B 4JFQA 4WW1B 1MHEA 5ERWB 5C3TA 1NCOA 4WV1B 1FHGA 1ORSA 1Q90A 3KPRE 3KYNA 3NFSH 1G7HB 5EO1A 4TYUA 2JK5B 3ZHKA 1J8SA 3AADB 4P59L 2ZSWB 3FTGA 3BE1L 2R0KH 3VD4A 1OALA 2N1TE 5E6ZA 2XPGB 2GYSA 4F7MA 3V8CA 3D33A 4IYKA 1YMHB 3K72B 4MNQB 4XTRC 2QEJA 4PS3A 3QUYA 2NLJA 2VXUH 1J8HD 1UXMA 4PJ5D 1UXLA 1Y1UA 1DJXA 1HOCA 1GCFA 3D39A 3NACH 1IAIM 1U93A 4UV4H 2ZAGA 3NIFB 1MCHA 2DLTA 4PR5A 4Z5RA 1JV2A 3RGVC 4Q97A 5IEHA 2A83A 1FFPA 5IESH 4UQ9A 3VXTA 1SBBA 2SEBA 4AYBA 3CFMA 2W5PA 3C2AL 2EKSA 1MHCB 1XB3A 3TNMA 1T2QH 3HE7D 2IANA 4XNQA 1QSFA 4D9RD 4ZMWA 3K2UH 3OR6A 4NWTL 2GEEA 2CO3A 4D7BA 3TCTA 2PWGA 3KL0A 4X8XA 4LLYB 3MA7A 4Y4HC 3VG0H 4RAHA 1JXGA 2OTUA 3ZDYE 3ABZA 3SBQA 1UH4A 3CSPA 3GRBA 3NJMA 4Q14A 2Y06L 3P3UA 3L2MA 1CF8L 2VXQA 4MA8L 2IQAA 5HYQB 3C5XA 3MACL 2O1AA 2QQNL 5CKAA 2YPVA 3L3JB 5G4MA 5IV2B 1XGQA 1QASA 1G43A 2NY1C 4HDIA 1NQBA 3F12B 4NNXB 3O9WB 5IB5A 2IH3B 3NGBC 5A43C 4P2QB 3LZFH 1D5XB 4FJ6A 3VI3B 2NY7L 1OY3B 1GSKA 5DEFB 4K7FB 3D3VB 3T08A 3O4OC 4FLRA 4HUUA 2Y07H 4OW6A 3LD8B 5L8JB 4GLRI 2D2OA 1IM3A 2K9UA 2CLZA 2QR0A 3OAYH 3T1WA 3OXSA 3GLDA 3QEQB 2AI0H 4GUPA 2VAJA 3VO0A 3P11H 4AG4H 1L6PA 2R7EB 5CP7B 5DD6B 3WSQL 5DEGA 4ZOCA 1J9CT 3L9RB 3P3SA 1AQMA 2ZWLT 1KFAH 2XQYK 4H8VA 2X9YA 3DMMC 3IJ7A 1KCVH 3K8MA 3KBEA 1C5BL 3HKFA 2WCPA 4MGXA 4QXGH 3DJ9A 4TULL 4FQIL 5IMKB 3UAFA 5KS9E 4OAWA 2F53D 3IPEA 1B0RB 3S96B 1HSAB 4HGMA 4HH8A 3V6FB 2J8HA 2NTFA 1T5XB 4IKIA 5T1KB 2E47A 2XVBA 1TJGH 1HWGB 2K4AA 3EBIA 4FP8L 3ZHNA 4ISVA 5C0JA 4LVOB 2JIXD 3W5NA 2R56L 3N9GL 1H5BC 2DDQL 1CB4A 5BZXA 2IPKA 3T0DA 5JOPE 4LFHD 4OCXL 4PRHB 1AO7D 4NNYA 1JNJA 3OGCA 3UJIH 1U3HA 1TFPA 3TZVA 5C6PB 