4DPAX

The 1.05 angstrom crystal structure of reduced (cui) poplar plastocyanin a at ph 6.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin A, chloroplastic
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dpaX00
2XLLA 1A4CA 1KCBA 4DP9X 5B7MA 3QJRB 3QJUB 5PCYA 3FQ2A 5AKRA 4GP5B 1MG2C 4K9JA 1WA2X 3AZUA 2ZWNA 4TXVB 2CAKA 4AKOA 2VSMB 2H47C 4KOBA 1ASPA 2WO3B 1NINA 2TSAA 1BQRA 1NWOA 2UXVA 3T6VA 3UADA 3FPYA 2DY2A 3TBCA 2PCFA 2HX9A 2YAPA 5LDUA 2GB2A 4KNSA 4G7SB 3FQ1A 1WS7A 2I85A 1J5DA 2B3IA 2UXTA 1ET8A 3QPKA 3WKQA 3DKHA 1XB3A 2IWFA 2J57A 1JXGA 3OMNB 2WO2B 4GP8B 2IH9A 1PZBA 2VM3A 1KBVA 3TBBA 4DP5X 3PPSA 1QHQA 2RACA 1IKOP 2BP0B 2BP0A 4GP4B 5I6PA 4F7KA 3WI9A 5D4JA 3FPXA 1KGYE 1OOWA 4UF7C 3SBQA 1GY1A 2IDTA 2YARA 1IBZA 1AZRA 3HEIB 1TU2A 2EIMB 3T6ZA 4YSAA 4KO9A 2N0MA 1KDJA 2FQEA 2BZ7A 5B1JC 1MG3C 4YSDA 2FJSA 3HB3B 3QJQB 4KO7A 1N68A 3NJNA 2FQFA 5I5MA 3AG3B 4E9XA 1NDTA 2NRDA 4BXSV 1V10A 2OJ1A 4A2GA 3ABMB 3AG2B 1A8ZA 1OV8A 3QJTB 2FQGA 1RCYA 2XYBA 2YAEA 1CURA 4DP2X 1EZLA 4E9RA 1M9WA 4ENZA 3FU8A 4A68A 4HALA 1AS8A 1WS8A 3OM3B 1ILSA 1R1CA 2MTAA 3NSDA 1E5ZA 2PPAA 1HAWA 1BAWA 1AIZA 2PP8A 1ZDSA 3FYEB 3PAVA 3PCYA 2FWLB 3FYIB 3DTUB 3NP4A 1MZYA 1J9RA 1NICA 2FT7A 3TU6A 2PPEA 1IUZA 1B3IA 2J55A 1E65A 4ZK8A 3GXUB 2BO0A 4YVNA 1URIA 1JXFA 5B1BB 1ZIBA 3NJHA 3BQVA 1BYPA 1TEFA 1OF0A 1PY0A 2GC4C 1AS6A 3EHBB 5B1KA 2BZCA 3WNIA 5FC9A 2UXGA 2PLTA 2DWTA 3UGEA 2Y69B 1I53A 2PPCA 1GR7A 3EH5B 1T5KA 4KOCA 4Q89A 4YSCA 1NIAA 3FSAA 3UAAA 3FSVA 2IWEA 1OE3A 1BXUA 3T71A 6PAZA 4DPCX 3ERXA 1OE2A 2XVBA 2XUWA 4DP7X 4BWWA 1SNRA 1XMEB 4AX3A 3CDZA 2I7SA 2FQDA 4QLWA 4M4RB 3KW8A 5I26A 2QPEB 4AZUA 2JKWA 5B7FA 3FSZA 3S3CB 1XB8A 3NSCA 2H3XC 2XWZA 1IC0A 3S8FB 3FU7B 3H4FA 2DYRB 3NJGA 1CC3A 2CJ3A 3CVDA 8PAZA 2UXFA 2VN3A 1AOZA 1UATA 2PPFA 3EF4A 2CALA 2CCWA 2HLEB 1J9QA 1OCRB 4YSTA 1PNDA 5A7EA 1QLEB 2IWKA 1KBWA 3PXLA 3X1BA 2YAFA 2YAMA 3ABKB 4JHVA 1JVOA 1ET7A 3NJJA 1L9QA 3V9EA 2Q9OA 4DP8X 5I5JA 2ZXWB 1KCWA 2VW7A 1NIDA 2VSKB 1E5YA 1PLBA 4A66A 1AZNA 3T9WA 3AG1B 3EH4B 2PCYA 5TK4A 1M57B 3CG8A 4FAAB 4E9YA 2IDUA 1GS8A 3OMIB 1OCOB 1JXDA 3ABLB 3ZX1A 1V54B 1A4AA 1IBYA 3SBRA 2GC7C 2JXMA 3IN0A 1ADWA 4UANA 4WKXA 3X1EA 2XX1A 2BWIA 1JZEA 4KO6A 5F7AA 1GS7A 1L9PA 1WA0X 3H56A 2Q5BA 4DPBX 2GHZA 3OD3A 4NERA 1CUOA 5D4IA 2XV2A 2GIMA 1TKWA 2EIKB 4HHWA 1SDDB 4HAKA 1L9SA 1AQ8A 3T6XA 2DWSA 1BQKA 4KNTA 3UAEA 4HCGA 1SHXA 3FU7A 3JTBA 1AZUA 1JZGA 1AG0A 1YLBB 4HHGA 4BWUA 2PPDA 7PCYA 4P5SA 3NJKA 2PP7A 2HRGA 3H4HA 4W9ZA 2EIJB 4A67A 1WA1X 1KV7A 2TSBA 2JFCA 4KO5A 1VLXA 1WAEA 4AKQA 1SFDA 2VW6A 2W88A 2I7OA 3NSFA 2YAHA 3PLYA 1N70A 4W1TA 3MBWB 3WNJA 3SBPA 1NPJA 2YAQA 2MRYA 5I6OA 4JHUA 2FT8A 3TASA 4YVUA 2OCCB 3ASOB 5B3SB 3FS9A 4GYBA 3X2QB 1ILUA 2OV0A 4HCIA 3ZIYA 3CVBA 4M3HA 3TA4D 1PAZA 3BVDB 4QKTA 1BYOA 4YSOA 5B1JA 3UABA 3QJSB 6PCYA 4YSPA 1JOIA 2IH8A 9PCYA 1GY2A 2LLNA 4YSRA 3IEAA 1BXVA 1A3ZA 1OCZB 1PNCA 1QNIA 1NIEA 3IN2A 4A2HA 3G5WA 5E9NA 4YSEA 4JKNA 1PZCA 3UACA 1L9OA 4DP4X 2ZOOA 4CSPA 1V55B 1NZRA 1W8EA 4DPAX 4P5RA 3KW7A 4RH4A 2QDWA 5I6KA 1SDDA 3FT0A 2IDSA 2CBPA 2DV6A 3NJLA 1MZZA 1XB6A 2GSMB 1AS7A 2WSDA 1RZQA 3D12B 2QT6A 1J9TA 5ANHA 4BXVA 5PAZA 2CUAA 2YQBA 3C75A 4YSUA 5I28A 1NIBA 4NAJA 3IE9A 2FNWA 3NJIA 4E9SA 2BWDA 3PAUA 3QJVB 3U25A 3X1FA 3DIVA 1TEGA 1ID2A 2BW5A 2YAOA 3NJMA 2VW4A 4DP6X 2EILB 4BK5C 5I5IA 1E30A 4G71B 3NT0A 3ZBMA 3QQXA 3S3BB 3L45A 3WKPA 3X1NA 3GDCA 2IDQA 1ET5A 3FU9A 2AZUA 1GYCA 2BHFA 1ZV2A 2GBAA 4WTQA 1RKRA 4G7RB 3JT2A 4DP0X 2AZAA 4BDVB 4E9QA 1M56B 2YXWA 1JERA 5I6LA 2XV3A 3ASNB 3OMAB 4Q8BA 5B1AB 3FSWA 2XV0A 2HX7A 1JVLA 2B08A 4YSQA 2FTAA 2P80D 4G72B 3N55A 2FT6A 3MX0B 3NJFA 1DYZA 5TK2A 4A2FA 2E86A 3NSYA 4MFHA 1AG6A 4PAZA 1HFUA 4A2EA 4X4KA 4BWTA 7PAZA 1JZJA 1PF3A 1NWPA 1SHWA 4HZ1A 4NB7A 1AZBA 1ZDQA 1F56A 3AW5A 3PAZA 1CYXA 4YL4A 2AFNA 1X9UA 4F2EA 2HX8A 4E9VA 1JZHA 3X1GA 3GYRA 2X88A 4AI7A 1L9TA 4HCFA 1J5CA 1NIFA 3OQRA 3FQYA 3V9CA 5AZUA 1EHKB 3IBOA 4UAHA 4CSZA 5B7EA 3NYKA 2IDFA 1RZPA 2UX6A 4DP1X 1PCSA 2QDVA 1AR1B 2Y1AA 1HAUA 4F2FA 2QPDB 3AY2A 2P80A 2DYSB 4KNUA 2VM4A 1PZAA 3N2JA 1JZFA 2IAAC 3CVCA 1BEXA 3T6WA 4EF3A 2HZHA 1FWXA 2PP9A 2W8CA 3SQRA 1AACA 4PCYA 1KDIA 1L9RA 1E67A 4YSSA 1OE1A 3AG4B 1DZ0A 1JZIA 1SF3A 1A65A 3WIAA 1AZCA 1ZIAA 4GXFA 2UX7A 1SF5A 3RYMA 2GI0A 1CYWA 1PLAA 1SJMA 4N4YB 5EHFA 2H5UA 2VMJA 2J5WA 2ZONA 1NPNA 4G7QB 3S3DB 2BP8B 2XU9A 1PLCA 2AANA 2BP8A 3CDZB 3CZUB 3EH3B 4E9WA 1GSKA 1ASQA 3WG7B 1MDAA 1PMYA 5I6MA 2HXAA 1W6LA 4E9TA 4G70B 1AANA 2HRHA 1AAJA 2J56A 1FFTB 2XX0A 4HIPA 5AFAA 2XXGA 1OCCB 3NP3A 4L0PB 1X9RA 4N8UA 4FA7B 1KYAA 3ABGA 1SFHA 1A4BA 2BW4A 2R7EA 2R7EB 1BXAA 5D4HA 4GY4A 4BDVA 1ZPUA 2XXFA 1FA4A 2EINB 3S8GB 1ASOA 4AKPA 5IY5B 1GS6X 3ZDWA 1BQ5A 1ETJA 5I6NA 2X87A 2YXVA 1J9SA 1NTDA 2A3TA 2AVFA 5F7BA 1W6WA 1GW0A 4A2DA
chains in the Genus database with same CATH superfamily
