4DP9X

The 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 6.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin A, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp9X00
4N4YB 2EILB 3DIVA 2VM3A 1AS7A 4K9JA 2XUWA 2HZHA 3UADA 4DPBX 4HCFA 2IH9A 1E30A 4YSCA 3IN2A 1KBWA 4UF7C 1ILUA 4P5SA 3WG7B 1JXGA 3MX0B 1L9RA 1QNIA 1PZCA 5I6NA 3QQXA 4A67A 1URIA 3GYRA 1OV8A 1A8ZA 4YVNA 4NB7A 4GP4B 1AQ8A 1ZDQA 4E9WA 3ASOB 1PLAA 5D4JA 2GI0A 2QPEB 3S3BB 1XB6A 3N55A 1L9TA 5PCYA 1PLBA 3CZUB 2Q9OA 2EIJB 3N2JA 2UXTA 3FQYA 1OOWA 1MDAA 2PPFA 2YAOA 1ASPA 3H4HA 1QLEB 4GP8B 3DKHA 3TASA 3GDCA 2AVFA 4GY4A 3PXLA 4A2EA 2XV2A 1ADWA 1OCCB 2YQBA 5I26A 1GS6X 2XLLA 2WO2B 1PNCA 2R7EB 3NSCA 4KO9A 2VW6A 1TKWA 2FT8A 3CVDA 2P80D 1WA2X 3V9CA 1CURA 2UX7A 3X1FA 1AS6A 1AZUA 2GHZA 2XX0A 4WTQA 2WSDA 5FC9A 1NWOA 2FQDA 3NJHA 4HAKA 4DP9X 1ZPUA 4QLWA 1L9SA 1WA1X 1KDJA 5AZUA 2HXAA 1FWXA 3GXUB 1A4BA 2AANA 1OE1A 2DYRB 3QJSB 1PCSA 1AACA 4HCGA 2QPDB 5B7FA 5IY5B 2CALA 2VM4A 4GYBA 5ANHA 2H3XC 1A4CA 1AZCA 3UAAA 2BP8B 1BEXA 4AI7A 2FT7A 1W6WA 2EIKB 4DP7X 3ERXA 2X87A 3UACA 4BDVA 1L9QA 3T6XA 1CYXA 2BWDA 4AZUA 1BQ5A 3FS9A 5B1BB 2PPAA 3CVCA 3EH4B 2VW4A 1RZPA 1AZBA 1PMYA 4G7SB 3WKPA 4A2GA 5B1JC 1SF5A 2BP0A 1M9WA 3KW7A 4KNTA 3X1BA 1AOZA 1ET8A 4G7QB 1JVOA 1GY1A 3JTBA 4E9QA 5I5MA 2MRYA 5B1AB 1MZYA 1OCOB 5I6OA 2JKWA 3NJJA 1NICA 1RCYA 2YXWA 2EINB 3FT0A 1NDTA 2MTAA 1JXDA 1HAWA 3TA4D 3FYIB 1OCRB 2HRGA 2XXFA 4DPCX 4GP5B 6PCYA 1JERA 4CSPA 1GSKA 3AG3B 1KBVA 3EHBB 1GR7A 1GY2A 4DP6X 1PAZA 1QHQA 1OE3A 2A3TA 4PAZA 3PAZA 1J9SA 2ZWNA 1CC3A 1W6LA 1A3ZA 2X88A 3C75A 3NSYA 4E9RA 3UABA 2DWTA 1BXAA 4E9SA 5PAZA 2YAEA 4YSOA 4M4RB 3CDZA 4BXVA 7PCYA 1FFTB 4DP8X 3PCYA 3FU7A 2LLNA 3ZX1A 1CUOA 2UXVA 1AG6A 5D4IA 4YSSA 3EF4A 2EIMB 5I6KA 4YSEA 4KNUA 2W88A 1KGYE 2IAAC 3QJVB 1BXUA 4BWTA 1EZLA 2H47C 1KDIA 4YSPA 3WI9A 5I6MA 1X9RA 1UATA 3V9EA 3ABMB 2XWZA 2XVBA 4UAHA 1BAWA 2VMJA 1AG0A 2BHFA 4WKXA 1J9TA 4E9VA 4FA7B 8PAZA 1PZBA 3SBQA 1MG2C 2FQGA 3FU8A 9PCYA 3L45A 1A4AA 3OD3A 4DPAX 1NIFA 5A7EA 2CUAA 2JFCA 5F7AA 1XMEB 3UGEA 3EH5B 2FWLB 1SFHA 2VW7A 2IDUA 2YAHA 3PLYA 1TEGA 2HX9A 1WS8A 2B08A 1RKRA 4YSAA 4DP1X 4GXFA 1SDDA 2OCCB 4ZK8A 1PNDA 1NPJA 3WNJA 1ASQA 4KOCA 3X1NA 3NJLA 4DP0X 1E65A 2CJ3A 4G72B 4A2HA 3NJNA 1MG3C 1J5DA 4AKPA 2DY2A 3ASNB 5EHFA 5B1KA 2BW5A 2YAMA 1JZEA 1X9UA 2FTAA 1JZFA 1V55B 2CAKA 2TSAA 2TSBA 2XV0A 2VN3A 2AZUA 4YSTA 1BYPA 2QDWA 2HRHA 3X1GA 2AFNA 2Y69B 4E9XA 2UX6A 4F2EA 4KO7A 2XV3A 4F2FA 1JVLA 2J55A 4L0PB 1SNRA 1VLXA 2HX8A 2CCWA 3NT0A 3QJQB 2NRDA 1I53A 2FNWA 2FQEA 2XXGA 1HAUA 1NWPA 2XX1A 3ABGA 1ET5A 2JXMA 3SBRA 3AY2A 3RYMA 3TBCA 4CSZA 2AZAA 4YSRA 4JHVA 2J56A 5F7BA 4NAJA 1J9QA 1BQRA 4F7KA 2W8CA 1JOIA 3EH3B 1ETJA 3D12B 1N68A 2YAFA 4UANA 3FPYA 1JZHA 3QJRB 4YL4A 2IH8A 5TK2A 2XYBA 1ILSA 4G71B 4QKTA 3NJMA 4ENZA 4HZ1A 3AG1B 1PLCA 2PCFA 3FYEB 1NINA 1EHKB 4AX3A 5AKRA 2FT6A 2UXGA 3AZUA 1JZIA 3FU9A 2PP9A 3TBBA 4BDVB 2PCYA 2FJSA 3FQ1A 3FPXA 1L9PA 4BK5C 1NIDA 2UXFA 2BZ7A 1JZGA 2BWIA 4E9TA 3X2QB 1ASOA 2PPDA 4X4KA 3HEIB 1AZRA 3OMNB 3ZDWA 4Q89A 3WNIA 1L9OA 3T9WA 1V10A 2BP0B 4HCIA 1XB3A 2BZCA 4G7RB 4FAAB 3HB3B 2FQFA 2I7SA 1F56A 3NYKA 4HHWA 3BVDB 4HIPA 3T6WA 1BQKA 3S3DB 5LDUA 1OCZB 1AAJA 3T6ZA 1WAEA 4JKNA 5B7EA 2Y1AA 3IBOA 3KW8A 3AW5A 3S8FB 2J57A 3JT2A 2XU9A 3WIAA 1SJMA 1IBZA 2R7EA 4W9ZA 5D4HA 2CBPA 3PPSA 4KO5A 2PP8A 4Q8BA 4BXSV 1SFDA 3NP3A 3CG8A 2YARA 1TU2A 5I6PA 2PPEA 2IDTA 3G5WA 1GS8A 5I5JA 1V54B 1OE2A 2PP7A 2YAPA 1BXVA 1WA0X 2QT6A 3T6VA 5B1JA 1OF0A 3ABLB 3U25A 2P80A 3NJIA 3FSZA 4DP4X 3OMAB 5TK4A 1M56B 2HLEB 3QJTB 4NERA 1KYAA 3PAUA 3FSWA 2GC7C 2ZXWB 3TU6A 4P5RA 3CDZB 4YVUA 4MFHA 4A66A 3IN0A 4G70B 4A68A 2J5WA 3FU7B 3IEAA 1KCBA 3H56A 3NSDA 1J5CA 3OM3B 2IDSA 2I7OA 2B3IA 1NIBA 2BP8A 1ET7A 4KOBA 1JZJA 1NZRA 1PY0A 3BQVA 1ZIBA 1AANA 2BW4A 1NIAA 3OMIB 1NPNA 1SHXA 3FQ2A 1WS7A 1PZAA 3MBWB 1DYZA 4EF3A 5I6LA 2GC4C 3FSVA 1IUZA 5B7MA 1E5ZA 3NSFA 2HX7A 3FSAA 3S3CB 5B3SB 1DZ0A 3SBPA 1GW0A 2YXVA 4BWUA 1BYOA 2GB2A 3AG2B 1KV7A 4BWWA 1AR1B 2GIMA 1E5YA 2E86A 3X1EA 4AKOA 1MZZA 1SHWA 1SF3A 1YLBB 1ZIAA 2OJ1A 4KO6A 2QDVA 1A65A 3QJUB 4YSQA 1M57B 2DWSA 3ZIYA 1B3IA 1R1CA 2GSMB 1ID2A 1KCWA 1HFUA 1IBYA 2IDQA 1AIZA 2PLTA 5I5IA 4PCYA 1PF3A 1SDDB 2N0MA 2IWFA 1FA4A 4A2FA 3ZBMA 2GBAA 4DP2X 2DV6A 2VSKB 4TXVB 2H5UA 2ZONA 7PAZA 1CYWA 4JHUA 1W8EA 3OQRA 1AZNA 3NJFA 4E9YA 3H4FA 2BO0A 4W1TA 1IC0A 1N70A 4AKQA 3NJKA 3SQRA 4HHGA 1ZV2A 2IDFA 4RH4A 3CVBA 3DTUB 1ZDSA 2Q5BA 2WO3B 4YSUA 3AG4B 3NJGA 1IKOP 4N8UA 2RACA 3S8GB 1GS7A 3QPKA 5I28A 5AFAA 2YAQA 2ZOOA 5E9NA 1NTDA 3WKQA 2DYSB 4DP5X 1E67A 3ABKB 2IWKA 3IE9A 3NP4A 4KNSA 1AS8A 1J9RA 2OV0A 3PAVA 3UAEA 1TEFA 2VSMB 4YSDA 1NIEA 1XB8A 1RZQA 2I85A 4M3HA 2PPCA 4A2DA 2IWEA 4HALA 3T71A 1T5KA 1JXFA 6PAZA 1GYCA
chains in the Genus database with same CATH superfamily