3IGFA 3HUJA 4RFEA 1K5WA 1NGPL 1FZJB 3L4ZA 3MV8B 4LGPB 5DHVH 3EJTA 4RA3A 4F37K 1EJ8A 4LOEA 3RURA 4OB5H 1ADWA 1RZIB 3DK2A 4PJXB 2UY7B 5EZLA 5DJ2A 4ZO8A 1GTNA 1A9EB 3RIAK 3LS4H 1JHTB 2NY3B 1G7QB 5KUKA 3D39E 3IKKA 1G4MA 4XCEB 2B20A 2W94A 4ZZFA 4W6YB 4FQXA 2CIIA 3IS1X 1H0DA 2HH0L 2HKHL 1OEZW 5DGQA 2WCGA 3CVCA 4FFWD 1ZVNA 4OZFB 1ZIBA 4KZ0A 3SGDI 2BMKB 4DW2H 4RISL 4LDCA 1DJSA 3B2XA 1LEIA 2IANE 3E38A 1QSFE 1CGVA 4GT7A 2CKBH 2VDOH 1DSFH 3Q8BA 3QIWD 1KGXA 3JTTB 4KRPC 3S6CA 3CQFA 3G5ZA 2RALA 4JREC 1EVUA 1ND0B 4MXVE 2EIJB 4M4PA 3PY9A 3DDFA 4IMKA 4KJWD 1YA5A 4IOSA 2HA1A 3EH5B 1HHGB 1MH5A 1U36A 2R1XB 4P48A 1Z32X 4LKCB 3DVIA 3RWCA 3BP7A 5EUOF 3TJPA 2KUTA 4E5XA 4LNRB 1EHAA 2ICCA 3CLFL 3IRZA 5BQ7B 5MP6H 1L7TH 2QV4A 3NCBB 5ADPL 3LNFA 5L2KD 4GKSB 1YVLA 3BYTA 3MRNB 4LQFL 1MQKH 1BWMA 3W81A 1R3KB 1IEBA 1ZS2A 4XP5L 5KZCD 2O6PA 1MRFH 2LGNA 1KJ3L 1CVRA 2FAUA 3K2KA 4FQQA 3FYIB 4ZT1A 4Y2DC 5DK2A 1KTLB 1QFUH 2ZYRA 4HMDA 4ZXBA 2VLJB 3L2LA 2BJML 4G3YL 1V3LA 3TIEB 4IU3B 4NCC2 5TF1H 4HOXA 4F7CB 2EILB 4HFUH 3G6JA 1PSKH 3HB3C 2AQTA 4E0RA 2Z31D 3RBGA 5A3ID 3GZKA 1E3ZA 4H88H 4JS7A 3MBWB 4GNKB 1Z1WA 1ZHKB 1KV3A 2OTWA 1I3GL 2Y7LA 1GS8A 5K59F 2YOAA 4Q4EA 4PRDB 4EN3B 1FO0A 2WLJA 1J05A 3MRCA 4WHTB 2E7DA 1FF5A 1OT4A 2RACA 1KGJA 1PZ5A 2LVCA 4LSRH 4NQED 4XE5B 4OLWH 2DYPA 4CMHB 3OHXC 3U4EA 3ZR6A 5T3ZE 1JSYA 4MQ7A 3V5DA 4JY6B 1NPNA 3MLUH 3P4LA 1M1XB 3JV4A 5AVUB 4CRPA 3VFMB 4L3CB 3IDJA 2BVOA 2CUIA 3LKPA 5F7HA 3S3DB 1OTUC 1D6EA 5HGAB 3N40F 4N2FA 5C08D 1T0MB 2B15A 1S9YA 2YRPA 2WHVA 2Y2TA 3C6EA 4Z0BL 5GGTL 2QHRL 4WEBH 5I2IA 1KB5A 2W0PA 3HS0C 4XCCH 4K2UL 5ICXA 4ZI8A 1MWAA 4UT6L 5B39B 