4DP9X

The 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 6.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin A, chloroplastic
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp9X00
1AZUA 1BQ5A 2AFNA 3NJIA 1XMEB 3AZUA 2YAQA 1NWOA 3OD3A 3UAAA 3X1EA 4HHWA 3H56A 1NTDA 4G72B 3IE9A 1V55B 4JKNA 2GI0A 3MBWB 2AZAA 4DP2X 4E9WA 1V10A 3FU9A 5I6PA 4UAHA 1WS7A 3FT0A 4A2DA 2GHZA 2PLTA 2HZHA 4BXSV 3ABGA 3UAEA 2JFCA 1ILSA 1NIAA 2IDQA 3DIVA 4E9QA 1CUOA 2ZXWB 3BVDB 2BZCA 3FSAA 3PAVA 4JHVA 1MG3C 4HHGA 4BDVA 2GC4C 4DP6X 3FQ2A 2PPEA 5PAZA 1JZGA 4E9YA 4WTQA 4YVNA 4BWWA 1EZLA 1TEFA 4PAZA 2CCWA 1AZRA 1M9WA 4NAJA 3FSVA 5IY5B 2BWDA 2NRDA 1PLAA 3ASNB 4KOCA 4M3HA 1JXFA 5TK4A 3ASOB 1WA1X 3GDCA 4KOBA 3TA4D 1IBZA 3PXLA 1M57B 3EH4B 1PZBA 1PZAA 1FWXA 4K9JA 5A7EA 4NERA 2BP8B 1L9SA 4AKPA 1J9RA 3UACA 4DPCX 3NJJA 2XX1A 3NJMA 3TBCA 4DP7X 1BEXA 2PPDA 4YSUA 1WAEA 2PPAA 4A2HA 1XB6A 4AZUA 1ZDSA 1EHKB 2YXWA 3WG7B 2IDSA 2MTAA 3FPXA 3H4HA 2WO2B 3RYMA 3AG1B 4AKOA 2UX6A 5I6KA 1AQ8A 3UADA 2YARA 3AG3B 1GW0A 2ZWNA 3EH3B 1MZZA 1T5KA 4CSZA 1ID2A 1OCOB 1DZ0A 1BAWA 1ILUA 2N0MA 5FC9A 4A2GA 1AANA 3NSFA 1BQKA 1CURA 3QJSB 2FQEA 3IEAA 1J5DA 1OCZB 2VW7A 4HCGA 3S8GB 4YSTA 2B08A 3PAUA 2FNWA 2FQDA 3CG8A 4MFHA 2XUWA 3N2JA 4ZK8A 4P5SA 1AG6A 3CZUB 4EF3A 2W88A 2HXAA 3ABMB 4G7QB 3MX0B 3WI9A 1HAUA 3NSDA 3X1FA 1KBWA 4DP0X 1NIEA 1JOIA 3H4FA 3N55A 4GP5B 1GS7A 4E9VA 5ANHA 2IDTA 3QQXA 4A2EA 5LDUA 3T6WA 4DP1X 1HAWA 4YSEA 1SJMA 1A3ZA 3T9WA 2J5WA 4W9ZA 1PNCA 3T6ZA 3L45A 2JKWA 1BXVA 3PCYA 2CALA 3UABA 2Y1AA 4GY4A 1IKOP 2VM4A 1L9RA 2VW6A 1MDAA 4GXFA 3SBPA 2QDWA 4KO6A 1NIBA 1PZCA 3PPSA 4WKXA 1AG0A 1L9QA 3PLYA 2YQBA 1N70A 1GR7A 3FYEB 1RZQA 2Q9OA 2AANA 2BZ7A 4W1TA 4AX3A 3D12B 2P80A 2CBPA 6PCYA 2DWSA 3X1NA 2R7EB 2DY2A 4YSDA 1GSKA 3EHBB 1VLXA 4KNTA 1NZRA 4BWUA 1GYCA 1SNRA 1OCCB 1ASOA 1AACA 1M56B 9PCYA 2A3TA 1WS8A 4KNUA 2VSKB 1E67A 3QJTB 1OCRB 4Q8BA 2ZOOA 3S8FB 3NSYA 2CAKA 2FT7A 2YAHA 2PP9A 2HRGA 1KBVA 1CYWA 2BW4A 4YL4A 4E9TA 1JVOA 4DP8X 2PPCA 3CDZB 3FU8A 2EIJB 3UGEA 1I53A 3NJKA 3WNJA 3G5WA 3X1GA 3ZX1A 4E9RA 3AG4B 3SBRA 1OF0A 1RZPA 1NINA 1KDIA 2VSMB 3OM3B 1AS7A 2UXFA 1NDTA 2EIKB 2XU9A 4RH4A 1MZYA 2XXGA 1SHWA 2R7EA 4KO7A 1DYZA 2FT6A 3CVBA 2FQGA 3FS9A 5D4JA 3U25A 1PLCA 2PP7A 4DPAX 1PCSA 1QNIA 2I85A 4GP4B 4QKTA 1J9TA 1AS6A 1L9OA 4N8UA 1J9SA 1ETJA 3FQYA 4G7RB 5AKRA 5EHFA 5AFAA 1J9QA 3NJLA 2XV2A 3CDZA 2FTAA 3OQRA 1SF3A 4BXVA 1QLEB 2I7SA 4G70B 1SFHA 1BQRA 2YAEA 3QJVB 1JZJA 2EIMB 4P5RA 5I5MA 4G7SB 1SDDB 1KCWA 3WIAA 3QJUB 2ZONA 3NJHA 1ET5A 1ZDQA 3T71A 1GS8A 2XWZA 4GYBA 3AW5A 2CUAA 3SQRA 2J55A 3GYRA 2PPFA 1XB3A 3ABKB 4HCIA 1NIFA 3FYIB 2TSBA 1A4CA 5AZUA 1KGYE 1HFUA 2DYSB 1ADWA 3NJNA 1AS8A 1R1CA 3PAZA 2BP0A 4YVUA 1X9UA 3WNIA 2H47C 2I7OA 4DPBX 3ZDWA 1GY1A 4DP4X 3NP3A 2OV0A 4HALA 1ASPA 3DKHA 3TBBA 4AKQA 1JVLA 3TU6A 5B3SB 2IWKA 1TEGA 2HLEB 2MRYA 3T6XA 1SFDA 5I5IA 1ASQA 1NPNA 3QPKA 1X9RA 3ZBMA 1AR1B 5F7BA 2HX9A 1AAJA 3HEIB 4YSOA 4X4KA 2YAMA 1W8EA 2GC7C 2HRHA 5B1BB 1NICA 5I6NA 3GXUB 3FU7B 2BWIA 4BK5C 2BW5A 2UXGA 2FJSA 2GIMA 1W6WA 1IUZA 3X2QB 4KO5A 5B1AB 1JZHA 4UF7C 3V9CA 1OE3A 2WO3B 4UANA 2X87A 4FA7B 3EH5B 3KW7A 3WKQA 2OCCB 2YAFA 1BXAA 3ZIYA 4N4YB 2YXVA 2J57A 1NIDA 3S3CB 1ET7A 3ERXA 1CC3A 1GY2A 1JXDA 3ABLB 3IN2A 4CSPA 2UX7A 7PCYA 4A67A 2BHFA 4E9XA 3NSCA 5I26A 1A4BA 1BXUA 1ZIAA 2IDUA 4M4RB 3T6VA 5B1JC 3OMNB 5B1JA 1QHQA 1B3IA 2QDVA 2JXMA 2OJ1A 4HAKA 5I6OA 5D4HA 2H5UA 5B1KA 2BP8A 5I6MA 4A68A 3QJRB 1JZEA 3JT2A 2GSMB 3DTUB 2HX8A 1YLBB 3NP4A 4DP9X 1JXGA 2WSDA 2QPDB 5TK2A 3AY2A 5D4IA 1L9PA 1FFTB 2DYRB 3S3BB 2GB2A 3BQVA 1WA2X 5B7MA 1NWPA 1CYXA 2E86A 1SF5A 2XV0A 4BWTA 4YSAA 4YSCA 1KCBA 2W8CA 2XLLA 4G71B 2YAOA 4F7KA 7PAZA 5I28A 1AIZA 2X88A 1FA4A 5I5JA 2CJ3A 4QLWA 5F7AA 1PLBA 1WA0X 3EF4A 1W6LA 3S3DB 2BP0B 1UATA 2IWEA 1F56A 1JZIA 2FWLB 4YSSA 3FU7A 8PAZA 1ET8A 4HCFA 5E9NA 3FSZA 2H3XC 1IC0A 3SBQA 2Q5BA 4DP5X 1PY0A 1NPJA 2IH8A 2UXVA 3FQ1A 2Y69B 4YSPA 1A4AA 3NJGA 3OMIB 1PNDA 1J5CA 1KV7A 2EINB 2IWFA 6PAZA 2IH9A 2AVFA 1OE2A 2EILB 1N68A 2HX7A 1V54B 2J56A 2VMJA 4TXVB 1JZFA 2UXTA 3CVDA 2FQFA 3HB3B 3NYKA 2VN3A 1KDJA 3IBOA 2BO0A 4HIPA 2XVBA 4JHUA 1ZIBA 2DWTA 2P80D 1XB8A 3WKPA 2FT8A 1AZNA 3NT0A 1BYPA 3C75A 4NB7A 2XV3A 4PCYA 3KW8A 2PCYA 3OMAB 3AG2B 1IBYA 1ZV2A 1GS6X 4ENZA 4A66A 5B7EA 5B7FA 1TU2A 4A2FA 1SDDA 4FAAB 2QT6A 2RACA 5PCYA 2YAPA 4YSRA 3IN0A 1RCYA 4AI7A 3TASA 2XYBA 4E9SA 1AZBA 1PAZA 1PF3A 2IDFA 3CVCA 1MG2C 1E5ZA 3NJFA 3X1BA 2DV6A 1AZCA 4KO9A 1JERA 1L9TA 1TKWA 4KNSA 1RKRA 3V9EA 1E65A 4HZ1A 3JTBA 1OOWA 4L0PB 1OV8A 4GP8B 1KYAA 1URIA 2PP8A 2B3IA 1E30A 2PCFA 2QPEB 1PMYA 1SHXA 1A8ZA 2VM3A 3FPYA 5I6LA 2IAAC 1OE1A 2TSAA 2VW4A 3QJQB 4F2FA 1AOZA 1E5YA 3FSWA 2GBAA 1BYOA 4Q89A 4BDVB 2XX0A 4YSQA 2AZUA 4F2EA 2LLNA 1A65A 2XXFA 1ZPUA
chains in the Genus database with same CATH superfamily
