4DP9X

The 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 6.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
b'IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin A, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp9X00
2FQDA 3BVDB 4A2HA 3S8FB 3X1NA 4CSZA 3NJLA 1AZRA 2GC7C 4DPBX 1M9WA 2GHZA 3AZUA 3FSAA 3JT2A 3FU9A 2I7SA 1SHWA 2BW5A 1E5YA 2DYRB 1A65A 4HHWA 2CAKA 2XX1A 2FT7A 3S8GB 4KO5A 2AZUA 4JHUA 1GSKA 8PAZA 3QJQB 4PCYA 3JTBA 2DWSA 3ZBMA 2R7EB 1RZPA 4F2EA 3FS9A 1BYPA 2DV6A 1ILSA 1PY0A 2HZHA 1A4BA 3TU6A 1W6WA 3FPXA 3ABGA 5F7BA 3QJVB 3WI9A 1NIBA 2IDTA 2X87A 3CDZA 3NP3A 3OMNB 2PCFA 3FSWA 4W1TA 2HX8A 1PAZA 2VM4A 4BXVA 5AZUA 4A67A 1J9QA 3TBCA 2P80A 2EINB 1MG3C 5D4IA 2CCWA 3AW5A 1AZUA 3H4FA 3NSFA 4NB7A 2IWKA 1WA2X 1SDDB 3T6ZA 1A4CA 2YAEA 4N8UA 2WO2B 4DP7X 2B3IA 2IDFA 1M57B 3HEIB 3H4HA 4NERA 2FTAA 3H56A 5I6PA 5B3SB 1AZNA 3OM3B 4BWWA 1DYZA 1CUOA 1A3ZA 4AKQA 4AKPA 3T6VA 1L9PA 1B3IA 5I5MA 3G5WA 6PCYA 5F7AA 5EHFA 1M56B 2FQEA 4YVUA 1KDIA 1SJMA 2X88A 3KW8A 2Q9OA 5B1KA 3AG3B 1BXAA 1N70A 3DKHA 3FU8A 5AKRA 1AZCA 3EH5B 4YSRA 4HCGA 1SFDA 2HRGA 2UX6A 3UAAA 4CSPA 1ET5A 2UXTA 3CVBA 1SFHA 4G71B 1OCZB 3PAZA 2N0MA 3FSZA 3TASA 5I5IA 3CVCA 3NT0A 1JZGA 1TKWA 1PNDA 3DTUB 4HCIA 3N2JA 2YAFA 3V9EA 4YSPA 4DP2X 1PLAA 2XWZA 1CC3A 2XLLA 3ZIYA 2W8CA 1OCRB 2ZWNA 1KYAA 1V10A 1ZIBA 4E9QA 3DIVA 2AVFA 1A4AA 4KNUA 1E67A 4ENZA 5A7EA 2EIJB 3NYKA 4KNTA 4AX3A 1WS7A 2HRHA 2OJ1A 1ET8A 2Y1AA 5I26A 4YSEA 2FT6A 2R7EA 5LDUA 3NJFA 2CUAA 2XV3A 3MX0B 4YSSA 4A2DA 4E9VA 3PXLA 4A2FA 1OCCB 5B1BB 1ZIAA 3KW7A 1ZDQA 2IDQA 3PCYA 4TXVB 1IBYA 4G70B 3IN0A 1TU2A 1NIEA 2YARA 2VW7A 1JZFA 2VW6A 2XXGA 4P5RA 2HXAA 1ASOA 1QNIA 2IWEA 4WTQA 1NTDA 2H5UA 2PPEA 4KO7A 3L45A 2MTAA 2UXFA 6PAZA 1NPJA 2PPFA 1DZ0A 1SF3A 1AG0A 4E9YA 1AS7A 1J9SA 1OF0A 1RZQA 3S3DB 5E9NA 5I6MA 2EIKB 1UATA 1SDDA 2PLTA 1A8ZA 2FQGA 4E9WA 1PLCA 2DWTA 1NIAA 2XUWA 3OMAB 1PZAA 5B1JC 2I85A 4AKOA 3FQYA 2QPEB 3AG2B 1GS6X 4A66A 2XYBA 3ABMB 2YAMA 2FNWA 3C75A 3T6WA 4L0PB 1GYCA 3X1BA 2BZCA 3GDCA 1OCOB 2CALA 4JKNA 4DP5X 1W6LA 3FSVA 2B08A 3TBBA 2WSDA 4KO9A 2AFNA 3FQ1A 1OE2A 5ANHA 1E5ZA 2YXWA 1TEGA 4F7KA 1NZRA 3QQXA 3NJIA 1QHQA 7PAZA 1FFTB 3CZUB 2XX0A 4E9TA 1ET7A 4YSTA 1L9QA 2LLNA 1XB3A 2H47C 4A68A 3NSYA 4DP9X 2FWLB 1SNRA 1JOIA 4UAHA 4NAJA 1CYWA 1NDTA 2GI0A 1IKOP 3GYRA 1JZIA 1OV8A 3IEAA 5B1AB 3OD3A 1FWXA 2BZ7A 4BXSV 2Q5BA 1XB8A 1WS8A 3BQVA 2TSBA 3EH3B 3FPYA 3GXUB 3X1GA 1JXFA 2Y69B 2ZONA 2OV0A 3WKQA 1CYXA 1MZYA 1KDJA 5I6NA 2PP8A 1XB6A 1BEXA 5TK4A 4FA7B 3ZDWA 5B7EA 2H3XC 1MG2C 4BWUA 4YSUA 4YVNA 4AZUA 3FU7B 3EF4A 2GB2A 2BP0B 1ILUA 3SBRA 1GR7A 3WKPA 4HIPA 3X1FA 2PPCA 4Q8BA 4BDVB 3ASOB 3NJGA 1I53A 1JVOA 3WNIA 1AIZA 5B1JA 1ZDSA 3X1EA 4HHGA 3UABA 4KO6A 4A2GA 1NWOA 3T9WA 3FQ2A 3HB3B 1BYOA 3FYIB 2BP8B 3QJSB 4QKTA 1NINA 2IWFA 1CURA 3T71A 3NJJA 1J5DA 1PMYA 4GXFA 1BXVA 2W88A 2XV2A 3EH4B 1J9TA 3NJMA 3V9CA 4DP1X 3UADA 1JVLA 3MBWB 2PP9A 5D4HA 1GY2A 1KV7A 3NJKA 2JFCA 1JXDA 1J9RA 4E9XA 5IY5B 2JKWA 4UANA 1AS8A 1OOWA 2NRDA 2BWIA 1WAEA 3EHBB 1X9RA 3PLYA 1KBVA 2BO0A 2PPAA 3NJNA 2CBPA 4BK5C 1F56A 3S3BB 2VSMB 1WA1X 3WNJA 4X4KA 2FQFA 1L9TA 1KCWA 4EF3A 2ZOOA 1NIFA 4HALA 3UGEA 1KGYE 1IC0A 5I6OA 1JZHA 3SBQA 1AANA 1JXGA 4YSQA 3SBPA 3OQRA 4YSAA 5B7FA 1V54B 4DP6X 2YAHA 3IBOA 4M4RB 1GS7A 2QDVA 1AS6A 1FA4A 2J55A 2IDSA 2GC4C 3RYMA 2XV0A 5B7MA 3WIAA 2BW4A 1NWPA 1BQKA 4YSCA 1EZLA 2VSKB 1EHKB 1BXUA 4ZK8A 5I6KA 3SQRA 1MZZA 1KBWA 4DP4X 2EIMB 4QLWA 3UAEA 3FU7A 1OE3A 3QJUB 3NJHA 3D12B 2P80D 2IH9A 1N68A 3TA4D 2BP0A 3ABLB 2PP7A 1BQ5A 1KCBA 1HAWA 4BDVA 4GP5B 2VM3A 2WO3B 1URIA 3PPSA 2YQBA 1PLBA 4GYBA 2PPDA 2J57A 2TSAA 2VN3A 4DP0X 2E86A 4KOCA 2UXGA 3AG4B 3QJTB 3CG8A 1WA0X 2BP8A 2GSMB 1TEFA 3CVDA 1QLEB 4K9JA 4YSDA 3X2QB 4E9SA 4UF7C 2IDUA 4DPCX 4MFHA 3QJRB 2J5WA 2QDWA 2BWDA 4HZ1A 2HX7A 1L9SA 5I28A 2EILB 2OCCB 5TK2A 3T6XA 4YSOA 4GP8B 4YL4A 2A3TA 1JZJA 1AACA 1RKRA 3ERXA 4HAKA 1BQRA 1E65A 1SHXA 1GW0A 1AOZA 4G7QB 3ASNB 3NP4A 2UX7A 4DP8X 3ABKB 2PCYA 4P5SA 3OMIB 4N4YB 1HFUA 2AANA 2BHFA 2QPDB 2GIMA 1PCSA 2DY2A 2XVBA 1VLXA 2DYSB 3NSDA 5I5JA 2J56A 1AR1B 1J5CA 1AAJA 4FAAB 5I6LA 1YLBB 3CDZB 1GY1A 3IN2A 3AY2A 3S3CB 4E9RA 3IE9A 3FYEB 2VW4A 1JZEA 1ZV2A 4WKXA 2RACA 2FJSA 3UACA 4AI7A 2VMJA 4GP4B 5D4JA 4DPAX 3N55A 4M3HA 1AG6A 2YXVA 2XXFA 1JERA 2HLEB 4HCFA 3ZX1A 3AG1B 4RH4A 5PCYA 3U25A 3FT0A 2YAPA 1ID2A 4JHVA 1ADWA 5AFAA 2I7OA 1PZBA 4KOBA 3WG7B 1RCYA 1BAWA 1E30A 2QT6A 1NICA 2XU9A 5PAZA 4G7RB 7PCYA 1AZBA 1T5KA 3PAVA 1PNCA 1PZCA 4BWTA 4G7SB 2UXVA 1L9OA 2ZXWB 1IUZA 1PF3A 4Q89A 1HAUA 1OE1A 2IH8A 1V55B 2JXMA 1IBZA 1NIDA 2YAQA 4KNSA 2MRYA 1GS8A 1MDAA 2AZAA 5FC9A 4W9ZA 1XMEB 1ETJA 1X9UA 4A2EA 2IAAC 4F2FA 4GY4A 1L9RA 4G72B 1ZPUA 1NPNA 2YAOA 3QPKA 2GBAA 1ASQA 1SF5A 3PAUA 1AQ8A 1W8EA 2HX9A 1R1CA 2CJ3A 3NSCA 9PCYA 1ASPA 4PAZA 2FT8A
chains in the Genus database with same CATH superfamily