2FJGA 5E5LA 3CSYA 3QJRB 1F41A 5MI0C 3FQ2A 2AK4D 4JFYA 4H8WC 4NJ9L 4ETQA 2BP3A 4U1KA 5CN1A 5D6CA 5F1NB 5FYJD 4AKOA 5B3JE 5FYKD 3CFUA 5EU4A 1TOXA 3NFNA 4I3RL 5AOMA 1CFTB 5FGBC 2PABA 2E59A 1INDL 4Q56A 4XCYA 2WAHA 4Q6KA 1Q1JH 5BZXA 3KH4A 1IKNA 2F54A 3QNXA 4AIOA 1AHWC 4P2AA 5DVNA 4AJYV 2R4RH 3H1ZA 1UQSB 5LDUA 3RWGA 4HIXH 4H7VA 2WNWA 3ZDXF 1DQLL 3FB6B 3UTOA 1NAMA 2GTWA 2ZOWA 5A2AA 2EDDA 1JXGA 1DEEA 4PV9B 2F5AH 4N0YH 5C07B 4AJ0A 2HVBA 4PR5B 3WHE0 3DIDA 3P40A 3MDJA 3BH8B 1CLYH 2RJMA 3K0YA 4TQPA 2VR9A 4AVIA 3A6OA 5C7ZA 1QFWH 5BRZA 1GTNA 2EE6A 2QLVB 3KXFE 4A37A 3F7RA 5EF2A 2VKXA 4XODA 5LWYL 4TQEL 1YPZA 2CO4A 3FCSA 3B5GA 4M7KL 2YRPA 4PJHF 4NC1E 1IGML 4NZRL 2EXWD 5HDQH 1QMUA 5JZ7D 4GRLC 1OTUD 3F84A 1RUPH 3CHPA 3F7VB 2FQEA 5DJ0B 2MIZA 4FADA 5T1JA 3UMNA 1QBLL 3VO0A 1E2VA 1M7IB 1PEZA 2EE0A 3NZ8B 2MJWA 3ZTCC 5ANME 2IH1A 4U6YB 3ZDZE 3T3PB 3HE6A 5DRXB 5C0CA 1X5YA 4WJ5A 1N19A 2ICWJ 4U1MB 1PFOA 4DP2X 2DLTA 4P46D 3TEUA 3ZKXB 4E9RA 4RGNC 5DZNA 2XWRA 2HUEA 1DL7L 2NY3C 1C08B 2CIIB 4ZXBA 3T3PE 4N0CD 4N28A 3MLZL 4GRMA 3NSDA 3V0VA 3WEOA 1GGCL 1KNOA 2Y1ZA 4MD5B 1AIZA 1E2ZA 1G7HB 5ACZA 5J06A 1WAAA 2ICEA 2X42A 2AXHA 3DTUB 1U33A 2ITCA 4GAGH 5AOLA 1H9VA 4TVPD 2YSSA 3O3UN 4Y9BA 5SWSD 5I8EA 1PL3A 2WLLA 1AKJB 5B1BB 2F19L 5A2JH 1IMHC 2E7DA 3NJHA 2DQDL 2CGRH 1D9KD 4IKJA 4K5OA 1OF0A 2PXYC 4R8WL 3J7HA 4OB5H 1UUNA 3ZTNH 3QG6B 3TLRA 5I73C 3I02B 1OAYL 1NBYB 3NFPA 3CFKB 1A6AA 4HOXA 3VA2C 5KTEH 4PG9A 1IEAA 1AGFA 2JIXB 4G9FA 3SODB 1XGRB 3NFSL 1EXUA 3EAKA 2FLMA 3UAAA 1SEQH 2LU7A 1B9KA 3V4VA 1P5VA 4D9RE 3UTSA 2CBOA 3MGOB 1AGEB 3A0OA 5CLXA 3WE1A 4O5LL 5D7KD 1NGPH 4UQ2B 1FRGL 4E42A 2GY7B 3EOYG 4XGZB 4TL4A 3KPQB 5AAMA 4X5RA 3FRPA 2UWEE 1U95A 3GNML 4JO1H 5ALBH 1USZA 4S1DD 4OCSH 5DRNA 4WDIA 1KYDA 4ABVA 2OMVA 4LP8A 3X14A 3O0RH 3WFZA 4B9PA 5FO8B 1ZEAL 1QI4A 3HBPA 1QLFA 3S3CB 1FUNA 3NSCA 5IEHA 1ZLWH 1HEJC 2YN5A 1Z2KA 3CDFA 4J3BA 3ARQA 1QFWL 1UATA 4JKMA 3VFMB 1IEBA 1Y0LB 1GIGL 3VGHA 4O02B 1N5YH 3DSNB 1ZTMA 5CKGA 5IIEB 2KC0A 4X9HA 2ESVD 3UOAB 4JFTA 2C4FT 2AI0H 4IRSB 2VUOA 1AXSB 4C47A 1TZHB 1XCTA 2V6HA 3GS7A 1NCGA 5KVFH 4K5MA 3NJJA 3SOBH 1IGIL 1E9QA 1IBDA 3PWPE 5BMFH 2YD6A 1S7SA 2BRRL 3BGAA 5HSFA 5D7JD 4B50A 3ARWA 4XT1C 3VXNA 1YEKL 4I0PA 1CICD 1M1XB 4AQ8A 2AV1A 5E6UB 2WXNA 4OM0L 1WC7B 1F6AB 4YEFA 3TX4A 4Z3EA 1C9SA 5IBLC 4PGEA 2EKSA 2Q86A 3DVGA 3MRHB 2X1XR 3HA0A 3I6KB 4YBQD 2ZXGA 1WBZB 3WNOA 4N22A 3MGTA 1JDDA 2ICCA 2O5ZH 2VWEC 5LBSL 1WBYA 3RU8L 2X0UA 4L4TE 2KBGA 3APMA 3RWDA 3RWFA 2NXZD 3BW9B 4RSYA 4CMHB 5F7AA 4KH9A 5I8EB 1TFHA 4Z7OB 4FHBD 1P1VA 1XR9B 4CW1A 1MAKA 5CF3A 1PY4A 1BDYA 1CUOA 4DGVL 4WKZB 2Z7YA 1VFBB 4BA8A 1F3DJ 4X4ZA 1WEJL 3F5WB 4LHJB 2H0EA 1I82A 3EBAA 4U1GB 1JPEA 4AQOA 3JV4B 5E9DB 3C9NB 4FP8L 4BZYA 3V4VH 1IEAB 2WXOA 2QVFB 4O2EB 3QJOA 5HPMB 1QRNA 3DUUB 3HG5A 1JD7A 3U83A 2Y2WA 3EGXA 3P2DA 2TSBA 1WAEA 4NQUA 5AB2A 3B2PA 1MY7A 4JJ5A 1QSEA 1QSFE 4LQFH 4U49A 5HI4D 5MEOA 2NXZC 2IFFL 2X2IA 4FXGB 2WY3B 5FYJH 4R26H 1CN4A 2W65B 2QHRL 2LAGB 3I2CL 4ES9A 1VGEH 4BZ1A 5D72L 4LLWA 4K71B 4MJIB 1OW0A 3HI6L 1CFQB 1NBCA 4ZQTA 2WBKA 3L6FA 4LSQL 2AEQL 5F1IB 4WGWB 4YSPA 4O02A 2QQNH 3AB0C 4J1UA 3P11L 4KTGA 1IZKA 1A3ZA 2FYVA 5F9WC 5IM7A 4GUQA 3X11B 2F58L 4JO2L 3QSKB 4K3HA 3B9AA 3OQ3B 2B4CC 2CO2A 4H8WH 2JJTC 2ZOOA 4NQSA 3S4SG 4CN1A 1YJDH 4OD2B 5T5NG 1C5DA 1DBMH 3O4LE 1UJTA 3K6SB 2LFGA 2BIOA 3FT0A 3LKOB 4BCZA 4IQHA 4N0FB 3NRQA 2CBPA 2QVIA 12E8L 3HN5A 4PVMA 1MZZA 5DRWA 2AMUA 4HIJA 3T0EC 4PG2A 1LL1A 2IC2A 4UB0H 1AQKL 3MBXL 4ANUA 4UIKH 3LZPA 1GGTA 2M8XA 2C3VB 5T1KB 3KD4A 1S9WA 3BSHA 3O6FC 1IV8A 3MMEA 3MTRA 1JVKA 2IALB 3N44B 4XNMA 3ILEA 5ANMA 1CGUA 2Z1KA 2E7LA 1M7UA 2YAOA 2PWFA 3S88H 3RX5A 4C56B 5CHNA 2NYYD 4JM4L 3GIVB 1VGKB 3C2SA 1YA5A 3LIZL 5CJXA 3OL2A 2OXHB 4JHZA 4G6AC 4UQEA 2ZX8A 4X5QA 3RKPA 4X4YB 2OK0L 2NQCA 2KMWA 2WXQA 1QRNE 3JV4A 4XN2A 4G7RB 5HHVH 4BDVB 2XPZA 5F9JA 5C0GB 1AQHA 5I1JH 4X99A 1U8CA 1MW2A 3DUUA 3UZVA 4KZEH 2HX7A 4WCYL 5EO9A 3LKQA 1THCA 3UC0H 5I1GH 1UD5A 5CMAA 1N7ML 5BRZD 5F89B 1HHJB 2GT9A 5C08A 4X7TA 3LZFL 4ZUVB 1RK0B 4X4KA 4NB7A 4JPWH 2JQAA 2DLGA 4ISVB 1KCVL 3DBXB 4NNXA 4UB0L 1R5IB 3T1FB 2ZCKH 1XZ0A 3TNMB 4ZJ9A 4F2EA 4LLWB 1SEQL 1TZIA 1HHKA 4PRHE 1FNLA 4YDVB 1OSZB 3MREA 4JFEB 4LCYA 4ZXBC 1IGFH 5KBLA 1KB9J 3KLDA 3M1BA 1NIFA 4HJGA 3TA3C 4QRRA 2GIYA 1D5XB 4JO5A 3QT2A 3V0WH 4Z23A 2W9DL 3B4NA 1QP1A 4RZCB 5H35A 4F8PA 5I71C 2V17L 4JUSA 1NGYA 4RRPM 4UBDC 1HILB 4B41A 4LF3B 1OTUC 2XQYK 1A6PA 2G2PA 2QPDB 5JOPD 2FSDA 1A3RL 5D5MF 4LHQB 1D7DA 3T6WA 4PWJA 3NSXA 1FWXA 1QPXA 3GRGA 3AUVA 4ZO8A 4LSTL 3WIHA 3H8NA 1R3JB 2WQXA 4I18B 5IB1B 5TH2A 4JG1L 1AXTL 4IHOB 2AQPA 5E2TH 3GIZH 4LSSH 4OCNC 1DL7H 1AR1D 3LB6C 4LLMB 2K7QA 3IDNA 2CJSA 4OCLC 4XE5B 2R1XA 2IALA 1RZIB 3BOVA 3D69A 2NUPB 1OEZW 1R5WA 3N1GC 1SGKA 1N8ZA 1KIRB 2AKRA 3SN6N 1L6ZA 2P9RA 3E7JA 4JFOA 5JXEA 2YEQA 2X44D 4XXDB 4PRBA 1TO5A 1W6LA 5DMJB 3L4XA 1OCWH 1NCHA 2EO1A 2XXGA 5ICYA 3PWPB 2QADB 2P5WB 1HL8A 2A4CA 4GEIA 2X6BA 4XVJH 2DN7A 4MJ6A 4OLYH 5JIPA 3K5RA 4U1GC 1HKLL 3RWHA 5C0GA 2BDNH 4YUEH 3RNQB 3NGBC 1ETJA 4XN5A 4U6VL 4TMPA 4UCFA 2A3TA 1WAPA 1NLDL 3VXRE 3UTPE 1N6UA 1ITCA 1PG7H 1MIEH 1P84J 3TF4A 1KCBA 1FFNB 3IDXL 2NLJA 5F9WB 2MNJB 2WBJA 5EIVA 1JWSB 4OAWB 4PJGA 1KTDA 1U4FA 4HIIA 4Q0XH 1DLHB 4H8HA 4I2XE 3AZUA 2EYSA 1MHEA 