4NO5B 5L4MA 4LKCB 4UBDD 3WEXB 2XUWA 2ZUXA 4EZMA 4QHMB 5IHWA 5KANI 5BRQA 3N9GL 5KS9E 1PTZA 5AAMC 3MNVA 4UT6L 3HLAB 4W9EC 1D5BB 2DLGA 5J11B 4C57C 4HG4J 4GB9A 5KSBE 3CBJB 3ARZA 4L3EA 5F0MB 2CMRH 4K3DL 1B4JL 2O6EA 1CXIA 3GO1L 5KOMC 2D4FA 2FX8L 2CCLA 5L9DH 4S0SD 1FPTL 1J1XL 1XB6A 4XN8A 2XY1A 3WN5A 1AGDB 2P8PB 5EU3B 2AJUH 4JM4L 4FYSA 2QHRL 1X3DA 3IU3A 4ODSH 2XY2A 1U3HD 3ATFA 3DTDA 3OB0K 4PS8A 3QVAA 2DH2A 3QZWG 2EUVA 1IFRA 5A16A 1GJIA 1XSJA 3Q9PA 4PG2A 3FFCD 4DGVL 3DRQB 3GI8H 3C6LC 2CIKB 4MB1A 5LGJA 2FO1A 3LEVH 3ELQA 5C0DB 2EUXA 5DO2D 3LZOA 5ICXA 3ISWA 1RZGA 2EDEA 3DDFA 3IFPA 3ROOA 2ZZUT 1AHWC 3QCUL 1OPOA 4R97C 4HQQH 3KMDA 2G5RA 1AZUA 1FL3A 1YNLH 4JL2A 5E7BA 4QRPB 1NWOA 1IM3D 2X1PA 4B9ZA 2V17L 2V7NA 2VTFA 1G0YR 4N2GA 5JXAH 1OD9A 2IAMD 2P5WA 3QDGB 4A2MA 1G43A 3A6OA 4QAMB 1IZKA 1MKFA 5DEFA 3FTGA 5IBLD 2F74B 1SOSA 2R56L 4K8RD 2E74C 5ANHA 1PZ2A 1A4CA 1O7SA 3EDDA 1K6QH 2ATPA 3UPRB 4POZD 2CG9X 2FR4A 3IDMA 2YEZB 1X5IA 3A5VA 4K7PY 1IKFH 2VZ1A 1M7DB 1T1WA 4KHTH 3IFLL 4NIKB 1C9SA 1MLCB 3OJDA 1L9QA 2C9XA 3ZDXF 4OD1L 1SEBA 3JWDL 3QG7L 4K94L 4LSSH 1C12B 1LGVA 1OARL 4X0NA 4OZ4B 4PJAA 4OZIE 3DO7B 2XYCA 4PWJA 1BQUA 5B3JF 4KKAC 3S35L 2A9AA 2LU3A 1T80A 1LYQA 3BZEA 1BEYL 4Z9KB 5HJDA 3IM1A 1R47A 4PVBA 5BZXA 5TGBB 5DEZA 2E9JA 1T04B 4YNYB 1N8ZB 4PJ5D 2VO5A 3HMXA 4G8GA 4LQFH 4E9QA 1Q0EA 2VDKH 5HI4D 4PI0A 2PWEA 3DV6A 3GB7B 2WXLA 3NAAH 3MV9A 2EO1A 2VQUA 2L8AA 1WITA 1EUUA 5JOPD 4Q9RH 2H2PC 3DXAE 3V5DA 3WY3A 3TA4D 1QD0A 5GRVK 1NKRA 4QRPE 4RGOL 3BUPA 2X1WL 4CSPA 4ANUA 4L37A 1GR7A 25C8H 1NC2A 4F1SA 3JTSA 4QTIH 2EDXA 3K4ZA 1EIBA 1G6RH 4Y4KB 3HMXH 3QIBC 4GMTL 1EVTC 1PEWA 5G5DA 1OAYH 3QULA 2PTVA 1N12A 3R0NA 4M8UA 5FHAL 3RWFB 1P6AB 1FJ1B 3ZE2E 5E5UB 2DWTA 4DFIA 4NQXB 4AGNA 2DQTH 3HN3A 4GRMB 1WCBA 3ZDYB 4JVWA 2C1OB 4HUNB 3X13B 2DMBA 3GMLA 1OP5K 2VLJD 3NCYS 4JFPB 5CGYC 5AVQB 3W5MA 3MOAL 1NC4B 4HS8H 3V10A 2Y7QB 4UUJA 2Y36H 3SO3B 1MW1A 1PVHA 1VIWA 2CRZA 2ARJQ 1INEH 3MLXL 3JV4A 3SD2A 4ICWA 2H47C 5AW4B 4UMGA 5BS0D 2IF7A 4OFPA 4JM2B 3TTSA 1QUPA 5DO8A 3WMPA 2CKBA 4AQEB 3VW3L 5TH2A 4P49A 4XPGH 4GXVH 4ELKA 3MRBA 4LFHD 4UT7L 4ZDHB 2QQNL 3TWYA 2FH8A 1ONQB 2A5UA 2P42B 2XTJB 4LLQB 5HGGS 3SBQA 3NCCB 3LKRA 4JGMA 1CTNA 2DKSA 4FQ1L 5JHBA 2APWA 4Z7QF 4GT7A 4DPRA 1UA7A 5EZIL 1AE6L 1O6SA 3EH5B 4M43L 5F9OL 3D3VE 2NCMA 4PIBA 4IOFD 1SOQA 4PJFE 5FXCH 2OP4H 3K2UL 1NL0L 5FFOA 1ACZA 4M1DH 4OFDA 1MJ7H 4KVPA 5AW1B 2CKBH 4ZUUA 5FKAA 4ZTOL 3K80A 4L3EB 1NUFA 4Z3IA 3ZDYE 1AP2A 1CYGA 2QJDA 3HBQA 4DP0X 3ABZA 5ISZA 5CINH 1ND0B 3WN5B 2R2HA 1MCOL 3D1MC 1J5OH 1IL1A 2DJSA 3HBGA 1CBJA 2BJML 2CAKA 3IU3B 2XWJA 1FG9C 4YO0A 2BS9A 2UWEA 1NBZA 2V5MA 2VUYA 4YSTA 4OJAA 2ZPKH 2JWYA 2GSIA 3CK0L 4NZTL 5A16B 2DQUL 2NR6C 1X44A 1LWJA 2LU4A 4I2XA 2BVQB 4KHXL 4DKAA 4JQXA 1LE5A 1IE4A 3SGJC 1I9JL 3AQXA 5LGJB 3HZYA 3GC3A 1UFUA 2HFEA 5CEZH 5ICXB 4X7EC 1RZGB 2JKRM 3IFPB 3ROOB 3KEDA 1KGCD 3WXVH 2WGNB 2ITCA 3I02A 1WSST 1YEJL 1FL3B 2F15A 4JG0L 4QO1A 4N2HA 1X7TA 5IK3A 2GBVA 2QGDA 3VMOA 2ADFL 3AY2A 4JUSA 2Z7WA 1ACCA 4P4KD 2E7MA 3RYMA 2DQIL 2V7NB 4HXAL 1QUNA 2AXFA 1IGML 2P5WB 5CBEA 5A3IC 3BKYL 2W9DL 2YN5A 5DEFB 3FTGB 5EZPA 2ZSWA 4N1CA 3ARXA 2GBTA 5EF3A 2OXGA 3LY6A 4YBQC 2MOGA 4DKFL 2ATPB 3MUY1 2FR4B 3IDMB 4L3EE 3JUZA 2ICWI 4WFEE 2JQZA 1EHKB 2ICWJ 3ZIMA 1T1WB 5JNYA 2J8UF 3OJDB 3T4AC 5GS0D 3MXVL 1SEBB 3P3RA 1L9PA 4MVBC 3CMOH 3LXBA 3DVGB 4PJAB 5CJOH 2IPTH 5LNEA 3V7MA 1G1CA 1USZA 3AS2A 3P0VL 5KVFH 5KZCB 4Y5VB 3FCTA 1V10A 5JIQA 1QSZA 5DJ8A 3VXMA 1TQTA 1MW3A 3CC5A 1UD5A 1BZOA 3TYGH 4G8GB 5DMIL 4IJTA 5D70H 1TJGH 1Z9OA 4F80A 4A04A 3ZL4L 5F9WC 2F5AH 3UBXG 3DV6B 3WTUA 1WO2A 3T6ZA 3MV9B 3QPQC 1SVZA 1A3LH 2XETA 5IBTH 4F7PA 2Y1AA 3IB4A 3KPOA 1QFWI 4HKBA 4WTZA 3V5DB 4YH6A 2EEXA 4ERSL 4AQAA 5JO5A 4QRBA 1JZ4A 4Q8BA 2BSDA 2XJLA 1ZXQA 3SE4C 1CTMA 4L37B 2QPSA 2XZCL 4R4NC 1NC2B 2CO1A 3JTSB 5DFAA 3MRNA 4U6TA 1ZD6A 5L0QC 4WWNA 2AEPH 3R1GL 2P5WE 1G7LA 5CZKA 1QNZL 2X9XA 5G5DB 3LXUX 3QULB 1WICA 3WFEL 3NJIA 4DP4X 4Y89A 4H25A 1KYAA 1KNOA 4NZRL 5E00B 3FTZA 4AJVA 1WCBB 1E7VA 2NY5L 4HD9A 3GMLB 3LHPL 1KXHA 2Y4SA 4LEXH 3HS8A 3CLFH 1CGWA 2K1MA 3ME0A 4APQC 4U0RB 3LKOA 3KCWA 1L0QA 1TO4A 2ESVD 4PJAE 4UV4L 4UUJB 5BUAA 5CD3A 4KOBA 4YPGA 3EJPA 3N0PB 1JZJA 1NZRA 1PY0A 2VN6A 4OGXH 4KZ0A 1NCBH 3JV4B 5GGTA 4NQCA 1BOYA 1HCZA 4DEWA 5DU7A 4EF3A 5I6LA 3G7TA 4PJHB 2ALWA 4G8GE 4PJEA 1EHLL 3TV8A 3WXWL 4HSQA 3RQ3A 3QUYC 2CKBB 2CQVA 2B1HH 5TH2B 1S3KL 2FEJA 3MGOA 1DZ0A 4ELKB 3MV9E 3MRBB 3SPVA 1MXDA 2ALAA 3GSVA 3PUCA 2IBZY 3UZQB 4BCYA 2E4TA 4ADGA 2WMPA 2HLFC 4OCYL 4WWKC 3N1QC 1SF3A 3GFUA 1F58H 4KZCA 5FHBH 3RDTA 1N0XH 3S88L 1O6SB 2LR4A 2AAVA 3WLWC 4PTTA 5I1HH 3TBSA 3UEZA 5LQBH 3GKWL 3MUJA 4NUGH 3NG5A 5E6UB 3K8LA 4JGJA 2NXYD 4ZUUB 4NKQB 5FKAB 4YUEL 1WT5A 1OTTD 3O3AA 3CN4A 4LU5H 1YO4A 1AP2B 1CO1A 5F3HA 1EAOA 2HN7A 3BE1L 3ZBMA 5ISZB 5JDSA 3KYKH 3T6QC 2ZONA 5IB3A 2R2HB 1VEMA 5HVFB 1VDGA 3GT6A 2A6DA 4ES8A 5H4ZA 1IL1B 1Z9MA 2XWJB 1P5UC 2DI7A 4L1HA 5C0JA 1LP9E 4YO0B 5GRUH 2B59A 2UWEB 2W81C 2GSIB 1UM5H 1NJ9A 4I2XB 3AG4B 2Y7SA 3FB7A 1LE5B 2V5RA 4ZUTA 3HZYB 1SPDA 3MFFA 1DEEA 5A7BA 2HFEB 4WJ5A 5C0EA 2YAQA 4XWGH 3GSRA 1KBPA 4BFOA 4DP5X 1GYUA 4J3OC 5FM4A 2MQ3A 1MIMH 4XOBA 3I02B 2JKNA 1E4KA 3L9YA 4X80H 3HS9A 3NP4A 1IIKA 3PDGA 3KLQA 1ZMYA 3GRWA 1LO5A 1F6AA 4KK6D 4QO1B 5IK3B 4ZFOL 3PAVA 5HGHB 