4M8QA 2DYPB 4LSQH 4CC1A 4HPYL 5ERWB 4PWEA 5KEZA 2WBJA 1I8IA 4ZNEE 1FNGA 2JI2A 5FR3A 1QLFB 4AW4A 4UT7L 1Q0EA 2HTKD 2I7SA 4O4YL 3W11D 2X4TB 4F8NA 2X4UA 3WJLA 5I76A 5I66A 1Z9SA 5CCKH 1X44A 3DNKA 3N3EA 2Y07H 2O5XL 2HPOA 3J7HA 3BPCA 4GW4A 1DVFA 5HGAB 3PG2A 3W39B 1RZPA 3MRCB 4OCRH 1A3RL 1FYTD 1TIUA 5AVZB 3UO1H 4HWEH 5HHPA 1KNOB 3CGTA 2GTWB 4LSUL 1J0ZA 1RK0A 2OMNA 4YWGL 2HKHL 3PUUA 1U95B 1JD9A 3CDZA 4XNZC 4LAJH 3RTQD 3WS6C 3ZZ1A 4XN2A 5L2JA 2ICEC 4ZXBC 2VM4A 1HXMB 3U30C 2IH3B 3NIDE 2A6JB 5HBBA 3WN5A 5HGBB 4NPKA 4PJFB 2JCWA 2VDRH 4OQ1A 2CIIB 2HJKB 3DHJA 4JRXE 3TBCA 3G6AB 1PGRB 2DH3A 3KPSE 2VMFA 3GQFA 4MGXA 1WIPA 3WIIH 4NB7A 5SWQB 2A74C 3DX8A 2JLPA 5E9DE 4ZPTA 4P46A 4MRCA 3MUY1 5IF0B 1UWGH 3KXFB 4NKQB 2YKKA 4L4TE 5EFIB 2HLFD 2GFBA 2GSIB 3QUZB 4ZTOL 4MNQB 3T3PB 5JHAA 5FFGA 4KXAA 3U7YL 1DL7H 2DMBA 2F19H 1P7QB 1H3GA 3QIBC 4ELMF 3C8DA 4IRSD 5IG7B 5FYLL 2QJDA 4NUJB 4MZRA 1GZQB 1DQQB 1V3LA 2YXMA 1E8WA 4Y2DB 2K70A 1Z7JA 3WXVL 1AZCA 1S7QA 2BY0A 4HCGA 2P49B 1J1PL 2IAMB 4DUWA 1BZOA 1F8TH 1FRGL 5EOTA 3ZL2A 2V2WA 4XMUA 4HXBH 1F6FB 5HGDA 3ROOB 2R69H 2XZAH 3AVEA 4MYWB 4FLSA 1EZVY 3G5ZA 3HVDA 2KC0A 2PYFB 1K3ZA 3S36H 5KVEE 5HPMA 1L7IL 5IJDC 3FRPG 4Y4KA 2ENJA 1YNTF 3LQMA 3V9EA 2PYEA 3ZE2B 1NSNL 3UTQB 4N8PA 2NY6C 4U1HA 1EO7A 1U8CA 4WV1C 1VDGA 4Z7UB 2C7UB 1F3DJ 1LDPL 4OV5A 2BVOB 2EDDA 4HWBL 1YYCA 3E0GA 1GYVA 2XA8L 2QVMA 4X7FC 3S35L 2R23B 3F3HA 3GIZH 3HPLB 3MRJB 4DKFL 5JIIA 3M8OL 4Q6IA 2E0PA 4EN3D 2OKMA 1OQXA 3K80A 2NUTB 5B1BB 4JFTA 3WFCL 5FO8B 1ZDQA 2N7BA 2O5YL 4MXVF 5A16A 5L4FA 1EO5A 5LAPA 4MD5B 1M71B 3BSZL 1UCBH 3MV7A 5LXGH 1VRSA 4LSPL 1PPIA 4AV5A 1MCIA 1MRFH 3QEHB 2ZX5A 3I2CH 3K7UA 1BMZA 1FBIH 2CGZA 4TVPL 3LRSB 3APMA 1HH9B 4Z7VB 4YGVA 1BG9A 4XPFL 3MRHB 1DZ0A 3HE6B 4Y4FC 3O6FD 3D9AL 4L4JA 5EA0H 4PJ7B 3QC6X 4AIZB 2YUWA 2K4WA 5HDBF 2IANA 5CILL 1A3QA 3EHBC 5JLZB 1BQLH 2FJGB 4JY5H 4J6RL 3BD5A 1A7NL 5I1IH 5IJVB 1EHLL 5CN2A 4ZW5A 2I85A 3D48R 4P0DA 1Z66A 43CAA 2N0KA 3JWOH 3T8MA 2EDNA 3L13A 5GGUB 2FNWA 5JHDD 3CC5B 1GIGH 1OCOB 1ZVHA 4MA3B 5JW3H 4R5XA 1DJWA 2ZCLH 1KCSH 3I9IA 5L0QC 3NCYS 3SE8H 2L7EA 1K4CA 2FVNA 1JRHL 2VLKE 2ZZUT 4NQDA 1ACYH 3SPHA 3TBBA 1U91B 4RQQA 4DO6A 2VMEA 4W9CC 2AV7B 1FI8C 1C5DB 1HT6A 3MLWL 4MA7H 5LO7A 4UV4L 1I7TB 1QSFD 4HIQA 4G8IB 2ZUYA 3LKOA 1IVTA 3UYPB 3APCA 2ICWA 2FATH 1SOKA 4HS8H 4JFXA 4LVOB 4WFED 2OZ4L 3AREA 1T0NB 3UZQA 5DUMH 4KH9A 3VFWA 3AWFA 4QEGA 5TH2A 1CBJA 2QGCA 5T3ZL 2CGRL 3KLHD 1T1ZB 3BT0A 1YUHA 4L5FH 4MJ6A 4RMRA 3ZYZA 3VFNB 4AQZA 3D09A 1CICC 2WCGA 4PWHA 3W0WE 4ZFFA 4KKQA 3WENA 4QKXB 1SN2A 1XB8A 5AUMA 3LH2H 4KITB 3BQVA 5DD1H 4W9FC 3MRMB 4DZBB 2VYRE 2OV0A 4EI5D 5F7KC 3H42L 4RZCA 2FYYA 4HP5A 2PP8A 2L7UA 3QXAA 1EDQA 3DX9B 3GXFA 5J6HB 5E70A 4NI3A 1T21B 4F5CA 1MW3A 1E9OB 1FVDA 4Z7IA 1YNKL 2YGNA 2VIRB 4B27A 4HIEB 4QO1B 4FXKB 3QNZA 3IF1B 3GD1C 4NN7B 4X4ME 3NRPA 3T4YB 3CK0H 2X0WA 3A67H 3KBEA 3EO9H 1NGYA 2BCMA 3RUGA 4YC2B 1KTDB 2WBJC 2NZ9C 5T3XD 4GUOA 4Z95H 1SLWA 4BUHA 4N26A 4M7LL 3F6LA 3NTCL 4AEHL 3HBQA 4WWKA 4QRQB 3WJLC 3TEYA 1CURA 4WW2C 1TMQA 4LLQA 1TQUA 2QFRA 1ZLUH 1BIIA 3FO1B 4UU9A 4FQJH 3L3JA 4AXWB 1DVFC 4OSUL 4LSDA 3MBWB 3D2TA 4J4PC 4RBPH 4XN5A 5MEND 2FEEL 3FRPB 3RFZA 3EXJA 2Q2EB 3U79A 3QO0B 1MUJA 1VENA 3KWTA 2IFFL 2WLLA 3C6LB 1BLNB 2NX5A 2V7HB 3DX3A 5DQ9A 1T03L 1KIPA 1T7WA 2F54A 5E08H 3RWHB 2D7PA 3BKJL 3P69A 3U2IA 4PV8B 5D2LB 5C0BD 2QR0A 4B7IA 2XOTA 2GTZB 4U1LA 3DYPA 3C5SA 4AYEC 2AV1B 1EXUA 1FAKT 3TA3A 1WA1X 2LFGA 2X40A 2ZCKL 3QDJA 2VDQB 4XVJH 3T09A 5KSVA 4NP9A 3L3DB 3ULVE 3BDBA 4EF3A 3BAWA 5EIIA 1S5HB 1WG3A 4NOBA 2CJUH 5B8CB 4ALAH 1L6XA 2Z35A 5E7BA 4HJTA 4ZUUB 5K1VA 5C08E 2ZCHH 2J1YA 3CQPA 3QHZH 4R8WH 1BZ7B 2DBJA 2E5EA 2PO6A 3N40P 2YWYA 3MR9B 4HS3B 3IDYB 5HI5D 5G4OA 2H1PH 5TE4L 1A02N 4UTAA 4EAEA 1RULH 3DHPA 5E23A 5IGXH 2XV0A 1LNUB 1NWPA 3O2VH 4X4XA 1B4JH 4JNXA 1OD9A 3MACH 3K1KC 3ZTNH 1BQUA 4XBMA 5DZLA 3HCVA 3IDNB 5J1AB 3MRIA 5CCKL 3FU7A 4LCYA 3EYUH 3QJUB 5L6YH 1VEPA 4MQ7A 4NEHB 4POUB 4KX7A 2E7HA 3SSGA 4AQ8C 3CH8A 3A6BH 4XMWA 1BG1A 3UO1L 4HWEL 4A2MA 4FQXD 2VM3A 5D7IA 4QXTB 1CVSC 3QCUH 3KYNB 2HJLA 4RGOH 4WU7B 5E2VH 1N59B 2DDQH 5FM4A 4ADGA 3BKCH 4KOCA 2QZ5A 3WEXB 4AC2A 1U4EA 1XT5A 2E9BA 2JKLA 3Q2NA 1HYSD 1NCNA 4N0FB 3ZR6A 4RRPM 4F7PB 1R17A 2VDRL 2ZUWA 1HEHC 4PJAE 2AP2A 4Q6IC 3RHWK 4J3OF 4TL5A 4P5KB 4P3CL 2VDKB 4OZHB 2NR6A 2BOBA 2W07B 3WIIL 4X6CB 5I73B 2JCCB 1UWGL 2EQDA 2UY6B 4I1RA 3ARFC 1BF8A 5E9AA 4ABUA 1U6AH 4P3WA 3PWJB 1SYVB 2YGVA 3PQYB 4TLTA 1CI5A 4YGAB 4YH6A 1HHKB 1I9RL 2UUDH 1DL7L 3MNWA 5F97E 3ZDYB 2PCYA 2F19L 4JB9L 4PWFA 2BIHA 4QRRB 3VFVB 2BVEA 4XHQA 3NSDA 2WWMD 1AAJA 4LBEA 4NRXA 2KKQA 2OTWB 1DEEA 43C9B 1UFGA 3CPLB 3I6GA 3IJ7A 3WFBH 1F8TL 4HXBL 5TE6L 5IB4B 3JWOC 2R69L 2DM3A 4Z7AA 1CG9A 4Z7QE 2V2TA 2FJSA 1M4KA 4ADIA 3UACA 3RDTB 3MV11 4FG6D 1XO8A 3S36L 5DMGD 5HHMB 4FP8H 1LE5B 5A2FA 4NO2A 3GF8A 4NGHL 4U1IA 5KTEH 1OSPL 4YPGB 1TQTA 1ID2A 4H7VA 2X6AA 2IGFH 1PZBA 2A4CA 4YX2H 3RY6A 2X10A 5JPNA 2YPVH 1YEHH 2XU9A 1I7RA 2YPVA 1AZBA 2AK4D 4Y0GA 5I2IB 3KNBA 2FHBA 3FTZA 4JZJB 4PGDA 4FXGB 2RD0A 1IC7L 4P3DB 1EAJA 1OE1A 1CTOA 4XRCB 3WO3B 1JPTH 5I71B 4X9BA 4ZQTA 1NIDA 4ZMTA 2DLTA 2Y2YA 4D0CA 3N6YA 4R97B 1TTGA 3E1F1 5KYYB 5D5ME 4GI6A 5LXGL 4CN1A 4HUVB 3SOBL 4J3WA 4LEEA 4R96A 5A2BA 4FADA 3I2CL 