4DPLA

Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with nadp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
354
structure length
354
Chain Sequence
RTLKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGQVPKEIADMEIKPTDPKLMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPHTISLIDEQRKRREWKGFIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDNILPLGDGYDAKTIKEIFRILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAPSKPIIVMNEDTRPQVYFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVEKGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for a Bispecific NADP+ and CoA Binding Site in an Archaeal Malonyl-Coenzyme A Reductase.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
molecule keywords Malonyl-CoA/succinyl-CoA reductase
total genus 118
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.75: Malonyl CoA reductase (malonate semialdehyde-forming).
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4dplA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dplA01
2DC1A 2XXBA 3VOSA 3GMDA 4M86A 4JJIA 4Q3NA 2BRUA 5A3JA 3TZHA 4BQPA 1DLJA 3PQDA 3HN7A 4J3FA 2I5PO 3DDNA 5JS6A 4RPHA 3HWRA 1DB3A 5CG2A 3ASUA 4RDHA 1YOVB 4TRJA 2Q50A 3F47A 5G2OA 2OXIA 2AQIA 2Q4EA 1ENZA 6LDHA 1DEHA 2X5JO 1C1XB 4XJSA 4I9UA 2QZ9A 1YJ8A 1EVJA 3AWDA 1T26A 2PGLA 1U8XX 5IF3A 1OI7A 2VRBA 4EW6A 1F8GA 2XOXA 5CEFA 1Y6JA 2NTJA 3F6YA 1KYQA 4Z0TA 2I9PA 4ZRNA 4OOEA 2O23A 1BRMA 1KEWA 1KEPA 2GERA 4HKTA 3KLMX 4JCOA 3ZU4A 3W8EA 1JWAB 1IE3A 1W6UA 3TRIA 5LDGA 3JQBC 3RROA 4Z9FA 1ZEMA 4YJGB 2Q1WA 2IDZA 3RUAA 5JC1A 2FZEA 4LW8A 3UW3A 1R0LA 1V6AA 1CJCA 3FR7A 3LK7A 1SBYA 2VT2A 3FNGA 3G1TA 4J1SA 3DOJA 3KYBA 1YE3A 2GN8A 5AXBA 2BHLA 1GQ2A 1M2WA 1LJ8A 1SCUA 5DOVA 1PQUA 3TZQA 3V2UA 1QYVA 4UEOA 4YRBA 3LC1O 1CQJA 5A9SB 2D5CA 1P3DA 4WE3A 1MFPA 2OHXA 4RJTA 1XU7A 4MP8A 1LDMA 3WBFA 3TQHA 2HMTA 4O59O 4YBZA 1O6ZA 3GDFA 3IKTA 4ILKA 2YV1A 1NASA 3T4EA 5L4LA 3I3OA 3ZNOA 3G3EA 2OO5A 2C20A 3C7AA 1KVRA 2H9IA 4HNHA 4YJFB 2H63A 4L74A 4FFRA 1LSJA 3H4VA 3QWFA 4QXMA 1GV0A 4CLOB 1MLDA 2W2LA 4CLHA 4CV2A 3ROKA 5IZCA 1I30A 1FDWA 3PWKA 1Y8RA 1FK8A 1K6JA 3O9ZA 1ZK1A 2ZB4A 4FOOA 4R9RA 1PTJA 2ZQZA 1TT5B 3E9MA 3LQFA 2Z1MA 1T2DA 1X15A 3UFXA 3ZWOA 1E3EA 3RC9A 1PEDA 4BO8A 5TLSA 3STHA 3G17A 3PLNA 3DMTA 4DLLA 2VYND 3JYPA 1QYDA 1WNTA 4ESOA 1HDOA 3WGZA 4EDFA 4B3JA 3LT0A 2VWHA 4YWJA 2WE7A 4R3WA 1RM4A 1N9GB 3IJRA 3GG9A 4P4NA 3VDRA 5JSFA 3VH4A 3GNTA 3AUSA 5LC1A 4LMPA 4BL5A 4FPXA 5JMPA 1DFIA 3K6JA 3L9XA 4YT2A 3EVTA 4K9DA 4JP3A 4CV3A 4JXKA 3D1LA 1DIHA 4MVJA 1DFGA 3GEMA 1D7OA 1J49A 4EJ6A 4GGPA 1MG0A 2VYVD 4MOWA 4XGIA 1LNQA 3PGXA 1P31A 1GEGA 3QY9A 4NDNE 4W4TA 3VPFA 1G1AA 2X7HA 2YV3A 3DL2A 1R4MB 1TXGA 3D5QA 4CM9A 4Y6PA 2YW9A 3DZJA 3MZ0A 1O89A 1O94A 4A26A 3QW2A 2IEBA 2QZZA 4OSPA 2P9EA 1W8DA 3R1IA 1QR6A 2DFVA 4J1QA 2Q2QA 1CIVA 3PK0A 1Q2XA 4E2YA 3HHPA 1DHRA 1SB9A 1XYGA 5EMHA 1C0IA 2CSUA 4TKLA 2ZJ0A 3V1YA 1EVZA 1QYXA 3WMWA 3WYEA 1ZBQA 2PH5A 1PL8A 2OZPA 3NAQA 5IZ4A 5JAMA 4R01A 4RVUA 4D3FA 1PQWA 1Z7EA 2ZYDA 2VZ0A 4YYZA 5I7VA 1B15A 2JJYA 2W8ZA 2Y05A 4DLAA 4NNJA 4IMRA 5JY1A 3S2FA 3KLPX 3WSVA 2OGUA 2WD7A 3LLVA 3B20A 1YQGA 2X0IA 1NPTO 2ZCUA 2UV8A 3LC2O 1P44A 1U7TA 4RF5A 2E4AA 3O4RA 4NJMB 1P1FA 4TRMA 3VC7A 1MX3A 4E4YA 4N5NA 4NK4A 4N5LA 3ZU3A 2Y66A 5KWEA 3DBLA 4GI2A 4CUKA 2O3JA 3PEFA 4QO7A 3GN2A 4IPTA 4B8WA 1DRUA 1DBVO 1CRWG 4RCVA 2BFOA 4RGBA 1A9ZA 4LRTB 2O3RA 4J4HA 1HDRA 3JD2A 2IYPA 5DBFA 3DFUA 3QE3A 1R16A 4OKIA 2O3QA 1E5QA 2Y99A 3AU8A 4CMKA 1V35A 5IXSA 4II2A 5DCUA 2IODA 5AXAA 1LSUA 4JNKA 4B79A 3KVOA 1RYDA 4IDEA 4W9NC 1RM5A 4N5MA 4RORA 4B7CA 4CUJA 5CEJA 5ADHA 1EBFA 5EQFA 5CDYA 3OQ1A 2EF1A 1ONPA 5B4UA 5BNTA 3CMMA 2CZCA 3FCOA 1ENOA 1VJ1A 2BGLA 4OMUA 3VZPA 1EUZA 4AJIA 3ZW9A 2QHXA 5HS4A 5IFLA 4JBGA 4R9SA 3WSWA 2NTNA 3MJEA 1TVEA 4M55A 4WECA 2CY0A 4FSHA 1P1HA 1FF9A 1R0SA 3OIGA 2V6GA 3PJEA 3L6EA 3DBLB 2HU2A 5A4DA 1TA4A 2P9GA 3PXXA 4RPGA 3L4SO 4IJVA 2FPPA 5IN5A 4J4TA 2ZTVA 4Z0PA 4RQTA 4BMVA 1YWGO 3H5AA 2FP4A 5H83A 5GZ1A 4A03A 3EY4A 3A28A 1BWSA 5TGDA 4WK6A 1XSEA 3UVEA 1LDEA 4E33A 4E6PA 1XEAA 3W8FA 4MP3A 4UUNA 4OL9A 5KJEA 3Q11A 2B4TO 3BHIA 3ZWBA 4MO2A 3QQPA 3SJUA 1BXGB 4CM5A 3I5MA 4DUPA 1XR3A 2BFAA 5COBA 4P8RA 1UH5A 5FFFA 1ZK4A 3JQAB 1R37A 2AG5A 2QG4A 4NMHA 3WFJA 1A71A 3AOEA 4E5YA 2HRBA 1E3WB 1ZFNA 4M1QA 1UAYA 2OOSA 3FHLA 4J0FA 1U2DA 3E9NA 2E82A 1A4IA 1N9GA 3GFBA 4II3A 2O3SA 3HJAA 4ALIA 4XR9A 1PJTA 1EE9A 1D3AA 1QKIA 3PYMA 1BXKA 2XPCA 4PGFA 1IPFA 2BH9A 4XB2A 1E77A 2X6TA 4G81A 5DZSA 4OIMA 1JKJA 4N54A 4CM6A 1BW9A 4EGFA 3RWBA 2X4GA 4LVUA 2YHIA 2D4AA 1NWHA 3DBVO 3ZU2A 4PZEA 1UXKA 1V3VA 3U4CA 3RU9A 1P0FA 4KQXA 2B36A 4B4VA 5ITWA 5LDHA 2IEDA 3RBVA 2OL4A 3KSDO 2O7QA 2PH3A 1ONOA 3ZH2A 4CMJA 4UVGA 2HCTA 5JC8A 1IYZA 1A72A 4GWGA 4BKUA 1H9AA 4PVDA 2C0CA 2Y1OA 4P4GA 3O38A 1LDNA 2C5AA 3I83A 4L8VA 1JWBB 1FXSA 3AOGA 5MDHA 2HMWA 2JKVA 2P5UA 3DEYX 3F5QA 1Q0HA 2OP0A 4YA6A 4UEJA 3PRJA 4BNXA 4U6QA 3VTFA 3FR8A 1H2BA 1NQOA 3AOEC 4QEDA 1GPDG 1XELA 3PWSA 1H6BA 2I76A 4LVCA 2WM3A 2DBRA 4BGIA 4JBIA 4XRRA 3W6ZA 5BSGA 4J16A 4WEOA 2FSVA 1N5DA 3INRA 5TIIA 3VVCA 2OBYA 3E82A 2IZ0A 1KVUA 3ANMA 2CVQA 2GPTA 