1KXTA 4YGVA 1J7VR 5T3ZE 1ASPA 1J1OL 4N2FA 4J5VA 1IFGA 4X6CB 3JV5A 4HG4J 2UXVA 1UXMA 3VDBA 1J1XL 3LRLA 2C1PA 3HZYB 4JKKA 1OSZA 3MREB 4JFEA 2KQNA 1D9KA 4YZWA 3RILA 1XR8A 3IS1X 3T1WA 2ERJB 2IPKB 3MVSA 3E3QC 3IAPA 4P2OA 3MRNA 3QH3A 3M8OH 4F9LA 3LN5A 3U2JA 4RZCA 5H35B 2BM3A 2ED8A 3D18A 3WXVL 1VB9A 3WKQA 1XB3A 3ZZ1A 4XNZB 4CL7A 1E4HA 3OMNB 4LARH 1I1RA 4I88A 3UJIH 5I6XB 5B3JF 3L3OA 3E2HB 3LRHA 4E0RA 1PZ5A 4H20H 3OKKA 1AI1L 3EOAB 1CFMA 1P5UA 1HIMH 1SJXA 3JWDC 4YDLC 2X09A 1MI5D 4EN3A 3S98A 2COVD 4N3UA 1EHLH 4PRAA 3V6OA 1V3MA 2I25N 1X9QA 5EH1A 1VFAA 3L3GA 4XHJD 4IHOA 2Z1PA 4DEPC 3QUHA 3I6LE 4NWTL 3S7GA 2YZ8A 1NAKH 3DBSA 3QW9A 5ACMA 1U93A 3IJEA 2NNAA 1VFOA 3VJ6A 2HWZH 2XBDA 3CFCL 1R5WB 3VXQA 2BOCB 3ZDZB 3LNHA 2NTFA 3DVNB 4G8GD 4I8DA 2B0SH 1J0YA 3BPNC 3GZOA 3IKCA 4PJDB 3VM5A 2OZNA 4ZG1A 2F53E 5DD5H 2GBVA 3U9PH 2Y36L 3VXSA 3MRPB 1V3LA 1ZT1A 3L3DA 1A5FL 1TT6A 3QZWB 4IMLA 4LIQH 4Y4FA 3SDCA 3EJRA 3ME0B 4ELDA 4PJCF 4H1LG 4MXWL 4LVOC 3CV5A 2XN2A 4PS7A 5E03A 4FZEL 4I48A 4MA8L 1W0WB 1P7KB 4NM8L 5JPMC 4MNQE 1ZLWK 3OM3B 1A9EA 3TXAA 3G04A 4RNRB 3MLXL 3FT4B 4NWTH 5I1HL 4FNLL 5I73B 4AV0A 3RNQA 1ZT7B 3RVTC 4YZFF 5AZEH 4EN2A 1I1YA 4H1LH 5F6HJ 3JWDH 4LCWB 2IV8A 4JDVB 1JGDB 4FQXD 3ZRSA 4F2MB 2DWEB 1PQZA 1B3IA 3BFWA 3PNRB 3VI3A 5I15H 5BMFL 4OCYL 2L04A 3GKZA 3HG2A 2ICWA 2JKRM 1HEZA 1KJ3H 1EX0A 4OAWA 3L1OH 4MB3A 2PN5A 1TEFA 1PY0A 2NYYC 3CZSA 3HG1D 4W9IC 3DK0A 3BWUF 4XVSL 3EHBB 4QR7A 4X6CA 5DLLA 3GO1L 4NO0B 2BIPA 4FG6D 2WXHA 3BAKA 4MGXA 2CDGB 2PPCA 3BZ4A 1A7PL 2OR8A 5SWQA 5D7SL 5LBVA 4XZUA 3AXIA 3VE0A 1YEHH 4QJ3B 4NIYE 4TOYL 4FMVA 5FKAA 5L0QC 3G5ZA 2H1PL 4IDLA 5EC1B 5GQBA 3ULAB 4DVRH 1Z0NA 2C3HA 1OE2A 3MTXA 4ZAKA 3VD9A 1TJXA 5JLZA 3RB5A 1G9EA 2X2YA 5BQDA 1FGVL 1DBJH 5E8DH 2XZCH 3O8XA 2OXGB 2CKBA 1OWWA 4HXAH 4HZLA 4ZODA 3SCMD 3QDGA 1D3CA 4NP4L 3N44F 3ZE2F 3UPCA 4AZUA 1TJIH 3MNWB 4XO3A 1T20B 4WI4A 3WYRA 2ITDA 4JREB 2MQ3A 4XNYL 4FQHB 5ES4B 4W68A 3H4FA 2UY6B 1KCSL 3NJGA 1PDKA 2WAQA 2OBGA 4XPTL 2CK0H 2YBRA 1ZTXL 4YHPA 2DH3A 1HKLH 1J9QA 3V8CA 5A7EA 3II2A 4JFPA 3IJEB 3C8KB 1AD0B 1L9MA 2WP3T 2AJVL 2X89A 1WHOA 4EIBA 4S0HA 1RY7B 4OUUA 3GSOA 3HG0A 3MJWA 1Z5HA 3LD8B 2VN6A 2C9QA 3ULUF 5EZLB 1DQIA 3NCWA 3MO1A 2H4EA 5DVMA 3ARGB 4HS6A 1RUQH 2VSKB 3TO4D 5D6CB 5F1NA 3V0WL 2JCWA 4GIAA 2CBTA 3RIAF 2VXTH 4FL4B 3CXDH 2NSQA 43C9A 5GS0H 1KN2H 1GAFH 5MP6H 4IRSD 3OMIB 1O6TA 1QLEL 2G75B 2RQEA 5IBUB 5H94B 2GK2A 3OKEA 5HP5A 2CCVA 1MWAB 3B37A 1KBGH 2MPAL 3A67L 4PLJD 2PR9A 4JDVA 4GQ9H 2JXMA 2YQGA 2MHAB 4LSTH 2IF7A 1ADWA 2F1BA 3D2UA 4QO1A 1HXKA 1QI5A 4H8WL 1JPFA 1L7IH 1YMMD 1JZEA 1GZHA 4MASA 4XVTH 3WEXA 4C55A 4CADB 4Q4IA 4OF6A 1OT1A 4FN0A 2P3YA 3NH7L 1OHQA 2AVGA 2H3KA 3AQYA 3GRWA 5IJCC 4WI6A 1CFVH 2APBA 4HMCA 4JMXA 3OD3A 4M1DH 5E00A 5IEKA 1TKWA 4C83A 1BD2A 1HE8A 2QSVA 1L9SA 5CJOL 1RIUL 1Y6MR 2B59B 3EYQC 5DS1A 1NCCL 1SDAB 3T6XA 1NBZB 3W11D 4Y2DC 4XN9A 3RBGA 3B9KD 4YS4A 3EYUH 3KYOB 2ERJC 4MJ4A 5K9OA 3CC1A 2YRBA 4PJ7E 3D87B 4YDKL 2Z7ZA 4OVVA 4F7TB 4G8AC 4JL2A 4BSVA 4BWUA 1JPSH 1VEOA 2PP7A 2FEJA 5GXBB 1ONQA 4X6FA 5D5MB 3FH7A 2WMPA 5EC1A 5ICZB 3FT9A 4WTZG 2DBLL 1L5GB 4KDWA 1SFDA 2W88A 1FNGB 4ZUSA 1XVSA 5H2BA 3NSFA 3G5XB 2GJ6B 3GUTA 1GGUA 1TYRA 1J5HA 3O2DA 2BY1A 1M6OA 2LTQB 4XNQA 3IFNL 3UTZA 3F7YB 5B8CB 3BRFA 4YDJB 1M71A 4C4BA 3J8F7 2F7OA 4GKOA 2ZNXA 1SVCP 2WQAA 1KY7A 3SPJA 2NX5D 2K6YA 4K8RC 4UM9B 1B88A 1ILUA 3NRFA 4GO8A 4YWGL 1KC5H 4KRPC 3ZIYA 3DI3B 1XAUA 4TPRH 4ZFGH 4N0RA 2CXGA 1PAZA 4OCWH 5AEAA 1ZVHA 4KVCL 2IJ0C 3DO4A 1FYTD 3UABA 3KYKH 1I8IB 6PCYA 4MD5A 1E9OA 1BF5A 2APVA 3OJDB 3GHPA 4I89A 5BOZG 3N85H 5I1DA 4GW4B 4L9LA 2G9HA 5FUZL 3L95A 1B4RA 2ITEA 2OMUB 3H2QA 3L4UA 5F3BB 3QULA 1FAIL 1I1FA 2CSPA 1AKJA 3BDXA 1HWHB 4MX7B 1FQ9C 1NZRA 1IGCH 1W8EA 4J3OD 5D96B 5HVGB 4MA1B 4ETQB 3RZCC 1QNZH 2BDNL 4ATTA 4WI7A 1TTGA 4Z77B 3REWB 4NNPL 3BSZL 5C70A 4EIUA 1EEQA 3TBYB 2WZAA 1EJFA 2OSLB 2VSDA 3CFNA 3GZPA 1Q38A 5L2KB 1FJ1B 4UMSA 2VJXA 3WO4B 3BQUA 4BQ8A 5D72H 5IGXL 3CQFA 1NIBA 3U1SL 1U42A 3HMXL 4Y2OA 5EZPA 1MRFH 3BIKB 3MRKB 1WRFA 2VDPB 1VEPA 1YJDC 1IFHH 1G0XA 1IGIH 3GS0A 2UZIL 3DXAD 4JY4A 5I0DA 2DQJH 3MBWA 2YD7A 2WVTA 3E0GA 3AQZA 1U6AL 1L0XA 5FA4B 5FW8A 3BPCA 3L45A 2R0ZH 4RMTA 5LVEA 4Y4KA 3VYNA 3RZCD 5IEHB 2AERT 4Q9RL 1A4KB 4PP1D 4U1IA 3PWUA 4ZD3H 4IW4C 4Q74A 2GBAA 4MJ5A 4L8SC 4EI5A 4GSXA 2YR3A 4E9QA 2WTRA 4OGYH 1YRKA 2JKXA 4LU5H 2XZZA 5I6LA 4KKBD 3GMRB 1YAIA 5ABDE 3FFDB 3S3JA 4APQA 5LN4A 4UT6A 3PGDA 3H42H 5AW4B 2EVHA 4YSQA 1CE1L 1G7MB 1IBHA 3DETD 3P77B 4MNQB 1CF1A 4A04A 1MWOA 3DMMD 4CSTA 2I69A 3ARRA 1B0RA 1FL3B 3QJXA 3TA3A 4AYFB 5SX4H 3AS2A 4FNQA 3ALXA 4PUBH 1PGRB 4F2ME 2BH0A 5AKVA 4ZO9A 4GQ9L 4C8XA 1ZDQA 2VZOA 3T2QA 3TP4A 4GQZA 1T0MA 4WJ5B 1YHPA 1DVUA 3S37H 3F12A 3HMXH 4XR8C 4FL4C 4X9BA 1FN4A 3MRHA 2H2SC 4JFHE 4M62L 3FQNA 2X4SB 1DBBH 4PRHD 5IJKA 1EO8L 3QDHA 2BCKB 2EYTB 3QS2A 2XG5B 1QNZL 2VDKH 2AJXL 3BUPA 3V0JA 5ITBL 3WIHH 4IBYA 5IVZB 4YXKL 3KXFA 4I1NB 4UAHA 1P4BH 1QKZH 2CR0A 4ZOAA 1PX4A 1HJCA 4XPAH 4I0PC 3TONA 4CC0A 2IDFA 5I5RA 2R2BA 2UX6A 1BZ9A 1SXSA 2CO6B 1S7UB 1HAUA 2X10A 