4DPMA

Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with coa
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
354
structure length
354
Chain Sequence
RTLKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGQVPKEIADMEIKPTDPKLMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPHTISLIDEQRKRREWKGFIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDNILPLGDGYDAKTIKEIFRILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAPSKPIIVMNEDTRPQVYFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVEKGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for a Bispecific NADP+ and CoA Binding Site in an Archaeal Malonyl-Coenzyme A Reductase.
pubmed doi rcsb
molecule keywords Malonyl-CoA/succinyl-CoA reductase
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
total genus 120
structure length 354
sequence length 354
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.2.1.75: Malonyl CoA reductase (malonate semialdehyde-forming).
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4dpmA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dpmA01
4TSKA 3E9QA 1C1DB 2ZK7A 5JDCC 4L9RA 1JAXA 3KYCA 1FDVA 3CSDA 3H9UA 3LU1A 3PYMA 1DFHA 1DIHA 1CERA 4CV3A 3VPHA 1OFGA 3SXPA 3A28A 4PLYA 3D4OA 2E6UX 4BVAA 4Z9FA 1JQBA 3KUXA 3DOJA 1I0ZA 4MVJM 1ZO8A 3RKRA 3QIVA 1VE9A 1NP3A 3B70A 1S7CA 1AUPA 4BNVA 1X1EA 2X9VA 1ADFA 4OXNA 1ENYA 1HETA 4WECA 3PZRA 3NYWA 5DT9A 3CTMA 4U6SA 1NPTO 5DCUA 2GZ1A 4ILKA 3G79A 4IDCA 2RAFA 2W2LD 3WGZA 1LQUA 4N54A 4IDFA 4YDRA 3RROA 4QQRA 1P1KA 4PRKA 2C0CA 4BS9A 1QKIA 4DRYA 5JDIA 4DIBA 3MZ0A 4N7RA 2OXIA 1DDOA 2CUKA 3AM5A 3K6JA 4U8GA 3S1LA 4WCFC 4AJ4A 4R51A 1PJLA 4FR5A 4L8VA 2B0JA 2O3RA 5COBA 3ZNQA 1EEHA 1K6XA 1X14A 1ID1A 4R9SA 4EJ6A 5KVVA 3FR8A 4YXFA 5CDTA 3V5NA 1M6HA 3BMQA 4UEOA 1KY5A 4BNJA 4XYMA 2PA3A 1Q2XA 4D3SA 4GX2A 5A5EA 4BKRA 4EJ0A 3JQ7B 3L6OO 1HYHA 4RORA 5A06A 3JQBA 4K26A 4E5YA 2X0RA 3M1AA 4UUNA 1KOLA 3RUDA 3RFTA 4Z6KA 4XQCA 4CUJA 1PIWA 3GLQA 4YJGA 2AQIA 4K1LA 1LSJA 1UXKA 4D43A 3HJAA 1U3UA 1D7OA 3WTCA 3DOCA 3UVEA 4LRTB 4RJTA 2D5AA 4UVEA 3K2BA 2ZTUA 1HDZA 3ZWVA 1XQ6A 4RCVA 5L9AA 2X6TA 1B26A 2NM0A 1VI2A 2NU9A 4P22A 1BXZA 2DFVA 3N74A 4PRLA 2X4GA 1GYRA 1XU9A 4Y6SA 1T2AA 5ILOA 3FTNA 2E82A 4E2XA 5JSFA 8ADHA 1LBEA 1QRRA 3F47A 4H3VA 2NU7A 5EIOA 2ZIZA 3DAFA 1ZK1A 4YVFA 1PTJA 4JP3A 4KDFA 3ZV5A 1EE2A 2PZKA 1R0LA 3JYQA 4XYGA 2Q50A 4TVBA 4XQEA 4AJNA 4PN3A 3WLEA 1HF3A 3KB6A 4RQTA 3IL2A 3OEYA 5DDIP 1WVGA 3H9JA 1K0UA 3KOUA 4JNKA 4EEZA 2O48X 1Y8RA 1H9BA 1ZSYA 3NEPX 4H7PA 2B35A 3U09A 3NDJA 2BGLA 2Q99A 2JCVA 3EDMA 4M86A 1V0JA 1V9LA 3TFQA 5TC4A 2PZMA 4MDHA 1OC4A 3ZWCA 5IDWA 4BMSA 4CM3A 1U4OA 3KSDO 2Q4EA 1ENPA 3KVOA 5CDSA 4Z9XA 1GADO 1MA0A 2D8AA 1U28A 2JAHA 1I3LA 1SEPA 4GMFA 3H5AA 4NMHA 2G5CA 1NPDA 5JE8A 1E92A 4UUMA 1W6UA 2C2XA 1PJCA 5IAAA 1CEQA 3F4BA 5LC1A 1QV7A 1GPDG 4WLNA 4YTEA 4DQUA 3PWKA 4E31A 1W73A 4CUZA 1UZMA 3BXXA 3D64A 1U5CA 1JKJA 1A7AA 2C82A 4PG8A 4I5EA 3TPCA 1E3EA 1B0AA 1I3MA 1W4ZA 1LLQA 5CEFA 1MXFA 1O0SA 4AJPA 3RUFA 2Q49A 4CMGA 1EDOA 4ND1A 4OQYA 4MOWA 4IZHA 1YL7A 1XG5A 2QW8A 1MLDA 1A9YA 3ADPA 5BNIA 3U4IA 2HK9A 1P45A 1RKXA 1A7KA 3PYLA 2I66A 5B37A 3DDNA 1DIAA 3I3OA 4OGWA 1GZ3A 2J3JA 1EE9A 3BTSA 3FBTA 4BNGA 2WE7A 4RVFA 3UCXA 2V6BA 3VPGA 1MG5A 3BHIA 3R6DA 3I9LA 1Y81A 4CMIA 1HT0A 2VQ3A 5CPFA 4K6CA 1LJ8A 2DUWA 3I9OA 1B8UA 1YL6A 2OP0A 2QRLA 2BHLA 3GAFA 4F6LA 1PR3A 3ICCA 5A9SA 4GKBA 3FSRA 1VL0A 5A1TA 4IGFA 5ICMA 1NASA 3C85A 1E3WB 3VVBA 4L4XA 1SAYA 3JQFC 2HAEA 2EV9A 4WKGA 3D3WA 1X7GA 4YB8A 5JY6A 2JCXA 1HRDA 3L77A 4JXKA 4D0RA 3ZV3A 2YDXA 5GZ1A 1VL8A 4XGIA 1E3LA 4PIVA 2I9PA 2PGLA 3D5TA 3ITDA 2H63A 4B4VA 2C54A 2EW2A 3NGLA 3FNHA 3ZHYA 5L51A 4R01A 4YWJA 3AY6A 1ZMOA 5JLAA 1ZSVA 2W2KA 3COSA 4XA8A 3GMSA 1A71A 3L6DA 5JC8A 5JFOA 5H83A 1SOWA 4XEHA 3A4VA 5G2OA 2O3TA 3DHEA 5F1KA 1HTBA 1KEUA 3G1TA 4HKTA 3GGPA 3DZIA 4WLFA 4U5QA 3PFFA 5T67A 5A4DA 3RFVA 5FEUA 3GFGA 3E03A 3U5TA 2JCYA 1NYTA 1YO6A 4YJFB 3OM9A 4NBRA 2B4TO 1Z82A 2OOSA 2XOXA 2C59A 3IOYA 5KJFA 1CETA 1T25A 2NV6A 3BTOA 4PG5A 1M2WA 1UP4A 1G6KA 3W4IA 3ZU4A 2EERA 3GZNB 4K9DA 4JBGA 3UF0A 3V2HA 2VWQA 5TSDA 1AHHA 4J4TA 1DEHA 5G4KB 2PLAA 4A5OA 3BYZA 2QYTA 1U9JA 7ADHA 1E7QA 3INGA 1BW9B 1PJBA 2E49A 4QX6A 3RBXA 4NPCA 2B37A 3ZH2A 3DB2A 2EHDA 5TS3A 3B6ZA 4PLZA 2Y0EA 2EP7A 2BGKA 5ILGA 2WTBA 3E82A 3HWRA 3IQDB 3SJ7A 1QG6A 3JQEA 1R4NB 3RIHA 3GDFA 1X0VA 3DO5A 4AVYA 2Y0DA 5C7OO 3DBLA 3UXYA 3JD2A 5TT1A 3F5QA 3HFGA 2GUGA 3RKUA 4QTZA 4ZRMA 2RH8A 2LDXA 4ND5A 1RM4A 3EUWA 4W99A 4W7IA 1JN0A 4E2YA 1BHSA 1HE4A 4J9VA 1JAYA 3ROMA 3ZGYA 2YYYA 1DLIA 1IYZA 3I6IA 3ZDFA 1D1SA 3KM0A 3V8BA 1OC2A 2PKQO 1DLJA 1CWUA 1TT5A 1BMDA 3ZZNA 4NIMA 3RUAA 1YRLA 1PX0A 3CZMA 4LN1A 5EQDA 1WW8A 3C24A 2JHFA 4I5FA 1ZK0A 1BDBA 1YH3A 3QV1A 2CDBA 4XQGA 5B4TA 2P9CA 1A27A 4FCCA 3RU9A 4UREA 1KETA 4CMEC 3ONFA 4OOEA 5I8ZA 1WDKA 4NU6A 3WMXA 4MVJA 2FRDA 1ZH8A 3WYEA 4QECA 3WGOA 5F1OA 1GUFA 4KWIA 2GN9A 4D45A 1KVRA 3ZWBA 5FYDA 1JA9A 3VH3A 4MVJE 2B5WA 3EVNA 1ADBA 1SB8A 1VRWA 3PXXA 3OJ0A 1PZEA 3KHUA 3BHMA 2CMDA 3CE6A 4D42A 2J3HA 4CM5A 4KUGA 2UAGA 2YV2A 5IFLA 3UHAA 1WDLA 1GL3A 2Z95A 1VL6A 5JO9A 1KVQA 1QYXA 4MKXA 