1FVCA 1MREL 4IRJA 4JCMA 2J25A 4HPOH 5ACLA 1WBXA 3LTVA 3ESPA 4L4TA 1QUNB 2AXFB 5CBEB 4URKA 3C6LD 1FLRH 4KK5D 4XN5A 4QRFA 2LU5A 3BRGC 1X5ZA 2ZSWB 1F1DA 1KELH 4NN5C 4OCLC 4HZLA 5K5YA 3HA0A 4YL9A 3Q1EA 5BMFH 4JQIL 3TEYA 2KERA 4MAYC 1O75A 5DCCA 3GRWH 5JNYB 5LN8A 4ZMWA 2XWTA 1O9ZA 3VWKD 1ILUA 4LLAA 3WG7B 5ISZE 1F3DJ 1JXGA 3CHPA 3BWAA 1EPFA 4NP4L 1G7HA 4LPCA 1NCDL 3KL0A 2VDPB 2NXZC 1BD2D 3ZTNH 2Y3NA 5CCKH 1ZWIB 1KEMH 1X7SA 4AUYA 1JD7A 2UWEE 5DJ8B 3GS0A 1FNGA 5SX5K 3VXMB 2IFFH 3CC5B 4Z0BL 5DMYA 1DVZA 3WS6C 5HPMB 4I2XE 1KV3A 3F65A 1DN0A 1OKEA 5D96B 2YAOA 1YPZB 3WELA 4UZUA 3ZHNA 4F7PB 1UEYA 4NBXB 2AHIA 2FHFA 3QRGH 3FMGH 3KPOB 4HKBB 4KKAD 1CR9L 2OJZL 3F7VA 2VDRL 5JO5B 4AQAB 4WSJA 5JIKA 4Y8AA 4AM0A 3ZYZA 4J6RH 3UIZA 3Q44A 4TTDC 4HFWA 4S1RH 3MRNB 1UEMA 4EN3D 1OAKL 1TT6A 3PG2A 3AITA 4K55A 5FFGA 1CURA 2KDYA 1G7LB 3K0YA 4IK6A 4YXHL 1MCSA 2CR0A 1P84J 1I75A 5KVFE 4FULA 5EC1A 1A9VA 3NZHH 2NY3B 4H25B 1KNOB 2CK2A 3H1ZA 5JXEC 3MUHL 4JDZB 3QJSB 3WL9A 1SBBA 2A9MH 3ME0B 4Y16C 4Z7NE 3LKOB 4I77L 4LVHC 7FABH 5AVZB 2ZX6A 1RK0A 3HTLX 3QIBD 4JO4L 1QASA 2JSFA 2ZJSH 2WSKA 1TYEB 4IS6A 5CD3B 1O6TA 4MMZA 4YPGB 1KJ2L 4DN4H 2L7QA 1PFOA 5DRZA 5C70A 3WY4A 1MFNA 3X17A 1CYXA 1TJHL 3O0RH 4NQCB 3VXME 3OPZH 4YFDB 5GS2H 3HLKA 3S37X 5B1BB 4PJBF 1MJJA 4RWYL 4QUOA 5FYLE 4YHOH 4OM1H 4IHBA 5EB9A 5K1NA 3WKPA 3MGOB 4P5TA 3SOBH 2WXIA 3SPVB 2UVEA 1KULA 1MJUH 3GSVB 1HWWA 2YMOA 5T1KD 1TCRA 3AGWA 5C0CA 4OLUH 2QSCH 2WMPB 3B9KA 5B1AB 2FE0A 1OCOB 2K9UA 3V4UL 1WHOA 4HOXA 3WAJA 5JIPA 3RDTB 2JKIS 2OFQA 4LVEA 5F3BA 4PTTB 4AYGA 5GHWL 3TBSB 3FUKA 4AV4A 2B20A 4NZDA 1ZLWH 3T0WA 2GI7A 1WP6A 1T20A 4GP5B 5ACZA 3O3AB 1F4YH 2QGEA 1GY2A 2JKLA 2MSPA 3OC8A 2ZCZA 3WDJA 4YBHA 2WSPA 4KUCD 2Z7ZA 2HN7B 5F3HB 1HSBA 2VZOA 1XIWB 5JDSB 2PYEB 5IB3B 3SE9L 3EBIA 4W93A 2Y7MA 2A6DB 3GWJA 3MJ9H 1YDPA 4RAUA 3RPKA 5PAZA 3HN5A 2FGWH 1YEKH 3GUFA 2YAEA 4JAMA 4YSOA 3GK8L 4N1EA 5C0JB 4CMMA 2B59B 3CDZA 3B43A 1RU9L 3L4TA 3PCYA 3OAYH 1QHPA 1NJ9B 2LLNA 2JE8A 3ZUNC 5ADOH 2PUQT 1CUOA 1KY6A 2MPAL 3FB7B 3VD3A 2X4QA 4MDIA 1YRKA 4MXWH 4ZUTB 3MFFB 3QQ9C 1DEEB 2J44A 2JH2A 4XO4A 4FLSA 4WJ5B 4PJEE 5I1GH 3QEQA 3GSRB 3UTQA 1Q1JL 5EUOA 3ZT5A 4GQZA 4HWBH 2UVFA 4IDJL 4L1DA 3EJYC 4JCLA 4PRBA 4ZFGH 4OZHF 1LO5B 1F6AB 1KIRA 2V5YA 1FVCB 4IRJB 3ABMB 2DI9A 1WBXB 1ZXKA 2NR6D 4L4TB 4W9LC 1UUNA 3KWXA 4WI4A 3U4BH 1C7TA 4XTRC 3QPXL 2XBDA 3G08A 1PZBA 5FYKL 1PZ5A 1QVOA 2F2HA 4HZLB 2OMTA 4BD4A 4LHQB 5CR8A 3T77A 1MFEH 1Q8MA 1NEUA 1QW9A 1HHJA 3RBSA 4WJKB 1P4UA 1PZSA 2Z3FA 3B34A 3ULUF 2QVFB 1XT5A 1CI5A 4OFYA 2H0JA 2IDUA 3VTAA 1KYFA 2XWTB 5E1GA 4O2FA 1D9KA 2CR6A 3U2JA 1FRGH 2ZP8A 3BWAB 4BQ9A 3HC3L 3UZVA 2VKWA 5A3ID 4GW5A 1G7HB 4OVVA 1J8RA 3Q5OA 4UOZA 5EBMA 3KWTA 2E8ZA 4X5WA 3QI9A 4YBQD 2MKLC 1FNGB 4CILA 1J5DA 4TSCL 4OGQC 4LRNH 2BW5A 3MLYL 4YEEA 1U3NA 1DN0B 2VAAA 1DN2A 3K6OA 3H8NA 3BT2L 3E0GA 4LVOB 3LRMA 4MVBD 1KT2A 3O6LH 4N22A 3ZRSA 3MNMA 4EUPA 2P44B 4LCCA 3M07A 1DQLH 1F5WA 1KB5H 3F7VB 3IMSA 4QJ3B 2G4EA 3ENEA 3S5YA 1VFBA 4ZX5A 4WDIA 4AM0B 4F9LC 5CJQH 2XN0A 2F1EA 3DK0A 4YMPA 4HFWB 2FX9L 3EXLA 4ZXBC 5CLTA 1MCWM 4O02L 1HAUA 1NWPA 4NO2A 3P30H 2EE3A 2WLNA 3SDDD 1WFUA 2VC2H 1IGFH 1NDGA 2A38A 3ZDZE 1H6FA 3I6KA 4Z3JA 3DX7A 4H8WH 1THAA 5EC1B 3KPSD 2AZAA 3UCRA 5D72L 3K6NA 1XD0A 3OMZA 4EQ2A 3SKMA 4WI5A 3ZE1B 3ULVE 4UM9A 4L0YA 1OVZA 1IM9D 4DKDC 2ZIDA 2R29H 4R4ND 4GFXA 1S7QA 3QJRB 1U2YA 4J4PD 3EH2A 4N9GA 3RI5K 4LMQE 1A7BA 3GINA 4G71B 2XFGB 4HZ1A 5IIEA 1RK0B 1CDGA 5I74B 1N4XL 1E6JL 2ENQA 3I9GH 3QARA 2D31B 3E2HC 4IS6B 4MMZB 1NINA 2WQSA 4Y2OA 3EXJA 1PY9A 3JZ7A 2UXGA 5DRZB 4U3SB 4DGIL 1DJSA 1T7WA 1C1EL 1MRDL 3DARA 2FECI 4K15A 2LLGA 3POHA 1OLZA 5CBAA 1MJJB 1JHLL 2DWYA 3QYMA 3AAZA 1XV8A 3P02A 3IXTA 3BESR 4JMXA 1ECZA 4APQD 3GJFA 4P5TB 1FF5A 3MCLL 3W81A 1PSKL 5LGHH 4P48A 1O5DT 5E6RB 2W65A 3MYJA 1E28A 1TCRB 1BJMA 5KSUA 5C0CB 1J8SA 4KQ4H 2Y72A 1CGTA 3B9KB 4KVCH 3SJVD 2DRUA 3NESA 1TYJA 1PFCA 2KDGA 4KMTH 3CFBA 1NLBL 4GRWE 1WAEA 4NJAL 1VENA 5K93A 4Z3HA 5F3BB 2DQDH 4HMDA 1RULH 2YSSA 5MP6H 3QUYD 5I1LA 4PWFA 1T20B 5CD5C 2Q8BH 3VDAA 5KBDA 1KPUA 2WTPA 5ACZB 3GJFH 1BBJA 5GGSY 4X7DC 1KYOK 3NP3A 5EUKA 2A4CA 4TV3A 3MA9L 1LDPH 3VYOA 3ET9F 2JI1A 1ACYL 1HSBB 2HLFD 3GPEA 4JO3L 4JK0D 3D8MA 3O3EB 1K4DA 3VG9B 3FB8A 2XA8H 2ZNXA 1QTSA 3ABLB 1H9VA 3VFUA 2P80A 3VD5A 3WLWD 5TK4A 1M56B 1YDPB 3CSTA 4JFZL 1WBYA 2HRPH 4MAUH 4RAUB 2F1BA 1YC7A 1Z5LA 4JAMB 2VISA 1OTUC 3APCA 3FSWA 3UZEC 1BX2A 1ZA6A 2HVJA 2IGFL 4CMMB 3CDZB 1JPEA 3FUDA 3UO1H 2J5WA 1IU1A 3DIDA 3QFDA 1E5BA 4WW1B 3NRFA 2X4QB 4MDIB 1JYVA 5CKAA 1B4TA 4XBPA 5DWPA 3QEQB 1WJ3A 2QZQA 4NZUH 3D69B 3UTQB 1T03H 5EUOB 2WV3A 1AANA 2BW4A 4PRBB 3SBWA 1KIRB 5C0CE 2X4NA 3ZQWA 4JFED 1OHZA 4H20L 4F15B 4KZEH 3X3GH 4DZBA 2XZAH 2R51A 2WBXA 3Q01A 3G08B 1HZLA 1PZ5B 1QVOB 3MJGX 2GK2A 2OMTB 4KI5C 5E70A 3T77B 1BLIA 4M6NH 4ZT1A 1EFQA 3CBKB 3KGSA 1A02N 1HHJB 5FS5A 4HUVA 1OOAA 5DJ2A 1ZIAA 2EEBA 1SM3H 1Z6JT 3OG6B 4GG8A 1U4FA 4JY4A 4KX8A 2YR3A 4RZCA 5D8JL 3UG4A 3ZDXB 2OK0H 3FUNA 4O2FB 1D9KB 4NKIL 1JPGA 3TURA 3IGUA 2Y06H 4JN2A 3UZVB 1AIZA 3OKKA 