3FUMA 2NY5C 4WIQA 3UROR 4EZJA 5BVPL 1N8OE 1Q94B 1T5WA 2CR3A 4HD9A 1QNZH 1UACL 1QD0A 2H6PA 3E2HC 5DD6B 1NTDA 2E75C 3QXTA 4F7MA 3GBLA 2C1OA 2ZUXA 3C60D 4CN1A 4LOUD 1CFBA 4XNMA 1KPRB 1SN0A 3X14A 1QFWI 1ECYA 4UOQA 2PLTA 4RLDA 4OU3A 3T2NL 2WSPA 4UWQB 1UOLA 4U6XB 5FECA 3K0WA 2OYPA 1WTGT 3RLSA 2WBJC 1J0KA 3KVQA 1NIAA 4A6YL 2Y7MA 3O11A 5DJ0B 1FSKB 4N5EC 3V7MA 2LU5A 1YMHA 4RISH 5H37G 3ULVF 4U3SA 3B7TA 3GLEA 2AXJA 3S88L 4N0YH 3FQ2A 2C4FU 4K5PA 2IQ9H 2WCGA 3JTTB 3B9AA 1CGSL 2CPCA 4AL8L 2BOBA 1OF2B 3NK3A 2ZF8A 3M6DA 3QS2A 5EZOH 1MF2H 2XOTA 3S98A 3AU0A 2BWDA 4XB7A 2WWNA 4M3HA 3HUJF 2FH8A 4PRAB 5FYLL 4KOBA 4M6NH 1MFVA 3CC1A 1PZBA 2VDPB 5HGDB 3O6FB 3V2AR 4O2FB 5DT1H 3V0VA 4DZBA 4YBQC 2JF1A 3NJJA 1U21A 2XA3A 4GBXD 4LVNB 2AV7B 2YLHA 4S1DD 3SQOL 1Z32X 4YSUA 5T1JA 4A2HA 5I1DB 5KEZA 4JG1H 1EHKB 4JPIB 4ACTA 3FB7B 5E94A 3GS4A 4N0FA 5I1AA 4WTXA 3PGFL 2VQ4A 2WKLA 2W0FB 3NIFB 5EEVA 1CDBA 3EOYG 1AD9A 3KYNA 2COQA 4PRPA 1KJ3H 5T5FH 1AMYA 2NY3C 1VACA 4JFOB 5KW9H 4YHYB 3ZTDC 3DYPA 1OCOB 5F9WB 2E7CA 1OT2A 3QFJD 2GCYB 2WLIA 1SJEA 4DW2H 2IAND 3D52A 3SBWC 2B2XL 4AWJC 5B38B 2YGPA 5K9OA 2KZBA 2C3HA 3T65A 4KGLA 4FQHB 1WAPA 3BIBX 1OSPL 4X9HA 3HZ3A 1AE6H 5IW1A 4WFGD 3ZE0F 4M1DH 4UZUA 4DN3H 2FNWA 2B1HH 4AE0A 4LDCA 1H6TA 1NEZG 4P5SA 1SEBA 4LK4A 2W88A 2OR9H 3C60C 3N55A 4ORZC 3BUQA 3P4OB 3MC0A 1P9MC 1Q4NX 1Z2KA 5AKTA 3EH1A 3MI6A 1G7LA 5TF1L 2VAAA 3T6WA 2QGDA 4RETB 1FN4B 4L4TD 3H9HA 3KDMB 1U8PA 1Y0LA 2F53B 3WJMA 4GW5B 1KZQA 3L9RB 4JDTL 1J8HB 3VU2A 2N7SA 1V7NL 2X4QA 4HGWA 3RRQA 3VCLB 5BXFB 3E6HA 1DJZA 5IEHB 3P9MB 3U6XA 4G5AA 3DIDA 4MA1C 3VXQB 3FRPG 3I50H 3KMDA 1PCXA 4M02A 3S8WA 5J5EA 4MJIE 3RTLA 4FQLH 4MAYD 3STBA 3WNNA 3O8XB 3QVAA 2PR4H 1GKOA 3GDBA 1F5WA 2HVKB 2XBTA 4Z7VA 4WZ9A 5J13B 5E8NA 3VWJB 2EDNA 2X3CA 1I3VA 2YD9A 4RSYA 3BHBA 3D39D 3FSOA 3VSQA 4F7EB 2Z7UA 1FFOA 4L5FE 3RWHA 4IGBB 2Z9TA 4H8PA 5LCVA 3IGAA 4ZW7A 3GSWA 1GYCA 1XGZA 3IS1X 3BE1H 3FT9A 2XYCA 4PB0H 3D18A 2IAMD 3TVMC 3FN3A 4NQVA 4Q8BA 1YJDL 4JO4H 1CU4H 1NGPL 2X2YA 3ARBD 2FT7A 2WZ6A 3WS6A 3WE6A 3QJHB 4UU9A 1BZQK 1F8TL 4RFEA 4GS7C 5HHQA 1A9BB 2GI7A 2GYSA 4H0GA 4PV9B 4G8FB 4JREB 3N06B 3TZVC 5IQ9A 5IG7A 1S3KL 2XETA 2VSMB 3ARFC 3PRZA 5D2LA 4KAQH 3A21A 1JIBA 3QHFL 4LVEA 2OMVA 1A6WL 2R29L 3KWVA 2EDOA 1QUPA 2BXYA 4LLWB 2W9EH 2W60B 5JXEC 3UL4A 3AS1A 2DL9A 1R3KA 3B43A 1D5MA 1VDGA 1IBDA 3BPLB 2BIPA 4DPAX 4YZFF 1URLA 1GAFL 3MNZB 3QIUC 2Y06L 2DKUA 1J9TA 1FFPB 1F3DH 2R2EA 5HI5D 3HA0A 2MIZA 4G7RB 5C9JA 3RG1C 1JGIA 1HILB 1YMHB 3OQRA 4BXVA 5D1XD 1P7KA 4KTEL 2EVFA 1YEIL 2V2TB 3IJHA 4Y2DB 3MCKA 3L54A 1A3RL 1Z9SA 3EH2A 1SLWA 3D33A 2WVTA 2V5MA 4XRCA 1UXSB 1CS6A 4L1LA 1GYUA 5E00B 4G8GD 4Y4FB 2N7BA 1WRFA 3IFLL 3WMQA 1FBIL 1S7WA 1J88A 1PKOA 1PW3A 2H4EA 4L1SA 1A5FH 2HG0A 2QR0A 3S3JA 4WI9A 5JQHC 2VKXA 1FZJA 3HS9A 3C12A 1E8XA 1P7QB 1B88A 3KS0J 4LCWA 3TZVD 1WZ1L 3DX9A 3UYRL 1I31A 3OKEA 4EPSA 4NZTH 2L4OA 3MJ9L 3ARBA 2NW2A 3LSOB 5DMYA 1DBBH 1MWAL 3D51A 5F3BB 3W0WB 3LRGA 3D0LB 4DP4X 3M7FB 4C57C 2AKRB 1EXUB 3VFSA 3EIFA 2VMCA 2DQIH 5HGHB 2K6ZA 2Q87A 3US1A 2MPAH 1DL7H 5LAPA 3AQDA 2F54B 1MW0A 4JFQB 2IAMC 3TVMD 4Q0XH 1H0DB 1WBZB 1XSKA 4E68A 1O6SB 3CSGA 3OXRB 2AJ3B 3CFJB 1S3RA 4B3EA 2OZ4A 1M7IA 1MCHA 3ECBB 1RZJL 3CXDH 3FZUD 1PFOA 1I1AA 3GNML 2ZG2A 3F83A 1OQXA 3SKJL 1MHEA 1S7SB 1KTLA 2G60L 1TQVA 3BUDA 4XMXA 3VFOA 4PV8B 4BRVA 1QFUH 2VR3A 3CFKA 1FI8C 4D8OA 4Y7OC 4GIPD 4DO5A 4K5LA 1N8ZA 3Q2WA 1EHLL 4H25A 4FHJA 2Z8VC 2VC2L 4HAGA 5CINL 2PUQT 4OF6A 5IMKA 3ZDYF 4FXGA 5DRZA 3ESMA 1OP3H 3MACH 3GSOB 4TUKL 5E2VH 3BAYA 2V5TA 5KYUB 4OD1L 1CN4A 4YS4A 3QUZD 1OB0A 2ZG3A 3LN9A 2FWSA 1FN4A 4HETA 1Z3RA 5GIRA 2R29A 4YDIL 3KPMB 4JFYA 4BH8B 4HPYL 4Z7QE 5ITBH 2YXVA 1PLGH 3SDXB 3UDWC 3VI3F 4K8RH 5C09A 3SKOA 1S7QB 2A77L 1RXLA 3NG5A 1RVFL 2IFGA 3F58L 5I8OL 2PR9A 2J8UE 3L9YA 5J89A 3BH9A 5J3HD 5IVXA 2N59A 3KPRB 5CCKH 3MTRA 5HHOA 1KLUA 3DIFB 2YUVA 4RWHA 3IMVA 1CLZL 3PXJA 2YC1A 4IRJB 3JV6A 2ZKYA 2DLTA 3F7KA 2Y0SA 5JPNB 3V4VA 4A68A 1XIWB 3H2QA 1OAZL 1JXKA 3JT2A 4DIXA 2P5WD 1MJ8L 1B4JL 5CIPB 4AYSA 2P45B 4PV1C 4WFGE 3X11B 3OQ3B 1N5YH 1CXHA 3ALXA 2P7TB 4DESA 3NP4A 3JTSB 4XO4A 3DX8B 4DEPC 3D18B 1TFPA 4B0MB 2NYYC 5CGTA 1HXMA 1FFRA 2KQNA 3BX7C 3PWVA 4KK6C 3S3BB 1NMCC 5LGYA 4NENA 1FZKA 4UDTB 3RDTA 1E27B 1EJ6A 1T6WA 5SV3A 1S8DB 4ORGA 2Y5TA 4L4TE 3MYZA 4NSKB 1P1ZA 1MI5B 3MLVH 4LCCA 1V3LA 2UZYB 3T0AA 5IQMA 3CN2A 1FVDB 4ZXBB 2NXYB 4QLWA 4B97A 3JZ7A 4JO8A 4X5XA 1OWWA 3TEYA 1XGUA 3IJEA 1N64L 4YL9A 1CFMA 2FWLB 3ZHKA 5BO0D 2HJLA 2R39A 1NBZB 3IDMA 3VSVA 3MA7B 3MGOA 1JGUL 4MQXC 4UT9L 4EXKA 5CCJA 3H3PL 3UTTA 3ZOAA 1XZ0A 2EDQA 2R83A 5E9NA 3SBQA 5TF0A 2Q5BA 4M5TA 1UURA 3T2LA 4IJTA 5MP6H 4AM0Q 5KS9A 2VNCA 1AY1L 3CMOL 3I6GB 4WWKA 4LQFL 4N2LA 2EACA 4GAFB 3WXVH 2EINB 4HFWB 1KG0A 4K71C 1DQJB 2HH0H 4PMFA 2BC4B 4JANB 3D39E 2Q3AA 3CQQA 3CH1B 4FLRA 5T1KA 4AC2A 1YEEL 2VMJA 1YNLL 1FLRL 3EJYD 3V6ZB 4NQSA 1LE9B 1FYTA 3FBQA 2HWZH 5FX3A 3IBOA 4M61A 4QHPA 2HKFH 1RZKC 3DO7B 1AQHA 3EOTH 3GHEL 4Z7OF 4W9FC 4X0KA 3R06B 4PIBA 3NFPA 1U4FA 2QKIA 4G6AD 4FFYA 4ZFQA 3OMAB 1O7SA 1Z3GL 2O6CA 1LM8V 2RFXB 3U2SB 2E47A 3ZKNC 5F9OH 4FAAB 2X4PA 4RISL 3O0LA 4AQAB 4M1DL 4U05A 4U1SB 3BXNA 4DN3L 4L4VE 3GIVB 2XYBA 3EOBB 4NM8H 4Y2OB 3ZKMD 2Z1PA 1EXUA 3VFSB 4CKVX 1MG2C 2LLGA 3RIKA 3ZE1F 4LCWD 3TZVA 1AH1A 1KOAA 1AP2B 3FONA 