1HE2A 5F5LA 1Y81A 5GY7A 3WTBA 4D0SA 3MTJA 1JU9A 3U4IA 1N7HA 1E92A 4O0LA 3TL3A 2B83A 3V5NA 4L0QA 3NTRA 2V65A 5TT0A 1H0KA 2JD1A 3W4IA 3GGGA 2GLXA 2O48X 2AA3A 3JQAD 3PZBA 1E3LA 3WGOA 1EQ2A 3M6IA 3O03A 4WGGA 3DB2A 2NNLD 3D4NA 4CM1A 4TRRA 4OH1A 1WDKA 4DLBA 3ZHXA 1ULSA 3KOUA 2HJSA 2GN4A 2AXQA 3QVXA 3CE6A 4J2OA 3ANNA 2P9CA 1BDBA 4GMGA 3ANLA 4IZIA 3D4OA 1HYGA 5IAAA 4U7WA 3I23A 1YOVA 4DIOA 1WPQA 4ZICA 3F3SA 2J3JA 1EUDA 4BKQA 3RD5A 3Q1LA 1YL5A 1C14A 1D1TA 1A7KA 1AE1A 2WYWA 3NT5A 2OORA 4AJPA 3EC7A 2HQ1A 5FWNA 2PZMA 2VUUA 3GDGA 4OYRA 1XKQA 4ZJUA 2VHVA 4KTVE 4WLUA 5FI3A 3UF0A 4XYLA 4FFLA 3GVCA 2UAGA 1GAEO 3NYWA 4U5QA 3SJ7A 2UUOA 1LEHA 3F1KA 1GV1A 4ZQFA 5KIAA 3GZ4A 3H3FA 3QWBA 4RF4A 1GR0A 1QXSA 4GQAA 1R0KA 1ZVMA 5I9NA 5TNXA 5JCJA 1ID1A 1DAPA 1YQXA 4LISA 4AG3A 1EK6A 1ZJZA 3BZUA 5A04A 1PU2A 2IYOA 3QVWA 1NVMB 5BSHA 1J0XO 2VNAA 3DR3A 1NWCA 3KM0A 4ZN6A 4DMLA 2NSDA 2PWZA 2PD4A 4FFMA 4E5PA 3QA9A 4IDDA 1HE3A 4ID9A 3NDIA 4BNYA 1FDVA 4KUEA 3G1UA 3HSKA 1Z6ZA 3WB9A 2DU8A 4PLCA 1ISFA 2FRDA 1JKFA 1EVIA 3TZ6A 1C3VA 2WWRA 4H7PA 3C8MA 2F00A 1LLUA 2JD0A 2WYVA 3PQEA 4FFPA 5CPFA 3D0OA 2QRKA 5CDSA 4J43A 4ALMA 5JMWA 3ZNNA 1H93A 1EEHA 1MFZA 4FGWA 4L4XA 4R5HA 2PD3A 4YVFA 1E7MA 1BDMA 1Y9AA 1WVGA 3OICA 3TZCA 1PZEA 1R15A 4H15A 1M6WA 2FR0A 3RASA 4XRGA 2DTDA 3AM4A 3PVZA 1TT7A 3JQCA 4HADA 4QFCA 2D59A 1WAMA 1GZ3A 1I2CA 1XIVA 3ENKA 1ZEJA 3JQGB 4BO2A 2J8ZA 4S1VA 4CR7A 1NP3A 4PG4A 3P2OA 3HDJA 4Z0HO 3KBOA 1R4MA 4A2CA 1UZLA 2G76A 1OFGA 4IXTA 3JQEA 4NZ9A 4E0BA 2AQ8A 2C07A 4UVEA 2O4CA 4PN3A 5K0ZA 4IM7A 2ZYAA 2EP7A 4U0KA 1L7DA 3DBRB 3EMKA 4JQCA 2ZTUA 3GHHA 2C2YA 2PK3A 1SPXA 2GR9A 4WCFA 1I32A 1E3SA 2Y93A 1U4SA 4GBJA 3DFZA 3LC7O 4ZU3A 1A4UA 3C3XA 1UXGA 1X1EA 3K31A 3UAGA 3JQBA 5KJ6A 1PL6A 3PPIA 4BO5A 3OH8A 1ORRA 4IZHA 4EEXA 1V0JA 4Q3DA 2VN8A 1YRLA 1GYQA 2JCYA 1Y9EA 3K8ZA 4DXHA 3GVPA 5ENVA 1GCUA 4BNUA 5ICMA 2VUSA 3A4VA 5ILGA 2NQ8A 4YACA 1MA0A 3ZW8A 4CL3A 5EPOA 1JQBA 5KJFA 3RUCA 1DC3A 3ZZNA 1AXEA 4R51A 4DQUA 4NH4A 5TRTA 4Y8VA 1PZFA 4TVOA 5TJ9A 2X86A 1JAYA 2X58A 5A9RA 3DMTC 1PJ2A 3L6DA 5GZ6A 2G82A 1DC5A 4XYGA 4CLDA 1PIWA 3SC4A 3KSUA 4YXFA 5T6BA 4BNFA 5JAZA 1IOLA 3JD1A 1HKUA 1N1GA 2EERA 3RI3A 1DFHA 5JYDA 2V6MA 1B3BA 2DT5A 1T2EA 2Y1DA 4I5EA 3U3XA 1XLTA 5CFZA 5T67A 4ZQEA 3FWNA 4GX1A 4BNHA 2X9VA 2NV6A 1LRLA 2DPGA 4CJXA 5IG2A 4LSMA 1MUUA 4W6ZA 4ALNA 5A9SA 1XWFA 3N7UA 4OJNA 1I2BA 4S3MA 1I3LA 1I3MA 3LT4A 4D44A 1FJHA 2J5KA 3NKLA 1BMDA 3DHYA 1YONA 3CINA 1OBFO 3QIVA 1VL8A 1GUYA 4Q3AA 3EHEA 1XA0A 1I10A 3PHGA 3A06A 1DAOA 1EFLA 4YQZA 2BFPA 4I5GA 4BB6A 2FPGA 3NJ8A 1YXMA 3NDRA 1UP7A 2YJZA 4JLWA 4XQ9A 5DNAA 3KO8A 3GUCA 4PLGA 3KEQA 4WLNA 4PG6A 1DC6A 4P4LA 2HKIA 1GPJA 3X2EA 1KY4A 4KDFA 1AHIA 4P38A 2EXXA 5EINA 2EKLA 4B4WA 5EIOA 1M75A 4DIFA 1YB4A 4B4UA 3D5TA 4DMMA 1K89A 2YV2A 3WGHA 3DZKA 3FNFA 3ZWWA 3GUYA 2VRCA 1PGJA 2H5LA 2EKQA 1ZXLA 2DPHA 2QQ5A 5B4TA 2C29D 1HZJA 2NM0A 5KJCA 4AICA 2WYUA 4YT4A 2WJPA 3LVFO 1PGNA 4ZVVA 4DWVA 2O3UA 1E7WA 1A9YA 2HAEA 1HDGO 5IDQA 3D7LA 1PGPA 3ZGYA 3KZVA 4FC7A 3S55A 2NADA 1UDAA 2B5VA 3PJGA 4IGFA 4MP6A 1MGOA 3IUPA 4PVCA 5BQFA 2C59A 1O9BA 3RBXA 4FR5A 3RUEA 3B1KA 5TF4A 4NBRA 4MKRA 4KOAA 1Q7CA 5EJ2A 5DF1A 3GOHA 2EHDA 5DN9A 1WMBA 4BMNA 4CV1A 5FI5A 4E2WA 3WICA 1F8FA 4IQGA 4CLRB 1CETA 3HQ4O 3BYZA 3DBHB 5A02A 1TT5A 3VPSA 5JNLA 3TPCA 2BELA 2ZIZA 3PHIA 5F1KA 5B1YA 2VHXA 4XA8A 2HDHA 3QRWA 1PSDA 4Y67A 2RH8A 3OJ0A 1WP4A 5HBRA 4XD2A 4MVJH 1EE2A 8ADHA 3JQ8A 4E30A 2NTVA 2FY8A 1KY5A 3GZNB 1LX6A 3RFTA 3RUFA 2W2KA 2RAFA 3ITDA 2X5OA 2P2SA 4HP8A 4PFJA 1ZCJA 3V1TC 4W82A 1OMOA 1ADCA 5U9CA 4TVBA 4F46A 1T25A 1QP8A 3WXBA 2V6BA 2RHCA 1AN9A 4MDHA 1NQTA 3L9WA 4BKPA 4RV9A 3GFGA 1PJSA 4ND4A 4W9NA 1SOVA 4FN4A 1P9LA 1KC1A 2E37A 1ONNA 4NBUA 1O0SA 2TMDA 3IIEA 3IQDB 5DBIA 4D3DA 4ZQBA 3K30A 3P2YA 4XEHA 4K6CA 4RVDA 4C7KA 2VUTA 4U0JA 4J6FA 5G0TA 5FYDA 3NT2A 2DTXA 2IXBA 3R0IA 3BMNA 3ZDFA 3WMXA 5JAQA 3AFMA 1A7AA 1PWXA 3PDJA 1B3RA 3VAZA 5C7LO 1PS8A 9LDTA 2I99A 3BXXA 1N8KA 1CF2O 5KVSA 3GVHA 4ZQHA 3PHHA 1JN0A 1I01A 2JAPA 4WEQA 2NVUB 5JLAA 3WGIA 1HRDA 4DYDA 3OBBA 1ISIA 4LRSB 1H94A 1VC2A 1RJWA 4EITA 1LSOA 4XIJA 2JFFA 4Y98A 5T64A 4BVAA 2BF7A 2VZ8A 3JTMA 2ZQYA 3NDJA 1M67A 3C7CB 3GLQA 2UUPA 1I0ZA 4E12A 4EYEA 3PHLA 2ZATA 1HE4A 4J7CA 3T7EA 1XG5A 1BVRA 5IDXA 1P1KA 4BUCA 2X23A 3SC6A 4HWKA 3D64A 1H6CA 4JJFA 4ONEA 2Q46A 1YB5A 3U5TA 3JQ9A 5BSFA 3JV7A 1QV7A 3BMNB 2X9GA 1KIFA 4K28A 2C7GA 3HFGA 2IZZA 5A3VA 1J6UA 1I5RA 1P77A 1C1DA 2A4KA 1ENYA 3HDQA 4E2ZA 4E5MA 3CEAA 4I9NA 2AEFA 3PJFA 5K6AC 1HWYA 1VL0A 4MKXA 4LCEA 3I4CA 4OXNA 4CM4B 4MKZA 2Y67A 4IQ0A 1YDEA 1C0PA 4EUFA 4J91A 3RFXA 4CODB 3GN1A 4BNIA 1Y1PA 4BV9A 3JSAA 3M1LA 5A9TA 5L7TA 1T24A 4DQVA 3WFIA 1XQ6A 5DULA 1BHSA 1UR5A 3U62A 4Q39A 3ULKA 1H5QA 2DVMA 3CUKA 1E6EA 1ADGA 1KS9A 1JA9A 1NR1A 1F12A 1Z7BA 4NQZA 4KUHA 4B7UA 5CDUA 3H7AA 1QYCA 1PS0A 2DFDA 3SLKA 3PWZA 3H65A 3CXRA 4GGOA 3PFWO 4EJMA 1U3UA 4XYMA 3H6KA 4UEKA 4WUVA 1ULUA 5I7FA 4R69A 4GH5A 2H1SA 2W98A 1ISJA 4PRKA 5JO9A 3G49A 1ARZA 3HNPA 1OZAA 2EW8A 3CZMA 5AXDA 5HWSA 5JCJD 3CTMA 2PZKA 3WQQA 4RVSA 4N18A 4FBGA 3OJOA 2C5EA 4GSLA 2Y1GA 3BA1A 4J7UA 4TSKA 1RKXA 3HDYA 4NFHA 2CDCA 2Q1TA 4XGNA 2CMDA 