4XAWL 4OQTH 4GW5B 2KZKA 2Y2WA 3MUZ1 5LLIC 2AK4A 2Z65C 4NXSA 3HC4H 5EBMB 3HG1A 1AGBA 3F84A 2GBAA 3QI9B 4ONHA 4X5WB 5A2IH 4MAYD 2GJJA 3AXHA 3OQRA 4LARH 3ALWA 2VAAB 4HK3J 5F96L 4F7TA 2MH4A 2WAQA 4ZO6A 4M1GH 1KT2B 1WAAF 1E5AA 3NJKA 3QEQE 3ALXA 4FNUA 4EUPB 4LCCB 2ZX9A 3JWOH 4BA8A 3QZNA 1N26A 4FQPA 2NXZD 4NNPL 1VFBB 1S7WA 4WDIB 4Z7OB 4G8AC 3ZHDA 3S34H 3K4DA 3VD0A 5AWNH 5AYUL 5KJ4A 3D4GA 4NO2B 4ZW6A 3L5JA 1NDGB 3SPGA 4NOBA 3I6KB 4H2AA 4P2RA 4X42A 5A2KH 1AKJD 4WWOA 3ECUA 3LOWA 2ZUQB 4YN3A 1A1OA 5F6HI 3HE7A 5F6HJ 2CHZA 2CGZA 3OAUL 5C0BE 2WLHA 4OLVH 3WDHA 4LSUH 3GBDA 3SKMB 5C7XH 4TQPA 3T0VA 3KYOA 4AEHH 4UM9B 4HEPG 4CVXA 1I9RL 1OCWH 5E2TH 3ZDXE 5IW1A 1U8CA 4XCCH 5HYSG 1S7QB 1MCNA 4NPJA 1MJ8H 1OM3H 3FRPG 3C2SA 4N9GB 4Y9CA 2QVTA 4N4YB 5C3IA 4FQCL 5IIEB 5L8LB 4OF5A 1IC4L 5B3JE 2VN4A 3SPHA 2HVBA 1NCIA 4Y2OB 1E30A 5JPMA 5E8DL 1PG7W 4PS3A 1JGUH 2JKSA 1ZK5A 5EO1A 3GIVA 3NSJA 4UF7C 3L8QA 4PY8J 5KVMC 3WNOA 5JXED 2WVTA 2OI9B 3QZWA 2UZYA 5KVDH 1LE9A 1M7UA 3IMRA 3STLA 1PGRB 3QQXA 3RZWA 4BH7A 4BZ1H 3GYRA 5CBAB 5I6NA 1E43A 1QSFA 3AAZB 4CU8A 5A1AA 3IXTB 4MMXC 1JYWA 1MCLA 1MWAA 2GJZB 3MCKB 3GJFB 3MROA 4Y16D 3JXAA 4HJSA 3UMNA 2W65B 1F2XK 3MYJB 1E28B 5I8OH 1FNEA 2O30A 5KSUB 4U6VL 2KZ1B 4Y4KC 2Z91A 1QBLH 4PUBL 1Z9LA 4RWHA 3BFQG 4P2CG 3GMNA 2KI6A 1AXTL 3TWCH 3CFBB 5K9OA 3K1DA 2YSSB 2XV2A 1U8QA 3CJJA 1GS6X 3ETBF 2B5IB 5I1LB 2P45B 1WWAX 1MWAH 1KPUB 2WLLA 4OF3A 1BBJB 2XIBA 1DDTA 5EUKB 2DKUA 3CDYA 4MCZA 2BDNH 4BIKA 4BM7A 3ELAT 4BUQA 3QXVA 3SO3C 1K4DB 4O2EA 3FB8B 5ICZA 1MAMH 2XKUA 2DD8L 4LLDA 3VFUB 1RZ8B 2C4XA 1WBYB 2OULB 4KKLC 1Z5LB 2VISB 2Z92A 2KQMA 3BAYA 1BX2B 1ZA6B 2HVJB 2IJ0C 1GGUA 1LK3L 2MOQA 4YK4B 2XT1B 3INUL 1OGAD 2QPDB 3OF6D 3QWRD 4J2QA 5C6TH 4AIXA 4BCZA 3UX9B 4HV8A 3FQUB 4F8QA 4HGWA 3HBZA 2XTJC 4LRIA 3OHXA 4XOCA 1TCMA 1SVCP 2R0KH 3QJHA 1LO3L 1VB9A 2LQRA 4UILL 4AVHA 1A14L 1BQ5A 3RVUC 1H6TA 1QRNA 3EH4B 5E4IA 2X4NB 5AW9B 4F3FA 2E9WA 3IJ9A 1OAXL 3KH4A 3ZOAA 4ES9A 3V79C 4Z7QE 4FQQA 4G7SB 1G7QA 1A7RL 4DZBB 4XVTL 4BSJA 2JIXA 3QQ9D 4FXGA 1FORL 2JJSA 3MOBH 4NCC2 2COVD 4E2OA 5JW5A 5E4EB 3DJZA 3CFUA 2TRYA 1SVBA 3QO0A 4CVWA 2CO2A 4HUVB 3EJYD 4RISH 5DJ2B 3WN5C 3H7LA 1VHPA 4GG8B 2BXZA 4JY4B 3PHAA 4RZCB 1DBJL 4N2CA 4PWIA 4OCRL 1F6LL 5CP7A 4EE2A 2V3EA 4KTGA 3W2DH 8CGTA 1SRDA 1JPGB 1BW8A 4NN6B 4XTRD 3OKKB 1U8KA 5CU5A 3EYFA 2EE0A 3U7WH 2AK4B 3LIZL 1ZVNA 3HG1B 4LSTH 1AGBB 4MHHI 4PAZA 5T8IA 3ARGD 3PS6A 1DUYA 5IESH 5CKGA 5H2BA 3QFGA 3FHAA 1IIIA 1W0YT 3D07A 4F7TB 1KEGH 1LQBC 5M94B 4D9QD 4V1DA 1NCCL 1I1CA 3QNYA 4QHNA 2R8SL 3QC5X 1X4XA 1QEXA 1F4HA 3F7PC 4M7KH 1XWVA 1CJYA 4OLZH 1S7WB 4XNBA 1FDLH 5DJYA 2PXYC 1XGYL 1S7TA 1KGYE 4UNVA 2ZUVA 4L8DA 2EVJA 3PXHA 1EXGA 3N5AA 3WD5H 4YSPA 4YZWA 4P2RB 3L2MA 4N2DA 4JRFA 3CHOA 5FCSH 1JMZA 1MXGA 5E8NA 1E6OH 1A1OB 1UH3A 3I9IA 3GTNA 3F85A 1AG0A 3HE7B 2QQKL 4R7NA 1F18A 3KYOB 2J8UE 4E9VA 4LEOA 3VD1A 4CVXB 4TNGA 1IEHA 5IW1B 3MV8D 5KANG 2LAAA 4C83A 3ZUCA 4DO6A 4ZXBD 1ZAGA 4FEIA 1U9KA 4BRJA 4Y5VC 1Q72L 2Q3AA 4P46D 4U6XA 5AQ0A 4NO0D 5JR1H 5IHUH 5JPMB 1QI5A 3MVSA 2DIAA 5EO1B 3GIVB 2IGTA 1L9MA 2EICA 3CZGA 2UZYB 4YFLI 1HNFA 1LE9B 4PJBA 1H3VA 3STLB 4BH7B 1QSFB 1SDDA 3KM2A 2PW2A 5F6IB 1MWAB 1PG7X 3MROB 4IRSB 3FSOA 2DF3A 5FV2A 3LH9A 2DY2A 1Q0XL 4JO1L 1KFAH 1FNEB 1UYWH 4XO8A 4FP8L 1RFDH 2Z91B 1UASA 4IW4C 4HGMA 2CR3A 3GMNB 5K9OB 5LXGH 2CO3A 3F04A 1U8QB 3NABL 4M7JH 4FQ2H 4IGBD 4B7IA 5DFTA 4MS6A 2WXJA 3C2AL 3L54A 4HUCA 1GHFL 3T3MB 4RGNB 4P2RE 2WLLB 3CQQA 5HHMD 5BJTA 3N41B 3ARYA 4H8VA 4WFFE 3UDWA 3WHE0 1IAII 1ZLWK 1IILE 3L5XH 4ZAKD 1CU4H 5JQ6H 4MCZB 4U0RC 3EW3B 4MA1B 2XX1A 1CD9B 3NA4A 1GPOL 5EZOL 3AXIA 4O2EB 2R0ZH 5ICZB 3CXHK 5IZ7A 4LLDB 3MNWA 5IGXL 5JW4M 4NQQA 3TNMA 2AKRA 2DIEA 4K5LA 2Z92B 4AJ0A 2J71A 3QO1A 1BQRA 1HKLL 3Q8FA 4I0PA 1ANUA 1ZANL 3X3FL 3DI2B 3WJJC 4HV8B 3GGWA 5FYJU 4HGWB 4AVJA 1JG9A 3C5JA 1I8KA 3OAYK 4LHUG 5CP3A 3OHXB 2P5EA 1QSFE 3FYEB 1ORQA 4MJ6A 3QJHB 3UBXA 2CK0H 3AS3A 3CZEA 1E9QA 3WIIH 4OZHA 1SN2A 1DQIA 4UT9A 2EE6A 2HH0L 2Z8VC 3FQTA 1QRNB 3A3YB 4E9TA 4F3FB 4R7LA 5HYIA 3V4PL 5DD3L 1VGKA 5JORA 1FL5A 1G7QB 1P69B 3NRQA 4A7TA 4AEEA 2ENSA 2JIXB 1P6FA 2WLIB 4FXGB 5IFHL 4M56A 5HJBA 3VD2A 1PX4A 4TQEH 5DXWA 1JGVH 5CP3H 3LKQA 3OHMB 2E5EA 5JW5B 2I7SA 4X5RA 1VF5C 5E2WH 2N7AA 4RGNE 5TE4H 3QO0B 2J5LC 3I9AA 1NGPH 4TVSa 2X2JA 4FL4B 3TL5A 2EEDA 4UT9H 1T2JA 1F13A 2PWDA 1CGSL 5F8QC 4XPTL 1HZHL 4OLYL 1G6VK 5CP7B 1OL0A 3HBPA 3H9YA 4G7YH 1WFJA 5GRXG 4CC4A 1U8KB 2ZCHL 3EYFB 3I2CL 4G11A 2YARA 4KI5D 5CF3A 1LILA 5I6PA 5SV3A 1GS8A 5D1QA 2WXRA 1OP4A 4NWTL 1DUYB 4FFWC 2YUXA 5H2BB 3ARBC 2J6EA 3IAGC 1IFGA 1F8TL 4HFUH 2OR8A 4JFYA 2P7TA 1AFVH 3NGBC 3VFGH 4V1DB 4KWUA 3QNYB 1NMAH 4QHNB 4XP6H 1J0JA 1I1RA 3UG5A 4MQ7A 2A0LC 4MSWA 4BELD 2F8XC 4FMKA 3BH9A 3T2NH 5HP5A 5DJYB 3DHUA 4PRDA 1QRNE 2X53A 3L9EA 1NCOA 1CFVL 5BXFA 1S7TB 3CQFA 1PX3A 3V0WH 1IC7H 4YHZH 1A6AA 1DSFL 2RCSH 5DQDL 1N64L 4L8DB 2J6EH 2IANA 5LBSL 3KJ6L 4OQ1A 1UKSA 3B2MA 3CFEA 1HEHC 4G2AA 2GTWA 3PABA 3FQ2A 4N28A 4W68A 3T1FA 2VDNH 4QRPD 3RFZA 2VLRA 5E8NB 1MFAL 3T08A 2O1AA 5B21A 3QZMA 