2Q7NA 4UM8B 1AP2B 1JZFA 3NSJA 5GJSH 3GSRA 4BCXA 1ZPLA 2VNCA 2E3VA 2BNUA 5EZIL 4DQAA 5DHDA 4WFHE 1T2QH 2ATKA 4MNHA 4WWNA 1E27A 1T7VA 3QQ3B 1AGFB 1SQMA 1A65A 2JCCF 3VXUD 2E7BA 4JPKL 5K59E 3AREC 2R1WA 5FYLH 1KJ2H 1N59A 1A21A 3ECBA 4F7EB 4ONGH 2LHAA 4LBAA 2X38A 4P07A 4OUOA 4XP4L 3P69A 4G7QB 4AUJA 3D39B 4KQ4L 4WGKA 4PV9A 2AANA 3E6FA 3MLRL 3EH3B 4E9WA 4PR5A 4GS7C 1L0PA 4N2HA 4N8CL 1D5RA 4DZ8B 1BFVL 4HIPA 5AFAA 1YEHL 4TOYH 1OCCB 3B9VA 5EULV 1VSCA 1N2RB 4MNGE 5KG9A 1YO4A 3QO1B 2FJUB 4LPCA 4X6BB 1U8KB 1A02N 4KKQA 2Y7OA 4GG6B 3KR3H 5F1IA 2WBWB 2G4EA 1PJ9A 1CQYA 1HXMB 3QJFA 1B0WA 2ZYIA 1OWRM 2N3JA 3IDYB 1T04A 4R0LC 4WWPA 2AVFA 1J5OH 5D70H 2H0FA 4U0RC 4NRZB 3RX8A 3UYRL 3MV8E 1SJEB 1E4KC 4N2KA 4TL5A 2C4XA 1R19A 1S7QB 1ZANH 5LB1A 1XGYH 1O9VA 2TRYA 5GSVA 4U4IA 2V4LA 4QHUB 4IEFB 1CFBA 1QHOA 3MBEC 3IJHA 4LDLB 2PR4H 2TSAA 3L13A 1A3LH 3BKCL 4LL1A 1RZJL 1I75A 4BZ1H 5C0DA 1EZUA 1N6VA 1I3UA 1QSED 1Z5YD 1EAJA 3IU3A 1NCOA 4HIJB 1E4XL 5K39B 1ZHNA 1C16B 1RUAL 5GS0C 4NQXA 1MLBB 4BZ2A 3AFLA 2WQVA 1DCLA 3ABZA 4PW9A 3SDDB 3FN9A 2VDLH 1LWHA 2WZ0A 3MZGB 5GGSA 2Z31C 4KKBC 2HFEA 5ADOL 2YPVL 2MKLC 2Y25A 3HAEB 1LO4H 4QXWA 4PSPA 4PRHA 4X8GA 4K55A 1XR9A 5EN3A 1U8LB 1IAIL 4IKKA 2QSTA 4QHMB 4QHLB 4P2QA 4ALAC 4APQD 1WITA 1E8ZA 3PHQA 2EEBA 2BNUB 2BMKA 3H53A 3VFNB 1MY5A 4BSWA 2Q87A 5E51A 1J10A 4LCIH 1W15A 2Q7AA 4V2BA 5IJBC 3BZEA 5IQ9A 4Q14A 1CQKA 1DJXA 1FP5A 3K8KA 3FPXA 4YR6B 4CA4A 1GY1A 4JFEE 1Q9KA 3P4OB 1E8WA 1RIVL 2OSYA 2YARA 2Q7YB 3BZDA 1YNLL 1YYMH 3LKSA 2FGWL 1HHJA 5EV7A 5C08B 3H9HB 3WNNA 2J2ZA 3NCXA 4RGOH 5HDBE 3T0BA 3VMPA 4BXSV 3D48R 4U1NA 4Z3IA 4B0MB 3V6OC 4G8GE 3ABMB 4YE4H 2NSMA 3ZO9A 2OMBA 3LRSA 1GGBL 4XPHH 5EO1A 4DVRL 3VI4E 1WWWX 3QQ4B 4Q2ZA 3NACL 4IGBD 1DR9A 5HDRA 4APQC 3RUGF 3SQOL 5FYKE 1CS6A 5ID1B 2HKFH 1YVLA 3GSNB 3AM8A 4NC2B 1ED3B 1O6SB 1DVFD 1ZV5A 5G55A 3SE6A 1MOEA 3M1BB 3PL6A 3ZSTA 4B7LA 4OV5A 3G6JB 3TEWA 3BE1L 4NKQB 2BOLA 5ESQB 25C8H 3MJ7B 3LZLA 4YFEA 5EU3B 4JO2H 4LEOA 2EH7H 1E9QB 4ZDHB 3I84A 1D2PA 5AOZA 3EYFB 4W4OA 5L7XL 5BJTA 4B7IA 4TS6A 4XNXH 4OGYL 1QUNA 2YGPA 2V7NA 4KV5F 2H3NB 4K7PX 2W59A 3UXFA 1TTAA 4Q9BA 3NACH 3MRDB 4ANWA 3KPRA 1YNKH 3QWOA 2YOAA 5I1KH 3I9GH 2A9CA 1T5KA 2APFA 4JVPA 2YC1A 4Z76B 3EO9L 4LHUB 1B4TA 1E9PA 1C5BL 3GMNB 3QCUL 1AD9A 4QMEA 5C0FA 15C8H 3MLTB 1OL0A 3GRBA 4L29A 4PJDE 1PIFA 3SYOA 1QR1A 4FXLA 5D4QA 3ERXA 5GGSB 4EBQH 4EKJA 2P26A 2VL4A 3WEBA 3ZHDA 1OO2A 1SNRA 1JJUA 4LP5A 1X7SA 3SOTA 1R47A 1RMFL 2Y36H 4GQPH 3ULVH 4KY1L 5HVHC 3OHXA 5E4AA 3B9KC 3H3KA 2WHVA 4OW6A 4IOSD 5I26A 3UAJD 1TVBA 2TRHA 4HA1A 2NSXA 5JW3H 2HLAA 4HBCH 3KCWA 1XSIA 4TVUA 4PGCA 4JZNB 2A4EA 2IGLA 1FC2D 3S8FB 4MJ6B 2BSEA 3I9GL 1HI6B 3GMQB 4K7PH 1CC3A 1P4LA 4AYID 1BOGA 4W93A 4P5TB 1QFHA 5IESL 2VXVH 1GYVA 1G7QB 1I3VA 2JJTA 3TO2A 2Y07L 3B3IB 5MERB 4AGMA 3RLSA 4Z95H 1RU9H 2BNRA 3ABKB 4WEMB 5DS2A 5GGVH 5GZOC 1IZJA 1UASA 6FABH 2AV7B 4DP8X 4Z7UF 4O2FA 2DDQH 5HTSA 1T21B 3QDMA 4KRPD 2YD4A 2LLGA 3H0TB 4CVWA 2O6FA 4OIBA 1T4KA 1U8HA 4QNPE 4M03A 1MHCA 2HVKA 4TNVF 2VMEA 3S97C 2IH3A 3ARGC 4FAAB 3T2OA 4TPRL 3TEYA 1E90A 5DD6A 5HGAA 4OT1L 1YEIL 2WLNA 1EVTC 3ZX1A 2XT1B 3GSNA 1IX2A 3ROOB 2I5YL 1XL4A 4KHTL 4R5XA 3QI9D 3ARZA 4KFMA 1P0SE 2J8UB 1O9WA 1O7DE 3A21A 4R4NC 5T5FL 1AGCA 4RCAA 4MKTA 3PGCA 4P23A 3GSUB 4NO0D 4YHIA 4GT0A 1D5XA 4GLRI 1YN7B 2CNYA 3JWOL 4HCRL 4EIGB 1T6WA 3S2AA 1K6QL 3DLQR 4HX1A 1HX0A 2EIKB 2XCMC 4FQXB 4LCUA 4YGAB 2X2UA 4PRPB 4DF9A 3D06A 1E4XI 8FABA 3E8VA 2Z0BA 5F8QC 3RGVC 1F58H 2X3AA 1AZUA 3VU1A 1O5DT 1BFVH 3IDGA 3PDDA 3PHSA 2H32B 3VFGL 4OZHB 2C3VA 2X0WA 4E5XG 3MLTA 2LE9A 5ESVB 3CZGA 2JK5B 4B95C 2DQCL 2ZCHL 5IROA 5ISZD 4M6ML 1WFTA 4URTB 5CU9A 3EOBB 2OA9A 1E43A 3MRPA 4N2MA 3WOVA 2YKLH 5IW6A 4Y7OC 2GUYA 3ZT5A 3E80A 2VIRB 1HHIA 3LS5L 2DBLH 1W72A 2K3TA 1UXWA 3Q48A 4W6WB 3FS9A 4Q6IA 5KSAD 4OIAA 5BV7B 1IM9B 1RUAH 4S1RL 5TE4H 3X2QB 5DC0A 4N8VG 1D5MB 4NXSA 1QLEH 3QDAA 3MV9D 4GAJH 4TNWF 1Y7VA 3R4DA 3CLEL 5SV4A 4ODTL 3QQDA 4GBXC 3MBEB 1T83C 1ZK9A 4NFDA 2UY7B 5TE7L 3WLBA 4U7MA 4OF3A 2QPSA 2E8ZA 3SE8L 3TT3L 4I0PD 3T6QC 1OCZB 1PNCA 1KGCE 4PRNA 1KXVA 4YC2B 4JRXA 3UP1A 4F3FA 2ZX9A 4ZYKA 2ZOUA 3DTXA 1B90A 3P30L 2YD8A 3KJ6L 2EO7A 3HG4A 3EXLA 1CIDA 1NC4A 3SQBB 1HSBB 1LWRA 4ZMAT 1TQBB 4QRPA 5JW5B 3DHUA 3QFGA 2XC8A 5DD6B 4I9WE 5HGAB 1JI1A 1AS7A 2WVVA 1YEGH 3FOLB 4PREB 2A74B 3D12B 4K9EH 2R56L 4ODTH 1MLCA 2NW3B 2YO3A 1KB5B 4DTGH 1TQBC 4BXVA 5PAZA 4IMKA 2J8UA 3LEXB 3AAZA 1NL0L 1AGCB 5E99H 3QZMA 3QIUB 2VLRB 4GRWF 4P5KA 1M3JA 2JI2A 1ZTXE 2QADD 4NAMA 3TC9A 4V1DE 1OARH 3GJFK 5G4MA 5CD5C 4JPIB 1CE6B 4M56A 4BD4A 2IAND 3QR1A 4TV3A 3FO9A 1CDJA 1MCWW 2AXFB 3HPLB 5EEXA 1KGJA 4JEGB 5LCVA 4M7KH 3U9UB 5BVPH 1QSFD 2WM0A 3S0PA 1J86A 1UUSA 2BVOA 3DXAE 3UPAA 1UGNA 1WPCA 3BVVA 3GTTA 4UDUA 1A7BA 2QJDA 2WZ5A 1X5FA 1JTOA 1NFDF 5INCB 1TZGL 4GBXB 4EO5A 3NCJH 4R0LA 3JT2A 4HT1H 4NKMB 5BXFA 1JK8A 1MCPH 2O5XH 1CBJA 1RJYA 1IGJB 2VC2H 2YBRB 1L6PA 2F1EA 1NCJA 1WEJH 3WFCL 2L8AA 2YOCA 1ERNA 3EO1B 4LSPH 5SX4I 5JPMA 5IR1B 2J71A 3D69B 3HNSH 1OAQL 2NW2A 1MWAL 3N55A 4HWBH 2FJGB 4GSUA 3RVWC 2R15A 