3S9DB 4HUKB 5IR1A 3W9EB 2XN9B 4DVRL 4ABUA 2JJWA 4TTDD 1ZT1B 2CO1A 1U8MA 1RKRA 2MOQA 2D3JA 5E4OA 3A6BL 4P59H 4BZ1L 3X3GH 4HC1A 1D6EB 1OLZA 1BZEA 3C2AH 3CUPB 3I6LE 4W6WB 1KNOA 3MTXA 3AUVA 5E8OB 1XF3B 5J12C 3K5SA 3QIBB 4X80H 4AH2A 3ZSSA 1DBMH 3ETBJ 3OPZL 5KN5B 3QUZA 4BFBD 3EAKA 1AI1H 5GGRA 1KUMA 3OF6D 4B6ZA 3NEXA 1CT8B 5BW7C 1U8IA 3PIQB 4FQLL 1A02N 1TEYA 4UDUA 1HN1A 4BDVB 4MWFA 3TP4A 2ARWA 2H0FA 1P5VA 1E3FA 3VNZA 4B9KC 1A7OH 2VM9A 5EUOB 1XMEB 4MD5B 4PI2A 3CXFA 4Y9CA 3G5ZB 1NWOA 4X9GA 3IT8D 4NOFA 4Q9BA 5CD3B 3VDAA 4FA6A 2AJYL 3NCFB 1C5CL 4J8QA 4H4NA 4AVIA 1YRKA 2CDEA 2DQ6A 3QIUA 4XCEB 1OSPH 1SDYA 4TTGA 3WLBA 4ZUSB 4AOFA 4HWEH 3FT0A 3U6RB 3AT9A 1F8TH 1HEZB 2GUOA 2DICA 4WI2A 3MBEA 2HLFC 2Z8WC 2EH7H 1OZTG 1O5DT 1UOKA 3FQWB 3S2AA 3CC5B 3UTZB 2XKNB 3C8KB 4NQCB 2A6JA 3MNVA 4JHVA 2HJKB 3LKQA 4PD4K 4NI3A 5DC4B 4EZKA 3G08A 4FNLL 1JZGA 2I9LA 3RWGA 3HBGA 3LIZA 2ED6A 3CFEB 4Z3GA 3L1EA 5F7DB 1BOGA 1ZLEA 2CHXA 2YPKA 2AV1A 5B39A 4JJHA 3KPOB 4JDEB 3MRIB 3ASNB 2GUYA 2X28A 3L95A 3NGBC 4ELMA 1W91A 1M57B 3QR1A 3U83A 4ECNA 4G1EA 2R4SL 5JPMC 5JXED 4TSAL 3HHSA 3FTWA 4IKKA 3KPPB 3QWOB 1TG8A 1WIUA 3K1KC 3NJMA 3U46A 4APQD 1C16B 1W2KT 1D7FA 1V3MA 1XXFC 1EO5A 5DJYA 4IBTA 4Y19A 4BE5A 3NCXA 3TO4A 1NC2A 4OCRL 1E8YA 3QDMD 4R0LB 2ATKA 3PL6D 4IOSD 2DKSA 1T1YA 2A0LD 1A5FL 4MBOA 2VDQL 2ADJB 4XN5A 2ZWNA 3OX8A 2JKXA 2R0WL 5TE6H 4JRYB 4A39A 2QBWA 3VM5A 3HZYB 4HFWA 2X4RA 3T6QC 4JANA 1BQSA 1DZ0A 4M7LH 1R3JA 4QUOA 4PP2B 4DUXA 3Q1EA 3CSTA 4A2GA 1TNNA 1PJ9A 1MY7A 2AXWA 4JG5A 1MVYA 1FNSL 1YNTF 3B83A 4AZ8B 3DVNB 4FTVB 4FXKB 4N86A 4WFFD 4MQXD 4CSSA 5JR1L 4OIFA 4QD2E 4J3UA 3LQZA 4JY5H 4PREB 4NWTH 2Y7NA 1KEMH 3VE0B 3QC6X 3T1FB 1WUZA 4MAYC 1HHGB 2F74A 2VDMB 4GFTB 2EDTA 4R4BA 4YJZL 1X5GA 4YHPA 2E27L 3RWFA 2FSDA 5LDUA 2WCSA 1JZDC 1X5KA 2DTML 2MQGA 5I1LB 4W9ZA 1PNCA 3CV5A 3EYUH 1AGDB 1YECH 3GUTA 4KK6D 3EYSL 2JKWA 3QNXA 1F6AB 5L7XL 1BXVA 1HJBC 3N40F 1QFUL 4U33A 1XX9C 4M5ZH 3VGFA 4DPRA 3IDGB 3LNHA 2WV3A 4NQTA 5DRXA 3WKMH 3BESR 1VZIA 4KDWA 1CLCA 5DMKB 3O6KL 1G4MA 2DEYX 4BH7B 4ONGL 5G4OA 1L9QA 5DD0H 5GGUB 1I1RA 1N70A 2YUWA 4HIHA 1G9ML 1EAQA 2UVEA 3QI9A 1XSOA 3TF7C 3T8VA 3MLZH 3OF6A 3A3YB 4Q6YA 1A0QH 1SLVA 3QIBD 3CTTA 3MREB 1HCFX 1X5HA 2X4SB 1A6VH 1OM3H 3E9UA 1KTDA 1XF5A 4JFZH 3UYRH 1BYNA 1O0VA 1QPKA 5SWSD 1FHNA 2NXZC 4X5WB 2X38A 2E59A 3O2VH 2Z31B 1XR8B 3HRZA 1T66D 4JRYD 1WC7B 5BV7C 2FD6H 2I69A 3ARRA 3FH7A 2Y4SA 3KLSA 5JMOC 4Y1AB 5E2TL 3QDMA 5HYFA 1VRSA 1WTLA 5JZ7D 1ES0A 4G9FE 1JFQH 1KLFA 4WJKB 3PJNA 3CDZB 1G7QB 3MLUH 3BKJH 4D0CB 3CBJB 5IESH 3L1FA 1H3WM 3T3PB 5EO9B 5JLZA 1WZLA 3KLDA 4PJ8C 3L5WA 5FGRA 3IBEA 1F58H 2NY5H 1HCZA 1RJZB 2VE6B 2Y3NA 3V0DA 4LCWE 4H44C 4OGQC 4R96A 3MLSH 4ZUSA 4HUUA 3DRQA 1DYZA 1I1YA 1T04B 2FT6A 2XPYA 4I1RA 4FMKA 4NNYB 5DCCA 2MMXA 5TH2A 3F85A 4ZUVB 2NR6C 1LO0L 4ZAKD 1PCSA 1YSOA 2F7RA 2WZ0A 1I9IH 5JPNC 2EEAA 3K74B 3HN8A 4M7KH 4PS8A 4ZW6A 4Y4KC 4MXQC 5BZDA 3MACL 5FO8A 4HZLB 1JV5A 2A73A 2XWBA 4KQ0A 3UTZA 3QZNA 3F2LA 5F6IB 4OZIF 1HDMA 1EIBA 2JQMA 5FYKL 4TUUA 3P2DA 43C9B 3U9UA 4YDIH 4Z1PA 3TEXA 3W82A 4ISVB 2GITA 3WIAA 1CFSA 3MBED 1QBML 3G3LA 4CMMA 1VEOA 2ZWLT 2CUAA 3GIZH 4NNXA 1Y07A 4WNSA 2A77H 5T3XL 1M53A 2HRPL 5MHSD 1NC4D 5LN4A 1A3LH 1KGYE 5D7HA 3D8MA 3FQ4A 3WNOA 3BGMA 3UJIH 2AQ1A 1J1XH 3HI6L 4OLXL 4PWGA 3WFCH 3PWLA 2YEVB 5I8CB 2O61A 3IRZA 2DPKA 4HLZG 2DB8A 4N1HB 1AKPA 3QEGL 3E38A 1GY1A 4KY1L 3H42H 2FATL 2FJHA 4DFHA 8FABB 1Z9OA 5T8IA 2VQTA 3WOVA 5D1XC 4I3GA 4M5SA 4OLUL 2F7PA 2IH1B 1HQRA 4AQ1B 1TU2B 2ICEB 1ZLVK 1OB1B 1OPGH 2GTQA 1N4XH 2NY3B 3TIEB 3ZBMA 1NLDL 4NDMB 3LB6C 3WBDA 2CKBA 3AS3A 1RZ8A 4B9PA 2EXWC 1KIUA 3RBSA 2IQ9L 3M1CA 5KOVC 1SY6L 3FQRB 3WY4A 2I07B 1KJ2A 4YEFA 1MIEL 4ABWA 1F4HA 1ADQA 3C6SB 1V7MH 4H8WH 3RGVD 3FQNA 1ACYL 3OZKA 5I8EA 4LDLB 1JGUH 3OR7B 3ZE2B 1IUZA 2UZYA 4R3SB 4DVRH 4QHLB 3WY1A 2ZXBA 5B1AB 1BBDH 1JZHA 4UF7C 1FNLA 2ZX6A 4OB5H 2F08A 4MNQE 3X3GL 4ETQB 3WTYA 4KI5D 1X44A 2L7QA 3L3DB 3PWPD 4CL7A 4H0LC 3NUKA 2Z3FA 2CGYA 5D1ZD 4NHCH 3IRCA 3KL5A 4MNGE 5E8DL 2CXKA 1NCHA 3QDME 4LQ1A 1ND0B 2C9SA 3GSRB 4OD2B 1BEYL 4XPTH 1KCSL 2J7LA 2YGOA 5FCUL 2H1XA 1D5BB 3RNQB 4F8PA 2FEJA 3AREC 5GRWA 2IDUA 5KW9L 2MHAB 3LZFH 1U8QA 4H1LH 4QOKA 1VGKB 2A6KB 1OAUL 2XWDA 1PYWA 1X7QB 4QAWA 4TNWF 5B1JA 2ITDB 4KKAC 4MA1B 5FDWB 4DW2L 4XNYH 2FBRA 4PG2A 1KGWA 1ZA3A 2FJGA 3V5KA 3T3PE 2WLKA 4NFDA 5E1AA 5D4HA 2H5UA 4HDIB 1NUFA 2EIDA 2N1KA 4PYHA 1S9XB 3MJ6A 3ORJA 3QUMA 1VSCA 3BAXA 1Y0LB 3BP7A 2J44A 5LG1A 4BZ2H 1T20A 2YD4A 4CDHA 4UTBA 4JFOA 3WN5B 4ALAC 4PJIE 2WLYA 2WMPB 3QDGB 3NCEB 3H54A 1CBJA 3VX1A 1UJ3A 1CYXA 4JO2L 1KIRA 1JK8A 2O72A 3LD8C 2CE6A 3UG5A 5I82A 4P9ML 3GGWA 4AMXA 3P4MB 4OJYA 5FYLH 2HVKA 4GS7B 4IRJC 1RLBA 4DGYL 1SEBB 4JDTH 1L0YA 1JCVA 1KFGA 4PJ7E 3P4NB 4GG6B 5DT1L 1UATA 1JZIA 3LNGA 2XKSA 3V0AC 1EX0A 3MLXH 1TFHA 3RPIA 4QHKJ 3H55A 2DF3A 4KQ3H 4YSSA 3FU7A 5C0EA 2ALAA 4M5YL 3E8UH 5JHLH 1IC0A 1QAWA 4M4PA 4F8TA 5E8EB 4OLVH 4Z78B 2IH8A 2RQEA 1W0WB 3I74A 1NFDA 1MVUA 4YSPA 2NX5E 3O3EA 1HHHB 4OFQA 4BZ2A 4XNUH 3US0A 1RUQH 1P7QD 2GK0A 3MRKB 1HCYA 3L81A 