1R3KB 1ZPUA 3MJWA 4XZUA 1FBIL 1I8LA 1P6AB 2ENYA 4QTHB 1KYOK 2WYHA 2FEDD 4X98B 5BZZA 1F90H 2NY0D 1MQKH 2VLLB 1E3ZA 2FEJA 4AK1A 3MO1A 2YPLD 4XVUD 3MCLL 4OLYL 4MDJA 5H37A 4MJ5A 3X1NA 2V0AA 2IXQB 2OMZA 4JFDA 3IJSA 1OTUC 3C09C 1M9WA 4EIGB 4JFVA 5I74B 4NLAA 4FFYH 1XIWB 3JWOL 2A38A 3ARDB 3D0LA 4FFYA 3IMSA 4AUJA 1YEKL 2ICEB 2O6PA 4Y1AD 1X7TA 2EC9T 1GIGL 3ABZA 2D31B 3TN0B 4Q2ZA 5JW3L 5HJ3B 4X42A 2IG2L 1UURA 3NH7H 2ZCLL 1G1KA 1KCSL 2X6UA 4KJWD 5FUOH 4WWKC 3AQYA 3VW3L 3SE8L 3WFHB 4M7KH 4MJHA 3CN2A 4PS4H 5IV2A 5EH1A 1R9FA 5AVVB 4XAKE 3FC8A 5CLYA 1MHEB 1T2JA 4OZ4B 4BSVA 1X5FA 4MA7L 2PWFA 1PEZA 3CSTA 4F8TA 3OWRA 4WFGE 3RFZC 4RMSA 4U7KA 3ELQA 2XV6B 1M6OB 4FHJA 3SKNB 4U7SA 2LABA 3BH9B 1M3IA 4BXVA 2FATL 3C8KA 3MJ7A 4X4YB 4P2OD 1AXSB 4WWOA 4M6AA 3DV4B 1NCDL 5L2KB 5DUML 4R4BB 3MGAA 2EABA 1G7LB 2X4PB 1ADQA 3MBXL 2IBZY 4L5FL 4NM4H 5BRZD 3SDAD 5EDSA 1YAZA 2OW6A 1HL5A 5JORA 1U8OA 3P4MA 3W82A 5JOFB 4G6MH 5E6IB 1K8IA 2V8MA 2QZQA 3CFDA 4MBRA 2YA2A 2OMBA 4ICXA 4AQ1B 5SWSA 1M57B 4CMMB 4OD2B 2EDOA 3LH2L 5C0NC 2DQMA 1OAKH 4M48H 5DD1L 3TA3C 1BVNT 4PJBF 5T1DL 4JY6A 1B3JA 4PRPE 1NFDB 3P4OA 1B2WL 2NY2B 1KIRA 4DQOL 2APWA 5I15H 1SJVA 3SDDD 1M7UA 2NZ1A 2IH1B 5F1SA 1OB1B 1ITBB 4GLRI 2GHWB 4LLVA 3BGMA 4DO4A 2VZ1A 1BREA 4ALAC 3CDFA 1EEZA 2XTJC 2O93L 2OZNA 2PO6C 5E6RB 5TDPA 1G94A 2AI0H 3UL4A 3TZVA 4K9EL 1DUYB 1V8HA 2DQTH 3A67L 3EO9L 2OJEA 4AYBA 4WK2B 5E4AA 1FVCA 5TF1H 5F6HJ 5DRWB 4HX1A 1IAIH 4KXBA 5F7DB 1KELL 3NT0A 1WQVT 3LPGA 4QRAA 3KYMB 1WICA 5CKAA 3NOIA 4Q58C 2X41A 1DJIA 1AZVA 2IGTA 3EGDA 3M46A 1PLAA 2I32A 1U2YA 4FQJL 3QRGH 3FCGA 4W93A 4X0NA 1V10A 4ZODA 5DHYA 2EDQA 1I1FB 1FQ9C 3KGSA 1S7WA 4PJFF 4ZFGH 1HHJB 4G1MA 4ZDHA 2MKWA 3CFJA 3VTMA 3DDFA 1MWOA 2WWKT 5IEHA 2OJ1A 3VFOA 4M6OH 1YEIH 2YBGA 4LEOA 2WIIB 3KPQA 5CD5C 5E08L 1U8HB 4BV1A 5LN8A 3VRJB 4H26A 3DDGA 3PXLA 4X9YA 4I9WD 4Y4FB 3THML 4A2FA 4TXVB 3PP4L 3IJYA 3LH9A 3L6FA 2M1KA 4JFQA 1JRHI 3IN0A 2I9LB 1M05A 3LS5H 2HXAA 4XB8A 1KUMA 4XVJL 3N9GH 5E8DH 3DROA 1LTXA 3CXHK 2CE6A 4WDIA 4XCYA 4JDEA 3U1PA 4L3CA 1NKGA 3MJ8A 1XAUA 5KWYC 1TSRA 2CJUL 4ALAL 4AEEA 3FFCB 3QEQD 1HHHA 4OIFA 4LDCA 3ORJA 3STLA 5C3IA 2OX5A 3E38A 2FQGA 4NQCA 4BD4A 1A2YB 1XL4A 2XWBB 1CGXA 2Z7UA 3CU1A 4XX1E 5IBTL 3FQYA 1WZMA 2E46A 3C60A 4ELME 3TPUB 5IGXL 2XQYK 3O2VL 3QZBA 3IXTA 4KZDL 2B77A 4IU2A 3MACL 5J9PB 4ZUWB 4JKNA 3ZTNL 4UMGA 4ODHL 3CBJB 1Q0YH 4C83B 1EHNA 3HTLX 1GHFH 3EUDA 1LWRA 1OSEA 3VGAB 5BS0B 3UCQA 4HKZA 4JRYA 1VF5C 1QBBA 1UVQA 4L29B 4XN1A 2DJSA 1VGKB 3DX7A 2C9VA 4Z7UF 1A66A 1UYWH 4K3GA 1J1XH 4HUWB 1CICB 3TNNA 4BGDA 4NO3A 1KJ2A 5BPPA 2P8PA 4XPTH 1E9PA 3T0EA 4C56A 1FLRH 1FIEA 3B2XA 3QCUL 1CLOH 4RGOL 5E2TH 2D0GA 4G7VH 3QXUA 1J5HA 2E6PA 1XB3A 4JY4B 4DK5A 1DQTA 4GI8A 4QRPE 2EIDA 4W6XB 5KS9E 3HC2A 5J7CC 2GI7A 2X05A 1WWBX 4HIJB 1Q9KA 3RY6C 1OT4A 4PJHF 5GGRA 2ZXQA 1OV8A 2P7TA 4P59H 3WTWA 2XACC 4WEEA 1I9IL 2JTDA 2PNDA 1HL4A 2QV4A 3CHOA 4XNQA 2D7OA 2YMXH 5B1CA 1KTBA 1UH2A 4AC4A 3CZJA 3FTGB 2O61A 2FEEI 3FHAA 4Z7VF 2APVA 2Y69B 3B8SA 4MXVE 3FAWA 1MZYA 2VCOA 3DHUA 1LHZA 5IQMA 3GMMA 4ZMAT 4ORGA 1U6AL 1V3KA 1FHGA 1SY6H 2W38A 5DJ2B 1XCQA 4P2RB 2FD6H 3BAYA 5EU7C 4XPAH 5EC1B 1I8LC 4QCIB 1WWAX 4XP4H 1KPUB 4JJOA 3GMRA 3MBED 1T2QL 3QUGA 2BVUA 5D7JD 3B2VL 4Q8BA 3UJTH 4DN3H 1T5XA 5IB2A 1ZGLB 2WKLA 1ROWA 4TSBL 1BMWA 1QACA 5IP4A 4IKKA 2R39A 4LQFH 1Q9WB 3ZLQC 1HOCA 1HL8A 4JW3A 4B50A 2BNUB 2A6IB 2HRPH 1FYTB 4KI5D 4L3EE 3WFBL 4XP5L 4B9YA 3TS8A 2PW2A 4QKTA 4AYFA 3QUXA 2OPCA 5EU6D 1D6VL 4LLMA 4EXPX 1U8KA 3FAXA 2WWOA 3P9LA 1XH3A 3B2UC 3HI5H 2Z8VC 3RQ3A 3VM7A 3SPVB 4Y19E 3RTQB 3UADA 1T1WA 2Y36L 3FUFA 4UQ3B 1U8QB 3INOA 3MLSL 1N6UA 2AEPH 1T04A 2VDRB 5C7XL 2C3HA 2D4DA 3TPKA 5KTEL 1EH9A 4AQEA 2JKWA 1FFNB 5EUOF 3WFEH 4KXZH 1NCJA 2OK0H 1OAUL 3KLKA 4G6FD 4G42A 1ZLWK 3FB5B 5T5NG 4XN9A 4ZMWA 2AEIT 2JKTM 2KERA 2VN5A 4OF8A 3LKQB 1HHGB 2R2BA 4LRIA 3S3BB 2XQBH 4IRJD 5CZVH 3MRQA 5HDOA 3QHFH 5FDWA 1AO7D 1JPTL 1KFGA 4NZFA 3RPIB 1MLCA 2AQNA 3PGCB 3FQXA 2W80C 1FL3A 5FO7A 2Q8AH 1FH5L 2DEWX 1HZHH 4IRSB 2H26B 1I8AA 4PPTA 4UINL 1P84J 2GSGB 1NGZA 4K23L 5CKGA 2BSBA 3QB7C 2DB8A 1MQKL 3O3AA 4HISA 5I82A 4XXDB 4DKDC 4LSSH 4TLUA 5F9DC 4MXWH 4ABVA 4YXKH 3DTXA 3WIAA 2ZUVA 3MTXA 1ZT4B 4IKIA 4ODVH 5FUCE 3OKNA 3BGFB 5FECA 4A7GF 4MHHG 3OKDB 1FE8L 2RFXA 2NYKA 2K78A 3EXLA 3VXUD 4HFWB 3PE9A 4UB0L 1ESOA 4GKSA 4FQCH 5GPRA 4F9LA 1XD0A 1QX1A 1BQ5A 4FI8A 1HAWA 5DJ0B 4GKZA 4GT0A 1URIA 3GPEA 5DEZA 5FKAA 2F8OA 3VGAC 4B5EA 4JO2H 2PPDA 1QTYT 4PS4L 3T2QA 1E27B 3QIUA 3FT4B 5EBMB 5ID0A 1W15A 4DO5A 1OAXL 2ALWA 4PJGA 2GT9B 1IQWL 1T0MB 4G6JL 5D2LF 4EN3B 5H94B 1UGNA 1OO2A 1EWHA 3VXRA 2R4RH 3BP4B 3ARFB 4YSDA 4K9JA 1A9BB 1RZGA 2HJFA 3DBXA 5CGMA 1CFVH 1IL1A 1INEL 3QJRB 3UTTD 3ZL1A 5IESH 4U3HA 5D6DA 5F9AC 1D5XA 4R4FL 1G9EA 4NM4L 3DK0A 2X70A 1CGTA 3WGVB 5I28A 1BF5A 1G4RA 2EDKA 4G6ML 4D9RD 2Q3ZA 1NA8A 2XZQL 2Y2TA 4YL4A 4N5ED 3WKYA 1DO6A 1XSIA 2EDRA 2OMTA 3O4LA 1BQRA 2CKBA 3O6FB 1XR8A 3E6HA 2ZOKA 4M48L 1JV5A 2HFEA 1NBYA 3RX5A 1MIMH 1EMTL 5TGBB 2WAQA 4PR5B 1V5JA 2DS4A 2I5YL 1J8HD 2MQGA 3AXLA 3BRFA 4ZMPA 1ACXA 