1JLLA 3DHNA 4IY1A 4UVHA 3RKRA 2B0JA 4EJ0A 4HFJA 4YJGA 2J3KA 4IDGA 4EUHA 1VJTA 2EV9A 3VZSA 4D3SA 3CKYA 3I52A 3U0BA 1SO8A 4W99A 3GC6A 3OECA 4YJDA 1PJCA 2F1KA 4INAA 2QW8A 3NRCA 4DIBA 1LQTA 1S6YA 3W8DA 3HFSA 2LDXA 3LT1A 4UAGA 3HG7A 4JGBA 3VDQA 1J5PA 2CVOA 4R1TA 1HSOA 3Q2KA 5JCXA 3P7MA 4XDYA 4TZKA 4I1IA 5DBGA 1IY8A 2PNFA 2PY6A 4RPJA 1X1TA 3GEGA 5H81A 3UOGA 2D8AA 4E13A 3EAGA 2Q4BA 4J9VA 2CF6A 4BGVA 3ZV3A 3O8QB 3UICA 3RUDA 3VZRA 4IDAA 5ES3A 1IULA 1U3VA 1B14A 2Q1SA 1MV8A 3ICPA 3UCXA 4NBVA 3AI3A 4LSWA 4BNWA 4OQZA 4ROSA 2PA3A 3ASVA 4MVJD 2HO5A 2PD6A 3NTOA 4OSOA 4R1NA 1KVSA 3EK2A 4Z3KA 4DREA 3N58A 1K2WA 3DAGA 1YH3A 3MCVA 1VRWA 3JQAA 2EEZA 1GZ4A 3GH3A 1R4NA 4MIOA 4Q9NA 3KRTA 1QG6A 1FDTA 1EBUA 2E6UX 3WLFA 1X0VA 3DONA 3DBRA 2D2IA 1HDZA 3BTSA 3MEQA 2RCYA 3I9OA 3GRPA 1IPEA 4NBTA 5DP1A 5EN4A 2XXJA 5JFOA 1U5AA 2NVUA 3OEYA 3QVOA 3S1LA 3I9MA 3UHAA 3EUWA 1ZNQO 2GZ3A 3GR6A 4BB5A 2GCGA 4RL6A 5KVQA 1GFSA 3GAZA 3SLGA 4YJHA 5K9ZA 3AU9A 2D1YA 2FR1A 4R4JA 1W0CA 1GUZA 3ZV4A 4AJNA 4UULA 2IXAA 4F3YA 1NR7A 2BMAA 2YQ4A 3WGGA 1RM0A 2JFHA 2HK7A 5G4LA 1ZH8A 4CM7A 4N7RA 4G5HA 5ILOA 1XDWA 1DIAA 3E8XA 2QRJA 3EVNA 1E6WA 2BLLA 2Z95A 3C1TA 1VLLA 5JYAA 1BW9B 5BR7A 4XKJA 1KBZA 5AXCA 1QYWA 3BIOA 1SMKA 2HK9A 4IJUA 1IHYA 2PKRA 3EZLA 5JY6A 3UCFA 1HLDA 4PLYA 1YB1A 1U8FO 4HFNA 5J23A 5DCYA 2C54A 3GAFA 4IJWA 5C37A 3I1JA 3T4XA 4OKNA 4OOFA 2DQ4A 1HE5A 1TI7A 4HXYA 3IKVA 3C7DB 3ZWMA 1I3NA 4CLOA 3Q0EA 2AQKA 2ILTA 2VTDA 4AJ4A 4OGWA 2DUUA 1JTVA 5C7OO 4B3HA 5KKAA 4TKMA 2V7PA 3AJRA 3KB6A 1VKNA 4DL9A 1VSUA 3VKUA 2VWQA 5CDTA 3PYLA 3A14A 3AUTA 2NU9A 2Y1EA 4FJ0A 3WNVA 1PGQA 4E5KA 4FGSA 3OFSA 4BO0A 1HYHA 3AUUA 3IL2A 3GK3A 1H9BA 4CL8A 5C5IA 1ZW1A 2A94A 5T8KC 4OHUA 2W2LD 4DGSA 4ND5A 5GMOA 4R1SA 3PIDA 1T2FA 5L9AA 1I24A 2Q22A 4GMFA 4K26A 3OSUA 1LC0A 3EGOA 3IP1A 3OP4A 4H16A 1KC3A 2Z1NA 4Q3CA 4BNKA 4QSMA 3BAZA 4IXWA 1F14A 4YR9A 1V9LA 2AW5A 5COAA 1LDBA 3WGYA 1DIGA 5I7EA 2FR8A 4IINA 3SXPA 1UXJA 1P1JA 1DHTA 1WDLA 2PZJA 4WJZA 5T73A 3GGPA 3ZHYA 1L1FA 4LCJA 1U3TA 2R00C 2R2GA 4YTEA 1N1EA 2HLPA 4L9RA 2CUKA 2BI7A 3CSDA 4MVJI 1XQ1A 3MJTA 1GYPA 2G5CA 3RJ5A 4Z6KA 4RZHA 3BMOB 1E1NA 5IZCC 2DBVO 3BMQA 3QJ5A 3F5SA 4CMIB 1ZMTA 4AFNA 2X9NA 3PZRA 1PWZA 4J90A 3MJCA 3B1JA 5L3ZA 2NVBA 1QV6A 3WS7A 2IZ1A 4BO4A 5CPBA 3BHJA 4YAIA 5L40A 3U09A 2FN7A 4YAGA 3OJEA 3JQFA 3ZWYA 1UXIA 4CR6A 1WZIA 4LMRA 3QVSA 3RC7A 4AL4A 1B16A 4ND3A 4CMBA 1U1IA 2P4HX 3ZV5A 1PX0A 1RPNA 3KYCB 1NX6A 3GA0A 4Z9YA 4YRAA 7MDHA 1N7GA 1IUKA 3IAHA 4GKVA 4QX6A 4R68A 3WQSB 4F6CA 4DPMA 3GF4A 1CWUA 9LDBA 1VE9A 4F6LA 1HXHA 1TEHA 1NFRA 4HNGA 4HBGA 3E6AA 3S8MA 2R6JA 1CERA 1SEVA 4ALJA 4E2XA 1S7CA 1MC4A 1ZK2A 4BO1A 2GDZA 4L4SA 1K6IA 1E0DA 3AI2A 4FS3A 2IRWA 4X54A 3E5RA 3FWZA 4I5FA 4CLXA 1Y5MA 2C82A 3ZNPA 2WD7B 4DC1A 4W7HA 2WDZA 1EZ4A 1GADO 4PG8A 1Y8QB 1FDUA 2YZ7A 3DZIA 1PQPA 4NJMA 3WGQA 4BQRA 1JDJA 2WE8A 3D3WB 5HM8A 1WDMA 1B8PA 3IP3A 1PZHA 3H5NA 4XYBA 2W4QA 4R41A 2GD1O 3F46A 3HN2A 1YL6A 5IDYA 2DBZA 1K6XA 1PL7A 3A9WA 3ORFA 3WJAA 3HB5X 4R5MA 1ZKMA 4R16A 5LCXA 4KP7A 4XYEA 1I33A 1B8UA 2O3TA 3NV9A 3TWOA 4BMSA 3AUAA 4FB5A 5KVVA 4D45A 1LQUA 1E7QA 1Q0LA 4F45A 2XF8A 4C4OA 1VL6A 2VHWA 4XGKA 4BO9A 4MIYA 1HDYA 1DIBA 3JQ8B 3AY6A 3FSRA 2C2XA 2D0IA 4BOYA 3LZ6A 4Z3DA 1Z45A 2ZKLA 4YRDA 1HEUA 2PGJA 2B4RO 1I2ZA 1KETA 4D0RA 2NU8A 3WX0A 4QQRA 3MJVA 2EW2A 3NJ4A 5JO0A 1WXDA 4GLOA 2WSBA 1UUFA 4NU5A 3DAPA 1YBVA 3PIIA 3GHYA 4PIVA 2G17A 1U7HA 4YQYA 3JYLA 4CPDA 3PFFA 1DDOA 4CQLA 1U5CA 5CAEA 2FPIA 4YDRA 1ISMA 1B8VA 1Z73A 1NYTA 3KSZO 2B37A 1NQAO 4I5DA 3BTUA 4J0EA 3ROPA 1B7GO 2X8LA 3KUXA 4A10A 2GF2A 5IN4A 1T1SA 2PKQP 4RVHA 2Y1CA 4Q3EA 3ZWAA 4BHTA 3WDSA 1C0KA 4D42A 3GPDG 1Y7TA 3WWZA 1V3TA 2GN9A 3DWFA 4M8SA 2GYYA 2WTBA 3MJSA 5BSEA 5BT9A 3GDOA 3VPXA 2HMVA 4K1LA 4XB1A 3V2HA 4IDBA 3OA0A 2DKNA 3U4DA 4GVXA 3GY0A 4ZQGA 4J4BA 3VTZA 8LDHA 5JDIC 4KZPA 2RHRA 3TFQA 3LSYA 1YL7A 2AHRA 4KTTE 4QT0A 3DOOA 5L4SA 2LDBA 4CMIA 1LA2A 5JBIA 4NBWA 2PKQO 3JD4A 3AM5A 3B70A 1K5HA 4XQGA 2X1HA 2I65A 5DDIP 1GCOA 1U4OA 1DJQA 3AI1A 3L0DA 4CM8A 3HADA 4DVJA 4M49A 2DTEA 4JX8A 3VZQA 4NK5A 2YDYA 5DOZA 1W4ZA 1E6UA 1JKIA 2WMDA 2ZTLA 1WZEA 4KWIA 1LC3A 4KUGA 3KETA 3E03A 3NEPX 1I36A 3S2EA 3CZRA 3Q9UA 2ET6A 4IIUA 2CDBA 2VHZA 5ENDA 3F4LA 4IJKA 4BNMA 3EDMA 4OXYA 2ZJ1A 1Y8RB 2D3TA 3L4BA 2VTEA 3OEWA 3DMYA 4J1TA 2OMEA 1GU7A 2CFCA 3V2GA 1DC4A 4XIYA 1EUCA 1O8CA 1XCBA 4M54A 1HDCA 1OC2A 5A5EA 3DTYA 2FSSA 4IS2A 2DBQA 3O8QA 4IGEA 4PLWA 3AM3A 5GZ3A 4DRYA 4XX0A 2ZK7A 4L73A 2CF5A 1XU9A 5A06A 2X5KO 4UREA 3RSHA 1Q0QA 4Q3BA 1GY8A 4WLVA 4BS9A 1WLYA 2GGSA 3LF2A 5JDCA 5C3MA 5I8WA 4YEDA 2YHUA 4NR0A 4FQ8A 3U4HA 1MC5A 3VPHA 2HMUA 4PG5A 3JYQA 1NXQA 3OA2A 2J3HA 1SOWA 4JIGA 2V6FA 2O2SA 1C1XA 1B2LA 3FI9A 3H3JA 1CEQA 4PZDA 1EFKA 4D43A 1Z82A 3I9KA 5M6DA 1HZZA 1O95A 5F3RA 4PLHA 1MXHA 3ST7A 5J9GA 4TRNA 2GSDA 4HUJA 4TQGA 1DPGA 2D5AA 5KTKA 1NAHA 4MVJE 3NTQA 3BMCA 5AYVA 3ZN2A 3QSGA 3ZWXA 4WLFA 4Y6RA 2EJWA 1A5ZA 2VNSA 2O7SA 4IIVA 4BNJA 1PJQA 2X0JA 3ONDA 3H8VA 1VSVA 3E1KA 4DBVO 3H2SA 5I7SA 2PGDA 2DM6A 5A5FA 2CD9A 2X22A 1QLHA 2VCYA 3I9NA 3CPSA 4TMFA 4RQUA 3KTDA 4GPD1 4FW8A 5ITVA 1HT0A 2YQ5A 2I66A 1NHWA 4A7PA 2Q2WA 3KYDB 4J9UE 