1TJHH 1E4XL 1X5FA 3TT3H 1QSZA 2JIXD 2FO4A 1G0XA 2YPLD 4FX5A 3NIDF 4IOIA 3WELA 4LF3A 2IANE 4K7FA 3VFWA 2E5EA 1TVDA 5EB9A 4JRYE 2FIKB 5C6TH 2IADB 3CVDA 1BVKA 1U6AH 1AE6L 2RR3A 5L6YH 2QHLA 4ZX5A 1QLFB 5CWSB 3T09A 2NY0C 4GUCA 3W3BA 5FUZL 4HXAL 1QO3B 3MPCA 4NN5B 4P49A 5HJ3A 2NUPB 1OPOA 1LO4H 3LPWA 5JNYB 4U4BA 3RTQB 3ZY7A 2PN5A 5TF1H 3QNZA 2H3KA 2R29H 3UZQA 2LTQB 2VLLB 4LPWA 1EDQA 1RJYA 3SZ6A 2NY2D 1IEHA 5I1HL 5B8CB 3QCVH 4AY0A 3GC3A 4R0LC 2GJJA 5J8OA 1KEML 1SYSB 4J1UB 2R56L 2ZCZA 2F5BH 4NYLB 1YN6A 1QSFB 1O9WA 5DJ8B 3OKKA 2A6JB 3MNVB 1A21A 1AGBA 1YY8B 4LVOC 1P5UC 4A7GF 3NIDB 1I7RA 3APCA 5HHMB 1HWGB 3TCTA 3WIIH 3QEHA 2QVFB 1KIUB 1T7WA 5DC2A 2P28B 1TYRA 5AB2A 2QHRH 4J12A 3O9WB 2GFBB 4Y89A 4JDEA 3RBGA 3WKML 1E30A 1WFJA 4LZKA 4FQ2H 2DDQL 5CN1A 2NR6A 5LHDA 1AOZA 5D71L 4KK8D 2GJ6A 5HDOA 2GJPA 1G9MH 4Y4HA 4NO0B 1PIGA 4MD0A 1YJDH 3FUHA 4JO4L 2WGXA 1Z9SB 2OAAA 3LV3A 2G5UA 2OW7A 2V7HB 4GKSA 3ZTNH 4C47A 2B16A 4HWBH 4PJEA 4OLZL 3IDNA 1CFQB 1N0LA 4R7NA 2Z92B 3W0WD 2H2SD 4WI3A 5C0GA 4FNRA 1DBBL 3MN8A 3ILDA 2X4TA 2TAAA 1B6UA 3W81A 1FV1A 1IGYA 3FN0L 4HGMA 1ETZB 3AROA 3PV7A 1PKQA 5HBBA 3Q6GH 4L29B 3Q7JA 1HWWA 5JR1H 2C34A 1A7RL 3M7OA 1BX2B 2P5WA 5HVGB 4EBQH 2HZHA 4K3GA 3MSPA 3ABGA 4JFVA 5LXGL 2EYSA 2QSCH 1R5WA 3ILQD 2ITDA 5FDWA 4M8QB 1ZWIB 2CSPA 1HZHL 3BUBA 4K7PY 3F64A 2D7MA 2QSVA 5C9KA 5F8RC 3ZRFC 3O3BB 2NTFB 4HS3A 3Q6FB 4NKDA 4TN9A 5KAQG 4ZMXA 3RUGA 2IALB 4XWOD 1F4WL 2UZXB 4F8QA 2QVMA 2A4CA 2YA0A 4IYKA 4Q4IA 5GZOA 4ZMNA 1KBBA 2RD0A 2P26A 4JHZA 5DMIH 2FJFB 3B56A 4J4PC 4OF0A 1UH3A 1R3IH 2HG5B 1Q1PA 2UWEA 5C08A 5ID1B 1LO0H 5FYLE 4PW3A 3PHQA 3VRLF 1WD8A 2NRDA 4FS0A 5I16B 5J9PA 4ONGH 5TK4A 3UH8A 5HD8D 5EOTA 4G2AA 5FGCB 5GRVL 5A7EA 4AL8C 4HIQA 3ZHNA 1X5MA 3VXSD 5EU6A 4DZBB 2JB5L 2PABA 4KROC 4U3CA 1IAOA 2R2BA 4HWUA 3RKDC 4BH7A 5CLXA 3O6FD 5F1OB 2VISB 3LVEA 1JN6B 4PJHB 3CZKA 1A9EB 3QPQC 4HA1A 3NACH 2L7JA 2Z8SA 2MTAA 4U0RB 2X1XR 2YOCA 3VWKB 3BWSA 4FEMA 5A16B 3UZEA 1FZKB 2YARA 4UDTA 3AG3B 1MVUB 3VMOA 1IL1B 4HCRA 3EH3B 1YY9D 2YXMA 3QFJE 1U93B 3EGDA 1T5KA 3UJIL 5JHBA 4N5UA 4KZEH 4QRSA 1E50A 4ODHL 4NT6B 5KJ7E 5C0CB 1DDHB 1UM4L 2E7DA 4YHLH 2VXQA 4Z0BH 3PL6C 3QXAA 4AV5A 4JGNA 1L3WA 1JFQL 2X89D 4PLOB 4KTGA 1N5YL 4KNQA 2BWQA 5GRJH 5EZPA 2Q6WB 4QRUA 1AANA 4LEEA 2YFNA 3MV7B 2B15A 1I9JL 2YC1B 3IEAA 3FOLB 4XBMA 5DMGD 5KS9E 2F8IA 1GTNA 1D7DA 3D3VB 3V4UH 2A2QT 5A2JH 1F58L 2NY5L 2FQDA 3RURA 1Z9LA 3GHBL 5TGBB 3C5ZA 4XP9L 4M4RA 1NIEA 4GP5B 5JOPD 2VC2H 5CINH 2E7LA 4PSRA 1RUAH 1S7UB 1LP9A 5ANHA 3UTSA 2H1LM 2NW3B 2PCPA 1A4KA 2XQ0A 3JV4A 2IDTA 2AK1L 2EDDA 4LLVA 3Q8BA 4TUKH 2MNWA 4ZQTA 2VDKH 2QLVB 3FT4B 4IMKC 3ARSA 1M4KA 1E27A 2MKWA 4HK3J 2DD8H 2DS4A 1B9KA 1QFWL 2AEWA 3SKUD 1GVIA 1ACYH 2VM4A 2JXMB 2VL5A 3AY4C 3UXFA 1JPSL 4LFHG 1IEBA 5F0LB 4JAMB 1GMIA 3WXVL 4XXCA 1QBMH 1PZCA 1BBDL 4MJID 5FO8B 2WP3O 1ODAA 5KVDH 5EF1A 5DZPA 5T3XH 3ROLA 3CLFL 1VENA 2FAUA 3MNZA 1RIVH 4XP6H 3HMXH 1I85A 2JKTM 4HIXL 3FK3A 4NUMA 4WNQB 3A4AA 3SQBA 1UYWH 4QYOA 1I4FB 1MI5E 1MREL 1SJXA 2VB5A 3BUYB 3C6LA 4GKZA 4OJFL 5HI4D 4D94A 5E08H 3GBMH 1MJ8H 1HI6A 3HI6H 4XB3A 3QNYB 1ASOA 5FCUH 5C0RL 2HJFB 3S2CA 2ID5A 2GJZA 4XNQA 2A3TA 3QH3B 4WWPA 3MO1A 1JGEB 2VXSL 4NRYB 1J5IA 5H4ZA 1B0RA 3MLYL 4LVOB 1CE1L 1I82A 1WD9A 3Q3GB 2CAKA 2GHWB 4IQHA 4MD0B 3H8NA 2YAHA 3DX0A 4XN8A 3LV3B 5TDNA 4OM1H 4O51B 3UGUA 4XCFL 1OTSC 3QDJE 4PJEB 3SDYH 5K9QG 2QZQA 5IBUG 1HE8A 3OAUH 4CUCA 5B3JE 4X7FC 1QYGL 4BZ2L 4IHOB 4MA8L 1DQLH 5D7JD 5I30L 1E7UA 1T0NB 1XQ4A 4Y5XA 1KDIA 5IB3B 4EIBA 1VZHA 3EUDA 4N0CD 1GGBH 1YUKB 4PJ7B 2BSDA 2CGZA 5E4IA 2G30A 3IGUA 4IBLT 5DEFA 1FL5B 3MV9A 4N2FA 4ZUUA 2CKBB 3HI5H 4WO0A 2XACC 3TFKD 2EECA 3S35H 2ILLA 4H1LA 3U25A 4X4YB 4IOFC 3CMOH 4AK2A 5E5UB 2DQHL 1NUGA 2UY6A 3QXDB 5D1XE 4N2GA 3EOBA 5DLLA 1MW2A 3LX9A 1HHIB 2I27N 1VADA 4OB5L 4G42B 2RJMA 5EUOA 3K4DA 2FTAA 2RIKA 3FONB 3AT0A 3O6LH 3H0TB 1JZJA 1P7KB 3HBQA 5DVKA 1KCWA 1YEEH 3EBAA 4QHLA 2OXGA 2ATPA 1BREA 3IMTA 1AQDA 1LO2L 1LD9B 1G7PA 1IMHC 2BVPB 2HWZL 3ABKB 2Z0BA 3ZK0A 3G6AA 3BWAB 4O9HL 4YPJA 1QPXA 1U41A 2HKFL 4AEHH 3DVIA 5A40E 4PGDA 4GAYA 3V5DB 3GI8L 1CLVA 5KZCD 4X6CE 1VFBA 3ZL4L 3KBPA 1AS8A 4XNYL 4J2XA 1C5CH 3GXDA 2DOCA 4FFVC 4OZHB 3RDTC 4QRTA 3FOMA 4TLKA 1IQWL 4S2SA 4BKLA 3NTCL 2MCG1 4XBEH 3ULAB 1HHKA 4PJ9C 1E7VA 1RZKL 5JW5B 3FW6A 2OYKA 3B1TA 1RPKA 4Q9RL 1P5UA 1P6FA 2X0WA 3M17A 2KPNA 2R2HA 3CZJA 5T5NF 1MRFL 3DKHA 3CN3A 5F8QC 3CU7A 4P2QA 4XCYB 2DEXX 2V7NB 5T1DH 4EI5D 4DF9A 4HWZB 3C09C 4ZNEE 1SFDA 1U93A 3EGDB 1CIUA 5GRVK 2KERA 2R15A 3ZT6A 3LS5L 4G1MA 3ESVF 2O6PA 4YSOA 1SXNA 3WS3B 4O58H 5J6HB 2EE2A 4UOZA 3DDGA 5EG6C 5I1HH 3QCVL 5FYKD 3AB0C 1CFTB 3U0PB 4Y19B 3I6LD 4XOEA 5E2JA 5MENB 2EJ1A 5JDSB 1SOSA 3TBWB 4RMTA 4O02L 3P4MA 3VQ1C 4X6BB 3RQ3A 3ME0B 4G7YH 3EO0A 1XR9B 1O5PA 1CXIA 1U58B 4F7PB 1XHHA 1HYRC 5BRZB 3WJMB 4UB0H 4J6RH 3D85A 4BJLA 2NYYD 1T1ZB 2WBKA 3GSVB 2YPKB 5HYQA 3DX6B 2R1XA 3FT4A 1H8SA 5LAXB 4UCFA 4OKVA 2PXYC 1SOKA 1YEFH 2A6IA 1H3GA 4ATTA 3ABLB 1K5WA 1NAKL 1FIGH 4KV5F 3N44B 4R2GD 4HJGB 2QEJA 3QZWB 2V2WB 3GJFH 4XC1H 3HZMB 4HJ0C 4E9XA 