4DPOA

Crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
NLYFQSMLAIRVVAKNQVKPEKVQEFMNLCKSLIEETLKEEGCIDYGVYQELENPEILTMLEEWKDEGSLDQHIRSDHFKEIFPLLSECLDKETEINIYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a conserved protein MM_1583 from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Unknown function
molecule keywords Conserved protein
total genus 25
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dpoA00
4EFAC 4HH1A 1FE0A 2HFOA 1Y9OA 1OQ3A 2K1RA 2ROEA 1GXTA 3HF5A 5F0WA 1FVSA 2OD6A 2W4DA 1AFJA 2W4PA 1YJTA 4F67A 3FGVA 1P6TA 2K7KA 2BUNA 2IYIA 4NPOA 2QLXA 2OD4A 2AW0A 1GXUA 2XMVA 3F44A 1X0PA 1LQ9A 4Y2IA 2QYCA 1CC8A 5A6WA 2FIUA 4OJ3A 1YG0A 2HIQA 1KQKA 2GV1A 1FE4A 2XMJA 2HQIA 4YEAA 1YJUA 3TRGA 2KT2A 4FNIA 1V3ZA 5A6PA 3CJKA 1SI9A 3HHLB 3KG1A 3UDCA 4FNHA 4HI1A 2RU9A 1Y3KA 1YRXA 3IWXA 5B0BA 2LXFA 3KNGA 1Y3JA 4DL0C 2PGCA 2QLWA 2ZDPA 5T7LA 1N5TA 1YJVA 2ROPA 4DPOA 3HDSA 2GGPB 5IXUA 1TL4A 2ZDOA 3TNVA 1MWZA 1VQYA 3BB5A 1CC7A 5K9FA 4A46A 2L3MA 2KT3A 4OIXA 1AW0A 1Q8LA 2BYCA 1RJJA 3KG0A 3MZIA 1TR0A 2BJDA 3KKFA 3LGNA 1JK9B 2ACYA 5B0GA 5B0DA 3BDEA 2RSQA 3HFKA 2K1RB 2KYZA 2XMWA 1U7LA 5B08A 2AP6A 1MWYA 1Y0HA 4OJHA 1QUPA 2OFHX 2PD1A 1X7VA 3HHLC 4HI2A 1FESA 1TZ0A 3WDOA 1TUVA 1FEEA 2KKHA 4U9RA 3BGUA 4A4JA 2GA7A 2N7YA 3GZ7A 2IYGA 2GGPA 4ZA1A 3HX9A 5B0AA 4OJGA 4A47A 4HH0A 4YDXA 3MCSA 4Y2MA 2AJ1A 4Y2KA 4ZOSA 1S6OA 2FHMA 2GO8A 1S6UA 3LO3A 1IUJA 1URRA 2GFFA 2VV5A 1W2IA 5B09A 1X8DA 1CPZA 2OMOA 1VQSA 2FB0A 1N5QA 2BBEA 2ROGA 3LGMA 1P8GA 2EW9A 2Q3PA 3DCAA 3K7RA 1TL5A 5B0FA 5B0CA 4DN9A 2ASYA 3QMQA 1SQEA 2G9OA 3BM7A 1K0VA 2N4CA 1KVIA 3BR8A 5B0EA 1FD8A 1SB6A 2RMLA 3T9NA 2VH7A 4HL9A 2K2PA 1APSA 1XBWA 2LQ9A 3E8OA 3FMBA 1WD6A 1Q4RA 3HHLD 4A48A 3IWLA 1KVJA 3FRYA 1OSDA 4Q2LA 2HLUA 2OAUA 2W4CA 1YJRA 1N5VA 3TOQA 1OPZA 3DXSX 5T7LB 2OFGX 4Q2MA 2OP5A 1N5SA 1JWWA 3VTIA 2JDJA 2FTRA 2N4DA 3HHLA 1FVQA 4QOTA 3BN7A 2XMUA 2XMKA 1OQ6A 2BJEA 1Q8BA 2AJ0A 2HFNA 2RILA 2CRLA 2OKQA 3CJKB 5KAKA 2LQBA 3QGPA 1ULRA 4OJ1A 2LDIA 3BF4A 4NL5A 2GCFA 5F0UA 1R6YA 2HLTA 3I9ZA 2XMMA 2K7JA 1Q53A 2XMTA 1AFIA 2IFXA 2QIFA
chains in the Genus database with same CATH superfamily