5D6CA 3HUJE 3SYAA 3TA3A 3S48A 4PJ9B 2Y6TE 5EO9B 4EOWH 4MRCA 4M3KB 3TEWA 4ODTH 3HR6A 2WV3A 2J5LB 5CAYB 3DPDA 2X6CA 3FRPB 1A6UL 5D2NA 4HIIA 5K1VA 3QCUH 5DRXA 4PRPD 2OXHA 5ID0A 2BVTA 2HRPH 1S7XB 5HJDA 4O02B 5TPWL 1T6BX 1TJXA 2J43A 3JWNE 4QRTB 2H9GB 3QFJA 4M8VA 2CK2A 4LMQI 3FO1A 3B2DC 3AZUA 4AQZA 1FYHB 3BZ4A 2CKNA 4OCSL 3OKMB 4X7SH 4YGAB 2L0DA 1Z5LA 4JRYD 4MZRA 4R5VA 1SJHB 1RZKL 1XR9A 4L5FH 1XL4A 1J0YA 4F7KA 4M1DH 3AG3B 4R8WL 4XNYH 2CALA 4I0CC 4R3SA 3ULUL 4ABVA 5DZ9A 4FULA 1LWHA 1GXEA 4LPCA 1N7ML 3HN8A 4NCDA 3I6GB 4A38A 2CHZA 2ZOUA 4ANUA 3MJ8B 2EXSA 3IF1B 1A7OH 4JM2B 2OYPA 1JS4A 2CO1A 2DS4A 1ZVHA 3IRPX 2N7BA 4WHYH 4FG6C 4G5AA 4ALAH 3MOAL 5JA8B 5J4MA 5CBAA 4KZDL 1NIAA 3ATFA 3CZJA 3LHPL 4NXKA 1ML0A 2XXCB 3WBDA 1FPTL 1CGUA 2RQ8A 2I85A 2VLKD 3RL2A 3VU1A 5K9KA 1UGKA 2P8LB 4P3DB 2D73A 1KB9J 3P77B 1LE5A 3NDZE 1F4YH 4QMEA 4MMZC 5D1ZB 3G5YB 4NERA 4FNLH 4X7CC 2NPLX 3NP4A 2RA1A 5CHNA 1PYWB 1RIUH 3AAZB 3MVSA 4HC1L 4QTFA 3AB0B 1YN6B 3LPWA 3G6JE 4EI6B 2EO9A 4J8QA 3GYRA 3UAEA 3J8F7 2HJLB 1CIDA 4NWUL 4RLDA 1T1XA 4YDIL 4AQ1C 3HC4L 1K8DB 1LXMA 4L9DA 5CJ8A 3X1FA 4HOWA 5IHUL 2DJ4A 2P7TA 4N90D 3ATAA 4DP2X 1IE4A 1QD0A 4HW6A 5JW3L 4K94L 3VYPA 2X4NA 2QLYA 4WFHE 2YD2A 4C4KT 4YO0A 1BEYL 2Y7QB 3VSUA 1NBYA 4OZHF 4XGZB 2GKIA 5D9SB 2EEDA 5C0CB 4XPFL 4AKPA 1AGFA 4OLEA 2X4PB 5D7JA 3VQ1C 4GKOA 4ODVH 1SJMA 2VDNB 2VM9A 2Z8WC 3DSFL 5JXEA 3CZLA 4K71C 1MCSA 1SF5A 5DS2A 1KPUA 4X9YA 2YAQA 1AYRA 1O6VA 2NQDA 5F96H 4WY7H 1NGYB 4WI7A 4JFPB 3VE0A 1IQDB 2MPAH 2FX9L 1LEGB 3BGAA 1I8IA 5F1IB 43C9A 2XXFA 1UCTA 1BIIB 5FDWB 3OBAA 3HE6B 5F7EL 1R19A 3WKNA 2HJKB 4J2XA 3D51A 1I4FB 3H2WA 3QEUA 