1NBCA 1BQLH 4OGZA 4FZEH 3U4AA 5DMGC 4R7NB 2BRRH 1ZTXH 3QDGD 4R5VA 2ROYA 2YXVA 4LEOB 5FX3A 5EA0H 3TFKC 2GB2A 3TBVA 1PD1A 3S37L 1WGVA 4C83B 5FW7A 1T7ZA 2YKLH 5D6CB 4D3CH 1E5YA 1P53A 3GNMH 3X1EA 2R0LL 4KBPA 2NNFA 4U6XB 4YAQA 3K0WA 3O2DA 4X8GA 1KXVC 1PLGL 3SDXF 5MERA 3PREA 5KVGL 3UYOD 2FEDC 4JL1A 2Y2TA 5CIPA 4PJBB 1SDDB 1ZEAH 1ZJAA 2J1ZA 2PW2B 3TC9A 4BA0A 2CUHA 4V1DE 4AC4A 2FLMA 4DP2X 2B4CL 5INCA 4LSPH 4LSRL 4U1GB 4FADA 4FFYA 1Z66A 3U6XS 4ADJA 5T5FL 1CK0H 5AW2B 1XCXA 5C9KA 1IC0A 2C3VA 1XAUA 4PBWD 2CNZA 3PY9A 3PRZA 4YHKL 1AD0A 3D9AH 5HHPA 3ESNA 2EVGA 2I24N 3LPOA 3HR5A 2NY3C 4MXVF 5KJRH 1IKOP 2OCFD 1QBMH 4PCTA 4EAEA 4XR8C 1VJSA 3BAIA 5BJTB 5ELIA 2Y7LA 3SY6A 4WU5A 1NTDA 1BZ8A 4LDEB 3KBEA 3V9FA 4Y4KD 2MFNA 3GJFK 2G75A 3VGHA 5T3XH 2E6QA 5C07D 1SQMA 5F0JB 4QXUH 3IDJA 2Y1VA 1TEFA 4MB4A 2L7JA 2B3RA 3MNWB 4YSDA 1MEXL 1I1YA 3TNMB 4YX2H 1XQ4A 2AKRB 4GW1A 2H2SC 1R5IA 3TA3A 4OFIA 3QO1B 4TVPL 4I0PB 4KY1L 2R4RL 3BAJA 4L9LA 1JNLH 3DA0A 2G3NA 4N8CL 3GGWB 1NC4D 3H9ZA 1AS7A 1J8HB 3H3PL 4PJBE 3C5JB 1I8KB 5KTEH 2HZHA 2P5EB 4EXKA 1ORQB 1AQKH 4MJ6B 2ZNWA 4OKDA 1LEKB 4DGUA 2MWCA 2C5DC 3UBXB 4ZMPA 2D73A 1E9QB 1CXFA 4OZHB 2X3BA 4JJ5A 4TRPL 3HI6L 3RDTC 1DQTA 3IJ8A 5ALBL 3FQTB 1WFTA 4AEIH 1QLEH 4JM2D 1URLA 1V8HA 4RETB 2EH7H 2BVTA 3CFJA 1VGKB 2AJSH 5JORB 1FL5B 1CFQA 2DLEA 3BN9C 1WT5C 5KOVC 3S3BB 3MBWA 1NOLA 2XTJD 5DMJB 3LKQB 1EHXA 2JJWA 3ZQ9A 4U1MA 2WXGA 5F70A 2YN3A 4FFZH 5B1CA 1XIWC 3T0AA 4KTDH 1E8YA 2PNDA 2RMNA 3IFNL 4J3UA 3MYZA 2VL4A 4AYFA 3SGKA 5L8JB 3UAJA 1FI8C 2YQBA 3TEWA 2KC0A 1FE8H 2NNCA 3K3QA 5GISL 3V95A 4OT1H 1G9NH 5ID1A 35C8H 4L3ED 4WFED 1EZUA 4LASL 4R26H 5D1QB 1AS6A 2YD8A 1NPUA 1ZJBA 3E9TA 1A7NH 3NCBB 5GQBA 2XX0A 4LPUA 4X4ZA 3MZTA 1UG9A 1E4KC 4JPWL 4JFYB 5HD8C 2P7TB 2C4FT 4BH8B 1WAAA 2X2YA 2N01B 1GGYA 1MQ8A 2VDNB 4EOWL 1OK8A 1H8NA 4WUUD 1PD0A 4IRJC 4PBXA 1AACA 3ROLA 4MQ7B 4MSWB 4LAQL 2W0LA 3BH9B 4Y4HA 1KPRA 1AZCA 1U33A 1JPSH 4YBLB 4PRDB 4L18A 5BXFB 2FT7A 2N1KA 1A6AB 4Z77A 1W16A 1ZTMA 1GYVA 2IANB 3W1ZA 4UTAA 1CE6A 2BWDA 4NM8L 4PM1A 1RUKH 3CFEB 3T1FB 2GTWB 3PABB 3NEEA 2N0KA 1A8JH 3FS9A 5GSRA 1MH5A 1KCLA 3RFZB 2VLRB 4NPKA 3B8SA 1TJIL 1G0DA 4YXKH 3REWA 1UVQA 1DO6A 1WE5A 2NT0A 2ZOWA 3VI4F 5L7XL 2P5WD 3ULUE 1M9WA 2PXYD 2X6CA 4K3EH 1QTPA 5F8RC 1E9PA 3TBVB 1JYXA 3NIGF 1C5CH 2D03L 2IQ9L 5TPWH 2L4OA 2MRYA 1MZYA 3DURA 4AYID 4YAQB 5DJCA 4OIIH 1N6VA 1N7ML 3VYNA 1JN6A 3NCXA 4ALAH 5MERB 4M7LH 5IB2A 2Z93B 3RBGA 1SUJA 4LVOC 5D1QE 3S3JA 1T1XA 4HF5L 5JYLA 4X5XA 3FYIB 2HRGA 5CIPB 4XBEL 5DK2A 1GSKA 1IC5L 2K45A 4RGMB 3V2AR 2YZ8A 4PD4J 2C3HA 5KZCD 1BVOA 2O5YL 5LG1A 2YPLA 2X2UA 4MCYA 2X2HA 4PPTA 5INCB 2M26A 5TDPA 2KL6A 4HSCX 1W72A 1ZTXE 5KYNA 2WB1A 4FQIL 3C5ZA 2C3VB 4N8PA 4TULH 4GOSA 1AD0B 5HHPB 3MV9D 4J23A 7PCYA 3E8VA 2VJ0A 1JAEA 3HR5B 2IANE 1ZT4A 1GXEA 3RTQA 4KC3B 5LWYL 1D7CA 4NC0B 1UHVA 1ADQH 2W1NA 2Q1EA 4KVNH 4C4KO 4KNUA 1VFUA 4WU5B 3SCMA 1NC2D 3OLIA 3WU1A 2HSIA 1W72H 2DMGA 4UOW1 2AABL 2KQNA 4IJ3B 1P4BL 4BWTA 1WTLA 2G75B 4IKLA 2ED8A 1D5IL 2W9EH 4OUUA 3IDJB 5E9AA 3BIAX 3EJCA 2VR8A 4XMLH 4I18A 4QGTA 1HYRC 1I1YB 2VMJA 4GW1B 2J1YA 5I9QB 3V0FA 1R5IB 3QCVH 4ORGA 3TA3B 4U2ZA 4NFCA 2R4SH 4LEEA 3CN3A 2O6DA 3IPFA 4L9LB 5DD0H 1EGJA 4GUQA 5AG9A 2FJFA 4QRTA 3L45A 2CCVA 3TH4T 5ADPL 4P5TC 1O6VA 2NYKA 2MOVA 2EJ1A 1A7PH 5DWUH 2F18A 2FSDA 1FVEA 4AC2A 1T6WA 2DEXX 3NACH 4GQQA 2DLFL 5K39A 1K3ZA 1ZK9A 4JJ5B 5A2CA 2B0SH 1WS8A 4OCWL 2QFPA 2QHLA 4NOFA 5IB4A 4Y2DA 1EGJH 3ZTJG 5T3XE 3CFJB 5AOIA 1T83A 1CFQB 3CVHA 4XCNA 3S36H 2APFA 4ODHL 1OT2A 3WHXA 2BSEA 2VR4A 1ODAA 3NDZE 4U1MB 3WE6A 5FWQA 4F57L 2JLPA 4Q9CA 4J3OG 2X4OA 1F00I 3L3KA 4Y1AD 4AYFB 4GW4A 2A7BA 4PW9A 3GD1C 2D9CA 3CPLB 4N2IA 4F9PA 5DJDA 3CSFA 3T3PF 3X1GA 4HUWA 5KVEH 3L81A 1T4KA 2J73A 3KJ4B 4ZD3L 2FIRT 4UQAA 1FZOA 3CVHH 2IV9A 5ID1B 1BZ9A 3B5TA 2QPUA 4F8LA 5FYJH 3V55A 1T5XA 1A6TA 2NDFA 2OMXA 3MN8A 1A5FL 5CEZD 5ISZD 4LKXA 5I0YA 5ITBL 1WWWX 2EDTA 4B53A 1IBFA 4JBSA 2IMNA 5DHVH 3RU8H 3O0LA 1CWVA 3D2TA 3LZNA 5BVJB 1YYCA 3ROLB 4R4FH 5GGVL 3MHZA 4F15C 1R3LA 2VXQA 4Y4HB 1CVRA 1KPRB 3NJMA 4D9LL 3ZYOA 2V2WA 2ENYA 4FFWD 5EV7A 4RZKA 1MHEA 1T4WA 3SQBA 1HL4A 1L7TL 3ARBD 4Z77B 3W9DB 3QDAA 2AEWA 3TO2A 4NI3A 2Q0ZX 1CE6B 2UXFA 5DT1L 1RZIA 1BGXH 1MH5B 1JZGA 3DI3B 4OB5L 4WNSA 5GSRB 3SQOL 1B88A 4K23H 5MHSE 4UDUA 2D3VA 5D6DC 3B5HA 5C92A 2A0LD 3REWB 1UVQB 3MGTA 1KENL 4ATWA 4JPVL 3C8DA 4LDLB 3NBNA 2VXQH 2HRLA 2DQHH 4XHJD 4XX1E 1DBAL 3I9PA 1E9PB 1A3RH 4JDTL 3MBXH 1OEZW 2FQFA 3KG5A 4HIPA 3QI9C 4XNXL 3KYNA 4KGLA 5IROC 4DESA 3OTTA 4QXTB 1SY6L 1JN6B 2ED9A 4DN3H 4A7GF 5IB2B 4OGYL 1T1XB 2Q8AL 1JK9A 2ZOKA 3A6BH 4X5XB 4H8WC 4AGOA 4L48A 5DMGD 2BNRA 3U2SA 4LCCC 5DK2B 4BXSV 3HI5H 3DSFL 5JIDA 3V5KA 3IWVA 4MKMA 4WV1C 5SWZA 1WAAE 5I5JA 3RKDD 4MCYB 3VXMD 3TIEA 1D6VH 5TDPB 4DNLA 1W72B 3MO1A 3S36X 5JIIA 5F7WC 2Z8RA 4NERA 1LO2H 2VZTA 2FEDD 5IKCA 4BYHA 1MY7A 2ZUQC 2NY1B 3WKYA 2VDOL 4BUHA 1ZT4B 5BV7L 2QSTA 5E99H 1RUMH 3RTQB 1G1KA 2NY2B 2XKSA 1L6XA 2VXVH 3FB6A 5I15H 2OMBA 2IG2H 2NUPA 4P59L 3PL6C 4PRHA 4H1LH 2VMEA 1MFDH 2BFVH 2DQEH 4NYLA 1HSAA 1VCBC 