5A8KB 5JVGQ 1KFDA 4HH1A 1FERA 1HNXF 1XR6A 1TL1B 2HAIA 1N36F 3ZTRA 1RB0A 1SIZA 1PO6A 5KFGA 1M1GA 1RWMB 4O4GB 1YIJS 3MXHP 5HMWA 2NYHA 1H74A 1XN9A 3IMQJ 3DRRB 4ILRA 2IYIA 3OL7A 2APOA 1CS4B 2W2NP 2QX0A 4Q7AA 1T03B 1LQ9A 1EIYB 3Q86A 2O66A 3GLJA 4I2PB 4UTGA 1HR0J 4KGVB 3K8VA 1KQKA 3MR6A 4B3TF 4NXNF 2C2KB 3HD2A 2QLBB 2JEJA 3DLKB 3CJ4A 3R7BB 2DVIA 1QAYA 4DPXA 4DOZA 2FLLA 4CCHA 3KG1A 3P4UB 1CJUB 1UMJA 3D1HA 3PW2A 1Y3KA 1SBRA 2GIQA 3PHTA 4TU9A 3KNGA 4IR9A 4KV8A 4CI0B 3ENVA 5B7WA 3OFHA 4KFBA 4B3SF 2YNIB 4G1PA 3LP2B 2Y3YA 1RT2B 2O1PA 3M8RA 2XCPA 2CDQA 1WKJA 1NU4A 5A2QY 3TNVA 4DV3J 1MWZA 2BKPA 3M9NB 3ZZYA 1NH7A 2KB2A 4OIXA 4WFNQ 3I0RB 4KC5A 1UAWA 3VF0B 3PJWA 1VQKS 4C6AA 3RW6A 2YPZA 1TFYA 1UW4A 2QC3A 3UFCX 1HPZB 1RBAA 1RTJB 2E1PA 3M30B 3QBCA 1VISA 3BQ1A 3QSYB 2R7UA 4O0IA 2BE2B 1FRJA 3BDEA 3SIPB 3AQPA 3SV3A 2D3O1 1SJ4P 3KTQA 3LP0A 3BGRB 4OYPA 2I6WA 4KRWA 4ELVA 1HQEB 3R5AA 1U49A 3T5KA 4LFCJ 2CAJA 1YVFA 3FUYA 2D9PA 2DR7A 3MCMA 2VJVA 3BH6B 3BGUA 2N3LA 2VZ9A 4MFBA 2G0JA 1IBKJ 1AYEA 3LP0B 1PYTA 3FCWA 3W2VA 1EETA 4Y2MA 4DZDA 1L3KA 4TU8A 1RKIA 2DH9A 5D0RA 1NDLA 4CO3A 1EKSA 2FHMA 2GVDB 1ZOTA 3AD7C 2X1GA 2BR0A 2MKCA 3TZXA 2EKNA 3L4BC 1F9EB 2A0FB 4EUVA 1WHWA 3M6UA 7AT1B 3PX4A 1L3VA 1HNWJ 4XPCA 3BPSP 1L5UA 3X1LB 3C14A 2ROGA 1VQ8S 4LF5J 1DHMA 4LJMA 3FBFA 1B99A 1JB0C 2F9JA 2ADBA 4FS2A 3QAUA 3H2VE 1SQEA 2C2RA 1G3OA 2LU1A 3R1HA 3PX0A 5AE3A 4LFCF 2A6MA 2VOOA 3BKUA 2GJ2A 2MKHA 2R3VA 2HFZA 1UEUA 3Q89A 1IQZA 4HL9A 6AT1B 1VQPS 1HYSA 2NZCA 2BA9A 3ETOA 3D6MB 4KSEB 4BBYA 3I96A 1WD6A 1FFWB 5KFBA 2OTLS 4JUZA 3HHLD 1S4EA 1ICEB 1NCLA 2I9SA 1U8SA 5D8HB 1U0SA 4B9NA 4BDPA 3UPFA 1A0OB 2BE7D 1OSDA 1RT5A 1R3NA 2BKOA 5CYQA 4B08A 3MAQA 1QE1A 1QAJA 5E3RA 2DIVA 2C3UA 3R9LA 1PAUB 1IR1A 2G2ZA 2MYFA 4OFZA 3FQKA 4U8VA 3NS6A 1F2GA 2FTRA 2H1YA 4URQU 4DFMA 1H3DA 5LL6d 1IKYB 3T6BA 5DM7Q 1S5ZA 2W7PA 3M2UA 4WK1A 5A2QU 3I4HX 4ANCA 3G6VA 2UXCF 1WKKA 3D28A 2DNRA 3CF5Q 3C2PA 3N6NA 2V0NA 5U47A 4NLPA 1RWVB 2OSQA 3R3TA 4KV8B 1NK8A 4YDDB 1CVJA 5JVHQ 3PFOA 1RTIA 1L3TA 2Y0BB 2YXLA 3FNNA 2CJKA 2Z2MA 2V94A 4UQGA 5K14A 2KVIA 4KKOA 1HR0F 2X7IA 3CIMA 1PJ6A 4NCBA 3RRGA 3UCZP 1X5OA 1GH8A 3TQ1A 4CZCA 4WZQA 1LW2B 