1PJ3A 4NBWA 1I30A 1J4AA 1D3AA 1U4SA 2VOEA 7MDHA 3MTJA 1KEVA 4YBZA 2JFFA 2R00A 4DGSA 4CLRA 3WB9A 1EMDA 3D4PA 4ND4A 2V7PA 3ZNOA 1R4MA 3AUAA 2TMGA 3VHRA 4Q3CA 3KXDA 4YCAA 5BNTA 2UYYA 2WYVA 4TRRA 2XF8A 3OJLA 4R1UA 2HJSA 1MX3A 2YY7A 3WX0A 4NBVA 1LDYA 3VH4A 3CINA 1N1GA 3AOEA 4J1TA 3WSVA 1YB4A 1NQ5A 1MFZA 5JAZA 4OL9A 1MFPA 1DOHA 4L4SA 4C7JA 4D3DA 3MTGA 3F1KA 2NQTA 4KMSA 1RYEA 3JQGB 1L7DA 1UAGA 1JVSA 4TKMA 5I8WA 5JNLA 4BQPA 5KVCA 2I67A 1T26A 4BNYA 3IKTA 1GCOA 5AYVA 4ZJUA 4Q9NA 1ZCJA 4J91A 4BB6A 4BO1A 3AU8A 3WYBA 1UDCA 1LLCA 3PQEA 1ULSA 2QRKA 3TZKA 1E3JA 1MV8A 3PFWO 1DPGA 3CEAA 3TDKA 4BNIA 4J0FA 4MVJD 3PJFA 2PD4A 4ZD6A 3C7AA 3ABIA 3JD0A 3PHIA 5TLSA 4FOSA 1JKFA 4MIEA 2AEMA 4KP7A 1KYQA 1PU2A 1JLLA 2X7HA 2FMUA 3LZ6A 5TGDA 2GDZA 1ZSNA 1UXGA 4KOAA 3ULKA 5EJ2A 3Q3CA 1KS9A 3H8VA 5THQA 1GV1A 3UAGA 4BQRA 5KIAA 3WDSA 5COQA 4TVOA 3GVPA 4R4JA 3TSCA 3ROKA 4KDEA 1NQTA 4PG6A 1DAOA 5ITWA 4G81A 3WQQA 4A0SA 2DBZA 4HUJA 3W8EA 4QO7A 4AJLA 1X13A 1IPEA 3W4JA 1KIFA 2CD9A 1MG0A 1DJNA 1G1AA 4WLOA 3ZV6A 4R3NA 4NHEA 5C5IA 1WMBA 1E6EA 1GTMA 3FTPA 3RASA 3KTDA 4UVDA 2Q2QA 2WMDA 4AL4A 1WXDA 3MOGA 4CM8A 2Y1CA 4BKUA 5TJ9A 5IN4A 2WD7A 2AEFA 3LYLA 1B16A 3GVIA 1FF9A 2YFHA 4P4GA 1R12A 1ZUD1 3LT0A 4BHTA 4N18A 2F1KA 2ILTA 5A9TA 2I5PO 4S1VA 4O1MA 1HWYA 4CQMA 5C37A 1JKIA 1O8CA 3PPIA 2Y0CA 4EGFA 3ZWNA 2I65A 3CKYA 3KBOA 2G17A 1C1DA 1Z45A 3IJRA 4JLWA 4E5PA 5B4VA 4Y9DA 2CY0A 3PTZA 1D8AA 5B1YA 4A10A 1NVMB 3ZI0A 3TN7A 4XYEA 1NAHA 1TXGA 3MJVA 5F21A 4XGNA 1ISHA 1IOLA 1BSVA 2PGJA 4YAGA 3T7CA 3TZ6A 1ONOA 2B5VA 4QUKA 3I9MA 3KEOA 4AJ2A 3NAQA 3RQSA 2DBQA 3BTVA 3WNQA 4MP3A 1K5HA 3FPLA 4FFMA 4PLHA 1VC2A 4PFJA 2YQ4A 3S2GA 3SJUA 2YJZA 3N58A 4CM7A 2UUOA 5JYEA 3ZWYA 1R0SA 3GNTA 5T8KA 1HDCA 3CH6A 1M66A 4O5OA 3GHHA 3VZRA 2E37A 3DZHA 4URFA 2O3QA 4NFHA 2NVUB 1EFKA 3G3EA 3GF4A 3RC9A 2DAPA 2ZATA 4KTTE 5EERA 3I5MA 4GPD1 4XJTA 4ZVVA 4YAIA 4GMGA 9LDBA 1EDZA 3OH8A 3K2EA 4OH1A 4O63O 3RBVA 3UFXA 4X54A 1E5QA 1RM5A 1EK6A 4I8XA 4R9RA 3QWIA 1LA2A 2FZEA 1Z7BA 2VRBA 2X1HA 3WGHA 1T1SA 3Q6IA 4LMPA 1VPDA 4CR7A 2G1UA 4JJFA 3JQ7A 4CQMD 2JD0A 3UN1A 4M1QA 5KJEA 5JAMA 3Q9NA 1UAYA 4YACA 3H2ZA 3WMWA 4B4UA 4B7XA 3H7AA 2RIRA 3I52A 3W8DA 2CF6A 1PSDA 3FRJA 4UAGA 1PQWA 3OQ1A 4WK6A 2Q1SA 3WIDA 4IQGA 1GCUA 1BVRA 2Q2WA 2RBEA 5CDGA 4MIYA 2GZ3A 3LF1A 4YJDA 3VZPA 2BMAA 2GGSA 2X5JO 3JQAB 4OQZA 1BG6A 1CIVA 5A3VA 1JWAB 2Q3EA 3U49A 4BGIA 4GSLA 3DBVO 3JQ8B 2X5OA 1ISJA 2JFGA 3U0BA 5JYDA 3PGJA 4WCFA 5JPIA 3DAGA 4B3IA 1LNQA 4MINA 1XDWA 4RPGA 2AA3A 4M49A 5IDQA 2WWRA 1TB4A 2Y93A 2HO5A 3DFUA 3TWOA 5L45A 1VM6A 1F0YA 4NI5A 2BFMA 4ONEA 1LLUA 5BSGA 3GHYA 2O3UA 4O0LA 4L4RA 2ZCUA 1UP6A 3GUCA 3K31A 4MVJH 3OIDA 4JIGA 4BB5A 3P19A 3RUIA 1PL7A 2FZWA 5KKAA 5KJ6A 4KTVE 1ENOA 4DREA 1UP7A 4IY1A 2O2SA 4YRBA 4Y98A 5EQFA 1P1RA 1LLDA 4LSWA 3SLKA 1EVYA 3I9JA 2NSDA 1ZVMA 1PJTA 5DP1A 1P33A 3RJ5A 4BNKA 1PQPA 1YE3A 3F1LA 4Z0TA 4ALMA 3NTQA 2JAPA 4RO0A 1T24A 2P5UA 2RH4A 3LK7A 5AVOA 4ZRNA 4DYDA 3DFZA 3BMNB 1GY8A 1EVIA 2I76A 3GPDG 1QYDA 1YQXA 2Z1NA 2HQ1A 1CQJA 3IJPA 2GN6A 3AM4A 1IE3A 3I6QA 4YA6A 5T73A 5EMHA 3F3SA 3JD4A 3G17A 3UCEA 4ALKA 1HDGO 2J5RA 3QE3A 4L0QA 3WBBA 2C20A 1K3TA 1LUAA 3BMOB 4GSKA 2ZCVA 4CM6A 3R3SA 2A35A 1M75A 2O23A 1ZK4A 3ZHBA 4J4HA 2DVMA 2QZZA 4RVUA 3UW3A 5L7YA 3SC6A 4YQYA 1CRWG 1PR9A 2VHVA 4IXTA 4ZQFA 3GVXA 2HMTA 4GLLA 2X23A 2PKQP 3PQDA 4FIZA 3TNLA 4BUCA 2HK8A 3O38A 4CV0A 3RFXA 3NUGA 3IUSA 1UDBA 4BMVA 5IXSA 1K6IA 3L0DA 3EK2A 1MXHA 3O9ZA 3BMCB 5BNFA 5K0ZA 1LDEA 4GAEA 3WJAA 3F5SA 3VKUA 2VTEA 1YWGO 4GVXA 1Z73A 1PJ2A 1HE2A 1WAMA 5L40A 1YDEA 2AW5A 3LC7O 3K96A 3TRIA 3WQSB 3ZNNA 4D46A 5BSFA 5DNAA 5KKCA 1LDGA 1XA0A 1K89A 3FD8A 4IQ0A 2YQ5A 3OEWA 4FFLA 4MKRA 1QYVA 2ET6A 4UULA 1L1FA 4CLDA 4A2CA 1E7YA 4K28A 3ST7A 4GI2A 1B7GO 3PP8A 4BKPA 4BIIA 3ZHXA 4IJWA 3WGIA 4L76A 5ES3A 5A04A 3LC1O 2WE8A 3JYPA 4DLAA 1E3WA 3NKLA 1F8FA 4NJOA 2I99A 2Q1TA 2GSDA 3T4EA 5ICSA 1E6WA 3DL2A 4CLXA 1T2CA 1EUDA 3JD3A 1IPFA 3V1YA 1PGQA 2P2SA 1EUCA 1LRJA 2P4QA 3RAJA 4PLGA 4UVIA 4DA9A 2R2GA 4HNGA 4BO0A 2OZPA 1YBMA 1P0CA 3GC6A 4CV2A 1ARZA 4UEKA 1LDMA 1J49A 2YDYA 4KQXA 4OYRA 1UXIA 2D2IA 4FGSA 3I23A 2JL1A 1YL5A 1XKQA 2AG8A 4KWHA 3AK4A 3RU7A 4E21A 2VRCA 4FQ8A 1PGOA 2FHSA 1I24A 4IDAA 1NR7A 1S6YA 4FDAA 1J5PA 3ONEA 5AXBA 4II2A 1LC3A 1FK8A 3H6KA 5HA5A 5I9MA 4GX0A 4OOFA 4BGVA 2ZKLA 5H81A 2J6IA 2EJWA 3VTZA 1DHRA 5LDGA 3H2SA 3IAHA 1YXMA 1X1TA 1GQQA 1GQYA 2RHCA 1N1EA 3VDQA 4IJVA 1DRVA 3Q0EA 3JQFA 4YJFA 4CLHA 4FJ0A 4EUFA 2O2YA 5K6AC 5AQ1A 1ZKMA 4J7UA 3TQHA 3T7EA 5KVSA 2WDZA 1NQAO 2HK7A 2BF7A 2EIHA 4FFPA 4DWVA 3IP3A 2DC1A 1YVEI 4ND3A 1VKOA 3GZNA 3FHLA 3RCBA 5BSHA 1LDNA 3L4BC 4O59O 4JCOA 2Q4BA 1PJSA 4I9NA 1LTHR 4QXMA 3H9GA 3I9KA 4EUHA 3ZU3A 5G4KA 5G0UA 1NFQA 5CG2A 4CMKA 2BFOA 5FWNA 1BW9A 2O7QA 4YJHB 1B2LA 4GGOA 1BTOA 2Y1GA 1OZAA 1YONA 4W6ZA 4IIVA 5AXCA 4XRGA 4E5NA 1P9LA 3EHEA 3NT5A 3ZW8A 1P3DA 3GDOA 4I9HA 1E0DA 3ETEA 1R4NA 5A3JA 3SBOA 1TLTA 1LI4A 2HUNA 5HBRA 4J0EA 3VOSA 4M89A 3SX2A 2V6MA 4F45A 1E1NA 2JJYA 3H3JA 3BA1A 5T6BA 5MDHA 1ONPA 1SC6A 3RUCA 4R5HA 3HADA 2VRCD 1H6AA 3A14A 4YRAA 1YJQA 2WYWA 3HUDA 4R69A 1FDSA 1QLJA 2C7VA 4RL6A 1ZIDA 2D4AA 3E18A 3HE3A 2EGGA 5AXDA 3ZWXA 