3H3PH 3F7KA 1Y18B 2CO1A 3NJFA 2Z8WC 3BJ91 4GMTL 4XXDA 5CD5D 4BWTA 1MQKH 3K46A 3ETBF 3HI1B 1JWMB 3PJSA 3HS9A 4WUUD 3SDAD 4DO4A 1ZSDB 1XH0A 4FYSA 3L2MA 5EU4B 2QZQA 3HC4H 3ZGHA 2G2RA 5JIKA 5A40E 2B20A 5J1TC 3NJVA 2PUQT 4QRTA 1LE9B 1F3DH 5C07D 5EEZA 1FGNL 1IGCL 4L1BA 1WZMA 3JQOB 1JGDA 3HE6D 5KJ7E 3RUGB 5BZDB 5B7EA 3P3UA 3RBSA 1S9YB 4ZFZA 3IU4H 1CLCA 1SJHA 4XC3L 5DWPA 5C0AE 3QFJD 1TZAA 4HETA 1H6UA 1JF6A 3FTYA 5KYWA 2Y1AA 1NC4B 4PWFA 1YYLL 4JPVH 5J6GA 3CC5A 1HXYA 3LPPA 3WUWA 2OP4L 5KVDH 4ANKA 2X4TB 3DURA 7FABH 1FZJB 2IAMD 2JF1A 2C1OA 2IADA 3S34L 2OQJB 3B2DC 3IMBA 1G9NL 5DS8A 1P7BA 4KXAA 1DZ0A 3BHBA 3AXLA 1KYOJ 4OGQC 1P7QA 4AQEB 5F7EH 4C59B 5C0BB 2CO7B 4K0OA 2XVKA 3RVVD 3WKML 3LH8A 1MFMA 3KM1A 3ZYOA 5HI3D 4JFXA 4M7LH 3GUTB 3VGAB 4Y5XB 2FNBA 4MDJA 5K9JH 2YMXL 3FCTB 3UTZB 2VN7A 2BSCA 1UOKA 2NY6C 4U7KA 1CD8A 3RGVA 1YEDA 4JLRB 1AANA 1ETB1 4PJ9D 4PS8A 3NP3A 4H44C 2PO6D 3GKWL 3IXTA 1PDKB 2XACC 3H7BB 1NGZA 4M43H 4PMFA 4XP5H 3JVFC 4ZUWB 4M3KB 3PWVB 4AITA 1S4IA 4N90D 3L4ZA 3NIGB 3UGXA 4AY0A 2ZXDA 1HZLA 3K4AA 4U7SA 4L9LC 4P4KD 4L3EA 4ZW8A 5DSCB 4QHKJ 5IKCB 5E08L 2TAAA 3QWRA 4N1HB 2ICEB 3RKDC 5FUOH 4NUMA 3AT9A 1S7XB 3CSYB 3OX8B 3M86A 3QJUB 1LK2B 3T0DA 4KK9D 1F1AA 2EP6A 4X9GA 1HYSC 1DJGA 1F90H 2XIBA 3FTUA 4FQQA 3MLPA 4MMYB 1AMYA 5KS9E 3BD4A 3WE6A 1BQHB 1JGVL 2G9KA 2QTEA 4M29A 3KL0A 4DFIA 1NWOA 3O9WD 1FPTL 4LGRB 4H8PA 5IROD 3SGEI 1DBAH 4MAUL 1A6AB 3UADA 4PJFA 3K91A 4X9YA 4RA3A 4ZTOH 1MWAA 5I0VA 1LE9A 1CGTA 1IJNA 3SCMB 3CMOH 3D39E 3V4VB 5EIQA 1KPVB 3MCLH 1R3IH 5KSAA 3T08A 4NRYB 2QKIC 2QPUA 4X7SL 2B3IA 2A6KA 1NOAA 3CFEB 3IXAB 4G6AD 3WEXB 4CADA 1URZA 2EXYD 1JHTB 1PX8A 5AYTA 4K23L 5LGYA 1NBVH 4L1SA 5HJBA 1PZBA 1ORSA 1KBVA 1X5AA 1IQDB 1XHHA 1YDPA 3CZFA 4R3SA 1ZLUK 1I7TB 3TYFA 2XXCB 4X0KB 1KV3A 2AQ3A 1IB5A 3W9DA 4NZUH 3BT2H 1YPZE 3QRGL 2NY4C 1S9VB 2D9QB 4MJ5B 1NEZB 2V9QA 3DGGB 5AW7B 2EDYA 3D0LB 3KLLA 1YPZB 4JREC 3DX0A 4Y5VC 5BS0A 3KL3A 5TE4L 4HOZA 3FKUS 3K2UH 1HL9A 1DFBL 4HP5A 4YWGH 3SPVB 2C7FA 1ADQL 3ZTEA 1KGWA 4F91B 3GSWA 2YD2A 3TVMB 2D31A 2VR6A 1A1OA 4PBVC 3ARXA 4QT5A 3CUPA 2X4OA 4NP9A 2ESVA 1IM3B 1CL7I 5EUKA 3RY6C 2R4RL 1Q9OA 5E2UH 1ZWIA 2YAEA 5I1LA 2AXJA 3G5VB 3ZYZA 3ES6A 5DJ2A 1F6AA 1SDYA 4A68A 1Q4NX 4HALA 1FN4B 1N5AB 3RVXC 3N40F 3D52A 4LSUL 3PWVA 4JO4L 5GRUL 3W2DL 2FL5A 4QTHB 1GAFL 3EIFA 5MP6L 1G7HA 1YEWA 2P4AB 3AS0A 5AWNH 4NQEE 3UTQB 1CDCA 2OYKA 4FULA 3FRUB 4I5BB 4LL4A 4H5SB 1RIUH 3OKNB 4N2OA 1KMGA 1Z1WA 1A1MA 2GTZA 1MFDH 1A3QA 3QPQC 4YOKA 1ZIBA 4F57L 5AVRB 2GABA 4PU2A 3BDYL 5IESH 3ZE1F 1LE5A 3ESUF 1JD9A 4HMEA 1F1GA 3I02A 1FORL 4B97A 2EYRA 1HHHA 5FC9A 2VJ0A 4WUKH 3OWEA 1GR7A 5C2BL 1MI5E 2O61A 4L8BA 3CFJA 5I8CB 1DO6A 1PZ3A 4P9MH 2NQDA 1U9KA 5I16B 2J88L 5HGBB 4M93C 3U0PB 3D2UB 4OLUL 1BXUA 2DYPB 3NIDF 4RFNB 1IKFL 3ZE2E 4DK6A 3RFZA 2XUWA 1QSEB 5TPWL 5TFSL 2VLJE 4Y19A 1WZ1L 1GC1H 2GEEA 4JS7A 4JQXA 2VLME 3WD5H 4O02L 15C8L 4Z5RA 3OB8A 3D4ZA 4NBZB 2UWEF 1F42A 1UYWL 2R29A 3H6JA 1NGQH 5MEPA 3O11A 2XQBH 1T83A 2JKWA 4WI5A 4P9HC 5J3HC 1IC0A 2AITA 3DRTA 1A7OH 3UJJL 3VXOA 3IRPX 3NG5A 5I66A 3MRGA 1H8SA 5JNYA 2OFQA 2DQGL 2Q76A 4IOFD 2FIKB 5B38B 4N6RA 3RTLA 2HTKD 3HCVA 4S10A 2WMPB 4HBCL 4TSCH 4APQB 5FF6A 5E9DE 5J0BA 2IAMA 3ZU8A 4RBPH 3X11A 1DVQA 4UILH 3NGBB 2YAMA 1OAXH 3WUWG 3QHFL 1RFDL 3TPUA 2P8LB 1EZSA 1QFWM 4WU5A 3SYCA 4ZPVA 5LNEA 4ZFOL 4XX1G 4FFYH 4FFYA 4G6ML 5I5JA 1XD0A 2C5DC 3NIDB 4NO5A 4IEFA 2K6WA 4NQDA 3T9WA 4NM4H 3AG1B 3LKOA 4MB4A 1ZD6A 4Z3GA 2NNCA 1LEKA 5DJZA 2YD1A 4OIFA 3OAZH 4RLDA 4HWEH 4Q97A 1GS8A 5GRZA 1CTMA 1WZKA 2ADYA 2QZ5A 5C6WH 1A4AA 2NY7L 5KBDA 3SBRA 2E7LC 4B53A 1E4KA 5F0PB 5F72S 1HH9B 2WLMA 1G7LA 3GEFA 3VFTA 2VLLB 2DI9A 1BVKA 1UKTA 1XSJA 5L7XH 3VD3A 3BCDA 3D4GA 3ZQ9A 1KTLB 1D6VH 4QGYA 1UWXK 1YJDL 4LHUD 4C56A 4H25B 3ZE0E 3RFRA 3ZMEA 2Y3AA 3QFDA 1EGJH 3PHQB 5JXEC 4LQ1A 2CK2A 4JY5H 2LU5A 3C60D 1BQKA 5D1QD 2ZWLT 4K73A 3QCVL 3WY3A 2CLRB 3ESMA 2P47B 3LV3A 2XTSA 3ZDZF 5I76A 3LX9A 4PJDF 5F9OL 2ZD0A 2BPBA 1QTYT 4Z8FL 2R1WB 3U0PA 1H8NA 1M2VB 4H20L 3WFDL 1KV7A 5DZVA 1CBVH 3APNA 3OLDA 1I1AD 4HLJA 2XIDA 2I7OA 3GMMA 4ZMXA 4R4BA 2VDKB 3LKNB 2AJYL 4PJHE 1A5FH 4P5MB 1CXHA 5CLTA 2GK0B 4PTUA 1NL0H 3L9YA 4PGZA 3WSQL 4AL8C 3TNMA 3VGDA 4RAUA 5KW9L 4DESA 3FHQA 1RPKA 5HXMA 1JF5A 4DVBB 3U79A 1KT2A 2IV9A 3VXOB 4PGBA 2N7BA 3F2LA 3DYMA 3IDYC 4P59L 1QATA 4QKTA 3UTTD 2HT3C 2WQRA 4H26A 3KLAB 1C5BH 3GJEB 3MV9E 5CJOH 4PBDA 2VR8A 1A6WH 3ZZQA 3RGVD 1H6EA 2X4UA 3FCUB 4OJFH 3SE4A 2A0LD 2AW2A 1FL3A 4AYFA 2ZWZA 3DX7A 2C34A 1L9OA 4JRFA 1NGYB 4G1MB 4HGMA 4M00A 1VACB 2HPOA 4NO5B 2QDWA 3ZMNA 4YN3A 1HJBC 4E41B 2H3NA 3F12B 3GD1C 2A4ZA 3KDMA 1I4FB 1WH0A 1DJIA 1G4MA 1B4JL 3NK3A 4XVJL 1RP8A 4EN3C 5I1AB 1UB6A 2DF3A 3BVXA 5K39A 1QHPA 1WBZA 4NQDD 3SGJA 4I9WD 3W0WA 5C0NC 2CUAA 4PCSA 4V1DB 2WINB 5TDNB 2HFFA 3MLRH 5I28A 1U8NA 2ZXCA 2NY0B 4E9SA 3IKKA 2ED7A 3X1FA 1QVOB 1TEGA 1OSYA 4W6YB 3OAWA 4LLUB 1I3RA 5BV7C 1EHNA 5DK0B 2DQUL 2DM4A 3H9SA 1W2KT 5EORH 5AZ2H 1ADQH 4ACPA 3EJYC 5E6ID 5FO7B 2IANE 3MV8B 2AEIT 5BOPA 5IFAH 1BJ1J 4ZNCD 2BSBA 4G5ZL 2AZUA 5HPOA 4XWOC 4NPJA 