1NJIT 2DO4A 2CJAA 4AL6A 3H90A 5HQ8A 4RLEA 4X4NA 3UI3A 2WONA 3IBWA 5CXTA 3L7UA 2ZH1A 3U1LA 2B9XA 1KWMA 1BD6A 1HW9A 1YJUA 1JLAA 2FLPA 3CJRA 1W7WA 4BWMA 4RW8A 3W9IA 4U7UD 2NUHA 2KJVA 2V5HG 4QIVA 3H40A 2RB7A 4K59A 2UUCJ 4KGZB 1VQOS 3MM9B 1H72C 2ATLA 3I9V9 5HSPA 5IM0A 3QZ7A 3CCQS 1N5TA 1EHWA 3E2EA 4J9MA 2XWYA 2MY8A 3J81Y 1VQYA 2BACA 2AHOB 2EK1A 2RE1A 3IN5A 2W8LA 1L3UA 2BMBA 4P7VA 5E2QA 1IBMF 4O44A 1SC3B 1LW0A 3HZGA 5GMDA 3OVSA 2YPYA 3MZIA 1YBTA 4WFYA 1VFJA 2EFGA 1AZSA 1U1MA 2JVOA 1UJ6A 4FZVA 4LRAA 2DY9A 3VZIA 2QRRA 4RUHA 3CXCR 2ACYA 3N01A 3AJDA 3QYYA 5D4LA 3THTA 4Y00A 4F0MA 1SXLA 3HI9A 2DIUA 3MMCA 2KG1A 1GMVA 2DTJA 1B3TA 5HANA 3MAHA 1X9SA 2RJZA 2YKPA 4PWWA 1RBOB 3T1YF 9RUBA 2HBRB 1ZBTA 4J9NA 5KFYA 4OZ1A 4DV2J 1B64A 4P75A 2QA1A 3G6ES 4DR5F 4A4JA 1C0TA 2FJDB 2IYGA 2OMLA 4ECWA 4K2JA 1U2RA 5EGYA 3PO5A 3Q0AA 4HT7A 2LEAA 4N8OA 2DRAA 4ECQA 4K4VA 3EICA 1Y5NB 1J5EJ 2XYGB 4GRSA 1HHQA 4M8LA 5ETTA 2ZKTA 4J9RA 2ZUGA 3NOCA 4ZS6A 3QJJA 3DLEB 2VG6B 2R8IA 2RVJA 1FTRA 4YUDA 2RF2A 2EW9A 4MMOA 2MJUA 4YR0A 4DN9A 3DHXA 5KFAA 1VHFA 4IO1A 2P5VA 1TELA 1CS4A 3TWZA 1J2VA 3NBPA 2YNHB 4WIQA 1RGVA 1WDDA 1UVIA 4JI0J 4LFAJ 3ILJA 1NSPA 4Q8FA 2J5AA 4LBIA 1F1BB 4A48A 2V4JB 5K14B 3MR5A 5ETLA 2PA3A 3QO9A 3QNWB 4V19J 4M94A 4TLQA 3HULA 4ILMA 5FLXU 1VI7A 2IDLA 3UO0A 2RT3A 2RH3A 5LXYA 2IHR1 3O3LA 1FDAA 1EP4A 2W01A 3HHLA 5EWFA 1TKZA 2V6AA 3C15A 3DRRA 3V5RA 4FF3A 4PRFA 2B5JB 3GFXA 3DOLA 3EDRB 3DMJA 3BSCA 3L3CA 4LF8J 2PC6A 2OKQA 1WI6A 2AZ3A 2VUGA 1NSQA 5LJ5Y 3QFWA 4F4YA 1YKWA 2E29A 3DDNA 1NKEA 1UWBB 4OJ1A 2LDIA 1GEHA 2MSTA 2UUWA 5D78A 5F9LA 1RTDA 4FXVA 2NPIA 5EDWA 1OMSA 2YQ3A 3H2UB 4X4RA 1HQUB 2KXNB 4NXMJ 2QSFA 3CIZA 3T1HF 2DO0A 4OZLA 1I3OB 5D4NA 1Y9OA 5J2NB 4B17A 3KYLA 2JVRA 3ZC4A 3Q8RB 3VAFA 1RQ0A 2VFRA 4JP8A 2DNLA 1B7YB 1V3RA 1VOMA 1RT3B 2VBXA 4LSLB 1EP4B 1Q5VA 1YJTA 4V1Ak 1JLCB 1AFJA 4O44B 2HWTA 2OD4A 4L75A 4RNOA 2QYCA 1IN0A 3BKFA 1ZM2A 2FIUA 2WVBA 2IRYA 2KJWA 3OV7A 2IDEA 4OI2A 2DISA 2H5EA 1YJWS 3W2WB 3FDSA 2EKYA 3MMAA 1WF1A 1QLNA 1SUQA 1X4HA 4OYIA 3W1YC 2DY1A 1SI9A 2QSWA 4X4VA 4ZVRB 3VWSA 4CM2A 2E9RX 3J80Y 2HQFA 2F1FA 1HHSA 2UV8G 4EU0A 1WSVA 3L7OA 1HNXJ 3HCXA 4WYLA 3OTOF 2B4UA 