3VE0A 1IKFH 5IB1B 3FF7A 5I19L 3IDUA 2VERA 3OJDA 4JRXA 3AMLA 4RX4A 1KLUB 4QXVA 5KJ4A 3MJ7A 4K3DH 2IQAA 5CS7A 2QGCA 3ZQ9A 1GGIL 1JPEA 4LF3B 1BIIA 1FH2A 5DVPA 3KH4A 2EYTB 1XBRA 1CVRA 1FGNL 3VO0A 1SEQL 5IUSA 2ZSWB 3ULVL 1T7VA 2VKWA 4X6DE 4A2MA 3OLGA 2DQCL 1DQVA 1MUJB 2EH8H 5E2UL 3VTTA 3ZMNA 4DN4H 1F90L 1JXGA 4HX1B 4BFKA 2JJSC 2JTYA 2YKLL 2GJZB 2OPCA 4Z7OB 2CZNA 3F6IA 3QUZC 2ZF9A 3DX3A 4HSCX 4BKTC 3WLWC 4GSDL 3ULUC 2X9XA 4Y5YA 1G5GA 4I2XE 3U48A 4FKHA 1EAJA 2YAOA 3MRNA 3LH8A 3D50A 5DQDL 4HQQH 4JHWH 1FFNB 3SOBL 2ZAIA 4WGKA 1MJUL 1YJDC 3FTYA 5L2KA 1WA0X 4YNYB 3SDAB 1EAPB 4S1QH 5F2FA 3OAYK 4OI8A 1ZS2A 1GZHC 4QXGH 4KX8A 2WM0A 3DETD 2R0LL 3F12A 2A74C 4XCNA 3IJ7A 3GBEA 1ET8A 1JGVL 3CIQA 3WHXA 5A2AA 1T7XA 3O6ML 3Q2NA 3QEHB 3UZEC 1KCUH 3TA3C 2WLMA 4PPTA 1QWUA 5D71H 4Z3FA 2BCKB 4LGSB 2NY6D 3ZDZB 2F53E 3GUFA 5CBAB 1FNGA 2H0PA 1MI5D 2FVNA 3QXUA 2HX7A 1NJ9A 2ZKWA 3C5ZD 4QHUB 3BYTA 1Q9LB 4LEXH 3L5IA 3O2VL 4DKEL 5AW9B 5F96H 1JZFA 4HW6A 4P5MB 4XGZB 5CKGA 3BMWA 3R0NA 2P48B 5BV7B 3ISWA 2PETA 5ADPL 2O5ZL 1S9WB 2P80D 3N1QC 2FT8A 3WKPA 4NUJB 1JNNL 4Q9QL 3S3PA 1UASA 3QDJD 1CK0H 4AEFA 3TH2T 1FO0B 4WKZB 4LCWB 2Y1YA 3BKJL 4PRIA 4Z0BL 2WZAA 4Z7WF 3UGXA 4PCYA 3QZLA 4X6FB 4JHAH 3AG2B 3U4AA 1ZV2A 4JFEE 4URTB 4ZTEA 3KPLB 4G9DA 2J1YA 1IGJB 2CDGB 4PJ8B 3FQXB 4L4VD 4KZDL 5LCVL 5FK9B 5EUOF 4AIZA 2FWOA 4YSRA 4C56E 5HYSG 4MJJA 2KZKA 3RZCA 2EKJA 3P3UA 3R19A 4HS8H 5CZKA 4CMMB 3VI3A 4E9SA 1TVBA 4JM4H 4KX9A 1K5NB 2D73A 2HUEA 1RZGA 2YGQA 2NTFA 2QVKA 1T2QL 2R1YA 3RX8A 4NQDE 3RDJA 1YEDB 1HSAB 3BIKB 4Z76A 3FB8A 3MV11 4QXTA 2E7BA 3V8CA 3UG3A 3MCYA 5GSRB 5C7XL 3EO1B 3DHMA 2D7QA 1Q0XH 3SY6A 1S5IH 2DIJA 5TH2B 2WXOA 4YXHH 3P1VA 2I60L 4P23B 3D48R 4P46D 4PJCF 4UM9D 4F2ME 3VXMB 1JPSH 2YRZA 1JWMB 2WXMA 4BCXA 5DD5H 5DJDA 4D0BB 1D9KC 4HIEB 4JDVB 3OR6B 5L0QB 2BY1A 3L7FB 1TZ8A 1RIVL 5SWSE 4IBWA 5BVPH 2F8XC 4YSQA 4P99A 4F2EA 2LLNA 4YE4H 1HVXA 3PABA 5A2KH 1FNHA 2LGNA 4N3TA 2OQJB 5BS0B 1MHHA 4ODHH 3UAJA 5J4MA 3QEGH 4MAYA 4CSTA 4I5BB 4IGBA 1J5OL 2BP3A 3BEVB 3DECA 3T0DA 1AD0A 4U1JB 3Q48A 2VXSH 4I48A 5D7IE 2HUHA 3RJOA 3KCPA 3RX9A 4N9GA 1LDPL 2J4WL 2PO6D 4WTZG 4BQ9A 2FR4B 3MJ8A 5I6PA 4Z7UF 3QZMA 4GQZA 4PB9L 1REIA 4U1KA 4A2DA 4OM1L 3UEZA 4L1BA 4U1NA 4AEIH 2H6PB 4LIQH 5DD6A 5GGQH 2XRAL 2JI3A 2AAVA 3G6DL 1NCCL 4XP9H 4YR6A 3X13B 4MB1A 1U8LA 4FCAA 3CFQA 3F8UB 5BV7L 4XPAH 3K1DA 3FOLA 5E1QA 3CAFA 3KCWA 1L9MA 1ZAGA 3BLPX 4EI6B 2FGZA 3BUIA 1OGTB 5C0AA 4DP6X 4YDNA 2PPEA 3GSRA 5HDQL 1HXKA 4L3CB 5EZOL 2KHAA 4WTQA 1USQA 1A4KB 1S78C 4QIRA 5ICZA 4GXVH 3LCYA 3D09A 2DL2A 1AZRA 3L6FA 4OSUL 2W0FA 2W95A 2W81C 5CCGE 1AHWC 4WSGA 1A1OB 3O4OB 2FLMA 3FQTA 1YAIA 1GC1H 2D2CC 1TDQA 1NBZA 5JYLA 3OR7A 1L9SA 2OSWA 3K6IA 3SDAA 3T65B 1QNZL 4KK9D 3WFCL 2PPAA 3TPUB 3VGDA 3GT6A 4PGEB 4A1RA 3BJ91 4IMLB 4DQOH 5JXAH 4N3UA 1DBAL 5EUOE 2YSSB 3ARDD 3WAJA 3GB7B 1HX0A 3T2NH 1MZZA 4JY4B 3MLYH 4F1SA 1ZHLB 1F42A 1BVLA 1T03H 3HS0C 2OMNA 1FNGB 2WQVA 1OALA 1T7YA 2VAAB 1CE6A 1S5HA 5D5ME 5E94B 4XCFH 1LO3H 5LKNA 2BVOB 4IEFA 4F5CE 1UCBH 3EF7A 2DLFL 1SY6H 2AGJL 1QYGH 5FS5A 4PY7B 3CPLA 4OCYL 4MHHG 5E6IA 5IOPA 5HDRA 1OCZB 4PRHB 1FG2B 1PAMA 2R8SL 2BNQB 2AQPA 2F15A 3GXIA 3QUYC 5I9QB 4ZK8A 1N26A 3CHQA 4ZZKA 3LD8B 3GBDA 1MF2L 3ISYA 3X1FA 4L2YA 2WB1A 4EN3B 3RZCD 5AOKA 2JJSA 4TNGA 3QQXA 1F6FB 1GGCL 2XNAA 2DQHH 3VYPA 1DUZB 2OMWB 1QI3A 1KIRB 4PJDE 3ULVC 4X7CC 4YFLI 5E6ZA 3QQ4A 4ZZFA 3PDOB 3GSWB 2DQGL 5A2FA 1CGTA 5JPNA 1CD8A 3H9SD 1MDAA 4HIIA 1PFCA 4JG1L 4N5ED 1RUQL 2ZUUA 2K0RA 1LO2H 3GSXB 1TJHL 3FFDB 1HHIA 1CIDA 2F53D 4G6KH 1GOHA 5FGCE 3S5LG 3PLYA 4ZFFB 1RK7A 1GR7A 2CRIA 3L8QA 4KKQA 3MLPA 2BS9A 4IBQA 4W1TA 2WLHA 3G6JA 1C8QA 4HIHB 4ETYA 1ZVHA 4JDZB 2XI9A 5G5DB 3FKUS 3BRFA 3KH3A 3BYYA 1CR9H 2DY2A 3AXHA 4JFHE 1FPTH 1BFOB 1GSKA 3B7SA 5AALA 3SDXA 4FEIA 2PTUA 2AP2A 1XSIA 1OCCB 2XN9E 3TNMB 2QTEA 2OL3A 1CFNA 2E7MA 5D2LE 3TVMA 5MEND 2V3FA 3U7WL 1LO4L 4G9FD 2OZ4L 5I15L 3NSYA 2AABH 5HPMB 3CJJA 1F1GA 1KC5L 3MCG1 3CHSA 3WFHB 1CYWA 2KQMA 5IK3A 4TUJB 1RJLB 5TD4A 2V5SA 5J6GB 5F9JB 4A6YB 3K71A 4RWYH 4OUOA 3MMEA 3QHFH 3DVGB 2ZOWA 3DUSB 2EH8L 3I75A 3X1GA 5E2UH 1JPFA 3AG4B 1OF0A 1XO8A 4JRFA 3DV4A 3VYOA 4ODWB 1GYAA 4KKCD 4ZSOE 2WXJA 5EZJB 4KQ3L 5C8JA 4ENEC 2LR4A 3LRMA 1D2OA 2LW3A 4NQDD 2R7EA 4PRID 5BUPA 4X2UA 1KXQE 1UD4A 2CO4A 3SYCA 3ARED 3RP1A 4BELD 3C6LD 1FO0L 2EXSA 4BFIA 5CP3A 5D1QA 2CBMA 2FCBA 2OMVB 4FLHA 4U49A 5D1ZB 4ADJA 2I85A 4C83B 4GRLA 2IAMB 2OSXA 1DVQA 1HC1A 1T0MA 4UUJB 1YEGH 2Y7SA 1XGPB 1WJ3A 4K3HA 4NYLA 1OSZA 3TT3L 4CU6A 2K4WA 2E0PA 1LEGA 1SF3A 1XEUA 4HZLA 2I7SA 1RY7B 3LHPH 2E9JA 2VMFA 4G7SB 2AXFA 4MS8C 1VF5C 3VWJD 3IFPA 4AV4A 4AQEB 4BK8A 1V27A 3ARVA 2XWZA 3D0LA 4PB0L 3GYRA 3P9LB 4ZFOA 2C7FA 2IMMA 5AVUB 1UA7A 4AIOA 3DSNB 4PJFA 3V7AG 4W4NA 5AAPA 3KBFA 3OC8A 4P2OA 3N0PB 5FUZH 2O93L 2TSBA 3UYPA 4HU8A 2R1WA 5I19H 2HMIC 3DJRA 1J0IA 5HI3C 2DYSB 1O6SA 4K3EL 3RPBA 4G11A 1GGIH 4NHUA 3V6FA 2P5ED 4QGTA 4DKEH 1OF2A 4JEGB 1UM5H 1U3HA 4X6CA 1X9UA 1K8DB 2I7OA 3SY0B 4PJFF 1PS3A 5ADPH 1Y1DA 2OXHB 4Z7QB 4RA0C 2QSCL 2Z35B 4DN4L 4QY8B 3WENA 4Q0XL 