1KZQA 3FZUC 4GOSA 2EUZA 5CP7B 4XP6L 2HT2D 4GINA 3LKPA 1AHMA 5JHDB 4XCFH 1A6PA 5JHMA 3G7TA 1CK0H 4LASH 5I6LA 2XCMC 4GW1B 1YLBB 2HN7A 2EYTA 2AW2A 2CM5A 2DQTL 4LNVA 5I1JL 3RB5A 3C60C 4N24A 2EEFA 4EUPH 5TF1L 4TQPA 4UQ2A 3EZ8A 1IAIL 2OMWB 4D8PA 3V6FA 5F9OH 5ITFA 1HQRB 4M4RA 1EDHA 4XCEA 4HU8A 4N0UB 1V3JA 1QSFB 1X9QA 3HNVH 3AU1A 3LD8B 4X6FB 3F7VA 1S7TB 1NGQH 5BCAA 1AR1C 5C6PB 1P84K 3D2UD 4ETQA 3P9MA 3EBHA 1IIKA 3AG1B 3QRGL 1ZGLP 1H3UA 5DQDH 2A73B 1BZ9A 3LSOA 3HR5B 1UZ8A 2MNJB 5D7HA 1K8DB 5B3NA 1ZK9A 4Y9CA 1NCGA 3LKNA 2ICWJ 3ALXA 2IO5A 4AV4A 1YECH 1T1XA 1L5GB 2QT6A 3L3KA 5AB2A 1NGXB 1T83A 1SBBA 1YEIL 3HG2A 4RGND 1VAHA 4NKOA 2R29H 4G7SB 4QGTA 4BWTA 4AYSA 4BGLA 3QBTB 4HUUA 1IC5H 4HYTB 1HAUA 3W2DH 4TN9A 3BP6B 3O3BB 5D1XE 5IVZB 1MDAA 3MRNA 2KDGA 1A1OB 3ES6A 4WI0A 2CA3A 1GKEA 2VZVA 3QNXB 1QLEH 3C09B 2FUTA 1CXHA 3L5XL 4HBCL 3N9GL 5E8DL 3PIQA 3E80A 2OTPA 4KKLD 4NQXB 1OAZH 1EAQA 3PFUA 5FYJD 1ASQA 2G4EA 3WHXA 1DBBH 4WVRA 5BO1L 2X7LA 2APXA 3R19A 5E1AB 4ZMZA 3NGBC 4B5ZA 1TKWB 4DKEL 3P1VA 3ZMEA 3FQNB 2VH5H 1JZ3A 1NLDL 2V6HA 3H7BB 1P2CA 3TO4D 3H54A 1G7IB 2VDML 5JTWA 3SPCA 2CDFB 4Q4EA 1Q0XH 4H44C 3K6OA 4M7LT 2NNAA 4B7LA 4D0DA 4B9FA 5CAYB 4N87A 1EVTC 2YXFA 1QFOA 2DBLH 1WITA 3DXAD 2R51A 3MZGB 2WMPA 1OGAA 1IV8A 4OFIA 2X4SB 3GXTA 4PCYA 1LP9E 2DWSA 5MENB 1OQOA 1Q0YL 3KPRD 5HHVL 1GHFL 3FS9A 5AVQB 1MDTA 3VE0A 3OKMA 3QUXC 1FVEB 5F9JB 3L4VA 3CDCA 4XODA 5CLWA 3PFQA 1KT2B 2PR9A 1VADB 3VH8A 3VI4A 4WRLA 1MN4A 5DVMA 1J1XL 5C0BB 4XPTL 4J2QA 5I9QC 4MAZA 4G7VL 2ZNWA 3O8XD 4IBYA 4U6XA 5EB9A 3QDMD 2Z4QA 3CCHA 1LXMA 3P73A 4WGKA 2MOQA 1S9XA 2MNWA 5D4IA 4X7TA 4TTDD 4JE4B 4P59L 3RI5K 4YQXL 4AQAA 1DBAL 1HHIA 1MFMA 5CGTA 5BVJB 3HG1B 1XF2A 4OAWB 3WGUB 3UBXG 5I8KH 2YMXL 2FTAA 4LRIC 1SJEA 4WUUA 1RD6A 1Z2KA 1IGJB 1AZNA 5F96H 4GKOA 3QZOA 4K94H 3G5XA 3RVVC 4PRHE 2FO4A 4HCRH 4MHHI 5AVSB 5B39B 3T6VA 2WLIA 2PR4L 1MHCB 1PIGA 2OYPA 1NCCH 3TVMC 1SY6L 2C3VB 5F7AA 5EG6C 3SKJL 3TBSA 4CBPA 5FHAH 3SY0A 2FD6L 2V7NB 4IU3B 4N2CA 4AY0A 2BINA 3BUQA 4XP4L 1DBML 1D5BA 1AI1L 1HILB 1KGCE 2L4OA 4UQBA 4HWNA 5C0AA 2Z9TA 4M93B 1ZGLM 1BXAA 3GZKA 2J2ZB 1FN4B 3UJTL 5DMIH 1UM5L 3EH5B 1IM9A 3U83A 4DN3L 4TVUA 2DWDB 4UQIM 4NSKB 1M7DA 1ET5A 4HUMB 1DVXA 2F58H 1CL7H 4LQFL 2DM2A 4XNAA 1JZ4A 5EZJA 5GGRY 2ATKA 3RKDC 5K9OA 3BKMH 4FQXB 4OZGA 4R3SA 3H7LA 2L7QA 4HBQA 3DTUB 1MCLA 5E5LA 3T0WA 2XWZA 4N22A 4DH2A 1CC3A 1N3NB 4F9LC 5C0CA 2XLLA 4MDIB 1FV1A 3BVNB 1SOXA 1I1YB 3HZYB 4ZYKA 4XNXH 3LJ3A 2AEPL 5IB3B 2COVD 5I1CH 1E8ZA 2WY3B 1P4LB 4Z8FH 1M7XA 3QIUC 5E5MA 2WP3O 3WDHA 4HKBA 4AX3A 5T5FL 5A40E 3T08A 3A3YB 4J3VA 3NJFA 3MLYL 4XNDA 5T1LD 4E9VA 1NAMH 3OKKA 2WLJA 1UA7A 4JDZB 4RAHA 2XKNB 2BC4A 3UG3A 4XNBA 1TU2A 1I3GH 5DWPA 2IWEA 2XQBL 1MCJA 1DSYA 2FZ3B 2WOYA 1WPCA 3MVSA 3QHFL 2CDEA 3L45A 3CIAA 4HGMA 2IWGA 2HB0A 4NO0D 4LPWA 1R3IH 3BPOC 3O3EA 2FYVA 4LCWB 4PG9B 5HYJD 2CNYA 4QAWA 2Q8AL 3M17B 4E9YA 4PJBE 1ZHNB 2F7OA 2EE9A 2B5IC 1NCWH 1T1YB 5DS1A 3RGVD 4XPHH 5JW4Q 1IC4L 1PZAA 2WKOA 2VDOL 3NIFB 4NZJA 4LSSL 1W0VA 2XWJB 4MXWL 5LBVA 4YXKL 1BBDL 5JDSB 1IVLA 3K71A 1L0QA 1PYWB 4NQUA 3G08B 1E8YA 4JZNB 2NQ3A 3FKUS 3BZ4B 4CUCA 3ASWA 4L4VD 5SV4A 5EO9B 3MA7A 4Y1SA 5FYKE 1SJXA 1JUFA 3QNFA 1XGRB 5EU5B 2GJ6D 4ZMOA 5A2LH 3CFEB 4M3KB 1LK2A 3FK3A 4JQXC 2RGSA 1OE2A 3BDYH 4FQCL 4CSSA 4ZAKD 4XCCH 5GISH 3D39A 1S7RB 4MJ4A 3BHBA 3QW9A 2V33A 3DVNB 4NKIH 1GRWA 1A22B 4JO2L 7PAZA 4MZIA 1WJ3A 3FH8A 4CA4A 1C12A 3IDXH 3ZUCA 4J3TA 4KKRA 5CSBA 2AK4B 2A6DA 2D2OA 2LLNA 2DKSA 2FWLB 5HDLA 1JOIA 2ZIDA 2Z0BA 3CQFA 2R4RL 1HQ4B 2XA3A 1IU1A 2QQQA 4PRAB 4PJFE 2JIXD 1AY1H 2CD0A 4UNTA 2C34A 5JXAL 1CFVL 1OTSC 2IV8A 3L95B 1FWXA 1DLFL 1T83C 4P9ML 3FHEA 1BX2A 3CXDH 2P24B 4EIZC 2Z7WA 3T04D 4ELDA 1B88A 3IRCA 1BD2D 1Q4NX 1SYSA 1LO5A 1MWAA 4ZPVA 4NXSA 3BAXA 3JV4B 3KXFE 3UBXB 2NY0B 1F4YH 3S96B 5HYIA 4PJ8A 3ARVA 2YPLB 3MLXH 4AYDC 3TOPA 3MX0A 4MNQE 1MIML 4P4KD 4YVNA 3T3PE 4K71C 4UOW1 3S48A 3IMRA 1KTKE 3WNOA 1KGWA 1TFHA 1HKLH 5DF0A 2F53B 1FNSH 2X5PA 1SMOA 2BCKB 4ODUA 1A7PH 3KDMB 3CVHH 3F7RA 3ML9A 1ZLVH 4UQEA 5JW4N 3NJGA 4LLUA 1NJ9A 5J6SA 1RJYA 3BZDA 3D3VA 1IX2A 3EFFB 3LNGA 4Y1AB 3H9SA 1E5AA 4XAWH 4XCFL 1AKPA 4LASL 1IM3D 4GSQA 3WCYA 2QSTA 4A2GA 4P2QD 1I7ZA 4XH2A 2I9TA 1QAWA 2EP6A 2AXJA 4H1LA 3TJPA 2CO6A 1MXGA 1FC2D 1XZ0A 4FLOA 5F9OL 1CGWA 4PB9H 1BXVA 2XV2A 5FGBC 1A4KB 2D3JA 3I75A 1Y1UA 3WNPA 3HNVL 2OTUB 5ICXA 1JHLL 5ESVB 3SDCD 1NGQL 3ZE2E 3CLEL 2KLSA 2MJWA 3UBXI 3OLEA 1J9RA 2DLIA 1JZ7A 4P2OB 3ZE1B 4Z7UE 2J12B 4KKCD 2NZIA 2ZYRA 1XF4B 4KKAC 5K59F 3SDAB 2DIBA 3T77B 2EVJA 4GI9A 2C4FU 1YECL 2W0FB 3O3DA 3TBTA 2BO0A 4KROC 4HG4J 2HA1A 2Q2LA 1PTZA 4OFYD 1SXNA 2R29L 4BK5C 5FAAA 1UB6B 3MRLB 2VL4A 5DJCB 1IC5L 3ULSB 3CX5J 3W2DL 1F2QA 2JMRA 4PJHE 2EDJA 3CSFA 1G7PA 4Y2OB 1NIFA 1IC0A 5DFWH 3TWYA 4XOEA 1MCRA 3P0VH 3T8VA 5EBWA 4F37K 4YSQA 3FONB 1L7TH 2MEJB 5ISZD 2J3SA 4WW2F 2JJWA 1UM6H 3KL0A 4OIAA 1U3HD 4Z7VE 3BZEA 1S46A 3DRTA 1E4HA 1K6QH 1P7BA 4IKLA 4K94C 2HG0A 5C8JA 1AHWB 1WIUA 3SBWA 4DT2A 2EVIA 2ATAA 4UNVA 3PWVB 4RAUB 2JB5H 1O7DE 2VH5L 4OM1H 5C07A 3KWXA 1IKNA 1UEMA 5LG6A 2P43B 