1RKRA 4XHQA 4TUJB 5C09B 3KDPB 5H4YA 1OGAB 1TQVA 4HDIA 2RHEA 1M56B 4O2EA 3L2LA 1JERA 2F8OA 2GSGA 4PBWD 3SDXE 3L17A 1D7CA 3OMZA 2OYLA 3ZKSD 1Z7JA 5IW1B 1T2XA 1K4CA 1E8XA 1FYTE 1GL4B 1GZQA 4L5FE 5B8CC 3NIFE 3JWOH 4HCRH 1DN0B 3H7LA 4A63A 1A9VA 4JZJC 4TUKH 2NCEA 3NEXA 5F89A 3WIHL 5B38G 1JWSA 5MEOB 2A9BA 1DZBA 5IBUG 4TTDC 1JRHH 1FL5B 1AGBB 1SHWA 4UIKL 3STLB 5F1OB 1KXTB 4LCCB 4MSWB 5JHDE 3BX7C 5F3HB 5KSVA 4ZSOA 1N2RA 5EO1B 4A6YB 2GBUA 3MJ8B 2ZOLB 4N2NA 4JFSA 5DHYB 3GTVA 4WUUE 2PXYB 4XBGB 1OP9A 5AOKA 5LGKA 2NR6A 3C08H 1OALA 4GH7B 1EAOA 2PWGA 5CD3B 4BRVA 3GJEA 1MVUB 3FOMB 1U92B 3OXSB 5JHLH 1OT4A 1JGUH 4JRLA 1MI5B 3THMH 4LZKA 4YHIB 1DP0A 4HWNA 5EBMB 5IQOA 2EDHA 5E95B 1KGUA 5HYSA 2BSED 2DIEA 4IM8A 4UUJA 4FABL 1P1ZB 1XIWB 1E0OB 3Q13A 1DHKA 1JGLH 4AMXA 3GB7A 3VGFA 2P80A 4PRPA 3ARBC 5FUOL 3CVCA 3LCYA 5E8PB 4XB8A 5HHOE 2HZHA 3ULSA 1JNLH 2AQ2A 2W8CA 3JSSA 1OF2B 4L48A 4X7DC 5AW8B 1BCIA 4Y5YB 1ETA1 3CNKA 3IDGB 4K71C 2YC1B 3QFJB 5F0JB 1MSPA 2WCGA 1E4JA 3GMNA 5C97A 4N1CA 4V1DA 1JZ4A 4GXFA 2RALA 3ZDXE 1RP9A 4Y4KD 1EJ6A 3ATAA 4PRIE 1Z3GL 3JTTA 3MUUA 1RURL 4DUXA 3RWIB 2J1WA 2J6EA 5DMKB 3EYSH 3L81A 3MXVL 2DIJA 4XNAA 3GIVA 4L4VD 1P9MA 1DQDL 4QHMA 2A6DB 5FS5A 3DOSB 3QZWA 1LEGA 4IMLB 4Y4FB 3SDCB 1QTPA 2AAAA 5HVHB 2HRHA 3ME0A 3QIUD 2XX0A 2J56A 1X9RA 1M1SA 2R0KL 4YHLH 1JZ5A 3DMMA 4EQ2A 1BX2B 1T66C 1E5AA 1MJ8L 4ZAKD 3Q7JA 1ZXKA 2Y7LA 4AKPA 4N2LA 1XF3A 4LPTA 4Q9RH 1JWUB 3N0AA 2BXZA 1JYNA 4YHMH 2ZG3A 4NZUL 3LQAC 5EZIH 2Z34A 1A4CA 2NLJB 5PCYA 3JTSB 3WLWC 5DJ8A 3CXHK 4GP5B 3CE1A 4IBUA 4WHYH 4X7TB 2KLTA 3CFQA 3AB0B 2AV7A 1S9XB 4FOMA 4ACTA 3BE1H 3BWZA 4U1NB 4J2QA 3P0VL 3WFBL 2GJPA 2AK4E 4AEHH 1PS3A 2H47C 4NQCD 3KJ4C 1X5HA 4GS7B 4R7VA 4WENB 2X89D 4KZCA 5EOQH 5IFHL 5J9PB 3D08A 5FYJE 1T1YA 5GS1C 1KB9K 5JXED 1QFOA 1ED3A 1O6SA 1T0PB 2YGQA 3MR9A 4X6CE 1GOHA 1JHKH 2V3FA 1NCUA 3D3VD 3I2CH 3MJ9H 4K7PY 4XWOD 2BRRH 1Q94A 2HG5B 4HJSA 2VXUL 43CAB 4FFYL 5DQ9B 4J4PD 4FQ1L 4LOUC 4NQVA 2NYZA 3MUHL 4G7SB 1NCAH 4U6HB 5T1DH 2XICA 5JLZB 2UXTA 4KQ3H 2CDFB 2R4SL 4GMTH 5A1AA 2WWNA 3T5WA 2E4TA 2X9ZA 3AU1A 1WVZA 3B9EA 3E8UL 3K81A 4NJ9H 1XIWA 3VGGA 4GP8B 3FO0L 1RZFL 3ZL4H 1CG9A 3A6CL 2ICES 4IGBC 1GA2A 1JPSL 4YO0A 3PNWA 2NY2B 5CZVL 1BPVA 3OC5A 3NIGE 4ODVH 4ELME 4F8NA 1JHLL 4I3SL 2LQRA 4YHYC 4AIXA 1R3JA 1Z3RA 3QDME 5LXVA 4YXLH 5K59F 4NQEA 1GXEA 4ZW6A 1NBQA 3WI9A 1U93B 4X6CF 1RZGB 5J4MA 3WN6A 3HEIB 3BO8B 2PO6B 1WZ1H 4YSAA 2QMJA 2BZ7A 3BPNB 1MG3C 5D7EA 1KIRA 2AKRB 1TEYA 3D33A 3QJQB 1LXMA 1YC7A 3MOAH 1P2CB 1J8SA 4R26L 2C3GA 3BP7B 1WYJA 5E56A 2A6DA 4YE0A 5KS9F 3HR6A 5DFAA 3GZKA 1QW8A 3EO0B 4HD5A 4MTMA 1M9WA 3IF1A 5I82A 2G2RB 1IAKA 4F37K 3LQMA 5AG9A 2EUVA 1ACXA 2CDEA 2NTSP 2XKUA 4IK6A 3U7WL 1P4LB 4AVJA 3TEZA 2MTAA 5A2CA 5BVJA 2L4OA 4GQQA 4KXZH 2ADFL 2ZT9C 4OLZL 1MXGA 2PPAA 1BZQK 1A3RH 1CGVA 1XGUB 4LCWA 5HY9A 2VRKA 3SE9H 2VRQA 4ZFFA 3HC0B 4GRLB 1OT2A 2B1AH 3OSKA 3VI3B 4NNPH 3MLSH 4ZFZB 1HH6B 4NN6B 1KIQA 2YPLA 5DQJA 1DVTA 2BINA 2OL3L 3QUXB 3P0GB 5F97E 2WLLB 1HHGA 1MUJB 5JW4R 1J5OL 1HCFX 2FIRT 2X1WL 1MHEB 3CFTA 4TSCL 2GBTA 1OK8A 2CK0L 3VD1A 2OJZH 1O6VA 4E36A 3U48A 3O2DL 2BNQA 4XMVA 4WTZA 4J3TA 2EIBA 3UPRB 5ISZB 3UH8A 3WGUB 3MR9B 4OBRA 5E2UL 4F9PC 4EXKA 5ICXB 4BSVB 1QO3B 1IBFA 4OCWL 2KT6A 4FQ2L 4PG2C 4HKBA 1BMZA 3C87A 3UTSB 3T71A 4XWGL 4HWEL 2YXFA 3N04A 1UH2A 5KYNA 4BWWA 2OYPA 1T1XA 3HLAA 4RAHA 3TH4T 3BLKA 4TSAH 2DIBA 3P02A 2W81C 4JQIL 1RURH 1VCBC 5B8CA 1XEDA 4OLUH 1RPUA 4POZC 3FN0L 1MWAH 1TVHB 2BHZA 4QRUA 5ID0B 4UM9A 4BUQA 3WV0A 1MFBH 3MRFB 4GI8A 1OLZA 4OJCA 3EYVB 4HJJL 2V3DA 4FA8A 1W8NA 4PLJC 1JK8B 3F7PC 2E4FA 2EC8A 4D9QD 1OP3H 3GGWB 5IIEA 5IT2H 3EFDL 4X98B 5AOJA 2YS4A 4TRPL 1N18A 4OIIH 3A23A 3BWSA 1LNUB 4GO9A 1MFDL 2ESVE 2P5EE 1DFXA 2OKMA 3BEVB 4LLVA 4WWID 4AXWA 4WI2A 2X6VA 2D7QA 3RIFK 2I9LB 5F2FA 4JO1L 4LOVA 5IHUH 2VLJA 2XKSA 4TQ8A 4Y19E 3VD2A 1PLBA 2Z4QA 4P23D 3W9EB 5GS3A 2GJ6E 5H37H 3CG8A 4BK4A 2VDOH 4XBPA 3V5DB 4IOFC 2EICA 2YXMA 1WUNT 4Y2DA 1V54B 4MA3B 3LN4A 3CFDB 4PGEB 4QKXB 3ZE2B 1LO3L 5T1LD 1AO7E 2B14A 3MRIA 1QSFB 1BVLA 2WTOA 1FFOB 4UTBL 5ELIA 3CIAA 3HIZA 1B2YA 1X5KA 3DX4A 1JPFB 1TQCC 3D9AH 4YLCA 5IQMA 1B9ZA 1S9YA 3ATFA 2WXRA 2Y4SA 4G42A 5DYOA 2D3LA 3P73A 4PLNC 3WTXA 4NQQA 2AJ3B 3MV7B 1S7VA 1CGWA 1I7TA 3P11H 4MVBD 2B1OA 4G8FA 4PJ7A 3TYFB 4EI5C 4F92B 1AJ7L 5J6GB 4WKZA 2VUYA 1JYWA 1REIA 4WO4C 5DHMC 1K5NB 3LXBA 3KCPB 4NO0A 3U7YH 4TRPH 4I3SH 1E7UA 3IGFA 1NFDE 3CQPA 3QC6X 2A1WH 4XMWA 3NABH 5D1QE 1F6FB 4XBMA 4ZW7A 3TCLB 3VE0B 7PCYA 5I30L 1JZ3A 3NJKA 3OKMA 2DMBA 4FZEH 4MA8H 3X13A 4JG0L 4IBQA 1MRDH 1TTBA 3BAJA 4HEME 4RAVB 3QAZB 1AGDB 5KAQG 4LKXA 3HLAB 2YAHA 4GKNA 3NZSA 2VISB 3UCQA 3O8XB 3BZFA 3MOAL 3IMUA 3QJHB 3L5XL 2ADGB 4PJ8D 2J20A 4LE8A 3WFDH 1CBVL 4JHUA 1UA7A 1N26A 2SODB 1I8KA 4G2AA 5EUKB 3B7UX 3TASA 5JMOC 2LVEA 2WOYA 4JQXC 4WV1B 2H0JA 3GFUA 2ZKWA 4JK0D 1QG3A 1UVQB 5IJKC 1KXQE 1UADC 3V4VL 3VFGH 4MJIA 5D7IF 2YRLA 2D3VA 4AEHL 1BYOA 4QTHA 1AYOA 1EGJL 4I3RH 5C0JA 4CVUA 4J3SA 2XBTA 1CXKA 3IEAA 1CICB 1A0QH 2P5EA 3Q5OA 4R2GB 3F7QA 1JS4A 1QW9A 1KENH 5FGCB 5FXCH 4AQAA 