1FMCA 2EIHA 3COSA 1T2CA 4MPDA 4DYVA 3JCZA 3G79A 3DXFA 5TX7A 4DQXA 4BIIA 3FPCA 3H5RA 4NG5A 5F1PA 2E49A 3KXDA 3Q9NA 4GWKA 3WGTA 4AJKA 3PP8A 3FTNA 1U2GA 2NVWA 2GO1A 2OFPA 4JJGA 4RLHA 2WD8A 4NPCA 5T8KA 5BNIA 3PGJA 5KJ1A 1MG5A 5KCZA 4XQEA 2HUNA 3JQDA 3TJRA 3PYXA 4IQ8A 3JD0A 4A73A 4ND2A 3TOZA 2JL1A 1Z74A 2HK8A 5EESA 1KVTA 5COQA 2VYVA 4CV0A 5F1OA 3QWHA 3LU1A 1C0LA 1E7RA 5CHEA 3UXYA 4URFA 1DRWA 4FFNA 1B26A 4BGUA 1J4AA 4D41A 1M6HA 1QRRA 3IC5A 3GEDA 1ISHA 3Q3CA 2X0RA 4WPGA 1DJNA 1UXHA 1Z75A 4CQMA 1E7YA 3I9JA 1ENPA 2ZCVA 3IS3A 4BKOA 1YBAA 1N2SA 4ITUA 2NU7A 5F5NA 5IDWA 4R1UA 4WCDA 3I6IA 1F06A 4J1NA 1T2AA 5HRUA 1QLJA 1SNYA 2VZ9A 2P4QA 1HF3A 2Y1FA 2JCVA 5CEEA 1DLIA 4FIZA 4DA9A 4PLZA 2EG9A 1LI4A 5JXWA 3RIHA 4NIMA 4U8GA 2VOJA 2QIOA 4FD3A 2GASA 3U49A 1HYEA 4GSKA 3GQVA 1Y5RA 2H6EA 3VKVA 4GX0A 3H2ZA 2PV7A 2ZYGA 1BXZA 3OIDA 1YO6A 5ER6A 3Q2IA 4B4OA 2A92A 3L6OO 5JPIA 1VI2A 1BXGA 1ZXBA 1G0OA 2EGHA 4UUMA 4R3NA 4ND1A 4E32A 3BMOA 3PI7A 4AJOA 1NPYA 1NBOA 3ADOA 4CMHA 4JROA 3QWAA 3Q6IA 1NAIA 3T7CA 5DCWA 2VRCD 1ZK3A 3SX2A 3WR5A 1GQQA 5CG1A 5KKCA 4D46A 3OHSX 2B4QA 4M87A 4DPLA 4AJJA 3AY3A 1AHHA 4KDEA 3ZCXA 2HMSA 1QSGA 3LF1A 4DC0A 3LLSA 1LUAA 5AVOA 3VH3A 3F4BA 3G0OA 4ZRMA 4LN1A 4YJFA 2B35A 2J3IA 5B37A 2DUWA 3FPLA 4D79A 5KVCA 3K9QO 4JK3A 3H9GA 4A27A 2E48A 1KOLA 3SVTA 2VQ3A 3I9LA 2P5YA 3TNLA 2YHIB 3SBOA 3FBGA 4XCVA 3DAFA 5IJZA 1H6AA 1SZJG 1ZSNA 3OIFA 3TOXA 2VHYA 4I9HA 1NHGA 3GG2A 1ZSVA 4YAEA 3S2IA 2Q2VA 5BNFA 1MB4A 5TC4A 3IJPA 3CIFA 1DIRA 5TJHA 4RLSA 3AFNA 3AK4A 5U4QA 4PZCA 3OQBA 1NFQA 5A1TA 4KWHA 5MGBA 1U28A 3WTCA 4EEZA 5I9LA 2DAPA 1NNUA 2G1UA 1TB4A 4WNIA 1WW8A 3RCBA 2CVZA 1PR3A 2O50A 1RWBA 1I3KA 2JD2A 3O26A 4HFMA 1G6KA 1G0NA 1GYRA 1MP0A 4LK3A 4BO3A 3C1AA 4WOJA 1NM5A 5L4NA 3TDKA 1UP6A 1VPDA 4JBHA 3ZWPA 3UN1A 5L95A 1ADFA 1U3WA 3HZZA 5KOIA 3R3SA 5EL0A 4RVGA 1YS4A 4G65A 4J7XA 4RPLA 3PTZA 3GZNA 4CM8B 4GVLA 1LDGA 1KVQA 1E1MA 3ZV6A 1NTOA 2YDXA 4PCVA 2AEMA 3QHAA 5CDGA 3ZHZA 3ONEA 5G4KB 5G0UA 4RVFA 2Z5LA 3WYCA 2NWQA 2CDAA 3INGA 1GTMA 2QYSA 4XJTA 1T1RA 3WYBA 3L07A 4YT5A 1R4NB 1TLTA 1GUFA 1AUPA 5AOVA 5A03A 1BGVA 1WWKA 5AQ1A 5TSDA 3RQSA 3ROQA 3PHJA 2B69A 3IMFA 3ZWCA 4R54A 1DSSG 1YQDA 5KNLA 1BVUA 4XZ3A 4HFRA 1X13A 3LYLA 4AJHA 4BNZA 3K5PA 2OUIA 1GQYA 3L4BC 4IUYA 4NFYA 1IHXA 4YPOA 1DRVA 3JYNA 3JYOA 2JFGA 1JW9B 3ZHBA 2Q3EA 3GMSA 1GL3A 1Q1NA 4ALLA 1LTHR 4NFSA 1SC6A 4NI5A 4RO0A 1U9JA 3TL2A 4CQLB 1Q7BA 1IL0A 4YT8A 1YBMA 3UUWA 1KERA 4UUOA 3AY7A 3UCEA 4MIEA 1P74A 1VM6A 4CMEA 3UGKA 3E48A 3OM9A 4CMAA 4WKGA 5H82A 3WWYA 5G0SA 1UAGA 2YFHA 2JHGA 3RJ9A 4ZGWA 4RPKA 3INTA 2NLOA 3MOIA 2AG8A 4OXKA 4QUKA 4AJ2A 5HTOA 1HLPA 5ICSA 5A05A 1LU9A 5IXYA 3QV1A 1UZNA 3JQFC 3DHEA 3DOCA 3VH2A 3RBZA 4FDAA 4QFDA 1EK5A 5G0VA 1A27A 5T57A 2XAAA 2R00A 1EDZA 2YY7A 3V8BA 4E5NA 4O6VA 2JAHA 4J2HA 3FBTA 4J49A 4C7JA 4CM9D 4CLEA 1E3JA 1HDXA 2AE1A 3DZGA 3H9JA 3MWEB 4EBFA 3S2GA 4XWYA 4OO3A 3GVXA 3ITKA 1LDYA 3DZHA 4BO6A 3OQ6A 3BMQB 4L76A 3FD8A 4MVJP 2EWMA 4DBZA 3DQPA 4CM4A 2RIRA 1MXFA 3RFVA 4A0SA 5L45A 1F17A 4GKBA 1O5IA 2PR2A 4RZIA 3TN7A 5FF9A 1D4FA 3EZYA 2YFQA 3KYDA 4GL4A 3MTGA 4PLVA 5JYEA 3TF5A 1W73A 3L77A 1PZGA 4FJ1A 1UDCA 4E21A 3ETGA 1OAAA 3OMLA 1OOEA 3I6QA 3K92A 5L7YA 4W7IA 5K6AA 1ZO8A 1K0UA 2A35A 3WLEA 2VYNA 3WBBA 1PJLA 3GPIA 4OQYA 5F21A 3CH6A 5T5QA 1JVBA 4M89A 1T4BA 1UJMA 3RC1A 4O63O 1Q7GA 1OC4A 3PJDA 3V1UA 3KHUA 4WLOA 2B5WA 4XDZA 3IOYA 4WLEA 7ADHA 1C1DB 1AXGA 3H9UA 1P45A 3M2PA 3FF4A 4KQWA 1BG6A 4UVIA 1M76A 4PLTA 3PDUA 4ALKA 2Y0EA 3HB4X 1B0AA 4PRLA 1H2HA 2P91A 3AW9A 3SEFA 2JHFA 4CM3A 3K96A 2NUAA 4EUEA 3W1VA 4MVJM 2FWMX 4GX2A 4OM8A 2Q45A 2AE2A 2FZWA 1CQIA 3TZKA 2GZ2A 4JN6B 4NHEA 2Q49A 1E1LA 4CMCA 4E31A 1PJ4A 1ZJYA 2IE0A 2EP5A 1GDHA 1XGKA 3E5MA 3EW7A 1YVEI 2JCXA 3DBHA 4IS3A 3VH1A 3VVBA 2X0NA 4NJOA 4BNVA 3DO5A 1DOHA 4ZD6A 4UVDA 3DC2A 4PG7A 3BTVA 1SB8A 2AQHA 2RBEA 3FN4A 4FOSA 3KYCA 5I9MA 3OJLA 3NUGA 2UDPA 1GD1O 3GNQA 4WCFC 4Y6SA 3QVTA 1QMGA 2ZTMA 1V8BA 2BGKA 3OF2A 5L53A 2PFGA 2O4UX 3H9EO 2GRAA 3K73O 1P33A 4P22A 4LGVA 1X7GA 5U1PA 2NACA 2TMGA 3MWDB 3FNEA 4I8XA 1DXYA 1P1IA 1I8TA 3OJFA 2Q1UA 1ML3A 4IDCA 4IDFA 2I3GA 1XHLA 4GAEA 2DLDA 5JE8A 4YJHB 3H9QA 2GZ1A 3M2TA 3CMCO 3A1NA 4TROA 1PJ3A 4ZHSA 3NT4A 1EQUA 5JW6A 3ETDA 4O5OA 4MJLA 2YYYA 1HSZA 3ZWVA 4RDIA 4PLPA 3B6ZA 2C7VA 4TWRA 3C24A 1K3TA 3ADPA 4BO7A 1YGYA 1LRJA 3RVDA 4UUPA 4WASA 3W6UA 3HUDA 4FCCA 2QYTA 1UP4A 1D8AA 1ZK0A 2P68A 3GT0A 3BHMA 3ENNA 1M66A 1YJQA 1YKFA 4CQMB 1YDWA 3GVIA 3JD3A 3K2EA 4CMGA 2W90A 3IUSA 4G2NA 3WOHA 1SAYA 4YAKA 2VWPA 5G0WA 4BNTA 3WIDA 3RAJA 2OP1A 5JYFA 4RF2A 3NGLA 5EQDA 2BFMA 1KEUA 5L51A 1LBEA 2RH4A 4XR4A 2POQX 1IZ9A 1WMAA 2WEKA 3HE3A 2VWGA 1P0CA 2AMFA 1PGOA 3GNSA 3RUIA 1LLCA 1UZMA 1ZIDA 2YUTA 4MVJF 5L7WA 1IB6A 3ETEA 2J5RA 4CMEC 1L7EA 1LXCA 4CUZA 4MINA 2PTGA 2VT3A 4B3IA 4A5OA 1BSVA 4WNCA 1R6DA 1X0XA 2J6IA 3ICCA 3QP9A 4Y9DA 3W4JA 3ZNQA 3RC2A 5JAIA 4L75A 3FRJA 4IMPA 4Z9XA 1R12A 3F9IA 1H6DA 2Q99A 3E9QA 1PJBA 3N74A 4O1MA 4CLRA 5B4VA 3RU7A 4QTZA 3X2FA 4AVYA 4AJEA 4I08A 2BKAA 1KEVA 3HDHA 2HRZA 1T4DA 3ON5A 2CNBA 3OETA 1BTOA 3EYWA 3QLJA 5C7IO 5JDCC 3C1OA 1JVSA 3LT2A 3ZI0A 4CR8A 2QX7A 2O2YA 3GRKA 1HETA 3I4FA 3JQ6A 