3P2OA 3D4NA 5DCWA 1C3VA 4RDIA 4KZPA 5CEJA 4NH4A 2DTXA 1DIRA 1B8PA 2FSSA 4GBJA 1U1IA 4R1SA 5DP2A 2PFGA 4E4YA 1R37A 1X7HA 4TRJA 5EL0A 3WSWA 2NACA 3GQVA 5LDHA 3C8MA 4W7HA 2VT2A 2Q1UA 5JAIA 4BNNA 3C7CB 4JROA 4XQ9A 3ZCXA 3TF5A 4CR6A 3M2PA 4W4TA 1PS8A 4Y8VA 4UUPA 1SPXA 2PKRA 4G5HA 2Q1WA 1DHTA 1NWHA 5M6DA 1XHLA 4LW8A 3CZRA 4RZIA 2BH9A 2OFPA 4YPOA 4BNMA 3GFBA 3IMFA 3S55A 1E7RA 4Z3DA 3RJ9A 1GZ6A 3LSYA 3PGXA 3DZBA 1QV6A 1SEVA 2DKNA 1AXGA 2H1SA 3ZHZA 1ULUA 4WUVA 5TRTA 1A72A 3AFMA 1H0KA 2BI8A 3KLMX 2IEBA 2GR9A 4RZHA 2FPIA 3DBRB 4IBOA 5DBGA 1Z6ZA 1Y8QB 2V65A 5J23A 2VHZA 3KSUA 1P1FA 1Q7GA 4PLPA 3F4LA 3GAZA 3E8XA 1TVEA 3INRA 3TZCA 1P44A 4CMEA 3E1KA 1C0PA 3FN4A 1NTOA 5KWEA 3CUKA 3HN7A 3D5QA 1B15A 1A9ZA 3GH3A 3OJEA 4XR4A 5DOVA 3UOGA 2GF2A 4HY3A 3RWBA 3WXBA 3U4DA 1N9GB 4IS3A 3JQGA 4OAQA 2Y68A 4PZEA 4XD2A 3PEFA 4WLEA 3HDQA 3L9XA 1YJ8A 1ML3A 2ZTVA 3C3XA 3GDGA 1DO8A 2JFHA 3S2EA 4YT2A 1PWZA 4BO3A 3S2IA 5IF3A 4M87A 2NTNA 3NTRA 3QVWA 1R66A 5CAEA 4J1SA 4CLOB 2A4KA 1QXSA 1C0KA 1Y5RA 4BNTA 4TRNA 3VC7A 4EEXA 4N5MA 4LISA 4MKZA 1MB4A 2OL4A 4FFOA 3I1JA 2H6EA 1YKFA 2CZCA 2BKAA 4WPGA 1PQUA 4DBVO 1EQUA 4FD3A 1DRUA 4AJOA 3GN2A 4BNXA 1ZW1A 1GAEO 1VJ1A 2QQ5A 1GEEA 3AWDA 3UKOA 3O26A 1P77A 1W8DA 3DMYA 4BO4A 2LDBA 1Y9AA 4NR0A 5JYFA 3EZLA 3T4XA 2UV8A 1G0NA 4DIFA 3QW2A 4IUYA 4NK4A 4Z0HO 2FPGA 2PH3A 2WD8A 3VZQA 1KERA 1UXJA 2EKPA 5TQVA 3ADOA 1H6CA 3PWSA 5IDYA 1U2DA 5FI3A 2ZB4A 1VKNA 2QG4A 3GEGA 2O4UX 4BV9A 2GZ2A 1EZ4A 1GYQA 1PJ4A 4IDBA 3DMTC 1WP4A 1JVBA 4WLVA 5L3ZA 3JSAA 1BWSA 3LF2A 2FN7A 5ER9A 4CV1A 1HSZA 3JQCA 4RV9A 2G82A 4E30A 3OBBA 3PQFA 4YEDA 3ZWOA 4CMIB 2YHUA 4FW8A 4GX5A 5IZCA 2PY6A 1SO8A 1A4UA 2IZ0A 1SNYA 3PHJA 2IZZA 3OP4A 3KSZO 4YT8A 3WS7A 3OHSX 1V6AA 1PGJA 1EQ2A 1NM5A 1T1RA 3GN1A 3PHGA 2POQX 4IDEA 3OQBA 4HX5A 1OAAA 3INTA 2WJPA 1V8BA 1XR3A 3GUYA 1HYEA 4R1TA 4ZQGA 4Q39A 2GD1O 3WICA 4DLBA 4JBIA 3RC7A 2C7GA 3VPSA 3ANMA 3OICA 1YGYA 4E5KA 1HDOA 1RPNA 1PL8A 1HDXA 4J90A 4UEJA 3HDYA 2NVUA 4MO2A 3DONA 3GVCA 2WYUA 3H3FA 3KLPX 3KO8A 4HFJA 2QX7A 1QSGA 1JW9B 1B14A 1EVZA 4XYLA 2GASA 4XJSA 3FWNA 1GPJA 5I7SA 5FI5A 4GWGA 3OSUA 1UDAA 2P91A 2JD2A 1YQGA 3NGXA 4P8RA 2HRZA 5C7IO 4J1NA 1E7SA 4PZCA 1ADCA 2VTDA 3DTYA 4Z0PA 3CXRA 4E12A 4I5DA 3TL2A 3PDUA 3DHNA 4AFNA 1HKUA 4RPKA 4HP8A 2EEZA 5CHEA 2QRJA 1RJWA 2VOJA 3PHHA 4FJ2A 1N7HA 4E3ZA 4CMAA 4WNCA 3EVTA 4NG5A 1NR1A 4I1IA 2CF5A 2X0JA 3ZU2A 1SOVA 1YBAA 4IINA 3GZ4A 4CQLA 5HM8A 1K2WA 3QQPA 4MJLA 3AUTA 3MCVA 1I33A 1SCUA 2IDZA 2IYPA 4OKIA 4F46A 6LDHA 3AUSA 2QYSA 1OBFO 2P9GA 4OSOA 1Q1NA 4AJKA 4YT4A 5J9GA 4EBFA 3JQDA 4CM4A 2P5YA 3GRPA 4O6VA 2E48A 3W1VA 2HU2A 5TJHA 5IZCC 1H94A 1ZXBA 2J8ZA 1Q0QA 3U3XA 1T2EA 3D0OA 4BNLA 1YDWA 2WSBA 3QVOA 4DPMA 1Y1PA 4EYEA 3BIOA 4QT0A 4B8ZA 3JQ9C 3HG7A 1HL3A 4ZGWA 4ALJA 4OMUA 4BNHA 2NVBA 1TI7A 4YAJA 2AHRA 1QR6A 2NNLD 4ALLA 4XGKA 3DBLB 3WJ7A 4WLUA 4ROSA 2EGHA 1UH5A 1I2ZA 2DLDA 4AJHA 1QP8A 3C1TA 1E77A 1R15A 4L73A 4YAEA 3G1UA 1O94A 5CEEA 3O8QB 4W9NC 3V2UA 3FNGA 3L4SO 1Y9EA 2ZTMA 3E9NA 3DZJA 3SLGA 1XYGA 2GRAA 1I2CA 3DEYX 3WFIA 4Q3BA 1DB3A 2O3JA 3L07A 3ZW9A 2D1YA 1ZJYA 4MVJP 3H5RA 1Z74A 2FR1A 3KETA 2YV3A 1U3TA 3BMNA 4JBHA 3C1AA 1XU7A 5KCZA 4II3A 4HV4A 4MVJG 5TF4A 2IXAA 4R3WA 4NDNE 4HNHA 1GZ4A 1Q7CA 3KYDB 1SBYA 4I9UA 4ZA2A 1KVSA 4R16A 3WGGA 4D44A 3GNSA 4J1QA 4QFCA 1NFFA 3VVCA 2QZ9A 1CF2O 1GUYA 4KUHA 1DRWA 1C0IA 1CJCA 4GGPA 4XZ3A 3GG2A 4FS3A 3EGOA 1JTVA 3GNQA 1DC5A 2V6FA 5CPBA 3RC2A 3WTBA 3BMOA 2WEKA 1IZ0A 2DFDA 4PLTA 3S8MA 2VYNA 2FSVA 4WEOA 3S2FA 4NBTA 2UUPA 5DBFA 4XRRA 4HWKA 4BNWA 5B4UA 3FWZA 3M2TA 1QORA 3D3EA 1I3NA 3ENKA 1V3UA 4P4LA 3QY9A 3HB4X 3DTTA 2ZB7A 3Q2IA 3D1LA 1GDHA 1R16A 3MOIA 2H9IA 3BMCA 2EXXA 1ZNQO 1U2GA 2JD1A 2PZLA 4TZKA 1V3TA 3QVSA 4MVJI 4PLFA 8LDHA 4C4OA 3P7MA 2EWMA 4CUKA 1IHXA 4WGGA 4ZQEA 3ZWAA 3H9EO 4F6CA 3PWZA 2PR2A 5AOVA 1T2DA 2YHIB 4J7XA 4XR9A 1JDJA 5CDUA 3BHJA 1BXKA 4W82A 1VSUA 2PD6A 3KYBA 4TMFA 4IZIA 4JK3A 3SEFA 3HQ4O 3ANNA 3WG9A 2VWPA 1KY4A 1MGOA 1NPYA 4M8SA 4TRMA 3LLVA 4LGVA 4QEDA 3U9LA 4DYVA 2GYYA 1ISIA 3NTOA 5IJZA 2VYVA 5I7VA 2NU8A 2PD3A 4ALIA 4EITA 2OORA 4J2HA 3DBHB 1ZEJA 5I9NA 3P5SA 2PH5A 4FFRA 5EN4A 3VH1A 4CL8A 2HMSA 5DBIA 1PZFA 1WZEA 1H2HA 2P68A 3EMKA 3PIDA 4PVCA 2YFQA 5G0VA 1IULA 1F12A 3WIEA 2OO5A 2VYND 2YUTA 5GY7A 2AEJA 4AICA 3OIGA 3K8ZA 2VHYA 3UICA 3OJFA 1HLDA 3H4VA 2IE0A 3ZU5A 4IM7A 1LSUA 1DIGA 1ENZA 1Q0LA 4FB5A 3R0IA 4BO5A 4BO9A 3PJEA 4Q3NA 5A5FA 2PZJA 5L4NA 3QVXA 1YOVB 4WOJA 1WDMA 5L7WA 4A26A 2AG5A 1XSEA 1C0LA 2EW8A 3V1TC 4NU5A 4OJNA 1HXHA 1U3WA 2VNSA 1ZMTA 4N5NA 1LX6A 4E33A 3U4HA 3HFSA 2DT5A 1E1MA 2VT3A 3GT0A 4WEQA 4DLLA 1PZHA 2VUSA 3IC5A 3SC4A 3D7LA 1NNUA 3K92A 4ALNA 4TWRA 5A05A 2IZ1A 4DQXA 2VHWA 1T2FA 1B3RA 4FOOA 4DXHA 1YS4A 4MIOA 2DTDA 3IIEA 4GWKA 4ZN6A 4BKQA 4YJHA 4LVCA 2OBNA 3QSGA 1T4DA 1IY8A 3A1NA 5DULA 2OBYA 2VYVD 3QHAA 3B1KA 1L7EA 2VWHA 1DIBA 1LXCA 4N5LA 5THKA 3GGGA 3HB5X 3LQFA 5BQFA 2X58A 3PVZA 4RLSA 2FWMX 3P2YA 5CFZA 3OJOA 4D7AA 1WMAA 5HTOA 4PZDA 1ADGA 1U7TA 4I08A 4OXYA 2AXQA 3PJDA 2B69A 4ID9A 1ISMA 4RVGA 5MGBA 4HFMA 3B1FA 4GVLA 2RHRA 4LMRA 2Z5LA 3F9IA 3AM3A 1LEHA 1ORRA 1GU7A 5K6AA 3IUPA 5FF9A 2Q22A 2J5QA 2FPPA 5FFFA 4CMCA 4RF2A 