5E03A 2ESVD 3GTTA 1EGJA 3JWDC 3TU6A 1HSBA 4HP5A 3VQMA 2IOMA 4RBPH 4Z8FH 3L3GA 3MRPB 4OCMC 1RQ5A 1IC5L 3IU4H 3QRGH 4LSPL 1ZHBA 2VLKB 4LLWA 5IB2A 3SKJH 2HPTA 1MJUH 2XHNA 5KYXB 5HI3D 1EHLH 5DJCA 4E41B 1HHGA 2PYED 5DMGC 1JPTL 3H7BB 4HJ0D 5CD5C 3MV01 1N6QL 4FQ2L 1DHKA 3FTUA 3OKNA 4R2GC 5DHDA 2JQZA 5E2VL 2W80C 2A1WH 3K46A 3MRLA 4MNQD 3DIFA 4KI5E 4KRPC 2VDQB 4R9HA 1LWHA 3VFMB 5IT2L 2CKNA 5JOEA 5IFAH 5C70A 2IDCA 3UTTD 4CN4A 4U1MA 2O26U 4N22A 4LNVA 5ID1A 3NFNB 3EW3B 4ZMVA 4ZAKB 2OCCB 4HFUH 4IGBC 2ZOLA 1WZ1H 5CIPA 4W9EC 3W0WE 3Q2VA 2VERN 1FF5A 3P4LA 3LMJL 3ERXA 1F0LA 5CCKL 2EC9U 2QELA 2VDOH 3ARZA 5ILTH 3QIWD 4GG6E 1UC6A 5F96L 1W9XA 2I32A 5KZCB 1CICA 2OSLA 1A7RH 2ZQKA 2O5ZH 4Q9QH 3FTSA 1PYWB 1X7QA 5HD8C 2VN6A 1MCOH 4QRRE 5KSBE 5JHAA 4KTDL 5CR8A 1J1OH 2VDLL 4HUCA 1I9JH 2N0KA 2F1AA 3ML9A 5AD0A 1A1NA 1KB5L 1LEKB 3BQUA 3FO0H 3P9MA 4HUNB 3E1ZA 4KUCD 2XZCL 2A6DB 4PJXB 3SE6A 2VDLB 2WIIB 2IGLA 4MKTA 5CJQH 1AXTL 1RUAL 3GMMB 5DJAA 2YIHA 1KJVA 4N2MA 5B7MA 3KGRA 2I9TB 5GISH 2DI7A 1R47A 1SQMA 1M6OB 4X8JA 1QZNA 4LNRA 1UOVA 5C2UB 5D6CB 5LBGA 4BUQA 5DQJA 1B0GB 2PWFA 5HDQH 2MCMA 5AB9A 4FXKC 4LDEB 1XT5A 4CDGC 1BG9A 1KWGA 1HS6A 4QI3A 2BPBA 1S5IL 3GMOB 2Y5TB 4J3OC 4WW2B 5MP6L 1A6PA 1R3JB 4M8VA 4I1NB 1RVFH 3NACL 4XP6L 3IK2A 1CFVH 4GKNB 5DD5L 3EG9B 2YD5A 3DBSA 5KJRL 2YPLE 1PNDA 4HUVA 1KXVA 5FA3A 2GSIB 1FORL 3GLZA 4OV6F 2A4ZA 2AVFA 5F7HA 3ABZA 4JZJB 3GJFA 1CFSB 4NX0A 5GRYA 5TPWH 1GJIA 1OL0A 1YO4A 2HT3D 3CVIL 1BJ8A 1OAZH 3BMVA 1QATA 3N41B 4V1DA 1P4BH 3TO4B 4MS6A 4L3FA 1T89A 4CADB 3ISRA 4EN2A 2VIRA 3HB3B 3GTNA 4FHBD 3ZZLA 1AZNA 3PU7A 1KN4H 3NT0A 3DUUA 4EVNB 3HNVL 4PWHA 1EERB 1JYNA 4MHHI 3UYPB 1DCLA 3LKRA 4Q9CA 5E2WL 1A47A 1SXSA 4XO5A 3UC2A 1NCCH 2DH3A 5FF6B 2XG5B 3AACA 3VRIA 1HXMB 5LNEA 2BS8A 1Q72H 2EIZA 3C5XA 3KLAA 4FG0A 1RPQA 2FHFA 3EDJA 4AQ8C 5PCYA 2KLSA 2L04A 2OXGB 4FQJL 4M9PA 2R8SH 4BK4A 2VR9A 3B2VH 3CVHB 1XH3A 2CBQA 1I3UA 5IV2B 5C08E 4IDJL 2P5EA 5MERB 5T3ZE 2FO1A 1E5ZA 3OGCA 2Q86A 3WNKA 5KVDL 4YHKL 3ZXAC 2F5AH 3HMXL 4XCCL 5D2LF 5FW7A 3JTBA 2FHCA 2XPGB 5D7SH 4X80L 4XZUA 4L0PB 4HH8A 4EN3D 4KJQD 1KYAA 1UACH 4H5SA 2MKLC 4LLYA 1I7UB 1VAHA 5J12B 1MPAH 4OJFH 3L6FB 1KGUA 4LOUC 4JVPA 1E9QB 4NN6B 4F2FA 1KBGH 5DDHA 4ZMTA 4FYQA 5BW7A 3MRQB 1FGVL 4FQCH 4KJPC 2I24N 1A8JH 1F11A 2OMTB 2RH0A 4NO0A 3BKMH 5EU5B 2G75A 3RGBA 1TTFA 1CR9L 1BW8A 2O1AA 5M94B 2RGSA 2AFNA 2PW2A 4PEEA 1RZKH 3SDCA 3L3IB 1X6NA 5E1IA 2K70A 3UAAA 3EFOA 5F9OL 3ML8A 4PJDF 2BDNH 3QPXL 1Y1UA 4DK5A 2LOEA 4WFED 3FCTB 4XHJD 3JVFC 5IMMB 4QT5B 3BT0A 1LNUB 1QWHA 2OLDA 3OKMA 3OKDB 4J2QA 1PD0A 4OCYH 4UAHA 2AABL 5GJTH 4EIUA 4PJEE 4H8WC 3PHOB 1OGAB 4ELDA 2YK1H 3POCA 1G9EA 3QULA 4AJWA 3S35L 1KBKA 4O58L 4RWYL 2IH3B 4QRFA 4KUCF 5AVWB 1XL6A 4KMLB 2APFA 5E6IB 5IOPB 1K6QL 2A9MH 1QQDB 1SRDA 2XKUA 3NN8A 4Y8AA 2NUTA 3LPOA 3HC2A 4GXUM 3SE4A 3VMNA 2C9VA 3N50A 1XAUA 2WO4A 3O6LL 2YBRB 2EDJA 4HYTB 1JL8A 4X8XA 2A6IB 5PAZA 5FYLD 3UTPE 2NOYA 1HXYB 3NDZE 4FJYA 4ES8A 4MZ3A 2E6JA 2ZKMX 4UQBA 4K55A 2DQGH 2ED8A 2CCWA 3FTXA 4LRIA 4PJ5A 4TSAH 1N2RA 1PLAA 1X4XA 2Q8BH 7TAAA 1WA1X 4Z3TA 4IKNA 4M93B 3BH8A 5CP7A 3SZKC 1FZMB 4ZOCA 2EAEA 4N8VG 3WS6C 4C58B 2BNUB 1KWKA 5FIEA 4TOYH 2NT0A 3G5YB 4FTVA 1IKFL 4Q6IB 4ZW3A 1ZDSA 5FM5O 1I8KB 3TO4C 3D69A 3HLKA 5I74C 1VGEL 2ZOTA 2DBJA 3RI5F 3UFIA 5DZVA 3IDIB 4Q6KA 1GW0A 2H2PD 2XN2A 5T1DL 1F18A 2X70A 1FFPA 1FGNH 2CNZA 5BS0D 1JRHH 3NZUA 2P1YA 3MLTB 3EXJA 1ILUA 4NT6A 2EH7L 2J20A 4QEGA 3QQ9D 5JIQA 1KZYA 1NC4A 4DOHB 3AAZA 5ANME 1J18A 4Y2DD 5AB0A 3EUUA 4OIBA 2CLRB 4MLIA 4A7SA 1RK0B 1PKQE 1J5DA 5CJ5A 4Q4EA 3DTDA 1WICA 2VIRB 5T1MB 4OTXH 1B4TA 5IG7B 1CTNA 1QVOB 3WEXA 3HMWH 3GLAA 1CGUA 1TTCA 1CXKA 3T0EB 3Q44A 4XO3A 1PX8A 3HAEB 3ARFA 4G7YL 1OAKL 3IJSB 4O51A 4E42B 1XMWA 4NSKA 2OKMA 1C1EH 3TXAA 4YSEA 3L3KB 3QO1A 4KY2A 1G6RL 4KDTC 1BM7A 2RQ8A 2OJZL 3Q5TA 1UQSB 1DN2A 3DOSA 1JI1A 5F88B 3UABA 2ZSVA 3O6KH 1INDH 1IKOP 4S1SH 3HR6A 3V7AE 1R5VB 4PJ9A 5I8KL 4PJDA 2QDWA 5HGHA 4R3SA 1PEZA 4FE9A 3BZ4B 4P3DA 2RB8A 5FDYA 3ESOA 4WKXA 5IT2H 1Q0EA 1LK2A 1Y7VA 1RZQA 4L8DA 4LMQE 3N04A 1UD3A 5EN2B 1XCTA 5AVTB 2AQ3A 4O2FA 3IF1B 5GZND 1WUNT 5DMKA 5GS0D 4HKZA 3CFTA 4PJCE 2EO1A 1JK8B 4H5SB 5BRQA 1FNSH 3LQAC 4M7LT 1E5BA 2J5LC 1Q8MA 1E42A 2NXZB 4AK1A 4GINA 4YHMH 2KT6A 2JIXB 3AITA 3FRUB 3MAWA 2XWJB 5I24A 1ZHKA 1S46A 4L0YA 3DSFH 5D6DC 4MCYA 1S4IA 4FXGB 2LE9A 4YIQB 2BIOA 5T1KD 4GSDH 4IU2A 2ZUTA 1J1OL 1PX3A 1TENA 4GT7A 1EJFA 2V5RA 4Y4KA 5KUMA 3CN4A 5KSAD 5D70L 2NSQA 3GLDA 5GZOD 2Z31A 3HRZB 1B2WL 1JV5B 2A73B 3OV6A 5FKPB 1KTJA 1UXMA 1I53A 4KROB 4WUKL 4XN4A 4ZXBC 3Q06A 4JM2B 2BIHA 4P23A 3TEZA 4KK9C 1CT8A 1WBYB 1TMCB 4NUPA 5B1CA 3MOAH 5CJQL 3P40A 3DURB 4LP5A 1DEDA 2IANA 1OP3K 4URKA 4X6FA 5DJDB 4YK4C 1EEYB 3SJVD 3V0HA 3FUKA 3B2UD 3KE0A 4FHKA 5J56B 4NN5C 2WBWB 1NFIB 1NGYA 1K8IB 2A9BA 2OI9C 2FQGA 5D93C 2BRRL 2RALA 1NM9A 1BA9A 1ZE3H 3G5ZA 3CFMA 3T3MB 1QNIA 2A1WL 1Q0XL 2WZ5A 1BVKB 3MUY1 3KBHE 4D7PA 3VI3B 2X4NB 3O81A 5H37H 2OL3H 3RB5A 4J39A 3FXIC 4HAFA 1EAOA 4FG4A 1UKSA 3O2DA 2XV2A 2NUTB 2H1PL 4F15C 1DQDH 1PTZA 2B4CH 1QLEB 3K7UA 