3R1LA 1S76D 3I0RA 1QDUB 2GVZA 4M5DA 4WTOB 3QLHB 5KTQA 4YP3A 3PKYA 4H4OB 1N56A 2WB1D 2J0XA 4H4KC 1CJVA 3MEKA 1N33J 1PCAA 3G8TA 2F40A 2QFJA 1N4LA 4MKBA 1YRUA 5FJ4A 1IBCB 1TQLA 1LWFB 3O5TB 3RAMA 4USUA 2VASA 3KKFA 4LR7A 1N0UA 4ZPCA 3R5DA 4RW4A 5H1SV 3MPVA 4LSNA 3D4JA 3MFHA 3RB3A 2K1RB 3HJFA 2AEMA 2KYZA 2DXEA 2IBOA 1NK7A 4EBDA 2OFHX 1FFSB 2ASLA 1MN7A 1H7WA 4HI2A 4J5OA 3D0IE 3MURP 2BOAA 2V67A 3NGSA 1D0EA 2X1FA 1B7FA 2ZZMA 4WP9A 2E5IA 5E0OA 3RAXA 4C11A 3WC2A 1VQMS 4ZN3A 1HW8A 1XWLA 3ET6B 3OHBA 1HIYA 1TV6B 3LTOA 1DJ0A 1W25A 2VC0A 4RNNA 3R5BA 1VBYA 3JAMU 4C8KA 4FYVB 1RT6A 1YJ7A 3M8ZA 3FRZA 1J27A 4NOHA 2CPEA 4L6V3 4ZP7A 3QT5A 3OR1A 4CLWA 4CO2A 1RXOB 2GZOA 3N79A 5CYJA 3IGNA 4NA2A 4XDCA 2HZVA 4F0KA 3AT1B 1FNXH 1K1QA 3PNIA 3G2XA 5KFPA 5JXSA 4OX9J 4AQYF 4W4MA 5KT4A 4R8UA 2IM2A 3T9NA 4OYWA 5DQIA 1KR4A 2F8HA 4P71A 4X65J 5C5JA 4X66F 1X5TA 4CLSA 1XBWA 2HWHA 4IRKA 1S0VA 3G82B 4Y6IA 2JLGA 2PMZD 4LUBA 4BS2A 1TL1A 3IWLA 3OXFA 3UQSA 3DOKA 2CQ0A 3BPDA 3MTKA 1GX5A 1N48A 2IM0A 3HD1A 3NS5A 1EKRA 3GE9A 4IOBA 4USMA 3QRPA 2J8SA 3GIRA 1CJKA 1ZZFA 3EDQB 5D4OA 1U1LA 4NLQA 1SL1A 4LF6J 2FHOB 3AXKA 3HZEA 3T1YJ 2O01C 2BM1A 1V5VA 2WB4A 4RPFA 4Y34A 5LOQA 2XGQA 5ETOA 2BE9B 4PQUB 2AJ0A 2RD5C 1NXIA 3CJKB 1PKUA 3ELHA 2D7SA 4DR1F 5IM0B 1RT4A 3W65A 4CLKA 2ZM6J 1JXLA 4F02A 1UP1A 4BC9A 4ZVPB 3IRWP 1IKVA 4DSIA 5E41A 2XMMA 1Q53A 3EJMA 4WWSA 1AFIA 4JBCA 1OIAA 4PYDA 4FXDA 3CMQA 2E5GA 2F3JA 3ENQA 4DV0F 3CMES 1OQ3A 1KKHA 5KOWA 2GQ2A 2Y1IA 4IH5A 1PGZA 4F4AA 2AGPA 4PXCA 4A8WA 4FF4A 2CPZA 3HP6A 2HGLA 5GMEA 1N6QA 3FC9A 5F8HA 3M7VA 1RA7A 3EX7B 2AW0A 5ETVA 2CDRB 3GIMA 4DWIA 4KPYA 2FLOA 4DV0J 2HHTA 1SL2A 2HVZA 1RYRA 3IR5B 4RX6A 1NJXA 1LWEA 1REVB 1TKXB 2A1BA 1NO8A 2XMJA 2A10A 2HQIA 3EWGA 4Y3CA 3ZO7A 3RTVA 3UN3A 4DS4A 1BLUA 2YKMB 3KFWX 2XC9A 1KHVA 4B3MF 1NSKL 4NYZA 3VGUA 1N6QB 4DHVA 1RP5A 2E5JA 4ZMMA 4JI7F 1IKXA 4B3OA 2BRLA 3RAQA 4HDHA 2ZJQQ 2CQHA 1HNIB 2OHDA 3ZTSA 4EWTA 2WVDA 3MMBB 1UFKA 2BANB 1DBDA 2M8HA 4FVCA 1HHTP 1HBMA 1UZDA 4J37A 4WIIA 2V8PA 1JLAB 2MHEA 4QQBA 2J9EA 2JZ5A 1Y4ZB 1WKLA 1ZPWX 2Y1RI 5K5MA 1NBEB 2WVEA 1Q8LA 3MHYA 4MIBA 4HHJA 5D77A 4X62J 4GKJF 2DH7A 1LFPA 4JI5F 3H98A 2ZD1A 