3L3DA 4ZO7A 4FNLH 4V33A 3QORC 2YGOA 2A1WL 3HPLA 4OUUB 2GC4C 3S5LG 4M93B 4I18B 3X14A 2NY3D 1KJ3H 4DTGL 4ORGB 1BFOB 1DZBA 1INQB 4N0FB 3UTPE 3NSXA 4LAJH 4M6AA 2Y7OA 3AG2B 2FJFB 3P2DA 4QRTB 2KPNA 3LEYL 4J3VA 4UNUA 2HPTA 4XP5L 1OT4A 2X5PA 1GGCL 1FVEB 3BAWA 5AB0A 5GIRA 4L3CA 2DTMH 1CB4A 1W2KT 2DICA 2QGCA 4I4WA 5K39B 2YPLE 4NQCD 4PJ5A 1ID2A 4I1PA 1OQOA 3BVWA 3GS4A 2R83A 2OTWB 2P48B 5I5IA 5IB4B 4Z95L 4N0YH 4Y2DB 5E03A 4R7XA 4G8FA 2B1AH 2B5IC 3I84A 5KW9L 3CVHB 4XCNB 5DHXB 5CGMA 3LB6C 4PB9H 1IGYA 3WHXB 2P4AB 3L3OA 4MKTA 4RDBA 1W8EA 4XB3A 3MLRH 4IYKA 3NJFA 3QUMA 3WE6B 4H26A 4X7SL 2WD0A 4FHKA 5AVSB 3AREA 2F7IA 2VLMD 4WCYL 5FK9A 2X4OB 3RDTD 2AQ2A 3L3KB 1WWBX 4HKXA 3SQRA 4O5LH 4GW4B 4RH4A 2FX7L 4M9PA 2Q5BA 1HHHA 2ZXQA 4PH8A 3N04A 4YSUA 1SEQH 5DJDB 4HEPA 3JV5A 4HUWB 1WZLA 3QPKA 3MLVH 1T4KB 5HYSA 1T89A 1FZOB 3GBEA 3FRPA 4XI5C 1BZ9B 3STBA 1UWFA 1AO7D 1GAFL 1T5XB 1A6TB 2OMXB 5EEVA 5D1XC 1JP5A 4FG0A 3QUMH 4FFTA 4M3KB 5JIMA 3IE9A 1XIWD 4W81A 4LKXB 2PYED 1LO0H 2WP3O 1QLFA 4OJFL 5H37H 3HZKA 1H3UA 4BEIA 2VDLB 4WW2A 4DQOH 4PCSA 2UZXA 3I3BA 3SBWC 4A6YH 3SYOA 1B6DA 2BVYA 3KPQA 3PPEA 3VQLA 1XF2A 2YC1A 3WSQL 3CPUA 3HG3A 2YHGA 2H6OA 3EFDL 1MFVA 2FIKA 3B9AA 3CXDH 4XC3H 4MA7L 5DD1L 3SN6N 3UYRH 4UTCA 1R3LB 3DIVA 5FM5O 3RHWF 3CFCL 1KXTA 2V2WB 1AIFA 1HL9A 4DQAA 4QDGA 2B16A 5B3NA 1MHEB 3I50H 2BS8A 3KS0J 3SQBB 3APNA 4YSCA 5MEOA 1RZKH 3LMJH 4JFTA 3IN2A 4KTEL 2A77L 4OIAA 3TO2B 5KSAA 2NLJA 2APBA 5FYJE 2XZZA 1URIA 2IMMA 4IRJD 4UDUB 2NZ1A 1KB9K 2HMID 3MGTB 4L4TD 5HI5C 4KU1A 4DO4A 5I17A 1YQVH 4Z7IA 4NN6C 3EO1A 3JWOC 4R8WL 1L9TA 3F58L 4UQCA 5PCYA 3MRFA 1CLOL 4NNYA 3I6SA 3LPGA 3D09A 3R0MA 4Q74A 5ANME 3VG0L 2EIJB 1HS6A 3FT1A 4AMKL 4Q0XH 5D7JA 3KYNB 4BE6A 2B2XH 5IW6A 3A4DA 1PG7L 3SDXA 1NCAH 1L5GA 2Y23A 3ZKQD 4JN1H 2WLJA 2W07A 5D93B 3IDXH 1XH3A 1JK9B 2ZOKB 5FA4A 2OL3L 3K4AA 2BNRB 3D2UA 5DUBA 3U2SB 3ZKNC 4BK5A 4Z5RA 1YSOA 1HIMH 1VEOA 4S1QH 3V5KB 1RSYA 5SWZB 2RGSA 2DBJA 2UX7A 1LHZA 1PCXA 4GXUN 3TIEB 2XQYK 3B83A 3GHBL 5EORH 3KLLA 3ZTDC 4G8EB 4CKQA 3KDMB 3L48A 2VRAA 3DYOA 1A9EA 2BSCA 3MOQA 5IREA 4APXA 5IVXF 4R6UA 4DOHB 4YEFA 5IKCB 1AKPA 2BHYA 4Z0XA 1OM9A 4WUKH 3M8OH 3MRPA 2X4SA 4KRMB 2VWEE 3HE7C 4A39A 3V0GA 3P0YH 4F20A 5FDWA 3TT3H 3FB6B 1F90L 2NUPB 1FBIH 5AZEL 3UAAA 3WY1A 4PRHB 1JI2A 2FK9A 3QZBA 1C16A 5BZZA 5JA8B 2CHWA 2VDQH 1NUDA 1HSAB 4NYLB 3L3DB 1V05A 2Q3XA 1YEHL 1ZHBA 4J3OF 2XRAL 3HPLB 4AZUA 1PZDA 4DT2A 5JPMC 2PMZA 5IWLA 1YEFL 3SKJH 2YOAA 3X14B 2MEJB 4M8VA 4QD2E 5GS2D 2LFEA 5IM7A 2XBTA 2E6PA 5G2NA 1N9PA 3VFTA 4A37A 4YDKH 2J4WH 4X0KB 1YJDH 3QR1A 4J3BA 4IRSC 5I1DA 5GS1A 4TLKA 1WZ1L 2BNRE 4FQHA 1RLWA 2VSCA 3E8UL 3L95A 2V9QA 1UADC 2DLHA 5E1QA 5GIRB 1X5XA 4L3CB 1GC1H 4I4WB 2GJRA 4PJ5B 4OFKA 1IX2A 5EN2A 4NKOA 1UACL 5HHVH 4ODTL 4AENA 1TUPA 1S9WA 5DZNA 3TXAA 2UY6A 3P54A 4HZAA 4XMZA 2BIPA 4XMKH 4Z3EA 1WH0A 3BD4A 4G8FB 4QJ5B 1OAZH 2Z8WC 2CHDA 4DOHE 3DX8A 3VTTA 4P5TD 2OAAA 1P1VA 2HTKC 1CBVL 4K3JL 3L3OB 3FAXA 4ZMZA 1CC3A 1I3GH 5C0CD 3ZVVA 3QUMB 4ESKA 1KN4L 1E9OA 1E4XL 3M7OA 4H26B 1F0LA 4G59C 3AREB 2H8PA 4PRHE 5FK9B 1REIA 5C3TA 4HKXB 5CUSL 2Z4TA 2AXHA 4GO8A 4AYBA 1RAMA 1HHHB 4PLOB 4NT6A 5D4IA 4Q9QL 1IKNA 5HYSB 4M5ZH 2EIMB 1FFNA 4FD0A 5AYTA 3FRPB 4LNRA 3SZ6A 4F8OA 4YHNA 3EBGA 1Z9SA 2YPVH 3Q8AA 1Z5YD 4OCMC 4M6MH 2HB0A 4LRIC 3BPNC 3OHXC 3KLAA 3EHBC 2AJVL 4JE4B 3E6FA 3ARVA 3D52A 3HZKB 3V9EA 3HIZA 4WW2B 2XHNA 2UZXB 1DLFH 3KPQB 1XF2B 4POUB 2YC1B 5CXPA 5J57B 4BUGA 2VT0A 2FIKB 4N5ED 4PJ5E 5F7EH 4NGHH 1KXTB 4FXGC 1AIFB 4Z23A 2JKXA 1BMWA 1CE1L 3P4LA 3V6BR 4DPAX 1A6WH 2J6WA 3DPBA 4GI9A 5A7EA 3QEQD 4UQ9A 5HI3C 5IT2H 2FEEI 3QGVA 4Q58C 1NBVL 3U83A 5MEOB 1MCEA 1KFGA 4KX7A 1DVYA 4G1EB 5I6XC 5KSAB 4P9MH 2YAHA 2NLJB 4JFQA 1E4HA 4FL4C 2PKDA 3EO9H 1M3JA 4MBRA 1ULVA 2QTEA 4JKMA 4O9HH 3SDYL 4ZK8A 3QYNA 3VI4A 3A47A 3QUZA 3M6DA 5FF6A 5DYOA 5I17B 4KQ3L 3EO1B 1EEUA 4LLUB 2D7TL 3MRFB 4NNYB 2HT2C 4XVSH 5JMOC 3FTSA 3BOVA 5D7JB 5C9JA 5IW6B 1XL4A 3G9AB 3SDXB 1L5GB 1BDYA 4YDMA 4W6YB 2WW8A 3U0PA 2W07B 4Y9EA 4OFYD 1JUFA 1XH3B 5FA4B 2ZCLH 1G9EA 3KPNA 5AAMA 2AC0A 2AFNA 3BC9A 2AQPA 3D2UB 5DUBB 1DSWA 1RZJH 4Z5RB 2VXTL 4JG1L 1VLXA 4LHUA 3SE8L 4AK2A 2NY4C 3ABGA 3QI9D 1PL3A 1MIEH 4C56A 4OZFG 3EYUL 2VDQB 4ZFZA 3ZXAC 5JHMA 1NUNB 2A9DA 1NCWL 3L9BA 3BFWA 1V7MH 4S1SH 1A9EB 4YQXH 1OAUH 1P9MA 3E3QE 3EYVA 4APXB 3IYLW 5F7BA 1SXSA 4WEUD 3DTXA 4NJ9L 4F7KA 5CFAA 4UANA 2LE9A 3D0AA 3MRPB 2X4SB 2WNGA 2EXWC 2AW2A 4RX4A 5FDWB 1DE4A 1OSPH 5CMAA 3TN0C 4J8RA 2PCFA 1NMCB 2V37A 3SO5A 3C6LA 3DUUB 4TF4A 3M86A 5GRJL 1C16B 3MACH 1INDH 5HTSA 1M6OA 4QXGH 1G0XA 4OLXH 3GSNL 1AHWA 1ZHBB 3C08H 4FJZA 4BK4A 1MCBA 4YFEA 5DFWH 3TBYA 1BZDA 3QJZA 4WENB 4X4KA 5IM7B 3EZ8A 3SDXE 2D7PA 2X4TA 5CSGA 1JIBA 3VFTB 1WQVT 2XJKA 1DANU 1WFIA 4LIQH 4Y88A 4XMXA 3PL6D 1UH4A 5CN3A 2TRHA 1KB3A 5I1DB 5GS1B 3T6WA 1BD2A 5BRZA 3BGAA 3GF8A 4FQHB 4FS0A 3NH7L 5AENA 5ILTH 4ICXA 2HLAA 4PBDA 4JKNA 1IO4C 1AJ7H 3AW5A 4O4YH 1I3RA 5EN2B 4NKOB 3L16A 4AENB 3M88A 4GIPD 4YDJA 1S9WB 4MHHG 4CU7A 2HMIC 4K7PX 2UY6B 1MPAH 4U1LA 1KGCE 4MRCA 5EIVA 2X41A 3DX8B 1JTPA 