1YEDB 3QVAA 5TQ2H 4NFDA 4JB9H 5MEPB 4HF5H 1KTRL 4PD4K 1W15A 1E8XA 5D2NE 5SX5H 4QTHA 4XNDA 3GSQB 2VJ0A 4W6XB 1XVSA 3ZE2B 1U8KB 4V1DA 1E50A 1MRCL 3TF7C 4OZFH 3V4PL 3QQ9C 3ESUF 1SY6H 3QFJE 4HUMB 4E42B 4NHCH 5AVWB 4PG9B 4GOSA 1RUQL 4ODXA 5IROD 4W9DC 3PDOB 4HAGA 4ETYA 5LHDA 2QMKA 4YVNA 3N44B 1HH9A 3WDJA 3V5KA 4A6YA 1H9VA 1IM9B 4LO9A 4PJ8A 1OQOA 3KWWA 1TMCB 2QQQA 4R7XA 4NX0A 3QA3A 2A1WH 3RFZB 5EDSA 1DANU 2DKUA 3KLHD 1ZVSA 4KRMB 3N43F 4UQAA 1UD2A 3AGVA 4X7TA 3GUTB 3ARBA 4R0LC 1CF1A 2VMDA 3GMLB 1Z9MA 4I8DA 5I17A 1AP2A 4GFTB 3X11A 3PQYB 3PL6D 1A3RH 4UAOC 1R5WA 4X9HA 1RFDL 3K6SA 2DWEA 5CKGA 1AD9B 3W3BA 4WWKB 4DF9A 1MFCL 1SLWA 4NPYB 3B1TA 5CZRA 3S36H 2C7FA 2OMVA 4MFHA 3HBPA 5H35B 4MHHG 1UOVA 2AVFA 2HSIA 3CV5A 4TOYH 1G4RA 4ETQB 3FOLA 1PKOA 4KJQC 3VFTB 3II3A 3W37A 4HWUA 4W9CC 1E27B 2Q9OA 2YAMA 4U6XA 1ZIAA 4FJYA 1ODAA 4OBRA 5D1XC 3V0EA 5GS0D 5DVLA 4ZZKA 1XMWA 3IFPB 2CJ3A 2JLLA 4JDEA 1N0LA 2KPNA 2AXHA 5E5RB 2Z65C 3SKMB 3WHXB 3D9AH 3UO1H 2OP4H 4KVPA 4G1EB 2BC4A 2J12B 3J2PA 4XRCB 2B0SH 3IDIA 1XCQA 1EFXD 2XWCA 4UT7H 5AVZB 3DBXA 4MB3A 2IV9A 1J1XL 3MR9A 2WVTA 4LGSB 5JPNA 2WQRA 3V5HB 2EUZA 1JHLH 3UXFA 1FL6B 3VVVA 2CMRL 3ASWA 3O3BB 5J13C 4EF3A 2VZOA 3BAEL 4PS7A 1QG3A 2EE2A 3VB8A 4K3EL 1RVFH 3HFFA 1FE8H 3CAFA 1X5GA 1X5FA 1U3YA 1BBJB 4JQIH 1N12A 4OJEH 2KZWA 4WFEE 4ERSH 4HKBB 1WC7A 4ODUA 4ZYKA 3HEIB 2XYCA 2N3JA 1J86A 2IPTH 3QNXA 4JKNA 1YRKA 2J1WA 5DJDB 3SO3C 1ZT1A 2VNCA 2FJHB 2JJTA 3AG4B 1T04B 5CEZD 2X10A 1AJ7H 3C5ZA 2X4UB 4KI1A 3UTTB 3PWNB 5FM5O 3KVPA 3N1MC 2H7WA 1KWGA 1KYDA 2OMZB 4ZS7L 4ZUTA 1EFQA 1GMEA 4NKOB 4O02H 3LXCA 5AUMB 1T4WA 2AV1A 1A7BA 2F54A 1I8AA 