5LSRA 3LGNA 2YX1A 2VHGA 4ED1A 4FPRA 2G4BA 1JK9B 2FVQA 1R43A 1V3SA 2G1DA 2QMXA 5B0DA 2ZUAA 1NEEA 2DGVA 3FJ2A 1IM4A 3O8WA 1S0MA 3GJSB 1UA1A 2KM8B 5DDOC 2JEIA 3FZBA 1D8YA 4QYRA 3D67A 2XHWA 2X51A 4GKKJ 2FHJD 2QEXS 4PG5A 2HRTA 3W9HA 2W24A 3C19A 2WRMA 1HWLA 2XO7A 2QMWA 3RBEA 2UXBJ 4WU3A 3DMJB 1VMBA 4ZCLA 3NEKA 1X4CA 2EG2A 3AA9A 3CE8A 4MKAA 3HHDA 4F0HA 2FY1A 5GVQA 2MY7A 1QSLA 4JV2A 4KJIA 1WC0A 4LVNP 5AE1A 2JH3A 2DHHA 4I4BA 5B09A 5C42A 1R31A 1ZTTA 3UD5A 4QBUA 5BXIA 1GAOA 1W26A 4OQJA 4Q44A 2DGQA 5GAHU 1S1TB 4J90A 2LECA 2Y1JA 3A3OB 3NS7B 1TU0B 4QIGA 1TL5A 2YH1A 4I0WA 3BGOP 4DQIA 4WKYA 4OZ3A 5E3QA 3GONA 1URNA 1N0VC 1M5HA 2CJQA 4KTQA 5T14A 3IXQA 1V9OA 4DU8A 1SV5A 2C3OA 2LEPA 2X3DA 3KUGA 3U7JA 1WACA 3OSPA 5BYRA 1IKVB 2Q43A 2ATCB 2VG5A 2KDOA 2ZE2B 2BX6A 3E8OA 2PEHA 3GCWP 3JQJA 4LVOP 5AXMA 4IFYB 5C25B 1S10A 1KFSA 4DJBA 4A8SA 2ZHBA 3VQTA 2FVCA 4F2SA 1D9AA 1FKOB 3OUYA 3FCVA 1LV5A 3KOAA 4PG8A 2J9DA 1O6XA 3P3DA 1D3WA 4LRFA 1N5VA 4ECTA 1DZ5A 3GG1A 2HHPA 3O6QA 1TKDA 3VTIA 2AF6A 2FHJA 2RUGA 5IQ6A 5HI7A 3KLHA 2A2DA 1FVQA 4QOTA 3NNCA 2AT1B 3BEGB 2XMUA 3H5SA 4JI8J 3VZHA 1I1GA 3N5BA 4IG0B 2HFNA 1U1QA 1TL3B 5ADZA 4MFBB 3QGPA 4MT1A 3SQOP 1ULRA 2OSRA 2HURA 3K5OA 5C25A 5C7PA 1QAIA 4OI1A 3BF4A 2YKNA 4M5GA 3WX8A 3CMAS 2Z30B 2Z4PA 4DV6F 1DURA 2X3GA 3U1NA 3PO4A 1B70B 5MLCV 2WW8A 3IC1A 1VRQC 4CO5A 1LEOA 2EK6A 1XR5A 3IAM9 4PWUA 2BJ8A 4OHWA 1HWJA 3HMJG 2YBVA 3K8WA 2GHWA 5F0WA 2HHWA 1R0AA 2AYGA 4H4OA 1LXJA 2K7KA 1WG1A 2I0XA 3M8WA 5DO2A 4ZDNA 1LW0B 2XMVA 4NASA 3W66A 4CNYA 4OMFG 4U67Q 2W9BA 3VAHA 3JXOA 4B3SJ 4ETXA 4QYZK 4NZ7A 4JI8F 3Q83A 1VK3A 2B5JA 1TP7A 3P5TL 4P9SA 2VA2A 2VG6A 2ZNZA 4YHHF 5KFWA 4QR0A 4R25A 3Q24A 3V4IB 1HMVB 2W9BB 3OTBA 3GSDA 1AUDA 2V2KA 3T6JA 1ZAVA 1NJYA 1IWGA 2MZJA 1U48A 1RT7A 1HNZJ 2NS1B 2CQ4A 1RK8A 1XMOJ 3MMAB 2ZWPA 2HNZB 2VBYA 2RRAA 1ZETA 4ZCKA 1Y5IB 3HPOA 3ILLA 1CC7A 1FJEB 4LF8F 2XNRA 3H2LA 1LK7A 4DX5A 4ZLPA 3K5MA 1RWXB 4DQQA 4DSKA 1M5KC 4J9SA 5KG2A 3BBBA 3FFIB 1BUXA 1IVZA 4QIFA 4ECSA 5DG8A 1TK0A 1R0CB 2YNFB 2UP1A 1KNZA 5HBMB 4YOEA 3H0PA 1E6VA 4CWBA 2HZCA 1RHUB 2RF2B 3HFKA 5LSLA 4MJKA 1SUQB 4DR3J 1AB8A 5B08A 2W2MP 2H4WB 3PV8A 2V8HA 1DFDA 5HLFA 