5GZ3A 4EUEA 2Q45A 4RF3A 3RUHA 4DPLA 1PGPA 4RPJA 2VZ0A 1ZXLA 5H82A 1M76A 1EFLA 1DJQA 2UDPA 3L4BA 4PVDA 3H65A 3BAZA 3WGYA 5G0TA 3OMLA 5IN5A 1I01A 3JD1A 2PGDA 4ZQBA 1NAIA 1PWXA 2CDAA 4GH5A 1LSOA 3WLFA 4RLHA 3KRTA 1HDYA 3NDRA 4XX0A 2HMUA 5TIIA 1O5IA 3PLRA 1N5DA 3I9NA 1XCBA 1DFGA 4ZU3A 1I3KA 4IXWA 5HRUA 1MC4A 1J0XO 3B1JA 4IGEA 4QFDA 2F00A 2B4QA 1EBFA 3GEDA 4OSPA 1QYCA 4J4BA 3WYCA 1UJMA 3RVDA 3K5PA 3DQPA 1T4BA 1X7DA 3WOHA 4XDYA 3LC2O 1TA4A 3ICPA 1P1IA 3R1IA 2ZB3A 3A06A 3FI9A 3CPSA 1GEGA 2B36A 3JTMA 4I5GA 1R0KA 1PGNA 4YRDA 5JW6A 4F3YA 1E7WA 1UUFA 3PDJA 2Y1EA 1IL0A 3NX4A 4NJMB 2ZJ0A 3NV9A 1E7MA 1ZZEA 2IYOA 3GVHA 2ZB8A 4WCDA 3ROPA 3DBRA 5AXAA 2NU6A 4WCFB 1Y8QA 1DBVO 1I8TA 2DUUA 1XLTA 1DC6A 4FC6A 4MPDA 3E6AA 1GV0A 1NHWA 4J7CA 4BGUA 4PG4A 4RQUA 1O6ZA 1PJQA 1GD1O 1CYDA 2E4AA 4FPXA 4KUEA 4NFYA 2X22A 1IUKA 3VPXA 2NQ8A 2OUIA 3WWYA 1LQTA 4XB2A 1HE5A 3DC2A 5K9ZA 1N9GA 5I7FA 5BT9A 1DFIA 2Y99A 2QIOA 4EJMA 3LT4A 3F6YA 3QWBA 4RF4A 2J5KA 5JDIC 4KQWA 5A03A 1N7GA 1BXGB 5KTKA 1C1XB 1VJTA 4L74A 3E9MA 4J43A 1D4FA 4JX8A 1ZFNA 2TMDA 5JAQA 1F8GA 1P1HA 4HADA 1UZNA 1YQDA 3I4CA 4YT5A 4CLEA 4JJGA 3KYCB 3DXFA 2OP1A 4WE3A 4IDDA 4LRSB 4QO8A 5DOZA 3DZFA 2J3KA 3ITKA 4DMLA 4CLOA 2EF1A 3GY0A 2DBVO 3W4KA 4CL3A 1RYDA 1GQ2A 4EDFA 4E13A 1KEWA 6ADHA 3N7UA 4FC7A 4BGEA 3JQBC 4FJ1A 1VSVA 1H5QA 2YW9A 4UVGA 3W6ZA 4CMHA 5A02A 1OMOA 4INAA 5ITVA 1FDTA 3CMCO 5ADHA 2A94A 4RF5A 5KVQA 4IJUA 2IODA 1DC4A 2QHXA 4ZQHA 4OIMA 4JGBA 1ZJZA 5HWSA 2R6JA 1Y5MA 2EKLA 1YBVA 2A9FA 1NVGA 1PEDA 1UR5A 4OHUA 1NQOA 2GLXA 4B8WA 1IB6A 1A5ZA 4FGWA 1B3BA 3NT2A 1FJHA 5GMOA 5DN9A 3VKVA 1FXSA 3FNFA 4IIUA 5T57A 4LCJA 2X9NA 1QMGA 1V35A 3QLJA 4FN4A 2B4RO 4RGBA 2NWQA 1D1TA 2CNBA 3HNPA 3RSHA 4XIYA 2X0NA 2NTJA 2YV1A 1X0XA 2BFAA 3PJGA 2G0TA 3BMQB 2Y1FA 5IG2A 1HE3A 1E3IA 3CIFA 3JV7A 2NADA 2Z1MA 3ANLA 5G4LA 3FCOA 1EBUA 3JQ6A 3W8FA 2CSUA 3PHLA 1J6UA 3KEQA 3GK3A 1XELA 3GR6A 4DBZA 5IDXA 2O3SA 2D3TA 2AE1A 1E5LA 4EW6A 2W90A 4YJGB 2EKQA 3DWFA 1AGNA 5JXWA 4DUPA 4PCVA 4Z3KA 4BMNA 2IRWA 3C1OA 3X2EA 5KJCA 2CFCA 1GYPA 1WZIA 1AE1A 3UUWA 4K6FA 3SVTA 3TOXA 4PLCA 3KZVA 4WOKA 1PL6A 4NFSA 1FDWA 3AI1A 2JHGA 3QRWA 1QLHA 1AXEA 4Y6PA 3K9QO 3MWEB 3JCZA 3FF4A 1U5AA 5HS6A 3E5RA 4ND2A 3QVTA 4DTIA 2C29D 2HLPA 3I83A 1DSSG 4IPTA 1ZBQA 1U8XX 2ZYGA 5JCXA 3DMTA 1ONNA 4EI2A 3AI2A 2Q46A 3EZYA 3HN2A 4NK5A 1K6JA 3ETDA 1E1LA 2VNAA 1M6WA 2VWGA 3UGKA 4R5MA 3MJTA 4BNUA 1SMKA 4U0KA 4AJ1A 1LRKA 4B4WA 4DC1A 1Y8RB 4WASA 1U7HA 2X86A 5I9LA 2AE2A 1WLYA 4OO3A 3GGOA 1LRLA 3C7DB 3EW7A 2IEDA 3IS3A 3LVFO 1UZLA 3STHA 2W98A 3OECA 3ASUA 5A9RA 2C5EA 2DM6A 2AQKA 2OHXA 1H93A 1Q0HA 3AY3A 3ASVA 2BELA 3MWDB 3HSKA 2NLOA 1VJ0A 4XDZA 2DBRA 4QSMA 5BSEA 1NX6A 3K73O 2O4CA 2O7SA 3HZZA 3PI7A 1GR0A 1G0OA 3Q1LA 1FMCA 4DPKA 3M6IA 4C7KA 1Z75A 5DCYA 3AY7A 1E3SA 3V2GA 4CM9A 4Y67A 5JMPA 1P31A 2GPTA 4FFNA 3M1LA 3MJCA 4GQAA 1I32A 1SZJG 2FOIA 1IHYA 2HMVA 3X2FA 4DQVA 2HCTA 4BNFA 2CVZA 2V6GA 3HHPA 4P4NA 3DHYA 1I10A 1WWKA 3EYWA 1P0FA 4MP6A 2DPGA 1HEUA 3MEQA 3O8QA 2VUUA 3UCFA 5LCXA 1U3VA 2VZ9A 3UH1A 4G65A 5I7EA 3G0OA 2I3GA 1C14A 1N92A 2CVQA 2VCYA 2FP4A 4IQ8A 2FR8A 3PZBA 5HS4A 1R6DA 4A27A 3WGQA 3DAPA 2BFPA 2ZYAA 2DPHA 1WPQA 4J3FA 4P38A 1PS0A 2CDCA 2DU8A 4GX1A 3RD5A 1KVTA 2D0IA 4E0BA 1HSOA 4U0JA 3F46A 3GRKA 4M54A 2Y05A 3NJ4A 4U7WA 3RI3A 4BL5A 5A9SB 3I4FA 2DTEA 1LU9A 3JQ9A 4DVJA 1ISGA 2VZ8A 3KYDA 4JQCA 5U1PA 4CJXA 3QA9A 4NBUA 3ROQA 5KNLA 3D3WB 1BGVA 2Y66A 1GUZA 3AOGA 4JP2A 2BLLA 2OGUA 2D5CA 2PWZA 3DZKA 1Y6JA 3GPIA 4YR9A 5JMWA 3EC7A 1CDOA 4CMBA 1MC5A 4AG3A 5GZ6A 1EVJA 1YB1A 2GN8A 1M67A 2XPCA 2ZQZA 2VN8A 1KEPA 1TEHA 4Q3AA 4E6PA 1RM0A 4W9NA 3RBZA 3OF2A 4CR8A 4D79A 3PLNA 1B8VA 4RVDA 3TFOA 4FSHA 3QWHA 4XWYA 4YYZA 3CMMA 2A92A 3IKVA 2W2KB 3R3JA 4CM9D 2C5AA 2ZJ1A 4BO2A 4HFNA 2I3AA 5ENVA 3ETGA 2EP5A 4DMMA 1DC3A 1Z7EA 1BVUA 5EESA 1DAPA 3BZUA 1XGKA 1NHGA 3VAZA 2ZTLA 4OKNA 3OA0A 2NTVA 3Q2KA 1Y7TA 1HZZA 3ON5A 2G76A 4PLVA 4R68A 1UXHA 3K30A 1JU9A 4IDGA 5JCJA 3FPCA 2HDHA 4BOYA 4J16A 3E5MA 2JKVA 3OFSA 4HBGA 1U8FO 4R41A 3QWFA 4GLOA 5JYAA 1NFRA 2GO1A 4U6QA 2YHIA 3AJRA 1SB9A 4IJKA 4OM8A 5BR7A 2HSDA 4TROA 4DL9A 1P1JA 4A03A 4M55A 3FR7A 5F5NA 4LCEA 2Q2VA 5CP8A 2HJRA 5ER6A 3PYXA 4HFRA 4NQZA 1H2BA 4IMRA 4MVJF 3H9QA 3OQ6A 1PS9A 3TL3A 2UVDA 3VTFA 3JQAA 3LLSA 1MP0A 3ZWPA 4RPHA 5TNXA 1EUZA 2P9EA 2BRUA 3VH2A 5L4SA 3GOHA 4NZ9A 2EJVA 2J3IA 4LSMA 3DBHA 4IS2A 3JQ8A 1RWBA 3FBGA 1F06A 5F5LA 4Q3DA 1H9AA 1HYGA 3MJ4A 5F3RA 3U4CA 5EINA 2EG9A 1E1KA 4Z9YA 3NJ8A 5ENDA 1LDBA 2NVWA 3DR3A 3V1UA 3KV3O 4EZBA 5CG1A 1H6DA 4E2ZA 3E48A 2Y1OA 3RUEA 9LDTA 3EAGA 1H6BA 2W4QA 1NVTA 1O95A 4AJIA 3GMDA 3PK0A 3WQRA 4E5MA 4L75A 5G0WA 3ZN2A 1QYWA 3TOZA 2I6TA 3TJRA 3VDRA 4FBGA 2X5KO 1YOVA 3JYOA 3PRJA 3ENNA 2CVOA 1FDUA 5KOIA 1TT5B 2GERA 3WFJA 4B3JA 2R00C 5CDYA 4B7UA 1AN9A 4YQZA 1EK5A 3IDSA 4ESOA 3JYNA 1Q7BA 5JCJD 3MJEA 4J49A 1HZJA 3LDHA 4RVSA 4Q3EA 5U9CA 1A4IA 3ZNPA 2ZYDA 4BNZA 2AMFA 4ITUA 4CMJA 4S3MA 4R54A 3VPFA 2NUAA 4XCVA 4GL4A 2H5LA 4B4OA 3AOEC 4H15A 3L6EA 3NRCA 3EY4A 2XXJA 2BGMA 4AJJA 3Q9UA 1NXQA 3AU9A 3NT4A 3OIFA 2PV7A 1NWCA 2HMWA 4A73A 3OETA 1E6UA 1PZGA 2DQ4A 3HDHA 1IZ9A 5B12A 5JY1A 3DZGA 1MUUA 1ZK3A 2Y67A 3O03A 1GFSA 