2P46B 1CFTB 4FGMA 1NDMA 1L6PA 2ZCZA 5LXVA 5LGJB 3GSVB 1LWJA 3TNMB 2IV9A 4X6BA 5CEXB 5E8PA 1XCTA 4XP1H 3MV9A 2Y3NA 3UBFA 4QHMA 1Q72H 1XSKA 1PQZA 4JFHE 3C6SB 2ZYSA 4HJ1A 5EUKB 1URLA 1B4LA 2IPTH 5DJ8A 1MQ8A 4P46D 4DP0X 2J5LC 5KYUB 1WDAA 4FDWA 2YPKA 5I75C 4U4IA 4NKDB 4KTGA 1ED3A 4Q9CA 2IQAA 4HEPG 3Q5YA 4GG8B 2JB6A 2QV2A 3LV3B 2OYKA 4K3EL 3KLAB 1F13A 1IAII 1SPDA 1LEGB 4V1DA 2K1MA 1N19A 4XBEH 4NFCA 5EUOE 3SJVA 5DGQA 3OR6A 3X17A 2QQNH 1CBVL 3W9EA 5IT2L 3C5JB 3HFFA 3GJFA 1DQJB 5ACMA 3MREB 2PTUA 3H53A 4KK8D 3ZL4L 2RIKA 2D03H 4PJCA 3FQWB 3QUYC 3QEQB 2VDMB 5F96L 2WHVA 3UTZA 3NZHH 3ETTA 4HCRL 2NYYC 3WKML 2WVVA 3ABKB 4JANB 4BM7A 5D71H 2DLFL 4MNGA 4JL2A 1NCCL 2ARWA 1BJMA 3BP7A 4Y4KD 4UM8A 4P06A 3ZVVA 1MCOH 5FHAL 2PYED 4DHLA 2ZAGA 5KBPA 4E0RB 4AT6B 2EO9A 1PCSA 4Z6AT 1AR1B 3DARA 4HG4K 4H8QA 4FAAB 2OR9H 3KGTA 2R56H 4Y7OC 3N0PB 5DMIL 1RLWA 4YBLC 4PBDA 1KENH 2GW5A 1ODAA 4OT1H 3FOMB 2F58L 4I2XA 3R8BB 1ZV2A 1CL7L 4FFZH 5HHOD 1BSIA 4APQA 4EXKA 1K2DA 1SEQH 5EIQA 2HFFB 3UCRA 1ZVSA 32C2B 4DGYL 2P26A 2XXFA 2WN3A 1RZ7H 3HUJB 5L7XH 5F3BB 5LJYH 3BUIA 1AXIB 3U25A 4ZX3A 2LAAA 2NW2A 2XKSA 1BBJA 3G3LA 1OAYH 2CMRH 4XO4A 3FB8A 3JWDH 1CFNB 5I1CL 4Z8FL 4HK3N 4HF5H 4QI3A 5B4MD 2OSWA 7PCYA 2ZYHA 1CD1A 1T89A 2CLZB 5D2LE 2KLTA 3HE7D 5M95B 1KLGA 4AENB 2IAND 3HZVB 3MNVA 1NAML 3NGBB 2JXMA 1JNNH 2J1WA 4K5OA 1LD9A 2GK0A 5F3HB 4UTBA 1XMEB 1I3GL 1XV8A 2ZSVA 2J6WA 5C0DA 5KG9B 4JRXA 5ANMB 2R0LH 1B0GA 3SY6A 2CHDA 5I17B 1H9DA 2BFVH 2ENPA 3FCSA 4AK2A 2E4TA 3MBEB 1A4JB 1SF5A 3X11B 2IDCA 1ZTXE 5E9DA 4X6DA 5J6GB 3ULUD 1EZUA 1ZHBA 4PSPA 1ASPA 4TUUA 1I7UA 3WNNA 3HPJA 4C54A 4JZOA 4QOKB 4PLJC 2EUWA 1NCWL 4JGNA 5ALBH 3AZUA 2AITA 3HRPA 4XPHL 2XPGA 2OW7A 1VKXA 4IBUA 1IB5A 1T80A 3P4LA 1IFGA 3NBNA 4EDWL 1MW2A 3ME0A 4R7VA 4KPHH 3QXDA 3ARED 2R8SH 5EZIL 3QJQB 3IPEA 4N2HA 2DQEL 1FJ1B 4YHPB 3IXAA 3FULA 2BSRB 1NEPA 2AQ1A 3VGEA 3ZQWA 3MXWH 5BV7H 4GQZA 3BDYL 3WLWC 3O45A 3WI9A 1D6EA 2XHNA 4YR6B 4ANXA 5TDOB 4XCCL 2VISA 3KPLB 3QFJB 4IBSA 1IT9H 4OY9A 3JYCA 2I69A 4NKIL 4X99B 5IM7A 1A6ZB 5F21B 1PAZA 4JO5A 1MFAL 1XSOA 4IHBA 5E03A 2NCMA 1IEAB 1RERA 1Q94B 2MCMA 5CMAB 1U2HA 4IRJB 2OSLA 1YY9C 4G6KL 4LK4A 3TVMB 3ZHKA 3IMUA 1IGYB 1AY1L 5EEUA 4JM2A 5JQHC 4KKCC 4MKMA 1XGQB 4R26H 1A3LH 4JRWA 2KUTA 2WQWA 4D3CH 3CXDL 3LNHA 1VPOH 3RP1A 3RA7H 5GGSB 3D1MC 3L4YA 3OF6D 3N44B 1IQDA 4X6CE 3D50A 4WFHD 5F1IA 1PW3A 4JDTH 4ZX5A 1YEFH 2VDOB 1UD6A 3PQYE 4WI8A 1HXYA 1U58B 1LEKA 2NY4C 3O2WL 3EOAA 3K0YA 2AEWA 2PUQT 4N8VA 2XG5B 4BRVA 5HGHB 3BOVA 2B9BA 1HKLL 2X38A 4QRRE 1FL5A 5DRXB 1FNSL 2Q6WB 2AQ2A 3SGDI 4WKZB 1DN0B 5B1KA 2LLGA 1A7PL 3SKUD 3CVHL 3FU8A 3X12B 4HIHA 4LP4A 2NXZD 5DA4A 2EDMA 4GH7B 3EYVA 3QP3A 5C09D 4B6ZA 3US1A 2GK2A 2FUQA 1UUSA 3QG6A 4XP9H 3VXUB 2LTQC 3Q8AA 3QWOB 2F54D 1THAA 2BVQA 4JPVH 3WXWH 5BNXD 1ZV5A 3B9KA 3M1BB 1OLZA 2YAFA 2YD2A 4FYSA 4DP2X 1D7BA 1MF2H 1YVLA 2X0VA 3P77A 4JJ5B 4PB9L 3NFSH 2DJ4A 4PJDA 5HHME 4AJVA 4I3GA 3IU3B 3EG9A 2G2RB 5CEZD 4S2SA 1SEBA 3CFBB 5CM1A 4YHLL 1OD7A 4E9QA 2N7AA 2VLME 2B14A 1VJSA 3DIVA 1PVHA 1NOAA 1MFEH 2QPUA 1WIOA 2Z1KA 4CNIB 4IDJL 1UOLA 3HW7A 5SX4H 1HC1A 2VLKA 1KXQE 5DJXA 3UTTB 1PD0A 4FNLL 2W0PA 4XXWA 4RGMC 5A2CA 3BXNB 4NT6A 1ORSA 3FBKA 5BRQA 3LVEA 3RL2A 5JIDA 1ZIAA 3KPPA 4I77H 1KFAH 1O9ZA 2V3EA 3D25B 1DQDH 3BRDA 1OEZW 4U1GB 4UT6A 1W91A 4P04A 2J8OA 1IZJA 1M7IA 2BK8A 2FBOJ 2IMMA 3E8UH 3GK8H 4FKEA 5DDHB 1H3XA 3ZTDC 2MTAA 2VAAA 2EXWD 4E5XG 1J8HB 1MVUB 2PPFA 3JV6B 1I8MB 3HZMA 4PVNA 1FYHB 2E8YA 5KVGH 1JG9A 1R3LB 4G6AD 1OSZB 3TTYA 1YMHA 3W0WA 3QFDB 3FO2B 1NGWB 1AG0A 1AS7A 1L7TL 4PP2B 4YO0B 1YRKA 3SN6N 1OARH 3FT3A 5I5RA 3IPBA 1IAIM 4TSAH 1EJFA 2VZTA 4EUPB 1DUZA 3AWEA 4LEBA 4G8FB 2A0LD 5H2BB 1HI6A 2JB5L 2AJUL 5D55A 4OLEA 3NCYP 2K45A 4OM1L 4PVMA 4CDHA 3UOAB 2BZCA 2XQYG 3PWPA 4E41B 4ZQKA 4JGJA 1N8ZB 3S4SB 5E6UB 3MGTB 2ZSWB 3HRZB 4ZZFA 3BYTA 4X4MA 4QHLA 4XC1H 3D2UB 3QAZC 1KB9J 4XP1L 1N2RA 1FNFA 2YXWA 3C9NA 1Q72L 4K7FA 4U1MA 1TEGA 2ATPB 5L88H 1IAOA 4C4BA 4PS3A 4A7VA 2NR6D 4MAUH 4F33A 1LLAA 1IEBB 4CVZB 2A4ZA 3EIFA 1MW0A 2DH2A 4BQ6A 4WWPA 3UFIA 4KKBC 4IHOB 4LHUA 4F3FB 1BYNA 1ZMYA 2WXJA 1B0WA 2FIKB 4MDRA 1AGFB 2HLAA 3PNWA 1MFDH 2VL5A 3GKZA 1T0PB 4GQPH 1IKOP 3JWDC 5L2KE 3ZW3A 1S78C 3B9VA 2PCPA 2B9AA 4N3TA 4TVPE 3RZCC 3WIFB 1JFQL 4XBEL 2AJVL 5CCJA 2RALA 1JK8A 3Q8EA 2TSBA 2ADFL 2BVPA 3X1GA 4JLRA 4AM0A 3HI6H 4RNRA 3WKQA 3BN9D 2FWOB 3QA3A 2GJRA 1Q9OA 2V5SA 1M6UA 5AB0A 4IGBA 4ODTH 2XIBA 1WZKA 1U3ZA 2D03L 4BHUA 3HG3A 4P57A 2HKAA 1RJCA 4R4NC 4WNQB 3TO4B 3NZHL 4WEMB 4OF7A 2ZUUA 3NIFF 5DJZB 3AUWB 2WTRA 2P52A 2Q86A 1JS4A 1G7JA 3ASOB 3FUJA 1FPTL 5D1ZD 1AIZA 3DXAB 4PREB 2I07A 2VERA 3MOAH 3Q6GH 4NENA 2PMZA 2YHGA 5C08A 1UT2A 5FB8B 4Y8AA 2OR9L 1NANH 2R56L 1S7XA 5JQ6H 3T9WA 3KPRB 1MELA 2FX8H 2IEPA 4N2DA 1KENL 2YFNA 1LEIA 3ARBD 4MCYA 4OT1L 4MVBC 3U4AA 4FQHB 1EERB 1YDPB 2ZOLA 2HH0H 4Z0BH 4FFZL 4TNVK 1QOKA 4DAGL 3HOGA 5JOPE 3CDGA 1SEQL 4KK6D 2FH8A 3EJTA 4OQTH 5CJ8A 1K4DB 3I6LE 2X53A 4X8XA 1JYXA 1U8MB 3TX4A 5T3ZE 4XWOC 1RZ7L 3O8XB 3KD4A 5L7XL 1TTFA 2RJMA 4YAQA 5BV7C 3MODH 3QDMB 4WUKH 4QHPA 