2QT7A 1HI0P 1FK9A 5L38A 3C6UB 4M5HA 1WC1A 1U2FA 3UN5A 1GQEA 1MMNA 2NUUG 2VFSA 3IAS9 2XI2A 2GJFA 1RSCA 3CTRA 2MDAA 1DTQB 5J1NA 3VGTA 4D3HA 2GA7A 1BHNA 1MLAA 2RHSB 2XZDB 1TVRA 3NMAA 1XNRF 2VD3A 4YDXA 1S0NA 4M63A 1CJTB 2AEJA 3G96A 2CJ9A 4NLOA 2OGUA 1Q8IA 3LQVA 3P96A 4RBUA 2FDNA 3CSKA 5L1JA 2DHSA 3KK2A 3EZ5A 1AUSL 2B4VA 2DNKA 2CXEA 5H9FJ 4C8NA 4K4YA 2FB0A 2V9KA 3DRSA 2KRRA 2PMWA 4C7QA 3EZOA 3ET6A 1B0PA 4DL7A 2UUTA 3DOLB 1S1WA 3QATA 2W25A 1MROB 2IJRA 2YNFA 1UEVA 2HS3A 2VBZA 2N4CA 4M1KA 2BQRA 1DRZA 2XS2A 3P8BB 4PG6A 3M9MB 4JI1F 2W2OP 4DQSA 4GKJJ 2MB0B 2Z2ZA 2QN6B 2QE5A 4C48A 1VGYA 1A6LA 3T3FA 1Q82T 2LQ9A 1T0TV 4DF4A 5IWAJ 2IY5B 3MM6A 2VONA 3UCGA 1VC5A 5DGBA 4NCGA 4PQAA 2YQ1A 2BJ1A 5GAGU 3DLGA 3K5NA 1RE1B 3D7SB 3SSRA 1VC6A 4E98A 1SCJB 1TVRB 2NXEA 3NKYA 4GVLA 4WFXA 5C24A 5T7LB 4JYAJ 4DR6F 1TUWA 4G6VB 4Q0BB 1WOPA 1VBZA 2DT9A 4WCEQ 2CVEA 1DQAA 4M5MA 3M32B 4L3NA 1FF2A 2IMOA 5GMKa 2IMWP 2HHVA 3AQOA 1Q8KA 2YX7A 1VLYA 1NZ8A 3WIUA 2RILA 5HROA 1N36J 4DR4F 1FDBA 1WC3A 3BYRA 2LQBA 4NMXA 2GJIA 3G8SA 1C0UA 2BRKA 2DHXA 3BN4A 4ZVOB 4EZ6A 3TARA 1U1OA 4WF9Q 2DNPA 2OPPB 1UJ5A 2R7OA 2HYIB 1R6YA 1P6TA 1NK6A 5CD4H 3GTYX 3JQKA 3PEHA 4A8FA 1FDDA 2F5GA 4JI2F 3BSAA 2HHSA 4OHVA 3WQPA 2F4FA 3D0HE 1PYSB 3A3PB 3EVMA 4IH6A 3E3XA 3CUNA 3JSMA 4F67A 4ELUA 3FGVA 3KLIA 2VICA 2B9WA 2GX8A 2OPPA 3TEHB 1BQNB 1GXUA 3PIOQ 1OO0B 4RW8B 1DLOA 3AAWB 3OFEA 1T9YA 5A6WA 4ECZA 2PIIA 2ZH3A 2MPUA 3I31A 4F04B 1HYSB 2CQ2A 2XHCA 3CB4A 2EFQA 1T9VA 5F8LA 1XTZA 2DNZA 2FJBB 4MAKA 3T5JA 4OZ5A 4ZLNA 4F50A 1Q5YA 1PJ5A 3THPA 5K8NA 3CCRS 3KK3B 3CJQA 2NXUA 4RBVA 1S7HA 1Q7YT 3TO8A 1RISA 3CJSA 4EYHB 4LBPA 4M5KA 1M5PC 4IOAQ 1SJ1A 2M2BA 1T95A 5I3QA 1QVGR 5ETQA 5F41A 2AD9A 5K9FA 3CJ0A 1AW0A 4X4OA 2RHQB 1NK5A 3VV2B 2W9AA 3FEXB 2BV3A 2E1MC 5HJYA 1T03A 3D3CJ 3Q8PB 1KONA 2BJDA 1UCNA 2FD2A 4I69A 2MQLA 3D5MA 4OHXA 5SZTA 1BGXT 2VODA 2XYPB 3ZZOA 4ED3A 4TKTA 3F41A 4MH8A 5EX0A 5M2PA 3GIKA 2V68A 2HW3A 1AT1B 1HQUA 2AP6A 1RABB 2HGNA 3MTJA 1HWKA 1Q7LB 3TX0A 1K8AT 1I5OB 1IKYA 3QIPA 5RUBA 2CWXA 2I1RA 5CHCB 4R8UB 5ITHA 4LFAF 1TUVA 3TAPA 3HT0A 1IR2A 1EARA 4DLEA 3J80U 3CNQP 2VKRA 2QA4G 3RBXA 3CO9A 2C2ZB 3KLEB 2G0CA 3GIJA 