1X15A 3JQAD 5DZSA 1AHIA 2GN4A 3ONDA 1OOEA 3LT2A 3LT1A 4BO6A 3AFNA 4R1NA 4CM1A 5L95A 1HLPA 3GA0A 3L9WA 4E2WA 3ZV4A 4WNIA 3GG9A 5C7LO 1I5RA 3WGTA 4AJEA 5COAA 1XQ1A 4XKJA 4CLRB 4UUOA 5L53A 1HDRA 5JS6A 4BV8A 4A7PA 1R4MB 2C2YA 2Y1DA 3B20A 2VUTA 3QP9A 1KBZA 4TKLA 3NDIA 4PGFA 5TX7A 3O4RA 5C3MA 1F14A 3WWZA 2HKIA 3AW9A 2PTGA 4WJZA 4J9UE 4ZHSA 1KC3A 4TQGA 2AQ8A 2P4HX 4J6FA 4RPLA 5T5QA 3ZWMA 4E32A 4J2OA 3U62A 3WNVA 3QWAA 4PG7A 5G0SA 1KC1A 5JDCA 1I2BA 2BI7A 2B83A 4IMPA 2FY8A 4Y6RA 4LK3A 4B79A 4JN6B 5L7TA 4D41A 4D3FA 2PK3A 4G2NA 3G49A 2GCGA 5IZ4A 4TZTA 1I36A 4B3HA 4XB1A 4XIJA 4DC0A 4BO7A 3Q11A 2SCUA 2X9GA 5L4LA 3RC1A 4ZICA 5F1PA 3W6UA 4DIOA 2PNFA 3A9WA 3OA2A 3QJ5A 2RCYA 4OXKA 4BO8A 4CQLB 2IXBA 4YAKA 1O9BA 1CQIA 4B7CA 3IP1A 4XYBA 3GEMA 5JO0A 4HXYA 4CM4B 1RM3A 1LSSA 5JBIA 1O89A 3ORFA 5TT0A 1KVUA 1WNTA 2ZQYA 3VZSA 4BKOA 3AUUA 1TT7A 1XIVA 3DOOA 3TZHA 2D59A 1NBOA 2W2LA 4LVUA 4D0SA 4NJMA 2C07A 3H5NA 4CPDA 3TZQA 2FR0A 2X0IA 2X8LA 4RVHA 3PIIA 2AQHA 5DF1A 3BTUA 1N8KA 4RDHA 5T64A 1BDMA 5EPOA 3ZWWA 4MP8A 2VHXA 3HDJA 1V3VA 2YZ7A 4GKVA 1XWFA 1OI7A 4CODB 5IXYA 1VLLA 1LC0A 5T8KC 1P74A 1XEAA 3JYLA 4CM8B 2GNAA 1BRMA 1ISFA 5KJ1A 1F17A 2WD7B 3AI3A 1ZEMA 2XXBA 2BD0A 1YB5A 2W8ZA 2XAAA 2OMEA 4PLWA 3WBFA 4UVHA 1DXYA 2WM3A 4H16A 4NNJA 3MJSA 1JWBB 1N2SA 1ZK2A 2HRBA 2O50A 3FNEA 4CQMB 1W0CA 1BXGA 3WR5A 4JJIA 1C1XA 5U4QA 5JC1A
chains in the Genus database with same CATH superfamily
121PA 1JZQA 4FE4A 3KL2A 2RK3A 4KMOA 1C1DB 1D5WA 2QSYA 1VI6A 5JDCC 3E5HA 3FZNA 3CSDA 2X15A 3ACDA 5AI5A 2WT4A 3AVXA 2IEGA 2VS1A 3ZE2B 1JBKA 2QDXA 1OFGA 2XUJA 4PLYA 4DANA 1Y89A 2G04A 4GI1A 4O2LA 2AGVA 2P2YA 4GYWA 2W22A 3E22A 3O4JA 3ZBPA 3DOJA 2OUKA 3R5HA 2FH5B 2WIDA 1I0ZA 1DDIA 1QVVA 1ZO8A 3C3CA 3QVKA 2B2XA 3QIVA 3FZEA 5KOHA 2FPMA 4I3GA 3B70A 3WIOA 1ZM7A 2HWUA 3ICVA 4F4JA 3GLGB 4M98A 4BNVA 2QPAA 3MMXA 1GLGA 1KPIA 1X1EA 2X9VA 4L4ZA 1EESA 4OXNA 1EWRA 4WECA 4KO4S 4TWBA 2HNBA 1VRVA 2O2EA 4KGVA 3VBCA 3OTQA 5DHPA 2RAFA 2W2LD 3E35A 3A4LA 3EXHB 1N3LA 2BJWA 5KSPA 2BGIA 4LJAA 4QQRA 3P4UA 5BNZA 1R6AA 3M33A 1JE0A 3LBFA 4KJZA 4MUXA 4QGHA 5FRDA 2C0CA 1HDEA 1L5RA 1OD6A 3MSCA 4H7EA 2XZPA 5H7XA 5BMVF 1A97A 3QENA 4UFOA 1VECA 1CY8A 2CUKA 3AM5A 1ZI6A 4X5OA 3S1LA 3W1EA 1NLUA 5IPFA 1B1AA 4D8UA 3ZJTA 5COBA 4AWXA 3L82B 4MJXA 1EEHA 1LK7A 2ORWA 2RG7A 2QLMA 1MNAA 4TQUS 1US8A 5EP4A 2I4IA 3BH0A 4GO1A 4P3XA 3G2HA 5ES4B 1DADA 3V5NA 1M6HA 3VSAA 1KY5A 1XZJA 4XYMA 1KRXA 4DCGA 4EF6A 1X7ZA 4XX1A 3M34A 3KQLA 5LMNB 4R8KA 1KSFX 2K2WA 2FA9A 2HK6A 3UWDA 4D0NA 4YMUA 5JJ5A 4YP5A 1QU3A 2ORYA 3ZTWA 5DTMA 1HYHA 1TD9A 3K4QA 4K26A 3JQBA 1VIDA 4RJKA 4PICA 4QTYA 2XXAA 3MFQA 1IVYA 1QIIA 1W35A 3IXMA 4Y1EA 2JIOA 4Z6KA 2Z57A 1JS1X 5BN1A 1H05A 1UINA 1RVDA 1YR2A 3GLQA 2IX3A 4KRFA 3VI4B 1LSJA 1UXKA 4N76A 1OR8A 4LJSA 3HJAA 4PZPA 2BZGA 1PYOA 1OZ0A 3DOCA 1TUBA 3UVEA 4B32A 5AVTA 4RJTA 1M1NB 3PIRA 1OFTA 1OYWA 1OX4A 1G3RA 5IC4A 1EE1A 3EB9A 2JJ8A 1EAYA 1U0FA 2X6TA 1G8SA 2PL9A 3DXXA 2G1PA 3S81A 1U0SY 1E3QA 1U8AA 1VI2A 1LNZA 4KXUA 4NYIR 1N32B 1LB1B 4IJQA 1YCGA 3VC3A 4Q82A 4BKMA 3KU4A 4JT4A 2QUIA 5ADWA 3KE9A 2IHZA 2ZAOA 2IU3A 3DMDA 1EHCA 2C4NA 2CE2X 4QOEA 5EIBC 2FN3A 4QGSA 4AF8A 1BE0A 8ADHA 1TPZA 1ETUA 5KC9A 1E6MA 4KPFC 5EIOA 1GNVA 1S2OA 3B12A 1F9EA 3WSTA 2PZKA 4Y7CA 2R7NA 1EHIA 1KZHA 1UC5B 3JYQA 4XYGA 4XQEA 4AJNA 4PN3A 3E1GA 1XRLA 1HF3A 3EP5B 3V8QA 4RQTA 3BGDA 4EW1A 4HVCA 1IPHA 2D1TA 2DKFA 3R7SA 4K9PA 3UT5B 2OV4A 3NV7A 3SQOA 4DT1B 3SEQA 4LI3X 3DF9A 4Y2GA 5AKGA 2O48X 2F3QA 4EFNA 1Y8RA 3MIZA 4L6AA 4B2PA 4XAQA 2WUGA 4Q3KA 4PSDA 4ZTUB 4QTUB 2B35A 2HSZA 4TV8A 3MGGA 1YZ3A 2IYZA 1VB3A 2JCVA 4YUWA 2PQMA 3MBKA 5C5CA 3N8HA 5KS2A 1TO2E 1G291 2PZMA 2J30A 2WT9A 4MDHA 4PIPA 1XWIA 2GQ0A 3L4EA 5CM9C 4BMSA 4HK4A 1OHHA 4C06A 4TKUA 4ZT7A 3KVOA 5CDSA 3R0XA 4Z9XA 1GADO 1Q1GA 2D8AA 2JAHA 1YJXA 4PC2A 3CZPA 4HAXA 1L7RA 4QJ5A 4QLOA 3DP7A 4CKBA 2G5CA 2BMDA 5F9HA 4L4YA 4QOFA 1FVXA 1YA4A 3U7QA 2C2XA 5LNK6 1PJCA 4LNUB 1CEQA 3SOZA 2BGUA 5IAAA 3PGMA 1QV7A 1GPDG 2ERCA 2OQRA 2QL7A 3PWKA 2VDRB 3DDHA 3KB2A 2IP4A 3KOOA 3SYKA 2WM8A 4QOIA 1UZMA 3VV3A 5L3VA 5BVHB 3OFKA 4NQRA 3O3CA 2D5IA 3N76A 2CFRA 2AG6A 2OCYC 2VEOA 3EIXA 4IVPA 5CYOA 3TLBA 4ZIRA 3INNA 4PG8A 4KO2S 4M0FA 5IBPA 1PR0A 3TPCA 5K45A 1B0AA 1I3MA 3BWCA 1WXXA 4MVWA 5CEFA 2QRZA 3KCNA 2NXNA 3MBIA 5TQ2A 3RUFA 5J2UA 3LTNC 2Q49A 1SA0B 2XRMA 1EDOA 4YP9A 5IJ9B 3HA7A 1J7JA 2X9LA 4MOWA 4ND1A 4OQYA 4Y2XA 1E0KA 3HCPA 2JZOA 4TYNA 4JJ8A 1XG5A 4LDZA 2VJNA 4ZI7B 1D2NA 1LZLA 2HK9A 2JLBA 2RGDA 1JG2A 4LY6A 3PQ6A 3PYLA 5B37A 2I66A 4DNPA 5JD6A 2ZXFA 4XVUA 5U4XA 3SR4A 4DKXA 1VMAA 3I05A 4FD2A 3GGJA 621PA 2RGNC 1DIAA 4FE7A 4YCBA 3TQSA 4OGWA 3RVJA 5A2GA 4UE2A 4EHNA 2I78A 1EE9A 2AFHB 3BBLA 3C2QA 3BTSA 1RCUA 2CKDA 3FBTA 3FVTA 3CLUC 4YAOA 4BNGA 2V6BA 1BEEA 4GICA 2J9FB 2AC2A 4I5IA 5IJ0B 3PJRA 3T7JA 1EQAA 3N8NA 3DCJA 1TVKA 2DUWA 2ZREA 4MW9A 4LG1A 4BZXA 1E2KA 5DRYA 2V4UA 2QE7A 2YZ2A 2ANBA 2BHLA 2IP1A 3H9CA 4D8TA 3GXOA 4JVMA 3T0FA 3ICCA 1IN5A 5A9SA 1XAJA 4BPRA 3C85A 4IKOA 5E7QA 1OBOA 2J6HA 3T5MA 4PAWA 1OHHD 4QUGA 1ZBDA 3D3WA 4WKGA 4YQFA 3A6DA 1SCIA 1EUDB 3K32A 1G5PA 3KOWA 1Q7TA 4UKDA 5BPFA 2VYQA 4D0RA 2BR3A 3KLNA 2ZRPA 3UWKA 5GZ1A 