1OAYL 3Q3GB 4MAYC 1GA2A 3QO1A 1OP5K 3JWDL 3QPQC 3JUYA 3VSUA 5IR1A 4C55A 4PV9B 3CD4A 4HF5L 4WHTB 2HPTA 1LE9A 3PHOA 2PPAA 5IW3A 4JFYA 3V2AR 4KJYA 4NFDA 1DANT 1TZOA 3C87A 4XMLH 4ES9A 5DR5H 4JFDD 1UJ3A 3TJHD 1L9TA 4UDUA 1GVIA 1UEYA 3ATDA 3F6IA 4Y7MA 4XMZA 1F3RB 1IMHC 3VYOA 3FQRB 3QZMA 4O51A 4JHBA 3SE4A 5M7QA 4PJAA 1JZHA 2NUPA 3SBQA 1CDUA 1HH6A 4GAFB 2ZJSL 5DVPA 4E5XB 4HUKB 2ZKWA 1KBBA 2BFVL 2DM4A 5DSCA 3OGCB 4G3YH 4Q9BA 1OVZA 5GS3A 2QDVA 4W9LC 1FL6B 3FFCE 1JGEB 3FUEA 3H9YA 3R4DA 4KY1H 3A24A 3S3PA 4UM9A 4F58H 5B7MA 1SLUA 2BW4A 4R6UA 4WI9A 4I48B 4YMPA 3ATFA 5ALBL 4IS6B 3DGGA 5IFJA 5IW6B 3BWAA 1SVZA 3ILQC 4KX9A 2J5LB 5CIPA 3GBEA 2Y9RT 3NPZB 1UD2A 3LKRB 4HH8A 3GMQB 3LX9A 2DQIH 2XQ0A 3TIEA 1N68A 1SOSA 5BS0E 2NOYA 2F5AH 3DX6A 4JKMA 3WL9A 2TRYA 3RX7A 1WAPA 2VABB 4L8BB 3P9WB 3B9KC 2ZQKA 3ZE1F 5D93B 1E9QB 3O4OC 1DO5A 5BV7L 4URTB 5E0FA 5SWSD 5DEFA 1NAMB 5JIPA 3K74B 1DLHB 3QJTB 4HV8A 2BP8A 1IT9L 2ADJA 1X7QB 5CP3H 2CRYA 3QUYB 3ARSA 3R18A 2MTPA 4OUUA 1RUKL 4P23C 1V27A 4XXWC 4YHOL 2BIQA 5K59E 4Z3TA 4J1UA 3OX8A 3IDIA 3AY4C 3F62A 4GEJA 2YMTA 4PD4J 4GRWH 2XSKA 3TZVD 2X1OA 2NY1D 4R26L 2IQ9L 5HYJB 5KZCD 2WGNB 4XWGL 3UEQA 4AVKA 4K15A 4HGWB 4U4BA 3RA7L 2MOGA 3L7FA 4DKAA 1JNHA 2MHAA 3ASNB 3QUMH 5HVGB 3EOBB 4H88H 2UX7A 2NLJB 4OD3H 1K5NB 5HY9B 3QI9A 1YCSA 4DP8X 4OFVA 4OR1A 5LAXB 3OB0K 2CJTA 4P2RE 3APDA 4ZS6C 1F2XK 3WFDH 5T1KB 4MXQC 3RBGA 3D6GA 3RVTC 2NQDA 4G6AC 2X1QA 2H0FA 3ESMA 2OCJA 3QQDB 1OPOA 3FT1A 3GUFA 2YD0A 4I5BA 5L9DL 3P2DA 1Z3GH 1BWMA 1ES0B 3POHA 3QIWA 4YHKH 3ILPA 4XP9L 3PRZA 3MLTA 3BAKA 3TIDA 1TVBB 2QSCH 4PY8J 2HT4D 3A4DA 3GTNA 4ZAKB 4BSJA 1YPZA 4L8SB 4LLWB 2VMJA 4ILDA 5D4JA 4JPVL 5DO2C 4ZT1A 1SXSA 2UWEB 3CN1A 1D7FA 3V10A 4EVNB 2OMUA 4AM0Q 1TZIB 3IAGC 1TTAA 3POCA 4F57H 5F9WC 1MF2L 3EO1B 3NFSL 3B34A 4LPVA 5AZ2H 2XY1A 2IBBA 4QD2E 3H9HB 4NUGH 3BH8B 2Y7SA 4BCXA 4RSYA 1CLZH 1U3YA 5JYLA 4JN1H 2JIXB 3WG7B 2BNRD 3NCMA 4MMZB 2CHXA 1OT1A 1G9MH 1PNCA 1ZANH 4PHXA 5C97A 3C6EA 1AKJA 2BZDA 3OAYK 3ARRA 3L48A 5IFHL 4JFUA 4QWWC 4TUJA 4L18A 1ZY9A 1KFAL 1NCTA 1RZIB 4I77L 1G6RL 3H6AA 3JTSA 3IMBA 2J88H 1RFDL 5DUBB 1HSBA 2VR4A 3P2BA 3WMQA 3ZKQD 1AD9B 1KTRL 4UTAL 3A5VA 2CUIA 4OZFH 3E8UL 3GK8L 2ZUTA 4AJ0A 1IAKA 3RVUC 4MNHB 4OZFA 5CHNA 3CVHB 4NQEA 5GS0H 4NJAH 4QRUB 5CBEA 3IAQA 1N0XH 2OL3L 2IOMA 4MS6A 4IGBC 5KVGL 3BT2H 2EVGA 4KUZH 4JRYD 5JW5A 2OMXB 4EBQH 3JVGA 4FG2A 4DGUA 4M62H 1GTNA 4TNWF 4KQ0A 4TSAL 2K3HA 1A0QL 2N01B 1YMMD 1IM3B 4PRPA 3BO8A 2GHZA 3FU9A 3L5WA 3MFGB 3ARUA 3T0ED 3ZKXC 1MCWW 5DUPH 1XSJA 1VFAA 1UWXK 2IPKB 4MA1C 4LP8A 4NQVB 3VXPB 1GSKA 4O5LH 3K2UH 4OCNC 5JW4M 3ZBMA 3NCBB 3SDCB 3I84A 2ISDA 5DD6B 3OXSA 2ODIA 2DMCA 4XC1L 4YFEA 3FB7A 1A21A 1Y0LA 2KPWA 5AW8B 3GLAA 1CFQB 1DQKA 5D7LB 5L88L 3WS3B 1GGIH 5AAWA 1IGCH 2ED9A 3WTYA 3DPDA 3RFRA 4NDMB 4OF6A 3G5VB 3MOBL 4N6RA 3E6FA 5AB9A 4KK5D 2R83A 5C3TA 4PJXA 1U93A 1J9QA 2WAHA 3F84A 2LVCA 2CLVB 3MV7E 1CIDA 5INDB 4PJ5D 1P1ZA 1AZUA 3ZXAC 2NT0A 3GIVB 5F7YC 5ADOH 1JTOA 3J2PA 4N8UA 4X5WA 2OM5A 4KDTA 3VFSB 2Q7AA 3FU0A 3H6JA 2BS71 3HEIB 1FCCA 3WSQH 1GZPB 5ISZB 2FJFB 4RA0C 2ROXA 3HI6L 1U3HB 2Y7OA 2VE6A 4GUPB 4FHBD 4H40A 1S5IL 4BQCA 2D0FA 5ENWA 3I9GH 1XXFC 3B7UX 4QXGH 3GJEB 1CE6A 5GRVK 3LEYH 3PWUA 3GXIA 1QUNB 3N1MC 1NL0H 2CO1A 1UWYA 2XFXA 3OZKA 4M1GL 3T8XB 4HPOH 4HIIB 3GSOB 3EBAA 3OZLA 2HRGA 2G9KA 3MOAL 5JHDE 3FUKA 3WN5B 4CSPA 4Z5RB 2DQFA 4M1DL 4NQDE 1Z9MA 2AERT 3TASA 1AGDB 5DVNA 1PZUB 4JN2A 3AS0A 5G5DB 5JQ6L 3DVGB 2ESVE 1RLBA 3DPBA 4U6YA 4HC1H 2SEBA 5FW8A 4ZMXA 3X14A 5GSRB 2IFGA 4HC1A 3T0XA 4P46B 2NYZA 4PLKC 4N0UE 4ELMA 4FNUA 2HH0L 2YA0A 1QSFE 2CDGA 4HU2A 5I1KH 1E4XH 1HE7A 4HLJA 3BIKA 4OQTL 3KM2A 4YBHA 1F1GA 4YHNA 1KYDA 1BZDA 3TYFB 1A4AA 1UD3A 3F04A 1AGCA 4L5FE 5E8NA 3RLSA 2C1OB 5FX3A 2E7BA 4FI6A 1FFOA 3QUKB 2Y1AA 4UWQB 4WUKL 3HB3C 2A1WL 4ZUTA 4YSEA 3IJEA 2GG1A 2CUAA 4G1EA 3VXSA 2EH7H 3V5KB 4HUXA 1BOGB 4U1JB 1DBJH 3S37H 3GSWA 1KEGL 2M83A 2JKIS 1YNTA 3SCMD 5D4HA 4Z7NB 2VW7A 4QF1B 5HDQH 4LKXA 4XMLL 1S9VB 4F5CE 5DR5L 5JDJA 2R2EB 5CNHA 3UTOA 2G2PA 3KYOA 1NFIB 5KS9A 5T33H 1ECYA 4ODXA 6TAAA 3AQXA 3RIFK 3DK2A 3US0A 5CR8A 2HMIC 1M53A 2PYEB 1UWEH 1CVRA 4UNIA 1R3HA 1CLYH 1SDDA 3GSNL 1U8NB 2AJ3B 3QAZB 1H5BA 3QI9C 4E9WA 1QFUH 1CR9L 1ECZA 2FGZA 3FB6B 1XFPA 2WNXA 4JL1A 2JVUA 2G5UA 3K81A 4F58L 5J56B 1UOWA 1IFHL 2J20A 3C75A 3WLBA 4W4NA 3X1BA 5HHOB 4LCUB 1RAMA 1E4WH 3FRUB 5CJBA 4O00A 5IEKB 2DQIL 2ZUXA 3LRKA 4RETB 3QS3A 4MCMA 2X89D 2Q76B 1AE6H 2NX5E 5EIIG 1K3IA 2XIDA 2F5AL 4DFHA 4F7KA 5CD3A 4H13C 2ZUSA 1JGDB 1NZRA 3NJIA 3RZCB 3EBIA 4L3EA 3VWJA 4MS8C 3L3OB 1PCXA 1AJ7H 4NIYE 3IDJA 2CRMA 3UYOD 4BFJA 1KCKA 1NC2A 3O4LD 3HE7B 2F8VA 4BSWA 2FX7L 4Y19A 4BZ1L 4LAQL 4ZO8A 1MW1A 2V2XB 1HZLA 1F1DA 2BZ7A 1F3JA 1G9MC 3WMPA 3BVWA 3FXIC 2G75A 2VOTA 3GXUB 5D7EA 2GCYB 5AOZA 5A7BA 3CFUA 4LCVA 4ODBD 3CMOH 3AS1A 1MAML 2XTJE 3HG1E 1FGNH 3S34H 3SQBB 3PP3H 3MRGB 5I6NA 5GGVH 2EDLA 3EDFA 3MNZA 2BP3A 1E2VA 1K4CB 3ESPA 4YPJA 2D0HA 1T22B 4LF3A 4QXUH 3QUML 4UIKH 5SWZB 3K1DA 1CQYA 4H88L 3QZWG 4OD3L 2E3VA 1SBSH 3AT9A 4LDLB 4JFFB 4BK8A 5GS0C 3MN8A 