1JKHA 1NUEA 4NMLA 1D9FA 1WG5A 4JV1A 5J2MB 4ED0A 2GFFA 3GYGA 4IG3B 4S0MA 4URSA 1HBUB 1U0HA 4JI0F 4ZHRB 4DFPA 3AA8A 4UQTA 4FF1A 5E3CA 4OYMA 3ZZPA 1GT8A 1U09A 5B0CA 3I0SB 1KLMB 1MG7A 2BW7A 2P9GA 1SKRA 3W62A 3K89A 4JV5J 4KY3A 1CBKA 4PR6A 3O1LA 2D9OA 2AWZA 2MKKA 2EFOA 4KPCA 1RT1B 2QJ3A 1KOOA 2IVYA 1HBOA 1WEXA 3RGIA 2ZVSA 3ULHA 5J2MA 3HVWA 4J9LA 5KG6A 1OWXA 3PM9A 1WWHA 1F2HA 1PBAA 2OAUA 3AH6A 4UUWA 5HJXA 3T5HA 5IV3A 1N8RT 3OPKA 4J7CA 1H38A 3J7YU 2VBWA 3MDFA 4DPTA 2OP5A 3GFHA 1QAXA 2JDJA 4PWDA 4USVA 2ZBCA 3US5A 1TKXA 3RR8A 1GX6A 3AD8C 4DPYA 2JC0A 4ID8A 1R0BG 2MTLA 4CRJA 1X9MA 1YZ6A 3JTOA 4F3MA 2HSEB 3M8QB 3MUMP 2V63A 1RHKB 2CADA 2E1AA 2HKEA 2Y0SD 4CO1A 1TAUA 3MPUB 1FTCA 3BV8A 2B0GA 3H7HB 4HHUA 4TLRA 3TX8A 2MQOA 4DUYF 3ENWA 3C6TA 2ZH2A 2DGTA 4HLBA 5EX3A 1BC6A 3KHRA 3D1QA 1NZAA 2PT0A 2K1RA 2ROEA 2ZJRQ 3F73A 2CYYA 2DRDA 1FVSA 2YWKA 2EXUA 4DI6A 3BKTA 2BW2A 4WP8A 4NPOA 5A76A 2YKNB 3DHWC 3KLFA 2FZGB 4NLSA 5GADU 3PW0A 3RYLA 3CULA 2CPFA 1CC8A 5KFEA 1S49A 2Y9HA 5H9FK 1WOSA 4PEOA 4CLPA 3SQGB 3R5CA 4P72A 2V4QA 3W5XA 1UPMB 1QD1A 1SJ3P 5EWGA 2HRUA 3KMQA 1ELOA 3ZZ0A 2J9DE 1JXVA 3BGLA 4P7TA 2CNKB 3DGPB 4M5DB 4C8MA 1PJ7A 5KFRA 3UDCA 1H0HB 5KFVA 1VDHA 2UXDF 3NL0A 3MEDA 2DNOA 2CQIA 2POKA 2VDIA 4OX8A 3FCHA 3DRXA 1U02A 4AL7A 2EVZA 2DB1A 2K06A 2YX4A 2X1AA 2J6SA 2OPSA 4CM0A 4DPUA 4DQPA 4OZ2A 1JQGA 1VBKA 3KXDA 4ZJQA 1R8CA 5G4DA 4DUYJ 3CCZA 4A8MP 4IRDA 1YJNS 3BGRA 3NXZA 2YNHA 1HI8A 4R0EA 2P6TA 4BLGA 3HHEA 4DMZA 3VAMA 3LP2A 1TK5A 3OTEA 3JQMA 5EUHA 4L76A 3DI6B 2GQCA 3HKWA 3ISZA 2KL8A 1M90T 4YB1P 4DV6J 4MYTA 1CJUA 3DN9A 5D3GB 2UVUA 4LF6F 1JLBB 4KQZA 5KFKA 4NX9A 4NLRA 5JJBA 4NZ0A 1C1CA 3MGJA 2CNOB 3PW5A 4OZNA 1Y0HA 4A8OA 3NGRA 4X66J 1IXKA 1Q0NA 5A0YB 1ZYQA 2YVSA 3D54A 2WSFC 1K44A 2CWKA 1R8AA 2HZAA 2UVWA 2QV6A 4TY9A 2LQ5A 3HK2A 5F8MA 2C2EA 3E01A 1LWCB 1FEEA 2M7SA 4KBIA 4XTTA 3VGVA 1M0SA 2J6UA 2FPHX 3J7A1 3PZPA 1H2TZ 3IP0A 4QW8A 3HX9A 3I32A 3M2RB 4OJGA 1H2UX 1X60A 3FK4A 1SVDA 4ZPVR 5IC6B 3H20A 4DN0A 1VQ5S 3C16B 4AQYJ 5DQHA 2GO8A 2J7UA 2M8DB 4CTAA 1YITS 4KE5A 3SCKE 1JLFB 2XB2D 2WVFA 1FJGF 2DNGA 1SKSA 1FJ7A 3TAMB 2NYIA 1FO1A 1JLEA 2C2NA 4X4TA 1RU1A 4W92B 3C66A 4QYZJ 