1EDEA 2QN7A 1E3LA 4X44A 5MN5A 2EKZA 4BBZA 4MPTA 1R9GA 3L0YA 3ITDA 5B3LA 1WE2A 4EY7A 5B7NA 2C54A 2DKOA 2EW2A 3NG1A 1RPAA 1WU8A 1UK7A 2JAOA 2PSDA 4HLUC 1QK3A 5CH5A 1ZIXA 3H13A 4EB8A 4ZK6A 4YWJA 3C6YA 2HV9A 3NM6B 5ALRA 2W37A 5JLAA 2W2KA 3B6MA 3QNUA 2ZT7A 3L6DA 4XA8A 4AMYA 1E0SA 1OLUB 2VQFB 4EHJA 1WY7A 2EQBA 5CJPA 5H83A 1L5HA 1KKLA 4J29A 3U9TA 2PUFA 2JBAB 3DHEA 1GPNA 2W6ZA 2XZDA 4J7AA 3KDAA 1FRZA 2XYGA 2JFQA 3P4YA 4HKTA 2EARA 1XZEA 2DFTA 2OXRA 4ZKEA 3ZKAA 1CUIA 4A8PA 4H7JA 2W11A 3C74A 2FPUA 1UK9A 3EC1A 5PNTA 5KX5B 1Z5UA 1YFLA 4OH7A 1GG2A 2GK6A 1TF2A 3SZMA 2R1VA 2ZJ7A 4O2BB 4U2KA 1WTAA 2YMQA 4YJFB 5G53C 3CCBA 4NBRA 4OATA 4JX9A 4FU0A 4ZPXA 1CVLA 3LPCA 3WGLA 4IYRA 3OQVA 4QYWA 4HQLA 3SHQA 1Z7YA 4CKZA 1CETA 2NV6A 4JUDX 1R3DA 3BTOA 3DLCA 4PG5A 4DJ5X 1HQDA 2XWJI 3PNOA 2ZXUA 4HMPA 1G6KA 3W4IA 4EYQA 1EJ6A 5J1TB 3KJZA 3LK6A 4FILA 3UF0A 2QE7D 3FJYA 4MYDA 2XZTA 4P31A 1BE6A 1DEHA 3H8WA 5G4KB 1E5XA 2P2GA 1K4MA 3MS7A 2GKOA 2ZVQX 5FOSA 4A5OA 3INGA 4MKGA 2E49A 5D8DA 3STUA 4C4SA 4NPCA 2B37A 3R7WB 3MWLA 1PVOA 2GD6A 2FI1A 1X3SA 2YIJA 2EHDA 3KC2A 1ZH2A 2H1CA 3O82A 4RW0A 5TS3A 4KREA 2EP7A 2BGKA 1PZNA 3RS9A 2WTBA 2ACKA 2J4CA 2XHEA 3MT9A 4N3NA 5AUQA 2HQOA 3FPKA 3SJ7A 1QG6A 1OJ7A 3W2GA 1DRKA 2BKUA 4AVYA 3RG2A 3UJNA 1GPAA 3OPXA 4S04A 2C4KA 3LIPA 3UXYA 2G77B 4HVAA 5CB4F 3F5QA 3HFGA 5TDHA 4Q9IA 5C46F 3GP8A 3QVVA 3EVFA 4M8IA 2PMBA 3MXOA 2I1LA 3IQGX 1U0NA 4FX5A 3VPCA 3PR2B 4IHJB 1J0CA 3HZRA 4ND5A 1RM4A 1PCXA 4KYTA 2X2PA 4W99A 4YASA 3TVTA 1T6ZA 5CIQA 5LBIA 1UQUA 4EMUA 1XVLA 3CXUA 1FW6A 4J9VA 2BFDB 4ABYA 1SKYE 1DLIA 1IYZA 1J9GA 1YQTA 4IQFA 3PPVA 1MJGM 3T7TA 3PCRB 4IDNA 2KI5A 2NVOA 4Y2UA 3E23A 1XZPA 1TT5A 4M8NE 3ZZNA 1BMDA 2NO4A 2PZ8A 3RYIA 2I7CA 3KPJA 1EX6A 1PX0A 1TM2A 2X14A 2XE8A 5C1IA 3CZMA 4NE7A 1WW8A 2JHFA 3G5AA 4QYIB 1GSOA 3LYUA 1BDBA 4NAUA 4L5BA 2O07A 2VXYA 1HNXB 3G7UA 4I55B 4UHFA 5JJBA 1W36B 1QRTA 3BHNA 1EDBA 3M6XA 4KQKA 3RTGA 1Z3IX 3LPMA 3PC8C 3FCAA 1A27A 1VPEA 4FCCA 4UREA 1AGYA 3VKHA 3O1HB 1XPUA 4A3SA 1R10A 2YJ6A 3ONFA 3N5KA 1E18A 3EA4A 3H11A 3BD9A 4GT1A 4US0R 1ZI9A 2AEEA 2PGNA 3BJEA 3SF0A 4PEVA 1GUFA 3UC5A 4E5DA 4KWIA 3LCCA 1WL8A 4L8WB 4CG1A 1C3LA 4D45A 4BY9E 1EIZA 2CWDA 3THXA 3VH3A 5G41A 1LF0A 4YV1A 4HWTA 3RFUA 421PA 2B4YA 3PXXA 3DV0B 2C99A 1L3CA 2P2ZA 3QELA 3CE6A 4WNAB 4D42A 2UYGA 1QOPB 2VRWA 5HR5A 3EP6B 2XQFA 4DDHA 5IFLA 1M74A 2C04A 2FOLA 3E7FA 3QA3E 3AGQA 4RA6A 1YOBA 2ECPA 4M0KA 4NONA 5JVDF 3E0XA 5DWVA 4MX8A 4NV0A 2WZBA 4QFBA 1RHJA 1KEVA 3EPPA 1SC9A 1IB0A 2JFFA 4C2AA 2R00A 1QRUA 3U4GA 5BQ3A 1VKJA 3EZ7A 4IVNA 4KIGA 2GK3A 2VDOB 1SUBA 2FPIB 3ZNOA 4HS4A 2G1KA 3AUAA 4QREA 2TMGA 5FD8A 2GN2A 4JB8A 2R7AA 3VHRA 5DGXA 1A9SA 1G9XA 1EFVA 2EU8A 3LFTA 4FHDA 4JBWA 3UA4A 3OJLA 4FDTA 1FTQA 4JXJA 2HJSA 2YY7A 1HE1C 4G0OA 4HDRA 4HQRA 4DQDA 2B7BA 3WSVA 4EA9A 4DM7A 5JAZA 3JVUA 1S2DA 1R27A 3BGOS 1NW3A 3H0VB 1JSZA 1EK0A 4MUNA 3CV3A 4TXNA 5I7HA 3Q2OA 3O74A 4GW3A 2WJAA 1P4JA 1Z34A 4KMSA 4MJ7A 1L7DA 1CHNA 3PXBA 1JVSA 4BIMA 3DFFA 1YC2A 5LYYA 4HRAA 4BQPA 3QFFA 2H57A 1CUEA 2HT1A 4BNYA 4H1WA 3QXSA 3ZEIA 4ZJUA 1T9CA 3EQZA 4EPTA 4OTZA 1GGJA 4UFPA 1EFRA 3AU8A 3WYBA 1EGAA 3VOAA 2WF9A 1KGSA 3UHOA 1ULSA 2ENWA 2QRKA 4HNSA 5HQ3A 3EP7B 1DPGA 3CEAA 2R5NA 3TDKA 4PGMA 4J0FA 3PJFA 5CAEB 3R7FA 3BQMB 5DNEA 1TJYA 3GUVA 4KP7A 2AEMA 2W6PA 3T61A 4ZDWA 4BVJA 1PU2A 3B9RA 3SWWA 1JLLA 1SVSA 4PGAA 2FMUA 3O8BA 5JISA 4XQ0A 1UXGA 1M1UA 2WTMA 4ZC8A 4KOAA 3T1QA 2W2TA 5L3QB 4HNUA 1QJCA 3KLBA 4JU8A 3DZ4B 2FK8A 2BBOA 4ERNA 2WJYA 3UAGA 3I39X 5COQA 4TVOA 2QR2A 1XZCA 3TIFA 4P7BA 4Q93A 3DKVA 2VDVE 3UMYA 3UBTA 3ESXA 4R4JA 1E79D 3SZ3A 1GXSA 3G8YA 4RVNA 1YTLA 3SJBA 1RYFA 1XCMA 5ITWA 1G2OA 2Z2KA 3L7AA 3QUCA 5DISB 2GFIA 4A0SA 1K75A 1C9DB 2DBZA 3IURA 4HUJA 4Y7DA 5FTWA 3WLPA 3W4JA 3JWGA 4KAJA 3AY0A 2JAXA 3D8RA 3ZV6A 5JALA 3PICA 2E87A 2GZDA 4DMFA 2PRIA 1T4GA 4XJXA 3C4JA 3ZJUA 1Z26A 2V9CA 2WMDA 3ABSB 3KHKA 4NYJR 5TVKA 3DKRA 4DS3A 3PCXA 1NI3A 2ZETA 5DT2A 5JTUA 4F8JA 5B36A 4BKUA 1F8UA 2WJVA 4PX3A 1ECBA 2CNLA 5CT6A 3E3OA 4FNOA 4AWAA 4N18A 2F1KA 4KJXA 1XO1A 2P6MA 3A36A 5D3MA 4I46A 2I5PO 1TEVA 2R751 3U39A 2DB3A 4O1MA 4D98A 2L18A 4HX9A 3SJZA 3OZBA 3UQYS 5FNZA 4ZVKA 3FZQA 3IUJA 2GILA 2Y76A 2I65A 3IT0A 4HDKA 5HFAA 3WGNA 3U60B 3IJRA 3ESCA 1YACA 4ZVQA 1Z33A 3IH5A 4OHZA 5B1YA 1VHLA 3ZI0A 1KZGB 1JNXX 2FEOA 1JHXA 2C42A 1AY0A 1HT1E 1NQWA 2HCFA 2LPMA 3HVHA 3JAWB 3MJVA 1M2OB 3NBXX 4H6WA 4TKVB 5F21A 4YDQA 3T5PA 2CLCX 2PGJA 3T7CA 4YAGA 4W63A 3ZV7A 4EJSA 5AM4A 2B3TA 5A4IS 3BS4A 2XDAA 2GPYA 2QTAA 1YZHA 3I9MA 1UK6A 3NFYA 1H0RA 1TGVA 2LP4Y 2W42A 3FRHA 2WJJA 4LOIA 2OLKA 3BTVA 4UMVA 4G0MA 4PLHA 3ZH9B 3Q4GA 3S2GA 1KMHB 3D8HA 4HAOA 2RJ3A 4NECA 2YXBA 3DBOB 4MWBA 4CM7A 4QM7A 2X9QA 3ZWYA 2D06A 4L5CA 2OV6A 4O5OA 5LYJB 1FY2A 4C6RA 1P60A 2RH5A 1R50A 1CKEA 4UZSA 4IDOA 2YJTD 4O25A 3VZRA 1TJ5A 3E3MA 5TPZA 1SCKA 1DDGA 4Q34A 4URFA 5I4BA 2A8YA 2NVUB 2CV1A 2ISQA 1OPRA 3RVQA 1KO7A 2D8MA 4KTTE 3IBCA 5F64A 5H5JA 1QGUB 3RSOA 4DA6A 1T8PA 1AUOA 2WWWA 4HWSA 4XJTA 4GMGA 5FQOA 1LGYA 4O63O 3RBVA 3DLTA 3QFRA 2O8BB 2BFFB 3NS7A 3AIKA 3EJWA 3NM4A 5EXXA 5GV8A 1XRJA 1P2DA 4R9RA 1ULAA 2Q1XA 4JDPA 5AICA 1TJPB 4KIFA 2FZLA 5IYZB 1T1IA 