4N3UA 2CGYA 1G0XA 3C5ZA 2NY3D 1T5WA 1JVOA 2VXVH 2ZX6A 3PY9A 3WFDL 5I6XC 2OJZH 5BVPH 4JFXB 3F58H 2AJZB 2P42B 1F6AA 1NWOA 4JO4H 4Z7OB 1YUHB 5BV7B 2H1XA 1M1XA 4OLUH 4U6HB 1OF2A 3GJFK 4MAYB 5BXFB 2AXFA 4X8CA 3CMGA 3HS0B 1MCKA 4QRSB 3BIBX 3K46A 3PJSA 4WI5A 5MHSE 3QDGD 3OAZH 4F57L 5I1LA 3F5WB 1JXDA 3VD5A 3E2HB 1U8LB 5AZ2L 5KANG 4TNEA 4NUGL 4ZX6A 1WBXA 3QJFA 2ZOUA 3CN4A 4UANA 5AAWC 1E0OB 5D1QA 1AS8A 5D2NC 2XWTB 3VCLA 4NHCH 4Q0XL 1DTUA 1HINH 4JQIL 3L8QA 4I0PD 1G9ML 1R24B 5EC2A 3CLWA 1WO2A 1NOLA 3O41A 1KWKA 3BSGA 1FO0H 4FMFA 3WNJA 1VACB 3ZU8A 3IKKA 5EOCH 1UXSA 2X2IA 2NSXA 3HC0A 5AWNH 2J88L 5DZOA 2J8UB 3MUGB 1RQ5A 4H5SB 4DEUA 5C0FB 2Z91B 4JVUA 4X9HA 1OP4A 1JPFA 3ZYOA 1NKOA 3RIAK 3LRGA 1AANA 2VDNH 2XZCL 1OGAD 4Q97A 5B7FA 4CW1A 3ZOAA 4LCWE 5GS0L 2X3CA 4NJAL 4WLCA 2C1PB 3VFRA 1N0XL 3LIZL 2J21A 3BT2L 1A25A 2ZKXA 3KPMB 1OL0A 4KUZL 2NXZB 5E7FA 5C09B 4EN2A 4EBQL 4KTDL 5E8EA 4M62L 5HJGA 3HMXH 1ZSDB 3B56A 4YSCA 4LSRH 4L8CA 1KIPB 1I8UA 2ZXBA 4PMEA 4WW1B 3VI4F 4CN4A 3NIFE 5I6KA 2QR0B 4GBXA 3ECBB 1AP2B 1R5VB 3VXNA 2A5UA 1NCOA 5DUPL 3OB0H 4FFTA 4TPRH 2C3XA 7TAAA 1PAMA 2ARJB 3EGXA 4K7PH 2IH9A 4O5LL 3K2UL 2ADGA 1J05B 3SO3B 2R0WH 3U6XS 4P23B 3ARPA 5H35B 4I18A 4HJUA 5JNYB 1S8DB 2K4AA 5I0VA 4P2CG 4LU5L 3EFDH 5ITBH 4A6YL 4GO8A 5IVXB 1OAJA 1QPKA 1GGIL 2VXQA 1IGCL 1G6RB 2UZYA 4JPIB 1PD6A 5H37G 3WUWA 1C16A 5HYSG 3NA9H 4TLKA 2IDUA 4Q14A 1W8OA 2R1YA 4MFHA 5GSVA 1B6DA 3MRFA 2AHIA 4Z76B 1QATA 1R3JA 5KAQG 2KS0A 2JELL 4TV3A 5KSAA 2OL3B 4GAAA 5C0AD 2F74B 2MSPA 5EU7E 1KGXA 3U9WA 5ADOL 3EYSH 12E8H 3U0TA 3B7SA 5ALCH 2ODHA 3VXMA 5F88A 1OTTC 3WSQL 4LCYB 1XGUB 2DQUH 5BQ7A 3NP4A 5CBAB 2R1WA 1USQA 3AROA 3MSPA 2YRPA 1NCHA 4UMSA 3SKMB 3Q1EA 3I9GL 1W0WB 2YPLE 3N43F 1NUDA 5D1XA 4R2GD 3FQTB 4QXGL 1Z5LA 5D7IB 5SX4I 4MJIA 5FXCH 2BX5A 3Q44A 4DESA 2FAUA 3QZWB 4X5XB 4XXCA 3RVXD 2AJSH 2F53E 4PGEA 4QT5A 4W4OA 1WCQA 1U8IB 1NL0L 3BEWB 1M2VA 1H5BC 3QZNA 3VWKD 1TO4A 4HPOL 3GSUB 2Q3XA 1GY1A 2DN7A 4I3SH 4UAOC 2WGXA 4Y1AE 3ZGHA 5MEPA 3D0AA 1P5VB 1IFRA 1MHHB 3GRGA 3DUUB 5FDYA 1XMWA 3MLRL 3HZKB 1LO0H 2YEZA 4GP4B 5FOBA 4GG6B 1LGVA 1H15A 3MV8A 3ZKMD 4LZKA 4ELKA 1ZHLB 3QJHA 4HCFA 3U4EB 2QQKL 1WUNT 4WO4A 1E4XL 2FLBT 5I1KL 2K3TA 3BEVB 3R7QA 2H6PA 1KWGA 1LP9A 4W9EC 4AEFA 4G8AC 4NNPL 2YEVB 1X5KA 2G60H 4NNYA 3IDMB 3ZE1E 4WF7A 5DFVD 1RZKH 4HH9A 2WXIA 1KXTA 3OJ2C 4QNPF 4HIXL 3I6KB 5T1MA 4Q7DA 2FSEA 1ZEAH 1AGBB 2RA1A 1NBQA 3S37L 2JLLA 4CC0A 5DYOA 4PN6A 4N90E 3CTTA 5LBSA 2VKXA 4BH7A 4G9DA 3NFNB 5K9KB 5ADPL 2WKOF 1ETJA 4OVVA 3RWIA 4BRJA 1T7ZA 5IROD 4F2FA 1L9RA 4ONFL 4TQIA 5LVEA 5C0EA 3ZKXB 5T33L 5DD3L 3OHXA 2H1LM 3OAUL 3KJ6H 5IW1A 1AQ8A 4MA1B 2YFOA 4WEBL 4XMPL 5LLIC 2G9HB 2HX9A 4B9IA 4IJ3B 5D1ZB 3LQAL 2ENQA 4EIBA 1FZMA 4RESB 2P8MB 3ARGA 1CLYL 1BF2A 4A7QA 4PRHA 5FA3A 3L9YA 3VD9A 5GJTL 2IALA 1F58H 4HSCX 5CN1A 5JPNB 1QEWB 2JJTA 4Y89A 1A65A 4L1TA 5KANI 4S1DC 3ARBB 4JK0D 2B7DT 3FFDB 2GIXA 2FT7A 5ICZB 3V4VA 2DKUA 4JDVA 4AZ8B 2E7MA 3E8VA 3JTBA 1P1VA 4HJIA 4MX7B 2OCFD 4AMWA 4F2EA 1UZGA 3ILEA 3W3BA 2D3LA 4YDJB 1I3RB 2R9HD 5DMKB 1P6WA 3D0VB 3FPXA 2F7RA 3WE6A 1AE6L 1FNEA 3FT2B 1I8KB 3S2AA 2X87A 2OQJA 5KYXA 4EIUA 2XN9B 4RAVB 3PGDB 4AMKH 4F8LA 2Q10A 2QVTA 1AIFA 2X42A 1JYNA 1DQVA 4OJEH 3EYQD 1MCBA 1AJ7L 4L8DA 3AAZB 4PJ8D 4A67A 3F7YB 3FUNA 4XPBH 5D4QA 2R1XB 4O2CB 3EDJA 2XZZA 5D1ZI 2YGQA 1T66D 2G0KA 4HJ0C 1AYOA 4I9WE 4R90H 5D1QC 2OFQA 1NANI 2PWHA 1QI5A 5HYSB 4JFDB 5F7WC 3Q8FA 4K7PX 2Y6SC 3RL1A 5K1JA 2B3IA 3IYLW 4K8RD 1D9KA 1OOAA 1GOHA 4LESA 2QKSA 3GSNB 1GC1H 1UENA 3AXIA 3H9SD 4K8RH 1JV2A 4J3SA 5DHVA 3S34L 4DZ8A 4EDXB 1A3ZA 4WFFE 5E00A 1KJMA 5GGVL 5F0PB 5GXBB 3DUSB 1C1EL 1B3IA 1U8JA 1WC7A 1XF5A 4QXUL 4Z3EA 5FWQA 1A1NB 4UIKL 5A6MA 2WQSA 4KGJA 3S7GA 1HE8A 1SBSL 2JF1A 3GUTA 4XE0A 2FGWH 1N0LB 3G5YA 3A23A 3DX2A 2Z31A 2VXVL 3MJ7B 2OJZL 1LWHA 5BVPL 4HUNB 5AVYB 1OGSA 3F58L 1PJ9A 4PJBA 1HU8A 1WHPA 4HHAB 4GBXC 3VXTA 4JO4L 3L5JA 4UQDA 3ZTCC 4OLUL 3IVKA 2DYPA 4C59B 2DI7A 5ERWA 4PTTB 3VG9B 4JCMA 1QLFA 2VLRD 2A9MH 3CFCH 2I27N 2X4TA 2P5WD 1NCBH 3HUJE 3HAEH 1KJVB 2ERJB 5GGVY 4I18C 2MCPH 3ENEA 4NYLB 3AACA 5A7EA 2V8LA 4TSCH 1LILA 4FD0A 4MMYB 1GSMA 5HGAA 5I26A 3W39A 4MCNA 3MRCA 4GRWB 5L8LB 4OLVL 4YSSA 1KNOA 4NHCL 4LCCA 5I1HL 3TZVB 1HINL 2X3BA 1FFPB 2NY1B 3DJSA 3Q0HA 4AIEA 3FTWA 3NEOA 4MA8H 2DD8H 1G87A 4ZD3H 1U95A 3GI9L 3QUMB 5KZCB 2VW6A 3WFZA 1FVCB 5KSAC 3TT3H 4JFEB 5C07D 1P53A 5DLLA 2LU7A 2PPEA 3ZHDA 3NACH 1HXMA 2IH3A 4RWYH 2A6JA 3QULB 5AWNL 3SGEI 5HGBA 4PJFA 2CIIA 2HJKA 5ANME 5ABAA 4L0YA 3G6AA 1ZPLA 5EEXA 4RRPA 4UDTB 2OXHB 3EGDB 2VDNL 4YZWA 5LCVH 3ATAA 2AQ3A 3ARZA 5B21A 4L3AA 3TV3H 4XMTA 2EIKB 5SWQA 1RPQA 2Y1ZA 5DVOA 4PBXA 2DWTA 5D1XC 1W72H 5IF0A 2UV3A 5B1JC 4ZFZB 3KXFA 2Z92B 2C7FA 3WDIA 4OIBA 4OLWH 1OM3L 5EFIA 4QOKE 4XXCC 3ZE0B 2GSIA 1NDGB 3HMXL 4W4OC 5IHLB 4MNQA 4LSRL 2CHWA 4LEOB 1XCWA 1ZKAA 4KI5E 4XR8C 4ZMNA 2XKUA 1RMFL 1ONQB 2CALA 1BVKB 3RVXC 2Y7LA 1P7QA 4YIQB 1W6LA 3FOLB 3GSXB 2EDXA 3RY4A 1KCUH 4V1DD 4NUJA 1GZQA 1DQQA 1E8XA 4Y2DA 1E4KA 2VRKA 4NCC1 2R0WL 1ETZA 4WDIB 4NM8L 4NBYB 4D2NA 3HC3H 2BNRB 3MXVL 3ROOA 