4CC0A 1Q9KA 1YAZA 3V0JA 5A6MA 1O7VA 2NTSP 1DR9A 3LS5H 4KY2A 4G6FB 3LQAL 4CN4A 4V2CB 4MXVE 3KBHE 1E9OB 1FNFA 3A22A 3BYTA 3DDGA 4ONGH 1BJ1J 1IAIL 2H8PB 3D18A 2Y07H 4GSDH 1ITCA 1FC2D 4A68A 3GBMH 3GI9H 1SBSL 5HJGA 3U1SL 3TJEL 2G2RA 1SXZA 3KBFA 4NT6B 3MLSL 4B9GA 1IT9H 2CLRA 3ALPA 4O58L 3KLHC 2YSTA 1FFNB 3L4ZA 1ET7A 1G7MA 4LNRB 4P3CL 2X4PA 2ZG2A 1C8PA 4YHNB 5EEUA 1Z9SB 2CRMA 4U1NA 3VFMA 1CCZA 1ROWA 4QTIL 3KLAB 4PGEA 1WS7A 3E6FB 1TVDA 2E4FA 5GJSH 3RA7L 1CLYL 2HX7A 1XXFC 1FCGA 4WHYG 4KKZA 4ODVH 3R8QA 3OL2A 5IUCA 1DLHA 5DVOA 4XI5D 4QPEA 1KV7A 1I9IL 5C6WH 3TCLA 3QWQB 4RA0C 1NSNL 2VMCA 4JDEA 5D1XD 3N9GH 1E5CA 3P2TA 1OP3K 1LMIA 2WANA 4UT6H 2WPGA 4JFQB 4K3DH 4GSUA 1B4JH 1T3FA 4OJYA 2HA1A 2I9LA 3GO1H 2W9LA 4GKLA 4PEEA 2FX8H 2Y5TB 4BKLA 1FPTH 3VI4B 1J1XH 3MXWL 3QUZB 4GEIA 4C47A 5FF6B 1IFHL 5DYOB 4CDHA 2QADB 1WG3A 4I0CC 2LFGA 2OXHB 4JM4H 3G6DL 2QHRH 2NQDA 3SKUD 1QEWA 3NIGB 1XDTT 1CYWA 4QGYA 4NC1E 4IBVA 4WLCA 2ETWA 3VCLA 3GEFA 5C9JB 3R18A 4JRYA 2EO7A 2H45A 5F1KC 4A7GA 2AGJH 4DGVH 4Y5XC 3P9LB 3KLSA 4HLEA 4Z8FL 3U0PB 2JJUA 2MIZA 4JPIA 1JUFB 3SE3A 2R0WL 3KPNB 2HFGL 5HI5D 2ESVE 1GS7A 3QCUH 3BGMA 2P1YA 2ICWA 3DVFA 2AK4D 3KPMA 4P3WA 3HG1D 5AB2A 2Y22A 4LHUB 5EEZA 3UBXI 3ARTA 4YBLC 1ZVHA 1UT9A 1DVUA 2V17H 4C56B 4ZFZB 2OV0A 2X89D 3EOAA 4UOQA 4J5VA 1FV1A 3B8YA 5FFLA 3EYVB 5DF0A 1KUMA 2R56H 3DTXB 1TLMA 1QWNA 1NOFA 3C09C 4LSDA 1YMHA 1ORSA 5AYQA 2C9VA 1HOCA 4B97A 3W57A 5JPNC 5F93C 3CD4A 3OLDA 3CZLA 3QDJA 1CLZL 1YAIA 1DE4B 3IFLH 3ZPDA 2PCFB 3SGJA 3RRQA 4OD1H 4YHLL 1AGEA 3ARWA 3JWDH 3QG7H 3V4VA 4K94H 2ZUWA 1OARH 3VI4E 1M6OB 1HXKA 1HHIA 1WYJA 4U33A 4CBZA 1QW8A 3VM7A 4F7MA 1AHWB 4R97B 3S35H 3NIGE 1BEYH 4WFFD 3TBYB 15C8L 2YGPA 3FHEA 3HE7D 3KDPB 4LL4A 2WC7A 2EZ0C 2X4TB 2X44D 4IBYA 2QPEB 1EVUA 1T7YA 5IV2A 2ZWZA 4LSQL 2X10A 1AR2A 1BD2B 1KB9J 4XO3A 3FF8A 5BRZB 2PPFA 2J3SA 3GRGA 5F7HA 2P5PA 2VJXA 5IHBA 2AVFA 2HLAB 3PXLA 3SODB 4A2EA 1QO3A 4RGOH 4LZKA 1TZHA 5I26A 1I3RB 2WNXA 3T4AA 5IHLB 4YDJB 1HE8A 2YD4A 4X5PA 1MF2L 1QSFD 4U1LB 4GMTH 4XPFL 4W4NA 1WFNA 1GTFA 2P47B 4IRSD 5FHAH 3TEXA 1Q9KB 5EIQA 4PGDA 3QAZB 1E8XA 2ICCA 3L1GA 3Q7JA 4WTQA 1VFOA 4FXTA 3C8HA 5K1VA 5T1JA 3ESUF 1WPCA 2G5BA 3ARFC 4IJ3C 3AFLA 3LQZA 4GSQA 1OAQL 5C08A 3NMEA 3IMWA 4LIQE 5CJ5A 3GXUB 1A4BA 3D18B 1LWHA 1XF5A 3MOAH 2WQWA 4TSAL 4DGYH 5C0IA 5I75C 3IKCB 3BVXA 4W6WB 1G9ML 5KUMA 2ED7A 3S7GA 3T3PB 2FBRA 2PTUA 5E8PB 1MCJA 2G2RB 3TA3C 3ZL2A 3VUAA 2CLRB 4RGND 3MLXH 3CGTA 4L9LC 2HTKD 1NBYA 5FDYA 1G7MB 4AI7A 2X4PB 4NRYB 1AQHA 5J13C 2VDPL 3TJPA 4TYUA 4U1NB 1PIGA 1W9XA 1U2CA 3VFMB 3KL5A 3GXDA 3EYSL 4HEMA 4TPRL 3TIDB 3NOIA 3QJXA 4PGEB 5AL8A 4I3SL 4K71B 3TGXA 3L3JA 4GG6F 3VW3H 1M42A 1SYVA 5FYLL 4UINL 4J27A 4UT7H 1OW0A 1BD2E 2QQNH 3B2VL 5BRZE 1PMYA 2R1WA 2YS4A 1JI1A 1Y18A 5B1JC 4X6BA 1DQDL 3QXDA 1DLHB 5E1IA 3G3LA 1TQUA 5L4FA 4FQ1H 4ZYKA 3VXRA 1EJOL 5HHQA 3TCLB 3CHRA 4DSYA 5EZIH 1AE6H 4JDEB 5F9OH 3QUGA 1G9NC 1Z3GL 4M43H 4PCKA 4APQA 3K2UH 1NL0H 2IVFC 2JKWA 2JK5A 4I85A 1NDTA 2ZQKA 4ZTOH 3V8OA 1IJNA 3GTTA 5C0AA 3K5SA 3FT4A 5CGBA 5FYKU 1T3FB 4WGVB 5A2FA 2I9LB 5JOFA 3BO8A 4BKLB 1QRND 4ZMTA 3O6FC 3BX7C 3B7SA 3UAJC 1O9VA 4OF7A 1XSIA 5F0PB 2Z7YA 3WFCL 1IAOA 1OE3A 3JVGC 1MCOH 2JIXD 2DM3A 1N5YL 1FAKT 2BPBA 1QEWB 2FYYA 2BJMH 4PJXF 1W6LA 1T1ZA 5HI3D 4F33B 1I8AA 3T3PE 4WHDA 3VCLB 2ATKA 2VUOA 3CK0H 4NZTH 4HWEL 4JRYB 5DQ9A 2DQUH 1H6EA 5DC9B 3TX4A 1X6LA 2IBZX 4KHXH 4WWKA 1FFTB 4FMFA 1I9JH 4JPIB 5GGTL 4GAGL 1Y6KR 3MLUL 3LN5A 3NZ8A 1R33A 2E0PA 3BGMB 3EDJA 1G4MA 1G7JA 2ICWB 3NZSA 4LGRB 1YEJH 3KVQA 2HJLA 3KPMB 4JG0H 4ZX3A 3CX2A 4Y4HC 5AKSA 5AOZA 3B1TA 2ADFH 5DRXB 1MCQA 3QIWA 2DQIH 4MJHA 4AGMA 4HXAH 1UATA 4FNRA 4OR1A 2QPFA 1ETZA 1IGMH 1YEEL 3BKYH 3EOAB 3N6YA 1FV1B 4MJIA 2W9DH 5I73B 5IVXA 4ALAC 1USQA 4WFGE 1NAKL 4V1DD 4H4NA 5TFSL 1CICA 3BPLB 3QZOA 3HPJA 1P5UA 2V7HB 1YMHB 1ORSB 5E2UL 1I31A 1HOCB 9PCYA 4DKFH 1J12A 3K8MA 4P04A 2E9IA 4PJGE 3VGEA 3QDJB 3ECVA 1HYSC 2NY4D 5ABZA 4EBQL 3GUTA 3MXVH 1AGEB 3V4VB 1A6PA 5FO8A 4NQUA 2FZ3A 2FWLB 3ZLQC 5KUKA 4L8CA 1HHIB 2NNAA 1FVDA 4BQBA 4F7MB 3V6OA 3C8KA 2BCMA 4OFQA 1IJ9A 4EZLA 3P0VH 4DVBA 4XE0A 1LNUA 1MFBL 3ZTJH 1AMXA 1WISA 4PV9A 4XVUC 4KITB 4MB5A 3V0DA 4F92B 2OW7A 2CJ3A 4G72B 4YZFF 3TN0D 2G0KA 3D4ZA 1AVAA 5DMIH 1R4XA 5KWYC 1JDDA 5IV2B 2VOTA 3ZL4H 1FO0L 1BAFL 3MSPA 5IB5A 4CC1A 4OI9A 5FM5M 1I1AC 3TV3L 4ERSH 1CD0A 1QO3B 1TZHB 1S7XA 1G1OA 2XZCH 3T4AB 1UFGA 4MYWB 3RIFK 1RI8A 2EDQA 2WXMA 3D50A 5KYUA 4X9IA 4F2FA 1HC1A 3R1GH 2XWBA 4A63A 1WBZA 1GRWA 1QNZH 3RTQC 2NY2C 2Y6TE 3N06B 3WFEH 2F7OA 1OSZA 4PGDB 4TLSA 5HDBB 4U3HA 4YFLF 4GSRA 4NZRH 1BZ7A 5TE6L 3S48A 4KROB 2G5BB 2NPLX 2NY5H 4ZMXA 1A6UL 3LQZB 3LHPH 3KYAA 4GKSA 4H88L 5C08B 2GTQA 3MRMA 1XH0A 1XF5B 2EIBA 5I24A 5AD0A 5C0IB 1RK7A 3ML8A 3F7KA 1N68A 4NFBA 5F9WB 4M93C 3ULVL 3ZU8A 4UV4H 4I18C 1BF5A 4MB3A 4KX9A 2XWXA 4PMEA 1HEZA 3IXAA 3ZO9A 1HEJC 2P43B 1CFMA 1GL4B 1KGWA 1NBYB 2EUZA 4QCIA 4YS4A 2IXQA 3IJEA 4N1HB 1F11A 2ZICA 1BP3B 5L0QB 1EHLH 3WXWH 3U7YL 5C0NC 3L3JB 4RFNC 1S3KH 1SYVB 3SSGA 5ESAA 1ZGLM 1NFKA 4IOIA 5J6SA 3B1UA 3BVNA 