2H41A 4F8QA 4FKKA 4V1DE 2PPAA 4YXKH 1MAMH 5DD0L 1JF6A 3EJYD 5CJXC 3MROB 3GM0A 4H1LA 2AKRB 1O7DE 3WXVH 1SM3L 2W1NA 4ONFL 5BZZA 3MNZB 1YEKH 2VN5A 2JI2A 3QXAA 1TJHL 4Z1PA 2I9TB 1EZVY 5CLZA 3N41B 3BQUD 1QNIA 4X4YA 1AACA 4DOHB 1UURA 3A6OA 5FYKD 3KD4A 1A2YB 4IJTA 5I1GL 1U8MB 2UY6A 2IV8A 3NBNA 1R34A 1A4AA 3IAPA 1H3VA 1W0WB 5JPMB 1PX4A 1H6UA 4RZCA 3EJPA 4P2RD 3QDME 2ZUUA 4FQHA 5EZJA 3VDAA 1HCFX 5DZPA 3OXRA 3MRLB 4LEEA 4OGXL 4HJEA 1GZPB 3E6FB 1P7BA 1HI6B 2BCMA 3GMMA 5FOBB 3ZQXA 5BRZB 2Z4QB 4J3VA 1TKWB 4UV7L 1NKGA 5F3HA 4YDKL 1QUPA 2Y2YA 1RPKA 1QNZL 5FIEA 1ZLWH 3MV9D 2BVQB 1KCLA 1MHHB 3QXTA 3WDHA 1MFVA 4QXTB 3HZYB 2RTTA 1A6VH 3SKJL 2VABB 1Q1JL 5DUJA 3F7PC 3PGDB 1JV5A 3FU9A 3IJYB 1G9MH 2QSQA 3ZE1E 5ACLA 3ULVE 4OGAD 2C4FT 2YK1L 5CEYA 1AZVA 3KHOA 5KG9B 3WE6B 3MLRH 1BOGA 2HPTA 4I18A 3T4AB 4Y16D 1OGAD 2J57A 3FO0L 3QRLA 1WFTA 4MJ5B 1JHKL 3O3UN 3EGDA 4BIKA 2F0CA 3ECWA 3QPQD 3WJMB 3MREA 3N55A 4JO4H 3VXMA 3S7GA 5DEJA 1ZOXA 2WXJA 1A1MB 3LPOA 5E6IA 5IGXL 3VXPB 4OKVB 2C9SA 5FHBH 3FB8B 4L29A 4HJ0C 3E8UL 4U1IB 1G9EA 1TF4A 4ZQKB 1IGMH 4R4FL 3TA4D 5ESQA 2COVD 4IMLB 3OJVC 1YN7A 5L7XH 3F04A 3C6LD 3WUWA 1S7VB 1WYJA 2CSPA 2VDNH 4OVUA 3P0VL 3GDCA 3KYAA 3MX0A 2CCWA 4HJJH 4L4TB 2ZOOA 2PYED 4QXWA 4BHUA 4I4WA 3FTWA 5F3BA 1P7KA 5TE6L 1RZFL 5D7HA 3PV6B 3CN4A 5HHXH 5E8EA 3UABA 1KIPA 4NUMA 3CXHJ 3O8XA 3N0AA 5KVFL 1NJ9B 3BVNA 3H9HA 1IGJB 2UXFA 4PJBF 1FWXA 2B4CL 2NZ9C 4L3FA 5DUMH 2UXTA 2WXQA 5T5FL 4K7PH 3UJJH 1OK0A 4PS8A 3TO4C 4HUXA 3L5XL 5AW3B 1QEWB 2AZUA 1QPKA 2MPVA 4JPVL 4L8SB 5EEVA 1BSIA 4YFEA 3BEWA 1ZA3A 1W72B 3WELA 4K23L 3MLWL 2GABA 3ARPA 4KTYA 5J0BA 2X0UA 3QQXA 3MXWH 