1NIEA 1U58B 3KYMB 1AIFA 3OX8A 5CU5A 5JDJA 1CGSL 2AEWA 1XH3B 1GOGA 4DKDC 3KLKA 5GHWL 3HI1A 2VSCA 5I24A 5FOBA 5E8OB 3AGVA 5I6KA 1KIPA 1MJ7L 1AP2A 4JFQB 3U6RB 3ECWA 4AC2A 2QGDA 3MV7E 4X6DE 3CX2A 4EOWH 2E9GA 3SPHA 1MFAH 5EN2A 4BH7B 4ENED 1WCBA 2OTWA 2OSLA 5L2KA 4E9LA 1G9HA 3HI5H 5ANHA 2AF2A 2Z35A 4JFDB 4S2SA 1P5VB 1BVLB 5EU6A 1BD2D 1MREL 3H6AA 4CDHA 4NQDE 2WUBH 3TV3H 4LNRB 5GGTA 1MFEL 4JY4B 1I9RL 1OAQH 3JXAA 5EUOF 4XGZA 1KB3A 3TO4C 5EPMB 2AJYH 1E30A 1L0YA 4RFOH 4XCEA 2YK1L 4JAMA 4P4KB 1DQJA 1SRDA 3O11B 1RIVH 2J12B 1U8IA 5A16B 4UTCA 4BHUI 3RWJA 4MDRA 2H1XA 3L4CA 4YUEL 4JO8A 5K9OB 1XWVA 4IMKC 2Y0SA 3MUY1 4GG6A 1NAKL 3LPFA 2IANA 1BVNT 4ZNEA 4Z0XA 4N6RB 4PYGA 5F9JB 3DSNA 1XSKA 2WKGA 2CUHA 1TFPA 3OKMB 3QUKB 3K8MA 5TF0A 3S35X 5C6PB 5I1CL 4F7CB 1CVRA 1R33A 2XXMB 4JFXB 5KSBF 2WXPA 4UINH 4YNYA 4A2FA 3ULVC 2IVFC 5TPWH 4GNKB 4ZMNA 4XNQB 5E4OA 3CUPB 1PF3A 4B9JA 1RVFH 2BSSB 2CKNA 3BWAB 4WIQA 2YN3A 4TYUA 1EO7A 2P8MA 1PYWA 3IJHB 3K6IA 5D93B 2K4AA 5I1LB 4P48A 4U33A 1GYAA 4XPFL 5LCVL 2R27A 3VNYA 4TUUA 1FNAA 1U4EA 2EDXA 2VQUA 3NJXA 1M2OA 4RWHA 2BY0A 3NESA 4UOW1 4XN8A 3ZTNL 4LESA 1T03H 4NI6A 2RBLA 4JRYE 3V9CA 3MOQA 3RGBA 2VB5A 5AZUA 3SB3A 1DQML 1IGYB 3EDKA 1U58A 3LDBC 4K2UL 1ZGLM 4TTDD 5IJVA 1XV8A 3MUGB 1CDYA 1XGYL 4JFFB 1R17A 3UX9B 1P7QD 1J1PL 4IU3B 3EOTH 5FOBB 3HLKA 2E9WA 3LKRA 4QRQA 5DUPH 1CTOA 3CH8A 4NAQA 2VDML 4P2OD 2XBZA 3HUJE 1E6JL 4YHOL 3DO3A 4XNUL 4I77H 3C9NA 3W82A 4DKEH 1V7NL 4FLRA 4XO9A 3CFJB 3MV01 2HKFL 3QRBA 3SQOH 2L7UA 4RETB 1WIOA 3RVXD 1ZIAA 1TJGH 4PGDB 5FYKU 5HD8D 1M2VA 5CINH 1XGTB 5KJ4A 2Y6SD 4AK2A 5HHQB 4FG0A 5M7QA 3O6LL 1RZ8A 4M8RA 3K71B 1CXEA 4IRJB 2O5NA 5KVEL 3FUKA 3MAWA 1T0NB 3LKNA 4APXA 3Q3GB 3L4VA 4NPYB 2WXLA 4PRID 5M95B 1GC1L 1OSPH 5I6MA 3UL4A 1JK9A 2P44B 1HWWA 1LVEA 4NLAA 4DZ8A 4G8EA 4Y4KB 4RAUB 3QA3B 3VSTA 4E5XB 5JORA 4UWQB 3LJ3A 5DJCB 1ZVSA 3INUH 4YHOH 4F1SA 2YHGA 2ROYA 4TNVK 2Z4TA 3ZRFC 4MJHA 5I8KH 1HQ4B 3OTTA 5DHVA 1Z5LA 4KKAC 5E8NA 3U4BH 2GW5A 2CHNA 2DMKA 4LFHG 3TIDA 4GINA 3H2WA 1PG7W 3NCJL 1W6WA 2ZAIA 5D8JL 3T09A 2WJ5A 2JCCB 4RMWA 1U8JB 2C9SA 3ETSA 5AW2B 1I8LC 1A1OB 3LEVH 2I9TA 4X7SH 3N6YA 2A6JA 4N9GA 4DOHE 4X8XA 2PMZA 3QEGH 4W70A 5J6HA 4ELKB 1MFNA 3R0MA 4FQPA 2F61A 4JFFE 4NWUH 1ZWIB 2W5PA 2H6PB 3QWRD 1ULVA 3G5VA 2WKOF 5DD3L 1QWNA 2G3ZA 1I4FA 1RV6X 2CIIA 2ZYSA 4ZXBB 5JHLL 3QWOB 5T3ZD 5IHWA 2FL5B 1EH9A 3GBDA 2BRQA 5LCVH 4DTGL 3CIQA 3P3TA 3V6ZB 5C8JA 3MRLB 3ZT6A 2MH4A 3AS3A 4G8IA 4EEEA 3CCHB 5HDBF 2P7TB 4G6KL 4HUNB 4XNMB 5F88A 1E6OH 3APDA 3FQ1A 4XMKH 2IBBA 3T8XA 3HRPA 3QPKA 1NCWL 4N85A 3GSQB 3LEVL 5CGYC 3O41B 2GTQA 4QHLA 3VXME 3STZB 5IUCA 1KELL 3LHPH 3NOIA 5I1EL 4JM2A 1EDHA 1TCRA 2A74C 2DQFB 4UU9A 5D7JC 2FSEA 1JUFA 2WVSA 1J12A 4OZGA 4JY5L 2CD0A 1OGAA 1VFAB 4XH2A 1IAIM 2Y7SA 3DTDA 1XO8A 1Q9LB 4MWFB 5CZVH 2DWDA 3GRWH 2X7LA 1M6UA 2ZG1A 5EBGA 4N90E 1OGTB 1ZA6B 1ID5I 1MAML 4OR1A 3VJ6B 4HOWA 3ULUL 1FLTX 1ITBB 3NA9L 4R7XA 2Q8BH 2D2OA 5L2KD 1A6TB 5IK3A 3MNMA 4QTFA 1NDTA 1S5HB 3TBWA 4OZIF 4P49A 1F8TL 1A8ZA 3ZGIA 2DB8A 5EOTB 3Q2VA 2JELH 5HGHB 1F4XH 2IGFH 1D5IH 4XBGA 3AMKA 4XCYB 4FFZA 1JNJA 3ESOA 3ZQXA 1G1OA 5GGQH 4P9HH 4K15A 1MJ7H 4G43B 1QI3A 5DWUH 3B34A 3HUJA 2PP8A 3SO5A 2JQZA 1H5BA 1RZKC 4N20A 4ZS7H 2PPEA 1IUZA 1AXSA 2WCPA 2X6CA 3BN9C 3HMWL 3BAEH 4LEOB 4YDIH 2X9XA 5D7IB 1JGEA 3UTTA 1U8QB 2LABA 4OD3L 4RVBA 1UD6A 5C0RL 1Q9WB 2I9TB 2P52A 5FYKL 3D7PA 3HRZC 1UKSA 3VCLB 2O6DA 2R0LH 1T6BX 4KK9C 2EDMA 3BGFC 2VZVA 2BZCA 3ASWA 2HMIC 4M1CD 2Y69B 2HCZX 4OJDH 4LLYA 3V0IA 4JN1H 4LDCA 1DQQA 1X44A 4KHTH 3ML9A 4A38A 3SEPA 4F58L 4LEBA 5JHMA 3CCHA 5I18L 2VLLA 5EIIB 3WNLA 1UURA 5HJGA 3RTQD 2MKWA 2VH5H 4KPHH 4MMZA 5E6RB 2KS0A 2B9AA 2WQUA 4K3GA 3WSQH 3IFNH 1XQ4A 4I9XA 4PJ9C 3P0VH 4BFEA 2QEJA 5DEJA 5IW3A 1U8LA 3J27A 2FBJL 1HZKA 1OPGH 5IMKB 1FFQA 2EABA 1R4XA 2GJRA 2QPEB 3RVWD 4FG6C 4TVPL 3FSZA 1FC1A 2BFGA 2H3XC 3A6BH 5MEQB 1GIGH 1FVEB 2DYRB 2CJ3A 1P5UC 3LKPA 4WHDA 2HN7B 2WUCH 3QQDB 1K8DB 4KZDL 3D0AA 4K7PL 4EN3D 4G3YH 4KWUA 4AENB 1SYVB 2R0ZL 3EDJA 2R0KH 4YHLL 2V2XA 2Z93B 4TNGA 2ZSWB 4HIEA 1ET7A 5F7KC 1NKRA 2WBJB 1T5WB 5CIPB 5KYXA 3T0EE 3RDTC 2PTTA 4PS3A 4N0UB 3SDYH 2Y7QA 5D7LB 3EYSL 2Y5TB 3TCXA 2BHYA 3B6SB 4P57A 4O5LH 3AT0A 4GG6E 5JO5A 5LDSA 1Y07A 5TK4A 4FFZH 2VLRD 2FX8H 4QRPB 2NY0D 3L2NA 5DO8A 4EBQL 5K93A 4S0TD 5TE6H 4RQQB 3SPGA 2DKUA 4MCYA 1DJZA 3ZDYB 4KVPA 5KVFE 1IBYA 2NW3A 2JIXA 4G9FB 4WW2A 2KZBA 1DLFH 3FT3A 4JPQA 4KDVA 3RZWA 2GC7C 4O58H 4ZMTA 4C57C 1JNLL 3IJSA 1G6VK 1K72A 1VRSA 4NRXA 4HUXB 1QR4A 1ZKAA 4MQXC 5EU3A 3RJQB 2CDFA 4ESKA 1IBGL 3D50A 3BRGC 2XX1A 3P30H 3WFEH 3QIWA 4D9RD 3GM8A 2FD6L 2W0PA 1TPXB 1IO4C 5AW3B 2C3WA 5D7KE 3FBKA 4CDGC 2BJML 4M9OA 4NERA 1FCGA 1YPZF 2LVCA 3CSBA 4OD3H 5F7NC 1UM4H 1KENL 3MA7A 4U3SA 1ZY9A 3WMQA 4J27A 4ABQA 2GUOB 5TQ0H 3ULSB 3QYNA 4Y1AB 3CZNA 2X4RA 3GI8H 4AOFA 1X7QB 4JFZL 4PB0L 2X70B 4KVCH 3F01A 4LHUA 3VFMA 2EVJA 1YUHB 4HKJB 2CM6A 5JDSA 5IHLB 5BUPA 3SKNA 2FX7H 4XRCB 1F4XL 1II4E 2IGFL 4OI8A 1IBGH 1LP9F 2FWOA 2K7PA 3C5ZC 1N70A 5E9DD 2J8UF 3IKCB 4GXUN 1IE5A 5E2VL 2NY1D 3ZL2A 1PCXA 2VDLL 