4MCZB 4MXWH 4D9RE 1PEWA 3VGBA 1XCQB 4HFUL 4JQIL 3RGHA 4PGBB 1GS8A 2HLAB 4YH6A 5JDSA 3LMJH 3TURA 4LSTL 3FO2A 3ILPA 1F3JB 4UM9B 3SCMB 4TNWK 2K4AA 3QEQB 1CG9A 2MH4A 3UAFA 4D2NA 1ML0A 3N3EA 4X42A 3U6XS 4NNXB 1X5XA 3EJQA 1P4BL 3IJEB 3N42B 5FR3A 3OKKB 3DTXB 1NCTA 2AXHA 5A2BA 5B38G 5IESL 4K7FB 1DUYA 2H47C 2YPLA 4DPBX 3NIGF 4L3CA 3MRHB 1OARL 2ZP9A 3SDDB 4F7CA 4ABQA 1KLFB 2OV0A 3S5YA 4HS8L 2XZCH 2V33A 4CVUA 5EZLA 3HNVH 2WUCH 3T2OA 1OPGL 4YPGA 4GG8B 1JVLA 3IJHB 4H8VA 4Y2DA 2P8LA 3BPNB 1KG0B 1QBBA 2VUKA 3OAYH 3JQOB 3KJ4B 1E4KA 3TV8A 4MZ2A 4OD1H 5FYKE 1NBCA 2VLJB 2DQEL 3HEIB 4X4KA 1PU0A 3WY2A 5DRNA 4FQJH 2FRGP 1W8EA 4FFVD 5D2LB 3RDTD 4NNYA 3UTPD 4D9LL 1PLGL 2DMHA 3WTSA 1GJWA 4WK0B 4F7TA 2ENPA 5JW4R 3GXUB 5KVMC 3INUL 1O7DE 4BK5A 5I0DA 3B9KB 2GIMA 2VAJA 4Y19D 4Z7NB 4LNRB 2H0EA 5DJ2A 4U2YA 4LRNH 3BW9A 1YYMH 2J1XA 3K0YA 3J07A 1B0GA 3GMQB 4WO4B 1CTMA 2B7DT 4QXUL 4FA7B 4UQAA 1JMZA 2Q7NA 4KV5E 3B8YA 3L3KA 1WISA 3CZFB 2YAFA 3D4CA 4ZO7A 1IX2A 2YD7A 1RP8A 3RWHB 2Z64C 4PJEF 2J57A 3CVIH 3UO1L 1KBGL 1BD2B 5I71B 4Q7DA 2D7NA 4WVRA 2Z91B 1LVEA 3QO0A 4TNEA 4YHPB 2EDLA 5FPIA 1WHOA 3JYCA 3RGVC 3QYNA 1KELL 2ATKB 1JGDA 5I26A 3T8XA 4CBPA 1LK2B 4AEIL 5KYWA 5DHMC 3VX0A 1LO3L 1ZT1A 4FLQA 1SHSA 4YE0A 5LGJA 5EORL 5DHYB 1IGCL 4LHUG 1AC6A 4PV9A 5J0BA 3NZHL 3RA7L 4QHNB 3P0GB 4NBZB 3WV0A 5I6MA 1KPRA 5E2WH 3QRBA 4EDXB 2N01B 4U0QB 4Q74A 4QOKB 3IRPX 5GJSL 5K9QI 3HN5A 1ZPLA 3SDCC 4W6XB 3OZ9H 2BP5M 2VJXA 3PDOA 4JFUA 4AIEA 4UT9H 5GJTL 1HL4A 1F97A 3AY2A 5EC2A 4Y9GA 1T0OA 2J72A 3GF8A 3KXFA 4P9MH 3KWUA 2ARJA 2XG5A 2VR6A 2GTZA 2X12A 1KFAL 1WK0A 2IMNA 3SPGA 3WN5A 4DGYH 1KCBA 1EDYA 1PY4A 1AGEB 4NUQA 2DLIA 2ESVA 5DJ6A 5I28A 2X88A 3G5VA 5DHVB 2XPZA 1MCDA 4IOSA 4NKDB 3MLXL 2OMYA 1A4JA 4QKXB 4ILDA 2JB6A 1JNJA 3EF4A 1G4RA 3IJYB 4UTBH 2J8UA 2FJUB 4AM0B 5DEGA 4APQB 1R5IA 2LV4A 5DZOA 2XZQH 4OLVL 3QUXA 4PRAA 4RMVA 1NAMH 4KITB 1BG1A 1BEYH 3U6RA 1N59A 4DQOL 3FSZA 1A1MB 4OCWL 4ODVH 1RZ7L 3UDWA 5AENA 4CJ1A 1VERA 5E9DE 1ND0A 3SE3A 1FPTL 4RNRB 4LMQI 1KJMA 3LEVL 1NGXB 3Q0HA 4F58L 4NI6A 4OF3A 2EILB 4RFNC 4L9LC 4NJ9H 1IE5A 2WLZA 1UWEL 2DYPB 3NCBB 3U7WH 2YHGA 4O02B 3WUWG 2A38A 4I87A 1IM3B 4JQXA 4Q52A 5ENWB 2FQFA 1NFDF 4NM8L 3QPXH 1NOLA 1YZZA 4JCMA 1KC5H 2ISDA 4OF7A 4UTAA 4ENED 3QJZA 1HZLA 3MRIA 5GGSB 1UXLA 3VRJB 2YBGA 3AREB 4KFZC 4WHTB 4LPTA 2YK1L 2XTLA 2E9WA 3L5HA 3IKCB 4JO3H 2PCYA 1NQBA 4RIRA 3V4PL 3CIAA 4UOW0 5H2BB 3VJ6B 2YMOA 4LCVA 2F58H 1OSYA 4D0CA 2A9ML 2H2SC 4P2QB 3PV6B 2F5BL 4XCYA 2K78A 3EGSB 4OTXL 2QPFA 3SDAC 2H3NB 2HFTA 3BH4A 3FTVA 3OPZH 1BF8A 4LPXA 4R0LA 4AI7A 2COVD 4S0TD 4GMTH 1AZBA 5EZLB 2GJ6B 1BQHG 3EGXB 5EO0A 1G7HB 3H9SE 4G6KL 4ZUWA 2VDRB 2V9UA 4QDGA 4YWGH 4KO9A 3X13A 1L9TA 5DZAA 5I8CA 5SWSA 2NX5D 1OK8A 2Q8BL 3PUUA 5HDLA 4NHUB 2O6EA 2ZWKA 3JWOC 2X10A 3EO1A 1IAMA 4BFIB 4LEBA 3RVXD 4GXUN 1IGYB 5IQ9B 4PJ5B 1G84A 1RU9H 4AQ1A 4LSQL 3D3VD 2X6BA 4OR1A 5C6TL 1UD6A 3FC8A 3GZKA 4YFEA 4XX5A 3BPNC 4Y5XB 5CJ8A 3ESUF 3TEWA 2OJEA 1VGEH 5I15H 2JCWA 5F72S 4B9ZA 4KRPB 4N0UA 4M7JH 4D3CH 3HTLX 3FQUB 4KXZH 5TE7H 4PCKA 2YD2A 1E8WA 2ZXQA 1JRHL 1E9OB 2HT2D 1F6AA 5I1JH 1TETL 3T5WA 3X1EA 2UUDH 5D7JB 5DZ9A 1MSPA 3S36X 4NZRL 4DP2X 3RTQA 3D1MC 2X4UB 2CHZA 2ITCB 3PFUA 2WXLA 1JPGA 5F1IB 1KNOB 3TEUA 3B5TA 4PRIE 3UOAB 1DN0B 3JV5A 4PREA 1B2WH 3SKNA 2R4SH 2AK4A 4TMPA 2Y3AA 3RX7A 3MOAL 2JKRM 4N26A 5IJKC 1A7NH 1VKXA 5E8PA 2LTQC 3G5XA 5AVZB 5AYTA 5D7KD 2GCYA 1E4KC 4U1LB 1FUNA 4XMKL 3TN0D 1EPFA 1NGWA 4ZUUB 3WIHL 4JW3A 4L3AA 3K81A 3N6YA 2DQTH 4W9KC 3KYMB 3F7VB 1ZS8B 5F7WC 5T33H 3OWRA 3ZIMA 1OAYL 4I4WA 4OLZH 5DUBB 4DPCX 1K2DB 5EBLB 3LNDA 3ZE1E 3RY6C 2VR5A 1JGLH 2G9KA 3J8F7 5LG6A 3QBTB 4OZGA 4QLRA 3FCUB 3GJEA 4Y2DC 3JWNH 4PN6A 2NYKA 4ZXBD 4U31A 4ZMQA 1GH7A 4JY5L 3H4HA 5GZOC 4BIKA 2C3WA 3AG1B 2BRQA 2QQNL 4YDVB 5D93B 4AKOA 4N2IA 2XC8A 3F5WB 4R7DA 4DSYA 4ZT1A 5CLZA 3VYNA 1NJ9B 3NGBB 3S35X 4JL2A 3VRLE 4X4MA 1PG7H 2ESVE 5GRJL 2ROXA 1L4IA 3CFEA 1D7CA 4APXA 1HZHH 1BVLB 1GYWA 1MNUH 4K8RD 1P0SE 4ANXA 4LKCA 5F93C 1QA9B 2B14A 2D0HA 4Z7OE 4WHDA 1W72L 2X40A 4UOJA 2QQKL 3HC3H 5JW5A 1AXTH 1F4WH 5HI4C 2BX5A 3GHBH 5D55A 3ULUF 4HCGA 3S8GB 1KTKE 2ZZUT 1QSEA 1CDUA 5ECGA 3PWJA 5GISL 5EF2A 1NGQL 1RIHH 2NY0D 3CZUB 4G5ZH 5I18L 1C16A 5DD0L 5LN8A 4V2BA 2VDKL 4IOIB 4EIGB 2DQEH 1UB6B 4DJMA 1OCWL 3P2BA 1I3GL 4RFNB 5C0CD 1FAKT 3QHTC 5IFAL 5J6HA 5LGKA 5C08B 4QRPA 3KPQA 1G9NL 3G9AB 4E5XB 2Q2EB 2PW1A 4NP9A 4UTAL 1CFVL 2B4CL 3VXSE 3CDCA 1BECA 1Z5HA 1QTSA 3L3JA 3OBAA 2F1EA 4PS3A 3VA2C 2H6UA 3CX5K 3DX8A 3D2UB 3CLFH 1BJMA 1TO4A 1WH0A 5CEZE 3JT0A 3EO0B 3H3BC 5TE4H 5FECB 3PGDB 4KI1A 4CGTA 1ZHNB 5BRZE 3A4DA 4IRSB 4JFHD 4PJ5E 3WFDL 1NC2D 3GMPB 1RULH 3MV8A 5ETUA 4OZIB 1R3KB 4RDBA 3KPPA 4KTDH 4JGMA 2EVJA 3FHEA 2W60A 3QUXC 1WBXB 2OX5B 4PW9A 5JXEA 4E5XG 1K3IA 3QEQA 4HJGA 4N0UE 1A3QA 2CDEB 2GSGA 4N1CA 2R27A 1J12A 1JXJA 5E9AA 3BP5B 3GK8L 3KJ6H 1E67A 4LSDA 2WTOA 4L8CA 4PGZA 3VWKC 2WUCL 4OF8A 2HRGA 2TRYA 4OCLC 3RA7H 1E2WA 2MJWA 4MRCA 1DUYB 2BIQA 2YPLB 1UXWA 4M7KL 3GS0A 1IU1A 2ED7A 4BFJA 4DP8X 5JOPE 3SDDA 2YD0A 1ZLWK 3CC5A 4WTZA 5TQ0H 