2F54E 3FK3A 4GW4B 5DSCB 4H20H 1NAKH 4HWEL 1KBWA 3EUDA 4IBYA 5CP3A 5J6GA 1FN4B 5F93C 4JRXB 2R2HA 2R29H 3JWNG 5GISL 5FM8A 4UNUA 2NSQA 2ED9A 2P5PA 3VJ6B 1TCRB 1ACCA 3QRGH 1E42A 1IAKA 2NR6A 3W2DH 3OJ2C 5E6SB 1M7UA 4LLDB 5A16B 4LOVA 3DO7A 1B4RA 4JHWH 5J1AA 5LBSA 3UDWA 1UM4L 2VUKA 4XXWC 2AJSH 1ZK5A 3QAZB 4G59C 5J7CC 3DIVA 4J6RH 1OCOB 2YAFA 4YX2H 5JA9A 4X2UA 2DQTL 1KENL 4N5EC 4OJCA 2WM0A 1FFNA 2C9UA 2QQKH 2VWEE 4DGYH 4WO4D 4D3CH 4QHUB 4LLMB 4MJJA 1T7WA 2CK0H 4XP9H 1LEKB 1EGJH 2IBBA 1H15B 2VLMD 4PV1C 5AVRB 1QYGL 4UM8B 1UENA 1SEQH 1G6VK 3IFLH 4BQ9A 4PVBA 2EEFA 5GJSL 4QRPA 1A9BB 4XN5A 5FM4A 4E5XG 5HGHA 3ARDC 5D55A 1AZRA 2DQIH 2DEWX 4P9ML 3CG8A 5DVKA 1QWHA 5IB4A 1SXCA 4MDIA 5CIPB 4H5SA 3VA6A 2UZYB 3ZZ1A 2O6CA 3DTDA 3LNIA 3VFUA 2YJQA 3H7BB 4H25A 1GKOA 5FUCE 3V6OC 3FF7A 1VJSA 2JKLA 5F3FA 1CDCA 2IBGA 2K7QA 3OC8A 5TDPB 4Y1AA 2EC9T 1WDAA 2NXZC 3SYPA 1BREA 2UZIH 2I69A 4NN7B 5C0AA 4XPHH 1TT6A 1P7QD 3EOBB 3QJQB 2WYHA 3VXME 4FHKA 2F8XC 4Y19D 5IBTL 2M26A 3FUEA 4JCLA 1CE6B 3QZOA 3BWSA 1E0OB 4OM1H 3NFNA 5KYUA 3L3GA 4KRPD 1MCBA 4N2IA 4RGNE 2YSTA 1CMOA 4YVUA 4U3HA 3TH2T 2FGWL 4CJ0A 1YY9D 1R5IB 4UQIM 2JKNA 4Q74A 4DZBA 1INEL 1C7TA 1DJZA 1GIGL 3DJZA 4R7NA 2O5XL 4R4BA 3T0VA 1IBZA 4JRWA 2HCZX 1U2YA 2GIYA 2X4QA 3UZQA 5HDRA 4LLUA 1BAFH 1NBVL 4QRRD 4BWWA 1IL1A 3V10A 5F0MB 2BPBA 4AW4A 4NQQA 4A1RA 4HK0A 4IIQA 4X8CA 1U95A 3WXWL 2HLAA 4ZOAA 5AOZA 4H4NA 2DLFH 2NDFA 2WXPA 3I2CH 5TF0A 3RY6C 2ZXWB 5DS1A 1XMEB 3CMGA 5GRUL 2CUHA 4Y2DD 2F58L 5J9PB 4KKBC 1CFTB 1PLCA 2CO2A 1OHZA 2XQYA 2BDNL 3OMNB 4GKZA 1MCOH 4XNZB 3O0RL 3VRJA 4XBGA 4Z77A 3MOBL 4LZKA 2R69L 5KSAD 2DQFA 4BEIA 3HB3D 