3W4KA 4BKRA 1RM3A 1F0YA 4BGEA 4U6SA 2FMUA 1NVTA 3B1FA 5HS6A 4FJ2A 2A9FA 1PR9A 3MJ4A 1GEEA 2HJRA 2PLAA 2Y0CA 4RF3A 1E7SA 1X7HA 3D3EA 4WOKA 4B8ZA 1VKOA 1E3WA 2NU6A 1UDBA 2EGGA 4HV4A 1N92A 3ABIA 3JQ7A 3ZU5A 4E3ZA 3RKUA 3MOGA 1ZSYA 5DT9A 4CQMD 2PZLA 3KV3O 4BNGA 3IDSA 1EDOA 2GN6A 4NU6A 3F1LA 3U9LA 4H3VA 1EVYA 4K6FA 4BV8A 2AEJA 1NPDA 3VHRA 1R66A 4B7XA 1IZ0A 3KEOA 4OAQA 3DZBA 1CYDA 2HSDA 4FFOA 3ROMA 4AJ1A 4TZTA 2EJVA 5I8ZA 3UH1A 2QRLA 3K2BA 2I67A 2I3AA 4YAJA 3RUHA 2BGMA 5THKA 3R3JA 5HA5A 1LLDA 4D7AA 3D4PA 3WJ7A 3JQGA 3M1AA 3TSCA 1ZZEA 3NGXA 4L4RA 1NVGA 1LRKA 5JDIA 4DPKA 3QWIA 4XQCA 4FC6A 3P5SA 4WCFB 4MVJG 1ADBA 3UKOA 3BTOA 1LLQA 3GGOA 1VJ0A 2SCUA 3JQ9C 4BNNA 4EZBA 5B12A 4DTIA 1AGNA 1V3UA 3TFOA 3DZFA 3E18A 4QO8A 1HL3A 4QECA 3PQFA 3WQRA 5EERA 2J5QA 2VOEA 4JP2A 1RYEA 1Y8QA 3WG9A 3NX4A 3WNQA 5G4KA 3ZWNA 1NFFA 2GNAA 2GUGA 2EKPA 2Y68A 3P19A 4HX5A 4BNLA 2ZB8A 3BMCB 1PS9A 4AJLA 1ZMOA 2UYYA 2BI8A 2FHSA 1QORA 5TQVA 1CDOA 4ZA2A 3FNHA 3LDHA 1X14A 2Y0DA 4KMSA 2UVDA 5TS3A 3WIEA 3D3WA 1HTBA 2ZB7A 3C85A 3ONFA 2G0TA 4GLLA 4YCAA 6ADHA 1D1SA 1E3IA 1ISGA 3DTTA 1NQ5A 2W2KB 5DP2A 5CP8A 5THQA 1LSSA 1GZ6A 3PLRA 4GX5A 5FEUA 3FTPA 1SEPA 1FDSA 2ZB3A 3VPGA 1JAXA 3JQ7B 4PLFA 5TT1A 1ZUD1 5ER9A 2BD0A 1P1RA 1EMDA 2OBNA 1E5LA 4YB8A 4EI2A 2NQTA 1E1KA 1DO8A 4HY3A 3R6DA 4IBOA 1X7DA 2FOIA 2I6TA
chains in the Genus database with same CATH superfamily
3VBEA 4LOIA 2VNKA 3GMDA 4M86A 1ULTA 1XXHB 2W43A 1K66A 2RDMA 4O1HA 4B6GA 1UJBA 2D1TA 4G5QA 5A3JA 3N0TA 5JD4A 3IOMA 2ORYA 1YKGA 4DEVA 1N5KA 5JS6A 1FC0A 2V9CA 4OYYA 1AD2A 3R40A 3T3NA 4B32A 4CKEB 3ZQKA 3ASUA 4KGZA 1FVXA 2PRYA 1AMNA 1YOVB 2Z6QA 2O8BA 4WHMA 1G8GA 1P2DA 2Q50A 3BL5A 3N07A 1YIDA 3MT8A 3O7MA 2OXIA 5A1JA 1UBHS 3WIUA 1UADA 1O9GA 2Q4EA 2EZUA 3NNSA 6LDHA 1ESCA 4ZXPA 4YX9A 1C1XB 4QUGA 2GDJA 4I1PA 1J23A 1YJ8A 3IURA 5GONA 1II8A 1H1TA 5ALNA 4DLKA 2DEUA 2AJDA 2OZLA 4XGQA 1U8XX 1K86A 1DAIA 1XD2A 2PPVA 3MWGA 5FCDA 1EM8B 4LJKA 1NVUQ 3K09A 4TLCA 2ADFA 5CEFA 3ZS8A 1Y6JA 4C4TA 2NTJA 3VO8A 1GNTA 3CZ9A 3H1PA 4L95C 4HUTA 2R4UA 3N9IA 4QBKA 4RADA 5KTTA 3UW1A 4EG6A 1M34A 2VRWA 3OAAA 1BAPA 7REQA 3UV6A 3U80A 1KAHA 5IABA 4HKTA 4BQIA 3KLMX 4W5HA 1JWAB 2XVYA 3TRIA 2JBAA 3NHRA 2WKRA 3ELUA 4LZJA 4OQFA 2FVYA 2XAUA 4YJGB 5AKJA 2OSBA 3HPRA 2Q6KA 4Q4LA 3OZSA 2IDZA 5JC1A 2GAJA 2FZEA 2CJYA 3OOYA 2XI4A 2AWNA 1RC0A 1M1YA 2AN9A 4Z7JA 3CLVA 1UC4B 1ZLYA 3LK7A 1NUQA 1SVOA 3NTUA 3FNGA 4MW1A 4D82A 4DCOA 3DOJA 1LK5A 3KYBA 1YE3A 3RYHB 1N6PA 5AXBA 4D9FA 3KSAC 3U7RA 1M2WA 3TXYA 3EZ9A 3SFZA 3DDCA 2JH9A 3V2UA 1QYVA 4G0PA 1Q7EA 3VDMA 2CNWD 4CFYA 2H1VA 2HGZA 1N5OX 4BJ1A 1E62A 3C6XA 4EFNA 3IAM6 3TMKA 2P6UA 3EWSA 2WZQA 4RJTA 4MYSA 1Z6XA 4NE2A 1HC7A 3WBFA 4KL8S 4LX8A 2HMTA 3LRTA 1LCIA 4O59O 2B25A 1JFTA 5LB2A 1HPLA 1O6ZA 3P9ZA 4ZI5A 5LLSA 1SG9A 1D9ZA 3D9QX 2IS4A 2HSGA 1GGHA 3PNQA 2QNIA 2QXTA 1CRLA 4BWYA 1KVRA 2H9IA 5CW2A 2NG1A 4L74A 1V45E 2XITA 1JAHA 2MT9A 3H4VA 4Q1CA 4QXMA 1GV0A 1SHZA 3HRKA 3MAGA 4CLHA 1BU8A 4C14A 5JUWA 2C78A 1FLAA 3G59A 1DBIA 3OIUA 4JR0A 2J9FB 3O9MA 3PWKA 1Y8RA 2FCAA 1FK8A 1ZK1A 2ZB4A 1XLWA 4FOOA 4RY2A 1SQGA 3JVDA 4NCXA 4E1AA 4ZK2A 4MLPA 3EPHA 1PTJA 2FMXA 3FFTA 2P0EA 2QX9A 3SHTA 3UXHA 2ZQZA 3E9MA 4HYTA 1IIBA 5BYAA 2BTOA 3G5AA 4LEIA 2VO1A 4RVOA 3WOVA 4L9AA 5TLSA 1YJXA 3VFDA 1IN1A 1OFIA 3WJ1A 4MW6A 1GG2A 3JVVA 3WK4A 1WNTA 4MMYB 2E85A 4P4TA 4ESOA 1HDOA 3WGZA 1R6XA 4PYIA 4B3JA 4FEEA 3CR8A 3RSCA 3QI2A 4NE9A 3O8NA 2X6QA 4KXYA 2A9OA 1MT0A 3E0QA 3GG9A 3IJRA 3RVOA 2RAUA 3BK2A 1SA0A 4NYMQ 3VH4A 5G3ZA 1KMHB 4XOUA 1ZAKA 1GN9A 3LX4A 4LMPA 4BL5A 4C0BA 3OQNA 1JDZA 2DHCA 2W2OA 5DWQA 3FA2A 4YRJA 3ADBA 2NO7A 1ODKA 1M2HA 1J7JA 5TS2A 4P0PB 2RJ3A 4M0UA 4BJ5A 3IEIA 2K7FA 2FZ4A 4Q1EA 1XNHA 3EP4B 3Q15C 1KAEA 3WRXA 1WUKS 4OUKX 1XQVA 3GEMA 1D7OA 4EVIA 3L7JA 1GGMA 4ITRC 3VU9A 1HFJA 2VDOB 3FYUB 2VYVD 3H19A 1LNQA 1J20A 4B6EA 2IV3A 4B6PA 1P31A 2NU7B 1GEGA 3QY9A 4RFSB 1E3TA 1HOTA 4NDNE 4GPEA 4NABA 4UNPA 4QARA 3UYKA 4CHTA 1ISPA 1J21A 2QJTA 4XJVA 3BG5A 1DL5A 1OZHA 1R4MB 3F0TA 5H68A 4C2BA 1P60A 1UBNA 4Y6PA 3DZJA 1Q1AA 2FSHA 4ESHA 4ANFA 3QW2A 1W581 2IEBA 1J2UA 2P30A 4OSPA 2ZWMA 4I6EA 1Q7TA 3C5HA 2XGSA 4L0CA 5BVGB 5DN6D 4IIYA 3HXPA 5J4HA 1LY1A 4G5YA 4PU0A 3EARA 1CIVA 3R7WA 3UJ8A 1Q2XA 2QD4A 2GLTA 5BUSA 4FE3A 2P4SA 3QLUC 2WUFA 1IY0A 2NU6B 5HYVA 4HGNA 4TKLA 4LXYA 3GJ3A 1FSGA 3GH1A 1PHPA 2C57A 1EVZA 1QYXA 1XL1A 2OGSA 3WYEA 1XF1A 4BEVA 3NAQA 5FIUA 1PL8A 4NS1A 2OK8A 2H17A 3D3KA 3FCYA 2RFLA 3D2AA 3IVRA 2IYEA 4JJ8A 4RVUA 5GV8A 4F2HA 2V74B 1KQGA 3VJRA 2VS1A 1Y7LA 2ZYDA 4UMVA 2NTEA 3EEQA 4BZQA 5JY1A 3ZD7A 4RK6A 5HIJA 3WSVA 4LRXA 2ERCA 2QRQA 1CTQA 3OF3A 3B20A 1YQGA 2WJHA 2JZCA 1ZW6A 2X0IA 5FLEX 1NPTO 1LBQA 1C9EA 2QB5A 1RTTA 1N2XA 3PA6A 4P7BA 1XZGA 5E1DA 4DSAA 3ELWA 1OFUA 2CHQA 3I2KA 4DSZA 1FMLA 3DXXA 1V4NA 3ILSA 3JWIA 1KR5A 3MSCA 4KO8A 2HCFA 2HA4A 2QLMA 4CUKA 3DBIA 3PEFA 3K32A 1R2QA 3N87A 1RDFA 2HA6A 4YBRA 5EHXA 3WL4A 1DBVO 1R8YA 4O4JA 3K1AB 4UM5A 2UYQA 4D8TA 1VPVA 3CLSD 4Q7KA 5LUAA 1ZOIA 4RGBA 5A0FA 3VO9A 3JD2A 5I5EA 2XYGA 2C9OA 4J0DA 3RTGA 2GVNA 3N8HA 4H7FA 5K0TA 4AQ7A 2IXEA 1LZLA 2WWXA 3EG5A 1TTTA 3AU8A 2C96A 4CMKA 2W6CX 3EQ9A 5DCUA 2IODA 1LSUA 