1UT2A 1IM9A 3TYFA 2F54D 2RHEA 5F1NB 4JFDE 3SBRA 2VLLA 4KROD 1MLCA 3SGDI 2UXFA 1KLGB 1HOCB 3QW9A 5ANMA 3ZMRA 4FFWD 2AJZB 4OW6A 43CAB 1K9TA 4XMUA 3SPCA 4YHKH 3E6FB 4DEPB 2AV1B 4LASL 4TQIA 3CVBA 2CRMA 5AVRB 4UMGA 4ZSOA 3VXOA 1VHPA 2C9XA 4ODUB 1OGTA 1ZHBB 4JFXA 2AQQA 1ETJA 3ARBC 5K33A 3NJLA 4JAMA 4JQXC 1OSZB 4OLXH 2XZQL 1UFGA 3OGCB 3QJVB 4QYAA 4XC3H 4YLCA 5HYIA 1J48A 3ZDXB 1V05A 3ROOA 2UY6B 4O9HH 2IOIA 1ZDQA 4GYBA 1U3ZA 2BC4A 5C0RH 1YYLH 1G9HA 3GI8H 1XB3A 2PKDA 3BKML 2HA1A 2J6EL 4OLUH 1FC2D 3B6SB 5AWNH 2CMRL 4LCUA 3VXNB 3FYIB 4G8IB 4F58H 2P5EE 4AQ1C 4CNIB 4QHKI 2E6PA 5DVLA 3UPCA 4XBEL 2BHYA 2BDNL 1R3LA 3G6AB 2CM5A 4GQQA 4Y0GA 2HG5A 2UWEB 4HT1H 2QZ5A 4MA8H 3U9PH 4XGZA 4MZRA 3I85A 1MRFH 4FXKA 4QJ3B 4X4ME 5EU5A 4QJ4B 5EDSA 5TDNB 4JKLA 1V7ML 3D2UD 1A2YA 4H8WL 2NX5A 3BDYH 3KR3L 3VFVA 4BHUI 3EYVB 3GO1H 3OZ9L 1C9SA 1GGBL 2WKGA 4NOBA 4JG0H 4JQIA 4AKQA 1S5HB 3SEPA 4Y1AA 1E28B 3OLEA 3VFRA 1L7IH 4W81A 4P0DA 2B59B 3EBHA 1K6QH 3LEXA 1Y6KR 2B39A 4KJPD 5C08D 3V4PH 3L3OB 1R5WB 4QNPF 4P9HC 1AR1B 3NIGB 2XTJE 2HX9A 1ZGLM 3PHOA 4PJIF 5DURB 1UJ3C 2PYEE 3KDPB 2EDFA 4MJ5A 2V2XB 2XJLA 1RJZA 4GMTL 1CD1A 1WGOA 3V4VB 2ZXEB 3H3KA 4ZMLA 5CD3A 4PJ6A 4XPTL 5A3ID 2JK5B 3VD1A 4YHZH 4IRJA 3MUZ1 4RGMC 3B5HA 2UXGA 4AV0A 4MAYB 1JHTB 1X5JA 5C0DB 2YMXL 5DQ9B 3WE6B 3CZSA 3SPHA 4ZW8A 3V6OC 1OAUH 3H0TA 1MFBL 4M29A 4OFVA 5EU4A 4AEHL 5I76A 2WNWA 2CHDA 1MCKA 2DQFB 3UAJC 3S4SG 5K9KA 3ZLQC 5BOZG 1NAKH 1S8DA 2FECL 4NKQB 4AQOA 3RVTD 1JWMA 4MXQD 2AEOA 4NJ9L 3AWEA 3IN2A 4RRPM 2DM4A 5DK2A 2HYMA 4PTUB 3UTSB 3L9BA 3BHBB 4K3DL 4A67A 1G7MA 4Q9RH 4ZNCD 1ZD6A 1NBYB 4JJ5B 2D03L 5D9SA 3IDMB 3OMNB 3SPVA 4KK5C 1SEQH 3ULUL 4P2RA 2DYPA 3GMPA 1B3IA 1E90A 4TVSa 4L8BA 5DZLA 1F90H 2DWDB 1JZEA 2WBXA 3OJDB 3QJHA 4G43A 4JRXB 3RFZB 2XWXA 2DWEA 1QHPA 3LKPA 2UZIL 1T0PB 2HT3C 3RWJA 2CJSA 2WSDA 5KSAA 2B9BA 2WTRB 5D4IA 3ELAT 1OAKH 1KSRA 3MRJB 3ASWA 2VN4A 1KGJA 1AO7B 3ARDC 3K3QA 4H88L 1UD5A 4RZKA 4WK2B 2CIKB 4I0CC 4X83A 4BWTA 4LLQB 3IAPA 3PS6A 4GKSB 4QYOB 5AB1A 3QAQA 3RVWC 4MA7H 4MJIA 5C86A 4G6ML 4HWBA 2XQYK 2PCPB 4KU1A 4YWGL 4UB0L 2OJZH 5FYJE 3DO7A 3BDBA 4OJDH 4J3OG 3NA4A 4QRQB 5DO2D 4MJHA 5DMJB 3T0EA 1VGKA 3S3DB 2BP0B 1ZLVH 3HFML 3T4AC 3FH5A 3PE9A 3ARUA 3O6MH 4LHUD 4YMPA 1NDMB 3DVNA 3BN9C 1AIFA 1SYVB 1CE6B 3G9VA 5FFGA 4NWUL 4R97B 4ZMAT 1B6DA 3E3QC 3OHMB 2F54A 3OSVA 1S78D 1FVCA 4CA4A 2FSEB 2X9ZA 2FLRT 4GIOA 4U1HA 5CFHA 1H9DA 4HWNA 3JTTA 4KBPA 4KX7A 4AQEA 2VZ1A 4KKPA 4M7JL 4D3CL 1JGLL 1QUNA 2VDML 2WNGA 2DMKA 3VSUA 1JNHA 2VTFA 3E80A 5AZEL 5I1JL 3IB4A 3DSFL 2QQNH 3E3QE 3U36A 5B8CC 3RGVB 3C6EA 4KKBC 1KDJA 2QFRA 5FGBC 4BE6A 3DX1A 1EGJL 3ARXA 4L29A 5SV4A 4J3OF 3OB0H 4IU3B 5SWZA 3B3BA 3HLAB 1AQDB 2AEIT 2G2RB 4GI6A 4JM2C 3SDCB 4A66A 1YEIH 4JFQA 1DE4B 2BY0A 4I13B 5E51A 1TJIL 1XCQA 3T3ME 3IVKA 4FDWA 2Y72A 4HS3B 4LGPB 1NOAA 1MXGA 2HLAA 4QXGL 4S1SL 3RUGB 4P4KB 2OTPA 5KYNA 4XMPL 3GSNA 1KCUL 3NJFA 3QULB 2H32B 3IGFA 4JO5A 4MZIA 4ZUTA 3FOMB 3X1BA 5C7XH 1IVTA 1AZCA 2H1PH 3FRPA 1DQDL 4BKLB 2OL3B 3HB3D 4KKLC 5D7EA 1EEYA 3UG4A 5JHLA 3CZGA 3QHZL 5T33L 2YWYA 4UTAH 3NSJA 1URIA 3DYMA 4NZTL 2X05A 4MMZA 1HSAA 5AAMA 2AJXL 2W0PA 4HWZA 4MYPA 5ALCL 2VE6A 1IM3D 1C7TA 1SQ2N 1LD9A 1PZDA 3KPMA 4JFYB 5AUMA 1T2XA 2PWEA 5EIIB 4TQHA 2WP3T 3FCGA 2MPAL 5D5MB 3REWA 1CK0L 1U8KA 5D1QE 2JNZA 1P1VA 3BP4A 1IGTA 3E9TA 3CFNA 1IGFL 2IFFH 1TQTA 5MEQA 1PG7L 5D70H 1X5ZA 1S7TB 1X4ZA 3O9WC 1RZJH 2G5BB 1DVFA 4JFED 4KZDH 1GGUA 2NY4D 4S1RH 5K9JL 4AXWB 1HH6B 1UJTA 3L4VA 4AVHA 5JQ6L 3HC0B 3I02A 4PMEA 1IEAA 1HL9A 3T0EE 1XIWA 2QLYA 2ZYRA 1M71B 5IMMA 2ZWZA 3G6DH 5CWSA 4C56D 5E8NB 4EMZA 1UB5A 3SJVE 5EO9A 3RWEB 2WKOA 3DJSA 3MUGA 1XCXA 3FB5A 3OZLA 4WCYH 5TQ0L 3H2WA 1CUOA 3U7AA 4Z77B 3K71B 5JW3L 3ECUA 4YPGB 1NH6A 1OCWH 1OW0A 3QZWA 3C5ZC 1G9MC 5ITBL 4MB3A 2IBZX 4JGUA 5DGRA 4GW5A 4UU9B 4GXVL 4I2XA 3VU1A 1QSVA 2NY7L 1H15B 4D9RD 2Y23A 4A7UA 2GW5A 2GTWA 5L9DL 5E8EA 4Z78A 4AT6A 4W9GC 1QFHA 4X0KB 3Q9QA 1CO1A 5DC9B 3GXMA 1WFMA 2C26A 3ZPDA 5F3FA 1XZ0B 5DR5L 1JUFB 2UYLA 1HEHC 1IBZA 3FUEA 3PXLA 4X5RA 3T1FA 4K9JA 1OXYA 3V10A 4IHOA 2WQXA 3RFZC 4IRZH 3B3IA 2F74B 4R4BB 3S6CA 3ROLB 4MD4B 1KEGH 1NCBL 2C9AA 1KIPA 2HN7A 2VRQA 3I9IA 3L4CA 3SGKA 1BEXA 4WV1B 1DBAH 3QFJA 5D7IB 1KELH 1YPZE 1YYLL 2M2DA 1HL5A 3AM8C 2ZOKB 1OARH 2Z31C 4KRMB 4PJ9B 4F3FB 4HG4K 3EO9H 2AJVH 3CHPA 5ID0A 2B1AH 3KXFB 1N0XH 5AOZA 1D5ZA 5BS0E 1AQ8A 4ODBD 5IM7B 1GPOH 4PB9H 4UOW1 3JUYA 2AK1H 4MJ2A 4ATWA 2XNAB 3EYFA 3Q01A 1DUZA 1INQA 5D2NA 2R2CA 5T5NG 3WHXB 4ANKA 5BNXD 1E9PB 1NDGB 2Q20A 3F3HA 1MXDA 3U82B 3VD3A 3EJUA 4DUVA 4PJIB 3QJSB 5KAQF 4YX2L 1N7MH 2YR3A 3H3PH 4AUJA 2J8HA 4PY8J 4H0HB 4Z7WA 4B9JA 4EF3A 3GSXA 1AG6A 4IRZA 5MEOA 2DYPD 3MCLL 5KSUB 1S7RA 4N6RB 1KBWA 1QLEL 4P5KB 4AYEC 4OSUH 3QZBA 4UYPA 1YYML 5C7ZA 1ANUA 2WXFA 4Y4KB 4V11A 4Y16D 3TX4A 1A6AA 2WYTA 5FO9A 1R33A 4QXUH 3TH3T 3UBXB 4Y2NA 2JJVA 2WLIB 1H8LA 3R8QA 2CXGA 3L45A 4JRWA 1IL1A 1FLRH 3UC0L 3QUMB 4OZFA 1OHZA 4YHZL 1HEJC 3ARWA 4RMRA 2FJFA 5B39G 4HC1L 4ONFH 3U4BH 4PJBB 3UO1H 2VW6A 5FUCE 3LNFA 3BP6B 2H6OA 3A22A 4PJHF 4GUPA 4JPQA 4XPB