1N0LB 2H6OA 4JPKH 3CU7A 2OCCB 3ZVVA 1DANT 1ES0A 1KYOK 5TFSH 5F7DA 1VADB 3K2UL 1EXGA 5DFTA 3SKJH 4OGXL 3OLGA 4L4JA 2HRPH 4GRWE 2F7PA 2ZX6A 3MBEA 2NX5E 3UYPB 1BOGB 1FO0H 4OQTA 4YSOA 4P5TA 5DEFA 4DKEL 5EO9B 1O7SA 3HG1A 4YK4B 5D1XB 5F7FA 4GFXA 5D2LE 5GSRA 5AB1A 4ZZKA 3AWFA 1DN0A 2X41A 4ODXA 3G08A 4HIEB 4RA0C 3QK0A 2A77L 1M4KA 3LHPL 2CLZB 1T89C 1J11A 2ZNWA 3QUXA 4Y4HD 3S6CA 2WYTA 1HHGB 3TT1H 1EO8H 2P1YA 2WBXA 3SE9L 4MSWA 2C9PA 1CF8L 1GPOH 3DYOA 5HHMB 2OW7A 2B1AL 4PCTA 3O3DA 5A6IA 2DV6A 2EXYC 3MRJB 4XAKE 1EJOL 4WNQB 2P28B 4FXTA 5DA4A 3MV7D 2R59A 4CUCA 1CR9H 2E76C 3IDIA 2ZF8A 1U3YA 4HK0B 1OKEA 3S5LG 3IE9A 5FO2A 4P5KB 4RISH 3UO1H 1I8UA 1XTLA 3PAUA 3KPPA 3VD7A 1UD2A 4HPOH 4P46B 5IHUL 3C5JA 2ZUXA 1ORQA 4Y5XA 1HILA 4MBOA 3EYOB 4R96B 5LNDA 2IMMA 1Q72H 5F96L 1V7ML 5B4MD 1ZT4A 1U3ZA 2M2DA 3LS4H 4UDUB 3LNDA 3F83A 3EFDH 3LIUA 1MRCH 3HC2A 1Z32X 5AKSA 5FWQA 3RY6A 1JHLH 2AZAA 4MD0A 1OHZA 2O1AA 3R8QA 3APFA 4H1LB 4NT6A 4Q8BA 4XPTH 2F0CA 1KBKA 4BV1A 2OK0H 2NR6C 2YWZA 1ANUA 4AVKA 3LPGA 3OHXC 1R3HA 4GFTB 2PO6A 2XV6B 2PW2A 3D4CA 4OUUB 2XQYG 4XP9H 4DKFH 2N7SA 4BFRA 3MX0B 2SEBB 3F7LA 5AD0B 4QCIB 4JFOB 4JPSA 5FA3A 4Z3TA 3SBWA 1XXFC 2VLJB 1JZJA 4ZMVA 1IQWH 3ILQC 4K23H 1KEMH 2IQAA 3GWJA 4WV1C 2I60H 1FNSH 1X9UA 2IOIA 4P04A 4X42A 5CEZL 3O6KL 3HBZA 4X80L 5DLML 3T2LA 4ONFH 4HFWA 2JKJA 1T5XB 2DQHH 1Q0EA 2WXJA 4XAWH 4XPBH 3O8XD 3X1GA 3K72B 1AOHA 3GSVB 1F11A 2D3NA 5BVJB 4XP1H 5F6HI 1XF3B 2AP2A 5FCUL 3T3PF 3RJOA 1NFDB 1JV2B 4GAYA 3GO1H 4RDBA 5KN5B 5T1KA 1AKPA 3O2DH 1OAZL 1DBAL 4MAUH 4QXUH 4Y5VB 5FFLA 4RWYH 1JIBA 3I6GA 1E3ZA 4HIHA 1FHGA 3CDGA 3G08B 4X5XB 5D96C 3OV6A 2CLZA 3F6IA 1UOVA 2BFVL 1FYTA 3MLVH 2WD0A 5FV1L 3VSUA 4Z7QB 2W9EH 3CBJB 2AJ3A 3C60C 5D1QC 3SD2A 2NY4B 1KCRL 1ICTA 1PCSA 3AMLA 3M6DA 1EPFA 1SXCA 3QCTH 1FVCA 4U1LA 1BD2B 5GGVL 3D51A 4NSKB 1LEIA 1HWGB 3DURB 5DWUL 5LAXB 1G6RH 1BEXA 4IDJL 3FQXB 3AGWA 2UZYB 4LSQH 4MCNA 1FE8L 5CBEA 3U4KA 1X6LA 3FOLA 1E67A 3AXLB 2DQEL 1OE1A 3FAXA 1DE4A 2JELL 2OW6A 1QBAA 4Z7VB 1DSFL 4HKXA 1CDHA 3VFSB 1CDGA 1MF2H 3L1FA 4JM2D 1RHHA 3VRLE 4DN3H 2MNWA 2VLRA 5L9DL 3Q0HA 3VXUE 2B77A 5ITFB 2ID5A 3FTWA 4WK4B 5HYQB 5IB3B 3P9MB 3GSWB 3G5XA 1FRGH 2J1YA 4MDJB 3WTUA 2W38A 1MJJB 4PJIB 1NGPL 1MFUA 2OAAA 1X7TA 3KHQA 3QORA 2P49B 3IMRA 2ODIA 1PZ5B 5ERWB 3KPLB 3TURA 1Q9OB 2FATL 2GITB 2HT3D 4FLHA 2N59A 3AADB 1CJYA 3VW3L 1A4BA 1OM3L 2ZUQB 2HKHL 1HHKB 3MCKB 3VNZA 1BMGA 1BXAA 4GAFB 2XWDA 3KEHA 4WUKL 1C5CL 1G43A 1ZPUA 2XXFA 1W8OA 5TD4A 3WTVA 4L3EB 2A1WL 4B9KC 1KELH 5IR1A 4PJGE 4G6JH 3IAQA 3T0AA 5DO2C 3GGWA 3NH7H 5JQ6H 4OGZA 5LKNA 3WFHB 1KB5L 1EHAA 3T3MF 5BV7H 3NEEA 1G6RL 2OMUA 2RD0A 4A7QA 2XSKA 3OKNA 4MBRA 5I17A 1LO2L 1BG1A 3UZEA 2XWCA 4LMQE 4QD2E 2VZ3A 4WU7B 4O02H 3MYZA 2ARJB 4MA7H 3RU8H 3EG9A 3QXVA 5IMMA 1G9MH 3MCYA 1EEUA 1NINA 3HVNA 4PJIF 3T0XA 3UTSD 4EDXB 4Z77A 2PNDA 4NKOA 1D2OA 1YQVH 2IDCA 4JFFD 5JOPE 3T6VA 1KJ2A 4J12A 4PN6A 4L18A 2YUXA 4YHZH 1FFPB 5DR5H 1C16A 1QSEE 2Z7UA 4MAYB 4LNVA 5LN8A 5KSUA 5KSAB 4QHKI 5J13C 3ELAT 3DDFA 1FFOA 1NOFA 3II1A 4OM1H 4Y5VA 3FFCA 2WXGA 4I2XB 4K94L 2ICWI 3FQWB 4LNRA 3O6LH 4KRMB 3TJHD 2IWFA 1JZDC 1JV5A 2BY2A 3HNTH 5DRZB 6TAAA 3VXUB 4F57H 3MCG1 2IXQA 3DHMA 1HDMB 3CC5B 1NEUA 4EUPH 2RACA 4L4VE 1FNHA 5FAAA 2ZXAA 4JDTL 3PWUB 5C7XL 3QPQD 3PPEA 5IT2L 2HJLB 2WKLA 2K70A 2YUWA 4LK4A 3N9GH 4CVXA 1MHPL 2FHCA 3KWWB 4U3XA 4AL8H 1CDIA 2NY0C 1GJWA 1RQ5A 1E3XA 2QMKA 3SKJL 3CAFA 3TZVD 4ZT1A 4BQCA 1XT5A 4ANVA 5A2FA 5LAPA 1EFQA 3F7VA 4DQOH 2QVTA 5I0ZA 5HHNB 3J2PA 3NJNA 5D9SB 3SJVD 4YQXH 1NDMB 5I5MA 1BBJA 3QORB 3UTPD 3H9HA 5CXPA 4E9XA 1GZPA 4JHBA 1V10A 1M7DA 4OY9A 2OJ1A 3ZYJA 1TQSA 1B0IA 3NA4A 1KACB 5C0EA 5DJZB 3DK2A 1SXBA 4V11A 3T65A 4ENZA 5I1IL 3KJ4B 1EFXA 9CGTA 2NNXA 3IJYB 3CZKA 4GG8A 1AS8A 1JP5A 3LZOA 4XXWC 4KTEL 3FONA 4KGJA 4OKVA 4BZ2L 3NPSC 4I4WA 4PCKA 2CJUH 3BESR 4XCFL 1WSST 4AQAB 2YGVA 3WFHA 3FRUA 1VIWA 3D3VE 4OCRL 1F18A 4NO3B 4NWUL 5TGBB 2FR4A 3GXUB 1K6QH 3MUGA 3BEVA 4LLVB 2UVEA 1CU4L 4FC3E 4JFYB 4DGWC 4WZ9A 3JWDL 3OPZL 2KUTA 1UT2A 3GXIA 2ZF9A 3VQ2C 2CQVA 2WK2A 4P05A 3W9EA 4D8OA 4E0RB 1BQHA 2GC4C 5I0YA 3ULVD 5B1KA 2VXQA 5E6ZA 1BIIB 1I1AB 1VJSA 1UWFA 4MDIA 2WXMA 2FH8A 3QIBA 4PG9B 3CFDA 3ILDA 3R8BB 2MPAH 1XGRA 4JL1A 3RUGE 4HPYL 3B7TA 2VZ1A 2HT2C 2WW8A 3APCA 3Q1SH 1AXIB 3CVIL 3T4YA 2C7UB 3G7TA 5FYLE 2EDOA 3HS0B 3P4MB 2CG9X 5JPNC 1C12B 4NHUB 3TBSB 2VDOL 4GMSL 5CO1A 2BOCA 2WUBL 1P9MC 5GRYA 4ZMPA 4M7JL 5F6IC 4G42B 3C6EA 3K7UA 2X1QA 5F7UA 2XA8H 2XTJB 4XP4H 1LM8V 5I1CH 4X0KA 4GUOA 3PFUA 5JOEA 1CGXA 1DEDA 3L9EA 5DI8B 4UQBA 3VGAC 3DO7A 4M6AA 1XB8A 1EUTA 1S9VA 4M8VA 3WDJA 1TQUA 1WWAX 4DVBA 5D1ZA 4O2CB 5EOCH 3QIWD 3Q6GH 2UXFA 1CFSA 4G9DA 3KWXA 3AWEA 3D0LA 5HHVL 5HBBA 2CALA 1AOZA 3L54A 3MYJB 3UJTL 4IOIA 4UDTA 5DK3A 3KPOB 2ZICA 4IGBB 3PXLA 4PY7A 3HR5A 3RAJL 4P99A 2B15A 2OI9B 2WZ6A 4GKNB 4MA1C 3WELA 5D9SA 3DOHA 3N42F 4PJFF 2FB4H 1M7IA 3UBXI 3US1A 4QXUL 2FEDC 4A66A 3VXNB 4B96A 5HI5D 4P06A 3IE4A 2IDUA 4GKZA 1IAII 1MF2L 3HHSB 1C1EH 3DARA 2CPUA 3CD4A 3ZE1E 2WC7A 4CU6A 4BINA 2Y1YA 4WHTB 4XZUB 2QQLL 4N24A 4ALAH 2J43