1NBWB 2X8WA 1K7YA 4PNZA 2R8XA 5IFKA 1RYDA 4W9NC 1Z4MA 1RM5A 4XCQA 3U1BA 1DZIA 1YCGA 4CUJA 5CEJA 3S70A 1EBFA 3PGKA 4B7AA 4QBIA 1QK5A 2LE0A 1L5HB 1LTQA 2YRFA 2Z5FA 3ILXA 1JLLB 5B4UA 3D6VA 4H0CA 9GPBA 1KTIA 1I7QB 2BGLA 4XIFA 3ZW9A 4ZTUB 1EUZA 5HS4A 4DZTA 1FRQA 1GLGA 5IFLA 1YVPA 4Q9LA 1ZVVA 2WIFA 5HK8A 4IRXA 1WMDA 1NKSA 4IIBA 3S5UA 3MJEA 4WECA 4FSHA 1FF9A 3COPA 1YIOA 5I9BA 1R0SA 3DE0X 2V6GA 3PJEA 5A4DA 2G1PA 1PT5A 3MUOA 5KYVA 3L4SO 4ZFNA 1G2IA 1VPWA 3ND9A 3L7CA 1ODJA 1YRYE 4IZ6A 3UUEA 2FPPA 3VR6A 4DV6B 5IN5A 3BFJA 4Q47A 2W11A 4N6OA 4RQTA 1XEXB 5H83A 2CVHA 1POXA 2FP4A 4HJXA 3SBEA 5E4YA 3FSGD 3A28A 4P84A 3SYRA 4GRIA 2O8BB 1WPRA 4EGQA 4TKUB 4G3XA 4C76A 1XSEA 3PEWA 4E33A 3KJNA 1RHUA 1A2KC 1G41A 3LZDA 4KEAA 1PT8A 2ZBUA 4L3VA 2P2GA 3W8FA 2VJMA 4DJJA 4MP3A 4UUNA 5KJEA 1QO0D 4DIEA 3TW6A 2B4TO 3LYAA 3M6XA 1KZHA 2P35A 3ZIAD 5KUTA 4MO2A 3ZKWB 5KTRA 1CFZA 3QQPA 5ESDA 4CEIA 1P6XA 2KBFA 3ACBA 3MFYA 3I5MA 4YUAA 2ZDGA 3IV9A 1RP7A 4O2AB 5COBA 5SICE 3VR4D 5LQSA 2XDQB 4AU1A 1E3DA 3T41A 4ZV9A 3ILYA 4OQDA 5HBGA 1Z29A 3AOEA 2PQ2A 4FX5A 4E5YA 3FZYA 1S3IA 2H4HA 5IMSA 2ZIGA 2ZWOA 2BHNA 3EFHA 1T3GA 3C4VA 4M1QA 1GZSA 1KS2A 1U8EA 2OOSA 4J0FA 4CIYA 3E9NA 1D07A 2E82A 4JYCA 4PYRA 5EJAA 4B2IA 1A4IA 4G23A 1MTOA 2YBDA 1D2GA 3A04A 5JS2A 1FUKA 4XVUA 1GZDA 2WHEA 3X3HA 3PYMA 4PYNA 3DL0A 1Y7HA 5HQ3B 1VG0B 2V8OA 2XPCA 2AC7A 4PGFA 1GLVA 1NMXA 4XB2A 1Z0DA 2ZROA 2X0EA 1WCYA 4HRXA 4EGJA 5DZSA 4YCMA 1OLUB 3L82B 5E6SA 5BVGA 1HYBA 1T8PA 4QOHA 1T0UA 3RWBA 2X4GA 1TVKB 4PYJA 1NWHA 1Z33A 3DBVO 2BEKA 3HY6A 3QKSA 4PZEA 3EVFA 3U4CA 4DNOA 1P0FA 1T0PA 4KQXA 3CSUA 4MWZA 3KJGA 4IX1A 4B4VA 5ITWA 1YBHA 3SDZA 1DMRA 2VIIA 3DFIA 5E3HA 2O7QA 3IXLA 4BX2A 1G5QA 1SC9A 3JSXA 3EXFB 4MKIA 5CTAA 3WMGA 3QELA 3ZH2A 1MH9A 2EBWA 3IHWA 3U17A 3WNZA 3ZDQA 1UEIA 4CMJA 2FOXA 1IYZA 2KM1A 4DRXA 2MYTA 1B1CA 3P2JA 4DA8A 2VRNA 4PVDA 4P4GA 3A37A 3NAMA 4I9GA 4P81A 2C5AA 2DQSA 3HFRA 2CL7X 4L8VA 1Y33E 4D99A 5MDHA 4V3CA 3MOSA 4JEUA 1QF9A 1G20B 5J58A 2AMLA 2GXQA 2OP0A 4MWCA 3PRJA 4UEJA 4BNXA 2R5NA 3R74A 3CRW1 1NQOA 4R2MA 1H1LB 2FQXA 1L5LA 3SLRA 1FFXB 3WL5A 3LDAA 1L5HA 1XELA 3MPUA 4XLLA 3KXIA 2WJIA 1W36B 2G63A 4ZT4A 1AT1A 1DEKA 2H2GA 1R0YA 4BGIA 3PT5A 3OURA 3PRHA 4XRRA 3TIGA 4QIHA 4TQUS 6NULA 2ACWA 3R77A 1T10A 4C21A 3INRA 4LJ9A 2CBZA 1KVUA 1RZUA 3STXA 3K0SA 3ZZUA 2O57A 2GPTA 1GNQA 2PS3A 2HUPA 2BZSA 3VNSA 3EAFA 1E92A 4O0LA 1NW5A 2B83A 3T1NA 2MINB 5KB3A 4HQ0A 1OFUX 2BOVA 3JQAD 2GLXA 2O48X 2NYVA 4DA6A 1XAGA 2NPIA 3BFVA 5ALPA 1WETA 4TMTA 3WGOA 3T7AA 5ESXA 1EQ2A 2HADA 2LV8A 2O2JA 3KZMA 2P41A 3M6IA 4LYFA 3U3ZA 3D4NA 3WWOA 4E03A 3DZ5B 1L4MA 3IE1A 3U7GA 1N1MA 2XH8A 3WL6A 5LP6B 3B2EA 1ULSA 3QE9Y 2JCGA 3KOUA 4E3WA 3QVXA 5JCOC 4J2OA 1T5LA 2H3EA 4AN4A 4LY0A 1M33A 5C35A 5J4LA 4YI3A 1NSFA 2C2HA 3ANNA 4RPCA 2I33A 2ES4A 1QYIA 4OVKA 1MAHA 1YKSA 1SCUB 3WAJA 2YC2C 2IHBA 1PTKA 3F3SA 5CCDA 2J3JA 1B93A 2QORA 3FIUA 5A0TA 1N2EA 1Z39A 4ZZ2A 2F1HA 2GPWA 4YCCA 1D1TA 3H6HA 5ICFA 1MX5A 1A7KA 4JBWA 1AE1A 4A16A 4CF7A 2OORA 4AJPA 2HQ1A 3O3MB 3ZE7A 2R7KA 2XQGA 3F6RA 1P8AA 4A9AA 3OOSA 1ECPA 2FV8A 4NESA 1O97C 1X1QA 2UAGA 2FEPA 3AR2A 3NYWA 2F9LA 4YRZA 2CLIB 4FSXA 4UFPA 4YAUA 4CN9A 2ZQ5A 1LEHA 3A9RA 3G2PA 2BMWA 2PGIA 5AJHA 4LE2A 1H2FA 3UENA 4EYQA 4EZEA 3GZ4A 4IH9A 4LMAA 3HCBA 1Z8FA 3LGSA 3V00A 3R8XA 4B6SA 3HK2A 4B09A 4EYSA 3DKIA 1FFYA 4GQAA 3EIXA 3QV2A 4G01B 3ZXXA 4JBXA 3K1TA 4OYHA 5ECDA 2CXOA 3I9V6 3L1JA 4XFDA 5A62A 5K4HA 4AKIA 3KJHA 1TPYA 2O59A 1N75A 1QVWA 4UHBA 2JFXA 1ZJZA 3MTAA 1NJGA 3I28A 1YR3A 1V5GA 2CUTA 3SS8A 2GYWA 1SQFA 3DHVA 3L4EA 3UY4A 3WKBA 4ZN6A 3HKEA 2HIMA 3MUFA 1U7UA 2NSDA 1FVOA 3MAJA 2JG3A 1N8TA 3K05A 5J5CA 3QA9A 4FILA 3AIIA 1W29A 1P5ZB 1I7NA 3RTEA 4ID9A 3RK0A 4ZZ1A 1M2FA 4KUEA 1YQEA 1DINA 4KR6A 1Z6ZA 1U7DA 4CF4A 1K4YA 3BE6A 1K98A 4NECA 2HNBA 3NC1C 1ISFA 5DI3A 3R7FA 1NRXA 2HIHA 3CZ5A 1EVIA 3TZ6A 3WISA 4BJHB 4WBNF 1C3VA 3OWOA 2WWRA 3RAPR 4CCSA 3O3CA 4OFXA 2OYCA 2F00A 2JD0A 3PQEA 1CC1S 2XQIA 2OCXA 4DR6B 2QE7D 5F7XA 2BFEB 2IW1A 5BN4B 3UQZA 4ERNA 4ZZIA 1NZJA 2ZSEA 3NB0A 4YVFA 2PKEA 2HZ7A 5GQSA 2ZJ5A 2LCQA 3WGUA 5DFAA 3EGDA 2G4VA 1M6WA 4US2R 4BDSA 1UMCB 1R5JA 3D4BA 5EJGA 4JI4B 2DTDA 1Q22A 3AM4A 1A50B 1TT7A 4I3HA 4Q6WA 1JIIA 2N1BA 2YW2A 4M1SA 4JLVA 5LNK6 1IN6A 4ZVKA 4KPEC 4IV5A 1QG0A 1FNSA 3M5WA 4BO2A 1TO6A 4S1VA 5BQPA 4CR7A 1VKHA 4DFDA 1BJRE 3GJ7A 2AR7A 3HDJA 3HWSA 1THGA 3K70B 4PW0A 3L8ZA 3RVPA 4D5GA 5AM5A 2G76A 4IXTA 4NZ9A 1CCWA 2AQ8A 2C07A 2IXDA 3AUFA 4BN5A 4LKOA 5B1SA 1SCQA 3BH6A 2ZYAA 1IVYA 4HLQB 4BB0A 1TE2A 5SYNA 3IBCA 2YVLA 1EJ0A 3DBRB 3FVVA 2ZTUA 1S3FA 3C6YA 4RV5A 2ZU0C 3GHHA 5IHXA 1ILEA 4UEQA 1I2DA 4Z7NB 2QD1A 4RK5A 2BKVA 3CCBA 2H1IA 1OW3B 1WP9A 2MSWA 2QT1A 3C3XA 4KE8A 1F3OA 5LFAA 2BFEA 4MUBA 1PL6A 1WRBA 3PPIA 1E96A 4BCDA 3BGWA 1FIUA 2PS0A 1ORRA 3NRJA 4EEXA 3WBKA 1Y3CE 4Q3DA 2XWPA 2VN8A 1DQRA 3ND6A 3ZTYA 5JT1A 5DLDA 3N2GA 5AUPB 5ENVA 4TV8F 3UTCA 1OLSB 1W1UA 3CWCA 1T0IA 3TR0A 3FVQA 1GPMA 4C3ZA 5JZBA 3LBIA 3SSNA 5KZMB 5ALTA 3FKSD 2V7BA 4RXMA 5EPOA 1ACLA 4NBKA 5DASA 4B46A 3FMOB 1MKYA 1AXEA 3ZZNA 3JTEA 1WA5A 1XTRA 3AKYA 3QH4A 1DADA 5LU8A 4HAXA 2I9KA 5TRTA 1CR4A 4M7WA 4GI7A 1Q1BA 1EZZA 2VSOA 3HCCA 