1AMYA 1UA6L 3AXIA 4G7QB 5C0ND 2CA4A 3UYPB 4NO2A 1F4WH 3DHPA 1GC1L 5C0GA 3QNZA 3UC0H 2G2NA 4NLHA 2OMUA 3NSFA 1PD6A 2L4OA 1ZXKA 3N85L 4TSAH 3HS8A 3EZ8A 4QRBA 3CLEH 5LO7A 4IGBA 5E08L 4GQQA 1E9QA 1LILA 5DDHB 3WNJA 1CDBA 1XL6A 5E8PB 1PLBA 4BELD 1OB1A 1MF2L 1K5NB 4L23A 1OSZB 4G7YH 2FWSA 3VXSA 4BK5C 4L1DA 1BFVH 1VKXB 1PZ2A 3U82B 2P28B 3HRZC 4J8RA 4U6YB 4U7MA 3RPIA 4KI5C 4LSPL 2UWEB 2P24A 1CFSB 2FJFB 5F1NB 5TE4L 1F45A 1RUML 3E7JA 4KOCA 4M7LT 3HC3L 3OLEA 5IFHH 2WO4A 4G7VL 3ILEA 3MNMA 4FQJL 5KW9L 4QRPE 5EN2A 5C0IA 2X9ZA 3MU3A 2VMFA 3FFDA 1FLRH 2IAMC 3NIGE 3VXUD 5JHDD 3FTUA 1DQDL 2WYIA 3SJVA 1L6XA 2A9ML 4AQOA 4LP8A 1Z3GL 2FSEA 4RIRB 3FSVA 3QUXB 1MCCA 4B97A 1NEUA 3U2IA 3CDZB 3VQLA 4F2FA 1BD2D 2XUWA 7CGTA 5FF6B 2Z3FA 2X42A 4KXDA 1LMIA 4X9BA 4Y1AE 3TWCH 3TTSA 4XMTA 3LB6D 5LUMA 4A7UA 5A6IA 4ANKA 4GG8A 2A74B 5CCHE 3VQ2C 3O6LL 4FG2A 5CCKH 2ZKXA 3O3AA 5C07D 5C0AE 3F84A 3L3OA 5KYNA 5AZ2H 3ILDA 2N56A 1F13A 1HKLL 3DC0A 4I0PD 1MFUA 2HKFH 4QAWA 1JIBA 3T8XB 2DMHA 4MD4A 4AUJA 1AKJD 3J07A 1U3ZA 1K72A 5C0BA 3IE9A 1I9RL 1HZLA 1S5HA 4MCYB 4XO9A 5IW6B 5GS0L 3VWKC 3RKDC 3GSRB 2RFXA 3KXFA 3AXHA 4WI4A 5DJ0A 5IFAH 2AEWA 2ITDA 3FQ2A 3GWJA 4WFGE 1HHIB 1MIMH 3ATEA 4PJ6A 5KJRL 4RMRA 5I1IL 1N4XH 1X3DA 2YD0A 3C5SA 5KVEE 3DX6B 4XVJH 1QBML 3LNEA 3G5VA 4PJHF 3RG1C 2QPEB 2GK2A 2ZKHL 1LO3L 1XF3B 2NX5A 3BGMA 3BHBA 2W07A 5EBLA 2R4RH 1W72H 4C54A 4D9QD 3L1GA 2BSRA 2XZQH 4GJTB 4NO3B 4QHLA 4U1NA 3SE4C 4AV0A 3UYRH 4DEPC 1RL1A 1I8UA 1VGEH 3ZDYB 5FO7B 5D7IF 3LQZB 5HDBF 1VFBA 5HYFA 5ICYB 4R90H 4TXVB 3FU0A 3FQXA 5F8RC 4I5BB 4ZFQA 3NJGA 4CN1A 2Q76A 2OM5A 2QSCL 2GITB 2C7UB 3P02A 2HUEA 2BOCB