1Z7BA 2P3SA 4G6ZA 4GC5A 1T5DX 1RT9A 4FDUA 3ZI4A 3EBLA 1TQ8A 4G5QA 3X43A 2G1UA 4C7XA 2ZWIA 2PGIA 3NPAA 3DTNA 1KDOA 2XBUA 2ZDQA 3LECA 4I4TA 1NW9B 1BYUA 1XU4A 4WXHA 2ZVDA 1ZD9A 1IJEA 3NZEA 6GPBA 2GMWA 3H3XA 2Q1SA 4G25A 2P69A 4GOMD 3R7LA 2BEVA 1G5HA 4IQGA 5DYNA 1BVRA 3TNJA 4C0KA 5CDGA 3NYRA 1CNMA 2PZAA 4WKPA 2VTBB 3VOBA 4YHBA 1K8YB 4YJ3A 2BMAA 1JSCA 2GGSA 4Z53A 1KOJA 3SLRA 1DINA 2ZAYA 4FLEA 2RHJA 2CXHA 4BGIA 1K63A 4JYCA 4K9KA 1FFXB 2ZYWX 1APBA 2FG5A 1GZHB 2CJFA 2IHBA 3PFKA 4X24A 4G26A 3SR3A 5K99A 2MIIA 3I42A 3QLEA 3PGJA 3H04A 5BSWA 1RAIA 1LVHA 1J07A 3N9IA 5JPCA 4MINA 1GUAA 4K6GA 1XDWA 3FE2A 2HXSA 4KEAA 1EYZA 3PUWA 3LPDA 2PXAA 4M49A 2WWRA 1TB4A 3DFUA 2HO5A 1FX0B 1N2CB 2YJNA 4IILA 4CEHB 2EHJA 2J08A 3TWOA 5L45A 3TUIC 2W9XA 2OZLA 4UQOA 3PQVA 5TPZD 4KXWA 4NI5A 4HN2A 4GLFA 4RCZA 5BMVA 5BSGA 5IT9A 3H17A 3OIDA 4MVJH 3I9V1 3P19A 1ECLA 1SXJC 4G9BA 5KKAA 3RADC 5C0OE 2DZDA 2WTXA 4EY3A 4XWWA 3M6VA 5EYPA 1WSDA 3RVMA 4XVCA 4EF5A 3B6KA 4CFZA 5THXA 3Q41A 3I73A 4EB3A 4DB4A 3Q87B 4UJ5A 1GFIA 2NSDA 3AVTA 1ZVMA 5D6OA 1JJVA 1XTPA 2F6RA 2GRUA 2RKBA 3ZEAA 5B2FA 2C5LA 2J6CA 3IBGA 4B09A 4QYXA 4ALMA 4RO0A 4ZDIA 1YCHA 2PUJA 3LK7A 4ZRNA 2JLRA 5AQEA 3SMQA 5IEJA 1DUIA 1RLTA 2JLUA 3FNRA 1RTTA 3GRAA 2I76A 1K97A 1YQXA 4ZCLA 2HQ1A 1K7XB 3OM8A 3TCKA 5BR8B 4M99A 3ZCRA 1D07A 3ZVLA 2IV7A 2GN6A 2BFNA 3I6QA 4ARCA 4RTJA 2UYHA 3KAKA 3SD7A 3IQIX 4Z3OA 3ILSA 3SJAA 4B6SA 3JD4A 1Z2OX 2IHTA 3G17A 2IPXA 1WVMA 3QE3A 2C20A 3V3KA 4O4IF 1PFWA 3DS8A 2C5BA 3HKEA 1W85A 2ZS7A 4LDRA 2OMKA 1K3TA 1LUAA 2IYRA 3LYHA 4AZWA 1K92A 2H4ZA 1P19A 2ZCVA 4WBXC 3SBXA 4YV2A 3ZCQA 2HGZA 4FEAA 1X2BA 3U80A 2OILA 2PGXA 1F6BA 3T5TA 3QUBA 5IAJA 3ZHBA 4HUTA 3SC6A 1IAVA 4LJ4A 2B20A 2P2LA 3QI2A 4IXTA 1O08A 1W25A 2HMTA 4GLLA 3L7KA 4NMMA 3TINA 2X23A 3KV1A 1BKSB 1JIVA 3F7NA 3PQDA 5ALSA 4BATA 3KQUA 5FOUA 2F8SA 3O38A 4CV0A 3RFXA 1UDBA 5BWMA 2JVJA 2EQAA 4JASB 5IAOA 3BMCB 4RQBA 2XDQA 4C0JA 4F5EA 4GAEA 3AL0C 3GUHA 5M2QA 5L40A 1U0GA 3R20A 1YDEA 3TRIA 3WQSB 1E64A 3L01A 2CLOB 4D46A 5BSFA 3UJ6A 4F93B 1XA0A 2GBGA 3FD8A 2YQ5A 2ZJYA 5DASA 2OQIA 4S1NA 4YFVA 4HDSB 5LBUA 1L1FA 5AVYA 4UZFA 3E58A 3U16A 3KQYA 4ZOCA 3CWZA 4ZZIA 2C1XA 2HF9A 4E03A 2AR0A 4WESB 2XNJA 3O0TA 4FMCB 1V7QA 4GI2A 3ST7A 2DQSA 2P3QA 1EFAA 2V4ZA 2ZRQA 3KUDA 4IJWA 2PUBA 1E2QA 3EBPA 1QVRA 2WVJA 3B8HA 4Q4HB 4YJ2B 4EPWA 1M54A 2RGYA 1E3WA 5JS8A 1F8FA 1FP4A 1UOQA 2H4XA 1YA6A 4Y0AA 3VV2A 1E6WA 3VU1A 3B48A 3V9AA 1AM4D 1SIOA 3JD3A 3B1XA 3BM5A 3VKWA 3B3AA 2TECE 3F74A 4G5RA 3HO1A 2P2NA 1FA9A 2NU8B 2BV3A 1LRJA 1BCSB 1CY2A 4P36A 1GO2A 3ANSA 1GZ5A 3NORA 2EDAA 4PLGA 4IV5A 4XM0A 2R6R1 4ZKDA 5K0GA 2HF8A 2R2GA 4HNGA 3KHTA 4BO0A 4URXR 4IV8A 3T9AA 1YBMA 2ONCA 3WMEA 3GC6A 4MGYR 3HGMA 4OFZA 4FNMA 1I4WA 1R5JA 4HRYA 2SKCA 4M7OA 4O33A 1Z08A 4URYR 4F1JA 2ID9A 5HOQA 2P62A 4QXQA 2IEZA 1RVV1 1XKQA 3A2LA 2VJLA 3EG5A 3NNNA 4FCTA 4ZI7F 1C3OA 2I0FA 3RU7A 3AH8A 4IIHA 3W5AA 4IDAA 5L8VA 4KO8A 1NNEA 3NOQA 2O59A 1J5PA 5KPJA 2FRVA 3OKAA 1BDHA 4JI8B 1LC3A 3H6KA 5I9MA 3SX0A 1ZKDA 1UT6A 4OOFA 4WSOA 2XUPA 5EHGA 1OXTA 2EJWA 4JHLA 3VTZA 1P6QA 1MX1A 2C2GA 2KPOA 3E8SA 4WY5A 1DU4A 1JSXA 2ZBRA 3VGPA 2BI4A 2ZS8A 4H4EA 4U7GA 4GZ5A 1IZZA 2RHCA 3DPSA 2BEJA 4IJVA 5D1NA 1OWNA 1IWPB 2HW8A 3KYJB 5D7BA 3HBJA 3CPEA 3JQFA 5GP1A 4I50B 3UUEA 1Y37A 3C6MA 3AFIA 4BN0A 2P1RA 4J7UA 2AIRA 1BE1A 1N6NA 4R2MA 2CXRA 3F9CA 1GNRA 3MS2A 3QEJA 4MXDA 1Z8DA 2YVUA 2BF7A 3REOA 1Q0PA 1UJ5A 4FFPA 4QPNA 1VKOA 1T36A 3BX1A 3GZNA 4LJKA 5HQJA 1LDNA 1RYHA 3L4BC 4C08A 4O59O 4ARAA 1U2RA 5KHOC 5JNSA 1PJSA 1CF9A 4D9JA 1L8XA 1ZN2A 3I9KA 3OOJA 2WOOA 3S5UA 3F73A 5G0UA 1MN6A 1NX9A 2OO7A 2PMWB 5F9MA 1L5KA 4CMKA 2R8ZA 3HVIA 2BFOA 3P45A 4QNMA 5FWNA 3CR8A 1V5IA 5FPKA 3G6WA 4GM0A 4L28A 4LBWA 1JTEA 4P92A 4IIVA 4WK0B 4NAVA 3TIIA 4DRXB 4S1OA 3S1AB 4U5XA 3WRYA 5KYVA 4LEIA 1P9LA 1FFWA 4AQDA 4BN5A 3DFMA 4TV9B 2RI6A 4HTAA 4LJ9A 3GDOA 5DTRA 4I9HA 1E0DA 4KB5A 4POAA 3BUSA 4PHCA 5A3JA 1TLTA 1IUOA 4NSNA 1N6LA 3TXYA 5HBRA 4EHBA 1ZH0A 1RP1A 3FMOB 1G5RA 3UB4A 1I14A 3STVA 3WWDA 1N5JA 2G5PA 4ZCIA 3NWBA 4GD3Q 4I9FA 1VBFA 3DD5A 1SC4A 3H3JA 5K3CA 3VZDA 4F45A 5TMPA 3UJBA 3KZMA 4M88A 3C8UA 4D82A 1FMTA 3P5BA 3HADA 2FPPB 4RK4A 4QBKA 3CEMA 3HU3A 1YJQA 5KX5F 4U2EA 1VIAA 4OAPA 4HQFA 4KW7A 3TX2A 2IPLA 4OLHA 1U1EA 3GJ7A 3EOZA 4BC1A 3F6BX 3NJRA 3TAHA 1KI2A 3D4NA 3IELA 3SHOA 2QAJA 3KZ1E 3T7AA 5TQJA 1RLOA 3BRWA 2PMKA 1DIRA 2FSSA 3H9BA 3Q3HA 4WV3A 4E4YA 2XYRA 3GQVA 4OQLA 1GTG1 5LDHA 3PRYA 4YFYA 1SD2A 2Q1UA 5JAIA 2OHGA 3C7CB 3D0KA 2PLRA 3OTOB 3HNOA 3HRKA 4CR6A 2PN1A 1PR6A 1XKTA 4UUPA 3KFXA 4DLRA 1JHDA 3UW1A 4TL6A 1ZL2A 3A6KA 4B3GA 1T5LA 2J3EA 5M6DA 4LIPD 3SCZA 1YRQA 1SUIA 2PJUA 4U7HA 4AZ0B 4C6TA 3CZRA 1GPWB 2QRVB 3H1PA 1A9TA 3IPYA 4KN6A 4LXYA 4ND7A 4PF1A 4Q7MB 5AHOA 4OHMA 1CUZA 3IMFA 3S55A 5K20A 2HD4A 4EPYA 3RJ9A 2PYZA 4W1RA 1QV6A 1SEVA 4RELA 5EVJA 4ZU6X 2H1SA 2PUVA 3ELUA 2R7KA 4RJLA 3T54A 1G4UR 4IHJF 1ULUA 1Z5ZA 2GXUA 1DKNA 2PSEA 2RGAA 2R5WA 2BAGA 3EPKA 4RSGA 5K0JA 2WIGA 1RWNA 2EKDA 2GYUA 3T06B 1ORVA 2HSEA 1NNLA 3ZDEA 2FCRA 3CE9A 4DJJA 1C3EA 2NT4A 2QTLA 1NOJA 2NU6B 1Z6ZA 2V65A 4O3MA 3I0ZA 1P1FA 3G9ZA 1RE0A 2ZRKA 5IAKA 4C88A 4O1HA 4XSVA 4CMEA 2WINI 3E1KA 