1PZFA 4GOMD 5TJ9A 1DU4A 3SOPA 2F7SA 1CUZA 5J9FA 1AS2A 1Q57A 1Z62A 1VMAA 1PJ2A 3O1LA 3L6DA 5IW8A 5GZ6A 5A9RA 4XYGA 1XCJA 4CLDA 4PHCA 3OZBA 4FYYA 2XGGA 4FONA 3NLLA 3R5SA 4K9PA 3SHVA 4EW2A 4RL4A 2KW5A 4II7A 4TQ9A 1ZS9A 4BNDB 3FPSA 4OQ4A 3EZ2A 2V6MA 4CFZA 1B3BA 3H8SA 2FA9A 1T2EA 1TADA 3M6VA 1XLTA 4LXHA 4IOMA 1SBZA 4DB4A 4MB2A 1RPAA 5J1TB 4NY1A 5JAHA 1E60A 1BE8A 5FTNA 1SUEA 5LQUA 4L5BA 4EKIA 1RQ2A 821PA 2O1WA 1LGYA 1DCFA 3KZOA 1N9ZA 3ZD8A 1P4RA 1WPXA 2DPGA 5F98A 2P9ZA 3L46A 5E6SB 3RWMB 4CJXA 1NQVA 2AFIE 5IG2A 1COZA 4ALNA 3CW2A 3VRHA 5A9SA 5BUZA 4M60A 4Q9KA 1P6UA 4IDPA 4S3MA 2BJHA 3PHCA 3OEHD 3FB4A 3LT4A 1FJHA 1XJ5A 4I50B 4S0ZA 2J5KA 3NKLA 3BX1A 1BMDA 4XDHA 5LR6A 3H17A 1I13A 4A8TA 3QIVA 4AROA 5LQJA 4Q3AA 4D8WA 3EHEA 1KRWA 3ISVA 1UC9A 2FPKA 4YXWD 5HKAA 2IP2A 1I10A 2J9YB 4TUYB 1UPXA 5B30A 1TFUA 2BFPA 3QOXA 3SXJA 4FYVA 4Q3LA 3QLVC 2I1QA 4X93A 3TTWA 1JYFA 1Z4OA 2C9CA 3H1GA 4Q34A 5G41A 5JFTA 2YJZA 1QRAA 3EJWA 4FS8A 3AEQB 4IQFA 3KO8A 4JLWA 5DNAA 3GUCA 1Z2OX 2CNOA 3B53X 1ESZA 5D85A 1DC6A 1E6KA 1OIXA 3MLBA 4YRPA 3X2EA 2PUJA 1KY4A 5JSUA 1NUTA 2OBLA 2X8JA 3E35A 1C7JA 1AHIA 1W6RA 2LCFA 3BAFA 2QTRA 3LM8A 2C2GA 2OLKA 2VLIA 3L1VA 1FYWA 1O77A 2W0SA 1QP0A 3SHOA 2WT9A 1HFWA 2VTVA 1YOBA 3D5TA 5J2TF 4MRMB 1JA1A 3DZKA 3D59A 2Q7DA 1L5FA 2RGXA 2G04A 3FNFA 1NLYA 3M0EA 3WVNA 2VRCA 5IM4A 3V3KA 1PR1A 2A86A 1F3LA 3GU3A 1ZXLA 3L0YA 4V0QA 3DC7A 1H8HD 3G5TA 2RB4A 1XVVA 2C29D 3D2LA 2WTXA 3E2PA 3LG2A 3NIBA 4NEGA 4TN5A 4AD8A 2XBUA 3ELYA 3WHPA 4AICA 2WJPA 5HUHA 2CWDA 3HP7A 4LGMA 4DWVA 4POOA 1E7WA 1A9YA 2HAEA 3SXUA 2R79A 5IDQA 3ZGYA 1FW6A 3WV5A 5KNBA 1J1UA 1EAYA 1NLMA 1SVSA 6Q21A 4K6KA 2CEKA 3U5ZB 4Q00A 4OFZA 5IUNC 2E6KA 3W7BA 1YRAA 2FWIA 3F2VA 4NBRA 4X5OA 1U11A 2Q5CA 3VO2A 3Q6MA 2ZAGA 3BIWA 3BK7A 1MDBA 2RHOA 4KXVA 2Z2KA 4PX3A 3DP9A 3HYLA 1APBA 1AQYA 1KGSA 2FLVA 1GFZA 2QTNA 3QKRB 3HVIA 1E5DA 4LI3X 4EG1A 3EXIB 1ZUNA 1N7JA 2BKXA 2UVPA 3UKJA 3A6EA 5B1HA 4EB8A 4RTSA 4CIDA 2C3MA 1XDUA 1X80A 3QTLA 3HQ4O 3DBHB 4FZVA 3KVRA 3SX0A 1RPZA 1GAXA 3M1YA 1PYDA 3QRWA 4WOPA 5CLLA 1QCYA 2RH8A 3HR4A 5M5BA 1I4OA 2PZBA 4TLDA 1O8BA 3S1AB 4WK4B 1EE2A 7AT1A 4DQLA 1I14A 4YC7A 1SU7A 4B73A 4E30A 3O73A 2FY8A 5FPPA 5CHYA 3GZNB 4ZODA 1QHNA 3CH7A 2Z6UA 3ITDA 2E4UA 3V1TC 1ZCJA 4A82A 1A9QA 3EYAA 2JLVA 1WVMA 1X19A 2JF0A 2CC2A 3L0SA 4UCXA 1OXXK 3T7KA 2ZJ6A 4KFUA 3NS7A 5FULA 4N0EA 3X44A 2Y1KA 4EJSC 1QP8A 1EKXA 2Q5HA 2X1MA 4DEXA 1KDTA 3G7UA 5LA6A 1RKBA 4U02A 4KX3A 3RS2A 1Z0AA 4IF6A 4F4FA 3U39A 2XA9A 3P97A 1NQTA 3QPVA 4MITA 2KLBA 5FBHA 2H4FA 3TPFA 4BRSA 2W6QA 1XZEA 2OHVA 3I30X 4IIDA 3IGFA 3VNBA 4LNUA 1YUMA 2WW8A 4IWYA 4OYLA 1SOVA 2Q07A 1P9LA 2E37A 2GN2A 3TOVA 2DE0X 1ONNA 1EJBA 2GYVA 2LNDA 3FPFA 3GMTA 5EZQA 1A8IA 4A36A 3IIEA 3M6AA 4TN1A 4D3DA 4ZQBA 4Q4CA 1YJBA 1PNVA 1Z0ZA 5LQAA 1GAQA 4K6CA 3GRCA 4RVDA 1C7FA 3DSRA 4ZO9A 1YU9A 4CDNA 3TM4A 5G0TA 5F1YA 2VP9A 5CX4A 2VJAA 1ZICA 2O0JA 4LRWA 1DWOA 3R44A 2IXBA 2ZOSA 3BMNA 3WMXA 3X2SA 3T5AA 3RS8A 1SXJC 1H4VB 1QMIA 2MMGA 2IHYA 2Y9PB 5C7LO 1DUSA 2QJRA 4L72A 4GC5A 1JMYA 2G77B 3PL5A 1G5PA 1GPBA 1QGUA 2D2VA 1DKMA 1DI0A 5EKDA 2CMKA 4KIWA 4WA8A 4ZAYA 3DULA 1I7DA 5F35A 4AB1A 4LF5B 1T5BA 2G4CA 1JZTA 2WK1A 1SHTX 3PHHA 4QU9A 1JG6A 4Y2JA 1QE5A 4V0RA 1Q50A 1PT9A 4DYDA 3GFQA 2WABA 3SQLA 5LNK1 2FFQA 1FMJA 4RHXA 5DN6A 1LSOA 2GPYA 4XIJA 3JVEA 2JFFA 4DILA 4M0KA 1INLA 2BF7A 2P4UA 4PANA 5FOTA 2VZ8A 3JTMA 5T64A 4RTOA 4YV2A 4AURA 3NDJA 2P9QA 1VHDA 3YASA 1DAHA 4EYEA 4E12A 2HYDA 3DDWA 1N2HA 2A88A 1VL5A 5T4EA 5B36A 3DT9A 3TG8A 1BVRA 4LDNA 3EGXB 3MS7A 3ZGLA 3C6MA 1H6CA 3D64A 2BEWA 4OKSA 2I4IA 1XLUA 4UOQA 5BSFA 2FQYA 3B78A 4KIUA 2F3SA 2X9GA 5M7EA 4NFLA 5EE3A 3ZDCA 2G7MC 3LGAA 4OEHA 2C7GA 3HFGA 1TRHA 2HD4A 4PS0A 4ZEMA 4R6XA 2F1JA 4B1FA 2JASA 2UYOA 1JG7A 2ZR9A 1C1DA 2A4KA 3KOXA 5AVKA 1RI3A 2I2BA 4E2ZA 1E1RD 2OCLA 3HKDA 1T8RA 1JHMA 4ZAZA 3EFBA 3CEAA 3LCUA 4I9NA 4A0GA 1BD4A 1XI2A 2I2XB 3CUTA 4JL6A 4JUFA 1VL0A 2W2QA 5AK6A 2P62A 5F7JA 3DQQA 1CX9B 2R11A 1DTSA 3G2JA 4OXNA 4IQ0A 1C0PA 3SVZA 2I55A 1KBOA 4Y2HA 5KNDH 4LQCA 1BKDR 4IKPA 5A9TA 5L7TA 1MO4A 1BHO1 2WILA 3WFIA 4DQVA 2BT4A 4MVYA 3A3OA 4ARAA 1OLSA 2PS9A 3ULKA 2C9BA 2DVMA 5JSKA 3RRYA 4E14A 2J7PD 2Z4TA 3EIWA 3LP6A 4MEBA 4QGGA 2C4HA 4CCAA 1QQBA 1PEKE 3DP7A 1NR1A 3PGMA 4X85A 1Z7BA 1DT3A 5KO2A 4FYXA 3OKAA 3E3MA 3KQVA 5IJ9A 3L84A 3VKHA 3PQVA 2C2OA 1RWWA 3B13B 4N6GA 1J1ZA 5I9TA 1MMFB 1M9NA 4FKMA 4OMFG 3CXRA 1H0HA 3BM5A 4O2AF 3ETCA 3KXKA 4EJMA 1U3UA 3IQIX 4OHMA 4TTRA 4HNVA 3TI7A 1Z35A 1ULUA 2ONYA 2IPOA 3AF5A 2O5EA 4R8MA 2IITA 2YV5A 4GH5A 4RSMA 4QFMA 1DXHA 2H1SA 2GJ4A 2IYUA 3HRIA 3D6TB 2AKAB 3QNMA 3TNDA 2FW9A 4RHCA 4U3JA 2NXEA 5AW1A 2AK2A 2JI8A 1ARZA 1H05A 1VPLA 2L18A 3CVOA 3CZMA 1I0IA 2QLNA 3VPDA 4OQLA 3W1EA 1F7VA 4N18A 3NHMA 4FBGA 3OJOA 2B3DA 2C5EA 4XWAA 3HA3A 1GU1A 3LUBA 1VJDA 2CDCA 3V7WA 5TY0A 2CMDA 4IY1A 1L7AA 2XMSA 4TM7A 2PXAA 4UVHA 3WLOA 5EE0A 3E15A 4EJ0A 1WXWA 1X2EA 3OPQA 5ARDA 5U4XA 5KYGA 1OWOA 4H3KB 1EFPB 1VJTA 4B48A 1P5RA 1DG1G 1TCAA 3U0BA 3NHSA 1SO8A 1ZCFA 4P5DA 3E2MA 3P0JA 4MV7A 1UOEA 4PY2A 2LDXA 3LT1A 4J6EA 3AR3A 4MICA 2WSLA 3UGJA 1U0HC 2CVOA 1PP4A 1HSOA 2C95A 1E4EA 4R1TA 2C4VA 1SVKA 3ZH9B 