3EFDL 1FIGH 5ITBL 4WO4C 3QFJE 3FMGH 2MKLC 2PYFA 4O02L 5E4IA 4EZJA 1ITCA 1DCLA 2E7DA 1NPUA 3U4BH 2CZNA 3NA9L 4GSDH 3IEAA 3NZ8A 4Z7NF 3TCTA 5DT1H 4RMUA 3UTQA 3EJYD 1RZKC 3DX4A 3S97C 2G3NA 4BXSV 1WS8A 3CWGA 4Z7UA 2C7UA 2CA4A 4NS0A 3N50A 3EDDA 4PWGA 2M26A 1MFBH 3K6NA 1I31A 2R23A 3HPLA 12E8L 3COOA 5ALCL 5IQ7L 3J27A 4JREB 3QK0A 4JRYB 5KOVC 5L4IA 4U31A 5H4ZA 4K2UH 3WN6A 4K7PY 2NUTA 5FO8A 3V7AG 3OHXC 1YMMB 1H3PH 2BP0B 4APQD 1C5BL 4NO3B 1M71A 5JIQA 1CLVA 2Q1EA 1PX8A 1OB0A 2OYMA 3RG1C 2OR8A 3QEHA 1PD1A 3ARGC 1G7QB 2LU3A 1CF8H 3HLKA 3LRSA 3P3UA 4Z7VA 1HH9A 3WNLA 3PL6C 1Q9KB 3MRHA 3HE6A 3IU4H 5IIEB 4I3SL 1QR1A 1O7VA 3Q1SH 4PJ7A 4AIZA 1PG7L 2IWFA 5DI8A 4A6YB 4JG5A 2XT1B 4U1KB 4LKCB 4NWTL 4MTMA 1DN2A 5FGCB 2FJGA 5JLZA 4KKNA 1NEUA 1FHNA 2X4RB 5IJVA 4PJ9D 3ZGIA 3VXRE 4KUCD 4IRZL 1GTFA 1KV7A 4HS6B 5GGUA 2ITDB 3LB6C 1O6VA 2E27H 3CC5A 5EWIL 4FABH 3LZFH 2CPCA 4MA3A 3UAFA 4JRXD 5I23A 1ZE3H 3SQOH 4PJ5B 1BFVH 3KPSD 3LXAA 1E40A 4U3SB 1N7MH 2IPUK 2ITCB 3IKCB 3ZHFA 2M8XA 4HAFA 3RWCB 3QXVA 1U91A 3Q01A 3HN8A 5E9DD 1P5UB 5AW7B 1C5DA 3EYFA 3LVTA 1LO2H 4X6DF 1ZEAL 4D9RE 4L4TD 4JFSA 4G8IA 3VVVA 3MU3A 3NCEB 1V7NL 4HKXB 2MCG1 2O5ZH 5I8EB 4A37A 1D9KC 1T0NA 1WISA 2QSQA 1J8HE 4TS6A 1T1ZA 3H0TB 1GC1C 3LXCA 4H2CA 3Q43A 2KQNA 3VFNA 1KLFB 2JH2A 5LGKA 1TZ8A 4GRLD 4EI6B 2P5ED 1BVZA 3FBQA 3MRMA 4OBRA 1NAKH 2BRRH 2ZD0A 1FF5A 5DK0B 4DZBA 3CSGA 4IJTA 1G9NL 3ZJAA 3T1WA 4HOXA 2CBMA 4PTUB 3D4GA 1XQ4A 3DX9A 2XBZA 2H0PA 2Z31C 4PG2A 5J6HA 3ZZQA 1T21A 1WCBB 1E9OA 2XTLA 4RFEB 1F0LA 1GGCH 2VIRA 4HIEA 1E6OL 2IMNA 1OE3A 1ZT1B 4QO1A 4AYGA 5GRVL 4E41E 5GZOA 4FXKA 4KKZA 1OP3H 3QEUB 3IF1A 2Q7YB 1EFXD 3T4YA 1HX0A 5MERB 4M1CC 3IMWA 1S9KC 1Y07A 4U6VL 3CZSA 1JCKA 2V17L 4JM2D 1KTDA 4KVCH 2D3NA 2DTML 2Q8BH 3UAJC 4EZLA 4J5VA 1ZTMA 2UXGA 4QHUB 4KQ3H 4AMKL 5J8OA 4X7DC 4P05A 4F2MB 4QRQA 1TEFA 3TBWA 4LPTA 1KBGH 3FW6A 4KDWA 3UTSD 1JWSB 3DO7B 4IBWA 2DQ6A 4UF7C 4ZFQA 1ZSHA 4P49A 3FO1A 2EC9U 3SCMB 2H2SC 4XPBL 4AXWA 3WOVA 2H45A 4LPCA 3MBWA 2NNCA 3FRPA 2B15A 3QO0A 4PRBB 2DEYX 3U36B 3MNMA 3C6LA 2H0JA 4ZTPH 2QL1A 4GP8B 1BLNA 2V7HA 1JGVL 1QBMH 3L08A 5IJKC 4HAKA 3QQ9D 4PBVC 3ZUNC 2ENSA 3RWHA 4D9QD 2J6EH 2Y06H 2DQJH 1E4XI 3NZUA 4PV8A 5D2LA 4K8RL 3ISWA 2J6EA 3ZT5A 4UAOB 2GTZA 4NBZB 2NTFB 1ZOXA 3OKLB 4LL9A 3RDJA 2AV1A 5JHLA 4JM4H 1WFJA 4EZMA 2VDQH 4AWJC 2GUYA 1HFUA 4FTVD 1HCVA 3L3DA 2GIMA 4AQOA 1MFVA 4PJDF 1S5HA 1SJHB 3DXAE 5B8CA 1ZCRA 3RJQB 4L2LA 3FYEB 1MIEL 4AL8H 3QUZC 4G2AA 5M94B 2VLKD 1KXVA 1BZ7A 2XJLA 3S5LB 1THCA 3MR9A 4HS3A 5DUJA 4JRLA 3DOHA 3VI4E 1WV7T 4D9LL 4XO5A 4DK6A 1IKFL 2FHFA 1RZJH 1Y7VA 2NMSA 4M7JH 1XVSA 2E74C 2BJMH 1LO3H 1LNUA 5IVXF 4H2AA 4HZAA 2ZOKB 3ZDXF 3CFCL 4RMTA 4Y2DC 4ESKA 1E4KC 5F1KC 4PIRF 4LIQH 2I7OA 3UGUA 2IAMC 5J1AA 1NCBL 1MJ7H 4N2MA 4G7YH 3OTTA 1FZOB 1R5IB 3QDME 5BW7A 5PAZA 1Z32X 3RWEB 4TSCL 3GMLB 1AVAA 2QSVA 2UXVA 2X2YA 3AC0A 3L1EA 3LKPB 4GAYA 1D5RA 5FS5A 4KHTL 3WEOA 4CDGC 1JF6A 4QXTA 3WTVA 3UYRH 3KYNA 4PS7A 4GSXA 4WU7A 3ZIMA 3ARQA 1N59A 4MA8L 2DD8L 4LFHD 4ZD3L 5E1GA 3WEXA 3O6LH 1NUGA 1ROCA 3S5ZA 1AXTH 2X9WA 5CLXA 1T3FB 2IAAC 1NKRA 2EKJA 1UCTA 1YC7A 3NACL 4N0FA 5E2JA 3O0RL 4F7PA 3BQUD 1EPFA 1AHKA 1HDMB 4NZ8A 2VDKH 2NY3B 4QYOB 5L4JA 4P5KA 4XMVA 5I19L 5LCVL 2FQDA 2EEBA 2W07A 4X6CA 2JCCA 4LNRB 4HPYH 1W72L 3BLPX 2UY6A 5DZJA 3OAWA 2HFTA 3K0WA 3PWJA 1SYVA 3PQYA 4NPYB 4OLWL 4ONGH 4O4YH 1QHPA 2EDYA 3L3KB 3MZTA 3PS6A 1RH8A 3AGVA 3QHTC 4KO5A 4JHUA 1HHKA 1TQSA 2WC7A 4QRRA 2O5XH 2R4SL 1Q90A 1P7KB 2V5TA 3UZEA 3VFVA 1WGVA 3MLUH 3WJJA 4L1SA 3QDGB 4DN4H 1A3RH 1EJOL 4HFUL 1KCUL 1M42A 1IRAY 1NIBA 4YWGH 2OTWA 43C9A 3RVWC 2HKHH 3OMNB 4ENED 3CPLA 4WJ5B 4L23A 2HX8A 3HC3L 5IB4A 5IHZB 1FIGL 4I0PB 5HSFA 1UGKA 5AW0B 3FMGL 3RDTA 3ZZLA 4OUOA 3WELA 1ZA6B 5IWLA 1LE5A 2E9IA 1ZE3C 2BNQD 3GXMA 3OKOB 3ULVD 1WA2X 5DT1L 2WLKA 3LNDA 3QZPA 2VDNB 4YPGA 3T6ZA 3VFTB 4QNPE 3DIFB 4OZIF 2AXWA 2ZUQB 3V0JA 4PRDB 1OGAB 4M9PA 3VMNA 5EOCJ 1MFBL 5HYJE 1D5IH 3B2MA 1BVLB 3CZGA 4AKQA 4LVOC 4HPHA 3S88L 5I2IA 2DQDH 2KPNA 3U7YH 4JZJA 1QVOB 4LOUC 4OJAA 4FXGA 4K2UL 4K3JH 2MNUA 3QQ4B 5KJ4A 4M43L 4XRCA 1TCRB 2F7IA 5EN2A 1H3PL 4ANKA 3KW8A 5KYYA 1MFCH 2N1TE 1SMAA 5FYLH 1XBDA 2ORBH 5CEYB 4HUVA 1CN4A 4YHML 3F01A 2X9XA 2HWZH 2GAZB 4TLSA 1R3KA 1J1PH 1CF8L 1FRGH 4QTHA 3S98A 4X98A 1JXKA 2VLLA 4HD5A 3Q1SL 3D39E 4ZSOB 5IHWA 3VD1A 2V5RA 4B60A 1NUFA 1GJWA 3N2JA 4H8UA 3N1FC 4V33A 1L7IH 2IXQA 4O02B 4YSPA 1DJSA 3GMNB 5AYTA 5GZOC 2WIMA 5K33A 3Q7JA 4P99A 3FHQA 3SKOB 2ZPKL 4M5TA 1CJYA 2FO4B 1XIWA 3BN3B 4Z0XB 3VFMB 3ARDA 1MH5B 3WS6A 2N59A 3B3IB 2ICEA 5FHBL 1LDPH 1LO4L 3TV8A 3TN0A 2D31A 3VNYA 1WS7A 4EQ3A 1TLMA 5HJ3A 2BMKB 2XBTA 1HNGA 3CIQA 3TBSB 4GLRH 4HWBA 3SQOL 1BFVL 1NBVH 4A2DA 4HZLB 3WFHA 5KAQF 5JXED 2QGEA 5ETUB 1MHEA 2YQ2A 4OZ4A 1JTTA 1MI5D 3R1GH 2O5YH 5DU7A 2YARA 1LO2L 2A74A 4UM9D 1GGYA 1RJZB 3BSZH 3FJTA 4IBZA 1UADC 3QORD 3SKNA 2VTFA 3BSZA 1G5AA 1NPJA 3C6LC 4X4YA 2BSSB 2W91A 3UH8A 1AXSA 2O5ZL 3MCKB 3DV4A 5L2KA 2BXYA 3WDJA 2WQAA 4R4BA 3BUPA 2DKMA 3LZNA 5IMKB 5BO0D 1G7LA 2X4PA 4XPFH 3UC0H 2Y4SA 3VI3B 2C4XA 3D3VE 3D9AH 4JG1L