3OZFA 1C0PA 5HHTA 1PQ4A 1W4CA 1NTOA 3GBSA 2N9UA 4U8HA 2AK2A 1ZUNB 4I55F 4PFSA 3IMKA 1A9ZA 4UXIA 4KSCA 3RNLA 3N0RA 2GF2A 2HQBA 1UCFA 3RWBA 1YF3A 3W0LB 4IS3A 3PKIA 4EGJA 4P34A 5AW8A 4MV6A 2Y68A 4G8BA 5TR9A 5T6MA 1TPYA 1A9XB 4XD2A 3BRWD 4Q6WA 1YJ8A 3FHCB 1SHKA 3ZDAA 1IM5A 2PYDA 5AKJA 2ZTVA 3DMNA 3W5BA 3ZDCA 4MCHA 3B13B 4DY6A 1ZQ1A 1SU7A 1VL1A 2HEIA 2OHJA 1TCCA 4G8DA 2ZSFA 1KQPA 5IF3A 2FX5A 3R9XA 4M87A 3HA5A 2A4KA 1O6BA 3QE2A 4IJ5A 4V1CB 1Z28A 2Q3LA 3KVNA 1GPUA 1QUFA 4Y2RA 4BNTA 5JFGA 3ETNA 2QRPA 2Y6UA 3QE4A 1Z5VA 4TRNA 4UQPA 5LQKA 4WKOA 5FUMA 2WZDA 4ASUA 4MRAA 4FMPA 4MQ6A 4LISA 4MKZA 4HSEA 1MB4A 4KNWA 3W34A 1GKLA 1TM3E 3WIBA 3I1JA 3M4NA 2CZCA 4FD3A 5ALHA 3RYHA 2VF5X 5JVDA 3GN2A 1IG0A 1E2LA 2R8RA 3I2HA 3RT7A 3OC6A 3S28A 1H4QA 3RIXA 4JA0A 3IEKA 3N2KA 1JA1A 1GGEA 1YS9A 2JDID 2QQ5A 3EXFB 3UTDA 1ZLYA 3NBFA 1GEEA 4M7WA 1PUXA 4X84A 4DLZA 2P5TB 1JKJB 1WZUA 5EXPA 5FCDA 1P77A 6REQB 3MXTA 2FRXA 4B6FA 4PSAA 3O9MA 4ZHQB 1E1QA 3TNDA 2FX2A 4GE3A 1QQ7A 3QK7A 1KI3A 3EZLA 5EC8A 3IFSA 2ZUDA 2GWRA 1KEEA 4TYWA 3ZQUA 4NK4A 5BXQC 5CNKA 2FPGA 2WD8A 3GRRA 2XSZA 2EKPA 2BFCB 4F4HA 3AHFA 2B8NA 5BR1A 1H6CA 4AZ3A 2Q2OA 1JHPA 1U2DA 3BA6A 4K40A 3EGVA 3A11A 2C94A 3HRIA 1VKNA 3GEGA 3MQ4A 2A9JA 1MV5A 1OASA 4KXXA 5AKLA 2PLWA 3AP3A 4BV9A 4LTNA 2HRQA 2E5LB 3VTKA 3QFTA 1GYQA 3EXEA 1AD2A 4HWGA 3HJBA 4DA7A 1ELOA 1M72A 2ODAA 3CT6A 4WLVA 5L3ZA 3UT6A 3KAQA 1BWSA 2FN7A 2P9QA 4CIXA 2FUG6 2H06A 1HSZA 3ZQ6A 4Q4CA 4XTRA 4RV9A 1BOOA 3E9RA 5F33A 5JLJA 2A9VA 2AC4A 2O5EA 3PQFA 4JKIA 4GX5A 1H23A 1S01A 1SO8A 3N2EA 2IZ0A 3PHJA 4KQJA 4WNYA 3HKDA 5DYGA 4H0CA 5K3OA 4YYEA 1NOIA 3X1DA 1V6AA 1PNTA 5DM4A 2IEYA 1PGJA 1EQ2A 1NM5A 1T1RA 3GN1A 4HEA1 2POQX 4Q9HA 1MH1A 2FEMA 1C50A 4HX5A 2AW3A 2E2WA 2XBMA 1H2YA 1XR3A 2B8WA 3V8MA 4ASUD 5LIPA 1F4VA 1JEOA 3M5PA 1T9AA 4R1TA 5HDQA 4GMKA 4QASA 3WL4A 4JBIA 3RC7A 2Q1YA 2VP5A 3M89A 2R25B 1XLWA 3PNMA 3UOAB 1K8ZB 1X7YB 1YGYA 1CLEA 1IXZA 4E5KA 2WQZA 2PUCA 3G2MA 4PX5A 4HYEA 1X38A 4NPHA 4RXMA 3PPXA 1UEXC 2DHDA 1P2BA 4ALKA 4D9GA 2XUIA 3AUFA 2QX7A 1QSGA 3ZBTA 2VDWA 4JJZA 2GASA 2HNKA 1M83A 2I6UA 1GPJA 4KE6A 4OYLA 4RH0A 4XJSA 1OXVA 1V2HE 3WAGA 3OSUA 3H2BA 1UDAA 1FU4A 2P91A 1YQGA 4YCDA 3A25A 4WA8A 3WGMA 4IIXA 1F20A 1SVOA 4KDCA 4PZCA 4QNRA 3KSAC 1ADCA 2EZTA 3L6RA 2WWGA 2C4VA 2XSZD 4Z0PA 3CXRA 4COOA 1RNLA 1KYTA 5AM5A 1A7JA 2IHUA 2C5GA 2QMQA 5K7SA 1Q7EA 2QRQA 5LZ8A 2VOJA 2PKXA 1IVSA 1KMQA 1TECE 3AFOA 4KXLA 3EVTA 5IHXA 4I1IA 3TTYA 4HB2A 2V0GA 4B9AA 4OHWA 4QL3A 2KX7A 1EWYA 2PBZA 2N75A 1FTYA 2QTWB 2ZJ3A 4UBNA 3FPJA 4YI3A 1XHEA 5LQJA 1AKWA 1D2AA 3BF8A 2XUHA 3GZ4A 4NICA 2I3ZA 3AKYA 4HPWA 1A5BB 3L5OA 3KJEA 1SCUA 3DVAA 3MCVA 4I4CA 4AN0A 5HZKA 5HPYB 2ZIXB 3WGJA 5HJ5A 1UKYA 1Y6QA 5JZOA 4OSOA 3TQFA 3ZHQA 4DRZA 2WMNB 2X4IA 4NZNA 4EA6A 3SYRA 4CM4A 2CEAA 2P5YA 2AYZA 3C48A 4TT8A 4ZVLA 3CZ5A 4ZOLA 2C7RA 3L8EA 3W1VA 2HU2A 2ZGVA 4B3MB 2BGRA 3HEAA 4HT3B 5JQGF 1VCIA 1HX7A 1T2EA 1YDWA 3VX4A 4H1UA 4NAHA 1MRNA 3EAFA 1N5IA 3RIGA 4QPCA 1K4KA 4INPA 3QMWA 2JGJA 1C9MA 4EZEA 4ZGWA 1L7AA 4JS0A 4F6RB 1N9ZA 1PUJA 1XOIA 4BNHA 2NVBA 5DK6A 5FEMA 1TI7A 1E6CA 3D6NB 1FJ2A 3OUUA 1NMSA 3RGWS 3UK0A 3UTCA 2C9ZA 4Z9BA 1QS0A 3DBLB 5A4KA 3GOQA 1I2ZA 3GJXC 2DLDA 2WFLA 4OF4A 1E77A 1R15A 3TR5A 3WISA 1ZINA 5EMLA 1OXKB 3G1UA 1ZN8A 4U7TB 2CL5A 2QKYA 3UGQA 4LJRA 5IYZF 3PQCA 3ZXIA 4BVKA 3PUYA 4MWZA 5KMGA 3DZJA 2WHPA 1YFZA 2AFVA 2AOXA 2WIKA 2GRAA 4KR2A 4AP6A 1TCBA 5AO9A 4LC9A 1Y0BA 5A0VA 4MQUA 5E3JA 2EQ5A 3L07A 4H1HA 3ZW9A 4BVBA 2D1YA 5J4HA 2RGWA 1ZJYA 3CH4B 2Z9CA 4IHAA 3H5RA 3OCYA 4BX9A 5HIIA 1WBJB 3DE5X 2C9YA 2XQKA 4OBXA 5C8ZA 4WXPA 5FOQA 1VSTA 1CNFA 2B8JA 3FMIA 2FJPA 3LIIA 3WLHA 3SZUA 2J7PA 1AQNA 1S4MA 1SFRA 1E6KA 5EAIA 5H70A 4ZT4A 4DB2A 1NYQA 1OFVA 3OTIA 1I1HA 1Z37A 4RV4A 4J1QA 1A5SB 2WUFA 2ZP1A 1UIRA 3NYIA 1NFFA 2ZQ5A 4LRYA 3IIIA 3GLGA 5CT8A 3B1ZA 1DRWA 2P2DA 2OECA 3EDQA 1X92A 3ELBA 4O4JB 3B5JA 4ZOBA 5CA0B 3ZLJA 1LPSA 2H8KA 2R6DA 4TMKA 3EGOA 1JTVA 3GNQA 1SULA 2QUAA 3GLGE 3RC2A 3WTBA 3BMOA 3ORRA 2H1WA 3LS2A 1V47A 3EFOB 3OZ7A 3P52A 4OLJA 1P5HA 4PLTA 2HA2A 4Q7KA 1KDZA 4ENTA 2A2ZA 4NBTA 1CU1A 4BNWA 1ORTA 1AQLA 1VIVA 1QORA 4LA4A 4MA4A 4TTPA 5ALJA 4RD3A 2BRUC 1WXQA 1BCRB 2BUAA 4Z2AA 1J7KA 4FDLA 3S2YA 2EVWX 3QY9A 3NHJA 3PF8A 2OFWA 3DTTA 2ZB7A 3FSJX 4EO7A 4GOLD 1NSYA 4NENA 4MQEB 1PN3A 1GDHA 4F86A 1F9AA 4TWIA 5JMOA 1WMSA 5I4IA 4Y9UA 1PNOA 3BE4A 1KNQA 1PR4A 5GPBA 1XQVA 2ZUUA 1VJRA 2EWMA 4M22A 2G9UA 4NKRA 1ZAKA 1ZHHA 4XUDA 2EFCB 4ZQEA 5C5DA 3BDIA 3QKTA 2TMKA 1CZHA 4LVNA 4KWCA 3T34A 3IWBB 1ECPA 2EFEB 1BXKA 1PFVA 4X6UA 3R9IA 1M1YA 4LGMA 4TMFA 4IZIA 4ZJZA 2VPZA 4YP6A 4PTYA 5K0NA 1JBEA 1KY4A 2MSDB 4LHEA 2BFEB 2ZRMA 1NPYA 3BERA 5TE9A 2C96A 1M1YE 2R6AA 2W48A 1QGAA 1O58A 3LLVA 4M8SA 2R7LA 4PYKA 1GT91 2YBEA 3STYA 1KAOA 3U9LA 2J7PD 4MS1A 1XFDA 3OZTA 3NTOA 4K9SA 2VYVA 1X1DA 5AKEA 2WKWA 4EITA 4J2HA 3AZPA 9MHTA 3ET5A 2PH5A 4O4IA 3OZCA 4XARA 1GZ7A 3DYIA 3EMKA 2ATCA 2JI4A 2DWPA 1Z83A 2PWYA 3NALA 1JENB 2XVAA 3CIOA 5HKKA 4P0TA 2AR9A 2HBRA 3LCRA 2PO5A 3J7TA 1XJQA 3CRMA 3CLRD 4H3KB 1QH8A 2I2BA 3K8ZA 2DQKA 2WW8A 1XALA 2VHYA 3NVKI 2A58A 1DO2A 2OB1A 1HLDA 1P91A 3OJFA 2PM8A 4EG3A 2OHVA 1PFUA 4IM7A 4K86A 1LSUA