4TZKA 2Q1YA 5DBGA 2PY6A 1Q21A 4RPJA 2FPPB 1Q3HA 2PM8A 1UKAA 1NBME 2JPDA 3SZRA 1S8AA 3ABQB 1Z7WA 3LCCA 3F5MA 3NM6B 1U3VA 4IDAA 4OBEA 3W7AA 4EYKA 3HXOA 1DV1A 2Q1SA 1MV8A 4HCJA 1D7AA 1DG9A 1UWKA 2ILVA 2O07A 3I76A 1O6CA 3KE9A 3TSWA 1L8AA 4X1IB 2R6DA 2HO5A 2PD6A 4OSOA 4CF6A 2EOAA 2ODPA 4HEJA 2PU7A 3K20A 3ORYA 2F9MA 4HPXB 4IILA 1OILA 2GCNA 2QXUA 2X77A 1RYZA 2FWJA 5DYIA 1I6MA 3N58A 3KWMA 1QAOA 3DAGA 3DR5A 3MCVA 1C8BA 1M0SA 1VRWA 4R71A 1US8B 2WVHA 4OP3A 3RKSA 2EEZA 2WHYA 1QB7A 5G1OA 3Q3EA 2ISSD 3VV2A 5CBPA 3VYRB 1YUBA 3GH3A 4A23A 4DXAA 2XBMA 1II0A 4C7XA 5AVXA 3EP9B 1FDTA 2YICA 1QZTA 2E6UX 3DONA 2D2IA 2YL2A 4BASA 2AUNA 2AN3A 3ACDA 2QVXX 2R8ZA 3OZ7A 2XMDA 3MEQA 1T1JA 2P1DA 2GT1A 1SUDA 2RCYA 2JANA 4WN3A 5EKXA 2X4IA 5E2BA 3HGMA 2B82A 4PYMA 4DJFC 4YMVA 5J2TB 3UFXB 1OGIA 3AEUA 2HI0A 3WB0A 2NVUA 1GHTA 3OEYA 3S1LA 1ZNQO 2WB4A 3BUSA 4RL6A 5KVQA 3GAZA 1TMOA 3QQ5A 4TL7A 2KQUA 2XB2A 5HF8A 1RAGA 3UB4A 3AU9A 4MW5A 3ZE8A 3U7QB 3DFMA 4MXDA 5AJXA 5CM9C 5IC6A 1D5CA 2PT7A 4Z9BA 4NZPA 4AJNA 3QMMA 1RRKA 2B5OA 1B6SA 3NHZA 2IZ5A 1TGVA 4QFBA 4DKXA 5JCPA 4KR2A 2HK7A 4R0NA 4MHTA 4CM7A 1P5HA 5L3SA 2X13A 4N7RA 1AK1A 3AETA 4G5HA 1YVDA 4M1KA 3PENA 4DDVA 4MV5A 3VC2A 4TXLA 3DYBA 4KWCA 4X6YA 2WTNA 3CURA 4LJ8A 2Z95A 2G5PA 3AESA 3EVZA 4M6WA 4LJ6A 1VFNA 3F78A 2XTZA 3GI1A 3S29A 5EJ4A 5AXCA 1MIOB 2CBXA 3BIOA 3IULA 2HK9A 4LE0A 3U3DA 4F4CA 1PEAA 3TSAA 1N6HA 1FFDA 1YVRA 2AYYA 2C9MA 1EWQA 1N0IA 1NW3A 2Z58A 1YB1A 4DA7A 4O4LB 4GMDA 3OUTA 4IJWA 1KE2A 3AF3A 1KOGA 1I1OA 2O1XA 3CKMA 1U7ZA 4OKNA 1L4EA 4OOFA 4HG2A 3RV4A 4RHTA 2QUHA 5D3QA 4HXYA 4NNPA 3C7DB 2HOQA 2GM5A 2JK0A 2JIMA 3C39A 2DY0A 1G3RA 1PFVA 1W85A 3CKKA 1DJOA 1YS6A 4AJ4A 5C8YB 1RJFA 2OCKA 3JVIA 2B1RA 4JYMA 4TKMA 1WMFA 2GF0A 4YUWA 2HL6A 1VKNA 5AW8A 2B8NA 3VKUA 3WHKA 3Q12A 5CURA 3GLGA 4KGXA 1HTTA 3DZCA 4KR3A 3A14A 2VTBA 4W5JA 1JQDA 3A4LA 2IFTA 2WJ4A 3AUTA 4FJ0A 2NZ2A 1V8FA 1BXRB 2HWYA 1YZFA 1MHPA 4LE1A 3GK3A 4AP6A 2H06A 2OPHA 5KKNB 1ZD5A 1IQPA 1JQKA 3A0UA 1ZW1A 4OD0A 2D06A 2B8WA 4ATNA 4CCWA 3WY9A 5L3RA 2OMKA 5KSPA 4O0MA 1BE6A 3IBSA 1I24A 2K7ZA 3N0VA 2Q22A 5JZSA 4GMFA 4CG0A 1GR1A 2QK4A 3EGOA 3TBKA 2EW1A 1Y0BA 1NF8A 1J5XA 3HKCB 1KC3A 4LJ7A 5I8PA 2MSDB 1KYIA 2GJSA 4UNSA 3TRKA 3A9TA 1TQ6A 1QH8A 2AW5A 3F98A 4IEEA 3SJAA 1JDVA 4IINA 1TYEB 1DHTA 4NQRA 3CU5A 3IAXA 4HGQA 5T73A 1PWEA 4N0PA 2QV7A 4WJZA 3G9QA 3M5DA 4Y1EA 1L1FA 5BR1A 4IGKA 1TFRA 2F17A 3BXOA 4KK4A 2QRPA 1GG5A 3DE3X 3WRWA 4P54A 4J07A 4QYIA 5DMXA 4DIKA 4RENA 1XZJA 3S81A 2VHUA 3T5DA 2FZ5A 4X1KB 4L5YA 1E6MA 2G7ZA 2BI7A 3OG9A 3CSDA 3UWPA 5CD9A 4MVJI 3LY5A 3AR5A 3SQMA 2VSXA 2QTTA 3RJ5A 4D6XA 1AF7A 4MWSA 1KBQA 4TMWA 3H9CA 3Q0IA 4L5AA 4DARA 5IXYA 5CFRA 1E1NA 2DBVO 4TT3A 1VYUA 3F5SA 3JW8A 2P6MA 2QDKA 1H8ED 3P9QA 4NDAA 5AP9A 5AI5A 1CUJA 2P2DA 3N76A 2C4WA 2LWIA 3QU9A 5JJIA 4J90A 1PWZA 2O5CA 3HKDB 3MJCA 2XQVA 2NVBA 3PGVA 1QV6A 2QN1A 4JU9A 5CPBA 3BHJA 1A97A 3OE1A 4BVEA 4YAIA 1C7ZA 2MHCA 4GI1A 5ECWA 2WQ6A 1KF0A 5E9WA 3ZI7A 4AAYA 1D1QA 3GL9A 3T1QA 3QVSA 4UTNA 4EAAA 3MJRA 2DLCX 2IUSA 3MN1A 4DMCA 1U1IA 2DMRA 3AIMA 1LQ2A 1AUOA 1CY6A 5CVJA 1RPNA 3ELBA 4XSVA 3PDIB 3GA0A 4Z9YA 3AHCA 1EG7A 3V8RA 4QLBA 7MDHA 2ZBDA 1TU4A 2CVFA 2QUAA 1VI5A 4GKVA 1M6EX 5EVCA 5FJJA 3DUWA 2WF7A 4R68A 1JS1X 4V2IA 4W1PA 3L4JA 2K2QB 3PLAE 4IFBA 1XTBA 5CD1A 4F6LA 4HLUA 3JWEA 1M34B 4FZ3A 2YYZA 4MQLA 1U04A 5AJVB 3E6AA 3DAYA 3L92A 4FSDA 4XAQA 3S8MA 3KKZA 4DOMA 3I5YA 4LFBB 5GINE 2PYDA 4L4SA 3TTUA 4O3FA 4Q7JB 3VYWA 2VH5R 1E0DA 3DQZA 2ZIVB 4X54A 3JR3A 1E2LA 3AJEA 2GPSA 5BMOA 3L7OA 2PLRA 2H5JA 2PWAA 3HZOA 1NVEA 3FJOA 4PSVA 3ZK8A 3EPLA 1S3GA 2FTKE 3G2LA 1G55A 3I2IA 5AD1A 1IB0A 2WD7B 2WDZA 521PA 1LX7A 2A7XA 1W4CA 1RYYA 4MR9A 3JR7A 3MTEA 5FUWA 3SZMA 1WMEA 3LIPA 1FDUA 1I1QB 2G1KA 2J46A 2P6NA 3D8SA 4IV8A 4N8DA 3WGQA 3DOUA 5KYTA 5HM8A 4NYMR 3QU2A 2W4QA 4NENB 3U6BA 4KGVA 2PXXA 1EWTA 4OGKA 3N6RA 4FNGA 1NW8A 2IXFA 2EIXA 3HN2A 1NVXQ 5IDYA 4IIJF 3TD6A 4GKAA 3H2YA 1PL7A 3CA8A 2R84A 4EENA 1PYOA 3VSDA 3AVWA 3AL0C 5F64A 1D03A 4CEHB 4KP7A 3QUTA 2A9PA 1Y9DA 4K9QA 5ECGC 1GA6A 2OV2A 3TWOA 4P3PA 2O9JA 1W48A 1LQUA 3GLIB 2GKGA 2O2DA 1HYQA 1D2RA 4RGVA 2FR8C 2XF8A 1NSTA 3PD1A 1B42A 1W2WB 5F3WB 4XGKA 5ALXA 1L4GA 4C0KA 3HBLA 3QMVA 1HDYA 1DIBA 1HBJA 3AY6A 1B6TA 3JRWA 1UYJA 3PC8C 4KOEC 3ZVRA 2W2PA 1QJCA 2CYAA 1MO3A 2FWRA 3UMJA 4INPA 1KAOA 2OVBA 1Z45A 2ADOA 2ZJ4A 1HEUA 2PGJA 3LUKA 5HGXA 1RYHA 2UUCB 1K6EA 2AZTA 1KH3A 1RW4A 4ZCRA 1ZKDA 3AVTA 4HSGA 3MJVA 5CT9A 4D0LB 3U4AA 2XKKA 5JO0A 3A0RB 3U48A 5DNCA 1PT6A 1UUFA 3RTBA 4OQQA 1YBVA 8ABPA 5CT8A 4P2GA 2C5HA 2G17A 1G18A 1U7HA 5JU6A 3PFFA 1BFUA 1EI9A 1RCUA 4N41A 3WGJA 4YDRA 1B8VA 1HE1C 1RKQA 2BFDA 2OHHA 3LYUA 4XM0A 1VA4A 3TEJA 1FW8A 1UPUA 3LA8A 2KHZA 4EHAA 2PL1A 3TGWA 3BTUA 4J0EA 1B7GO 3K0AB 2YS7A 2JJ8A 2YWHA 5D00A 1L5RA 3QUAA 2GF2A 1G60A 2PO7A 2A67A 1MOPA 1D6NA 4G9BA 4RVHA 2W48A 2GOYA 4QRDA 4BHTA 1DELA 3IMCA 2NMVA 3GPDG 4U2FA 2NO6A 1N6NA 1N8SA 6CHYA 4EKEA 4MPPA 3A6HA 1GZ5A 2WTBA 4QOEA 3MJSA 4KXNA 3BWEA 5BSEA 1JX6A 4OXXA 3GDOA 4Y30A 3VPXA 3WDLA 2GBCA 5B3JA 1KJIA 3BXZA 1KP3A 2DKNA 3DL4A 3ZZ0A 1OI3A 4DR7B 4J4BA 4KZPA 4LJYA 1Z4QA 1S9HA 1OROA 1YL7A 2O7VA 4X6XA 2DUNA 3DOOA