5BQ7A 3HEIB 2R1WB 5IEKA 4JQVA 5IJCC 1QHOA 2G3XA 1Y18B 4X6BB 4I0PD 1ERNA 3WGVB 3KLHD 3F6IA 3QXDB 4QAWA 4Y2DC 4B3VA 4ZYKB 3VXRB 4G7RB 2VERA 3OQ3B 1FG2A 4H40A 5HHQB 3S88H 3RL2A 1T83C 1JNHB 3A4EA 3BVDB 1Y6NR 5L8KB 1J8HD 4APQB 2P5ED 4TL5A 4WEBL 2JK5B 4DAGL 1TLKA 5TF0A 5H94A 1J0KA 2JMRA 4YUEH 2J57A 5C0AB 3FT4B 4RMUA 4R7DA 1BQSA 2R7EA 2D4DA 1R5VA 3F00A 1E2ZA 2F6AA 3BO8B 3KH3A 5IFJA 4PVLA 2R59A 3BE1H 2G60L 2W91A 2O5ZL 1CTOA 2XNAA 3CG8A 3QR2A 4F9PC 1IAOB 3P4NA 2GJ6A 5AW7B 3U6RA 4BKSC 3RI5F 1U8PA 1RPKA 2FYYB 5LB1A 4E42A 5IF0A 1T1ZB 3U25A 1DVSA 1VZHA 3FSZA 3K2MC 1OB1A 2DBLL 4TUKL 4X9FA 4EIUA 4PJ7F 1YCSA 5DQ9B 1PDKA 3BSGA 3S5LA 3R06A 4KRPC 3MJ6A 3QQ4A 4WWKB 3N1MC 3CTTA 1A21A 2BY1A 3IN0A 4G70B 4LESA 4HEME 2SEBA 3LN5B 3NZ8B 4L1TA 3A21A 2I7OA 5DLLA 4D8OA 4Q4IA 4KFMA 4EVNA 1G7JB 2A74A 4L2LA 4U3XA 2HJLB 1D5MA 1XZ0A 2C34A 2JCCF 1K4CA 1MREH 1YECL 3QIWB 1OTSC 3AQYA 3MRJA 5HYJA 1DYZA 1EFXB 1GYWA 1ETZB 4NBYB 3GTVA 4I89A 2BWQA 4MJIB 2PWFA 2QQQA 1HH9A 2CXGA 5IVXB 1NCTA 4N85A 1CICB 1S7VA 3HPJB 3SBPA 3W0WD 1L0YA 1P5UB 1QFUL 2M83A 4JQIH 4LXFA 4LL1A 3EYQC 4PJHF 4BWWA 2HG5A 2FVNA 4QYAA 3SJVE 4LOUC 3GUTB 1FFQA 1M57B 1PS3A 4F37K 1GGBL 2DWSA 5FO8B 2FZ3B 4XO9A 3LNEA 4L8CB 2KS0A 3GIZL 2B1OA 2IAND 2NNAB 1FVDB 3KYMA 4NP4H 4ANXA 5I2IA 2YFOA 3C8KB 5J1TC 1XL6A 1NCDH 3GZOA 4XVJL 1ZY9A 2VLRD 4DVBB 1LNUB 3KPRA 3ZZSA 2NY6B 4PV9B 1J86A 3FO2A 4Z0BH 3V0HA 5E6SB 3S96A 3K2KA 4A2FA 1HXMA 1N6QL 2NYZA 4NN5B 4E9YA 5IB5B 3I75A 2DS4A 2H1PL 3EJZC 3ECQA 2MCMA 4I0KA 3D48R 1CR9H 2OJZH 4QI3A 3C60C 2VDRH 3O2VL 5JTWA 4XODA 5KBLA 5LAXA 1I3VA 1S7XB 3FL7A 3NJGA 4N8UA 4R5TA 2EZ0D 2OMWA 5KYUB 1OAKH 2BXYA 2DDQL 2X28A 2GUOA 2XWBB 2ZOOA 2LVEA 1WBZB 4MJIE 3F6LA 3US9A 1J0ZA 5IVXE 4YXHH 5I0XA 1KTBA 3FJTA 1KJ2A 4NHUA 1IBBA 5FAAA 1OSZB 1VA9A 5D7IF 1BZ7B 1RJCA 4L5FE 1UCBL 1KIQA 1WZMA 4UB0L 4JFVA 4ETYA 2QR0A 4GKSB 4JFEE 4QF1A 5T3XD 5TF1L 4Z3FA 3KCPA 3IJYA 3MRMB 2BZDA 4X8XA 4LVNC 3CUPA 5AD0B 4K2UL 5DMKA 4I77H 3IDNA 4HIEA 4JO4H 1F1AA 1T22A 3IJSA 4M8QB 1HEZB 3IXAB 4FFVC 4Z3TA 1AOHA 1KJ2H 4HK0A 4GNKB 5DD6A 1TJHH 4QCIB 1SOKA 1QSEB 3MJ7A 3IJHA 1WWCA 2IXQB 4XRCA 3IJEB 4F9LA 3NCYP 1F11B 1OK0A 4P9HL 4RWYH 3VNYA 1J48A 4Z7VF 1W80A 3PE9A 2WWMC 2X05A 4I1NB 4NO0A 1SJXA 1WUNT 3FO1A 5ESAB 1KWKA 3DYPA 2OTPA 4IOIB 1XCQA 3BVNB 2N3JA 4YVNA 3ZYIA 5BQ7B 5IEKB 4GP4B 3TA3D 1CGXA 2X6BA 1X5JA 1X7QA 2CDFA 3N55A 3V4UH 4KUZL 1FG2B 3RL2B 3SDCC 5F7NC 1A7OL 1I7ZA 5E1AA 5GHWH 1C8QA 3ASWA 1QX1A 4LVHB 5DK3A 3FCBA 2F54A 1J0YA 4FQXA 1DL7L 3NIDF 5H94B 1ADWA 2EDOA 5IVOA 2HTLD 3VXNB 4R7DB 2R7EB 1PYWB 1KJVA 3AREC 4WIQA 4QMEA 5IFJB 1YPZF 2OPCA 1RXLA 3F12A 2XNAB 5EWIL 3RVWC 5JYMA 3SE9H 1EXHA 4JKLA 4PN6A 2FJGA 3P4NB 2GJ6B 3AS0A 2A73A 1T89C 3U6RB 1U8PB 4E42B 1F2QA 4DP9X 1U30A 3PDOA 3GK8H 3EDKA 2F5BL 3LD8C 1OB1B 4O51A 1RU9H 3QCTL 3TZVB 3S5LB 3R06B 1RZKC 3QQ4B 2C9UA 2MPAH 2DYRB 1CDJA 3KXFB 4WW2C 4Q97A 3UAJD 3RKPA 4ZS6C 5HHXL 4G9FA 4X6DF 2H3XC 2SEBB 4S2SA 3NDYE 3CIQA 3O6KL 1Q1JH 2N7SA 2LT9A 4HJGA 4ZPTA 4PS7A 2A74B 4IDJH 4RNRA 3WUZA 2EIKB 3H42L 1D5MB 4DP7X 1XZ0B 3CFDA 3VGAC 4WFHD 3E3QC 3NUKA 4GBXC 3V5HA 2NTFA 3BXNA 5HYJB 4NKMA 5JOPE 1MRFL 2DN7A 3QPXH 5B39G 5KSAC 1L7IL 1HH9B 1ZHNA 2WQUA 2Z0UA 1UJ3C 1CFSB 1WIPA 3CZJA 4XB7A 5FYKH 3UFIA 1V7NL 2YMXL 4NRZA 1S7VB 3DX4A 1SF5A 2EEAA 3UZEA 1Z5HA 4OLWL 5CILL 1IGCL 4IBWA 1WZKA 2HG5B 4KGJA 1GY1A 2QL1A 4K9EL 4Y4HD 4Z7UF 1UXWB 1V3MA 5I1CL 2IIJA 7TAAA 5DA4A 4FN0A 1K5NA 4BFGA 2H0EA 1OO2A 3HC3H 1YY9C 1TZ8A 2CPUA 3KYMB 5D7JC 2IADA 5I2IB 5ICUA 2HT4C 1CF8L 1C7SA 4FDWA 4DPCX 3WIHA 3QWNA 3KPRB 4Q14A 2QKIC 3S0PA 5GGQL 2VSDA 4TSCH 3FO2B 5D7LA 3WO4C 3GSQA 4HDIA 4AM0Q 3MLYH 3S96B 4O02A 6FABL 1HYSD 1J9SA 1HXMB 3KLKA 3BT2H 1HT6A 4X99A 4IBQA 4L4VA 3FCSA 4K7PL 4X7TA 2EXTA 4KXZH 3TT1L 4AGPA 3I75B 3F7RA 4M61A 1BXAA 1MAJA 2Z7UA 1NAML 1ECYA 3B4NA 2OYKA 1XGTA 1KSRA 1XVSA 5LAXB 4XVUD 3LKPA 2FX9H 2OMWB 3U0WL 5HYJE 2CE6A 5L6YL 1MDTA 2FAUA 5I6KA 4O02H 1HWGB 2GUOB 3MUGA 2W88A 4ZTPL 4Z6AT 3P0GB 5A2JH 3QEHA 5AEAA 1KJ2B 4NHUB 2ZE0A 2A6JA 4AQ8C 6TAAA 1NMCC 3VMPA 4PJIB 1YJDC 1I1AD 4ZBJA 1ED3A 5D1ZC 5D72H 2K4WA 1MHPL 3VH8G 1EUTA 4D94A 4UAHA 1JDAA 2QR0B 5CU9A 4QF1B 3AWEA 5FEBA 3KCPB 3IJYB 4TUUA 1J9TA 4AGQA 3CLEL 1B2YA 1GC1C 3BWZA 3CUPB 1M1SA 1B0IA 3VJ6A 4EMZA 4FA7B 5DMKB 3IDNB 4HIEB 5CJ8A 3EGSA 1N4XH 1PD6A 2CLVA 1E6JH 3IJSB 3RTQD 4E0RA 2NY2D 3OG4B 5I8EA 3OD3A 1AC0A 3FUJA 4HK0B 2FUTA 4DGIH 4HSAC 3MCG1 3KPRE 1C1EH 3BZDA 1R17A 1MRDH 2VZVA 3MJ7B 3IJHB 4I1RA 3UGEA 4KXBA 4X98A 2AK1L 4M6OL 4XRCB 4L8BA 3DOSB 5DHDA 1JHLH 3MRDA 5FO2A 3ZY7A 4Y2LA 1A2YA 1DVFC 4GG6A 4KJYA 3IDGA 4JKWA 2D3LA 4ZS7L 2NSMA 2V6HA 3FO1B 1BMZA 4NO0B 3MCLH 1XCQB 1PSKH 4Z18A 4XXDA 3MGAA 3X1NA 4U1SA 1X7QB 3MRRA 4OCXL 4ABWA 2EIEA 4WHTA 3VNZA 4CA4A 1SXBA 2YAMA 3QEUA 1NLBH 4NJAH 1I7ZB 5E1AB 4OZFA 4D9QE 4YIQA 2F54B 1LEGA 4I9WD 5C0ND 4FQXB 3E2HB 2QDWA 4XO5A 1F3JA 2P9RA 2NX5A 1QPPA 1KJVB 2Y69B 3MA9H 4HJ0D 4MQTB 1WIOA 3NA9L 1ACYH 4MLSA 5TDNA 4JO3H 1JMXA 3F12B 2BIOA 4NC1C 4Y2DD 3OAZH 4CVUA 1VKXA 5D1ZI 3FU6A 3UP6A 1KN2L 2FJGB 3ATAA 1IKNC 2ZYHA 4MMXA 2A73B