2B3TB 4DX8H 2OMOA 2ZWOA 3DM2A 4DL3A 4J9KA 4FKYA 5KFXA 4P52A 1P8GA 3JB9k 1X9WA 1IBKF 4LSNB 2M9KA 2LQJA 3N28A 2DKOB 1S6QA 3NAIA 3OXGA 1PIEA 2K3KA 3BM7A 4GVBA 3FSIA 3BR8A 3NGKA 1ZZNA 2RMLA 2V2ZA 3DC2A 3GYNA 1UVJA 3QJPA 1HA1A 5L9XA 2W7AA 2C22A 5H9EJ 3QFHA 4AD6A 4NLDA 1NH8A 3FMBA 2UZAA 4YY3F 1M1HA 3LW5C 1TL7A 3A8JA 3WBZA 2HNYB 5I3PA 4CTAB 3N6MA 3MOZA 4ZCIA 5BYSA 4IR1A 3D6TB 4X4PA 2RDIA 4KT0C 3K5LA 3W61A 3DLHA 4WKRA 1KQGB 1FJGJ 3GSIA 5DDRC 2OUGA 5ETNA 4ICLB 3LGHA 4RNHA 4HEA9 2FJXA 3TZZA 1N32F 2HNYA 3BSOA 1FRIA 4OI4A 1Y7PA 1Q8BA 3NP5A 2MQMA 4UOHA 4NE9C 4O3OA 2E7XA 2I8EA 3ILIA 4KR0B 3Q8VA 4DCJB 4RW4B 4F3OA 3MM9A 1CQMA 1GTEA 3GR0A 4QR1A 1NRKA 2XMTA 3MEEA 2IFXA 4TVAB 2XCAA 2FY8A 3M8PB 3OTCA 2IBKA 3D6FB 2HK3A 4QPTA 4YB6A 3BH7B 4ETZA 1S1XB 2XS7A 2GC8A 3OTDA 4ED4A 1U47A 1WUUA 5ETMA 3I6PA 3I82A 3GCXP 2AEFA 4LSZB 4C98A 4CYUA 2UUAF 1MN9A 2D3ZA 4I56A 2ZOGA 1JJHA 2PN6A 2HK2A 3MI7X 3KLGA 5KFTA 2JFDA 4FNIA 6FDRA 4QWCA 2HHXA 5KFOA 2HHHF 5ETSA 2CNNB 3CVKA 4PPDA 4K2XA 1EQMA 4RW9A 4XPEA 2DNNA 2ZH7A 3J7AN 2H5IB 2HQGA 3HSZA 4L74A 3EPIA 4M5JA 1WTFA 3SI8A 2UUBF 2A2CA 2UUCF 2E66A 1AA1B 1FKPB 2XYHB 2KH9A 3L09A 4LF7J 1RTZA 2H5JB 4LT6A 2ZDPA 4FPIA 4QWDA 5GAGI 3KK1A 2WZ1A 2Z8QA 1YZ7A 2CQGA 2GGPB 3DYAA 1C4CA 2JFKA 2XSFA 1WDTA 3DRYA 3M2UB 3MPYA 4TN2A 3S8SA 1ZS6A 1RAFB 4F25A 2JSXA 3LOUA 5LMUJ 3GWCA 4P73A 4P2SA 2D69A 5L9NA 4DL5A 1FX2A 2CZ9A 2V8DA 4Z37A 1UL3A 3H42A 3VVUA 3RRHA 2A6OA 3TP2A 4TY8B 5J1PA 1NJWA 1S0OA 4H4KA 2C3MA 4QR2A 2FJWA 1WEYA 4ZVFA 5KFMA 3QT8A 3DYAB 3DU5A 1RWOB 2LDYA 4YR2A 4IDKB 3SFUA 3RBZA 5AT1B 2UXBF 1FKPA 5HO4A 1S9EB 1RT1A 4KAIA 4P6QA 1Q78A 1GMWD 2B56A 4AE5A 2Y8YA 4NWBA 3BO4A 2DPJA 1G4CA 4JI3F 4OHYA 3OQ2A 1RADB 2BZ2A 3MD3A 2ZM6F 1D1UA 2ZHOA 1X4FA 1QTNB 2VU5A 1SQGA 3NCQA 3HO1A 2E5HA 1FEHA 1NB2A 2L41A 3IRXA 1FKOA 1KS2A 2HS0A 3PYDA 1IJFB 1J5EF 1S1TA 2MQPA 3CC2S 2BXJA 3BYPA 4I6AA 2EPIA 2VV5A 4NA1A 3TVZA 2BM0A 1JNRB 3IBCB 4RW7B 5GAHI 3ZFVA 1S9GA 3T5LA 4V19X 1REGX 5HMXA 1G1XA 3IM9A 4BCAA 3W3SA 5LM7E 2BBEA 2EFPA 2WCXA 4DV3F 3A12A 2GQQA 4ZP6A 2Q3PA 4XO0A 3FEYB 4OYBA 1SH3A 4I67A 4TY8A 2MKSA 3V6HA 3AOCA 2CPXA 1OYDA 4HACA 2GMJA 3Q8SB 5J2QA 2ZEJA 2CJXB 3RW7A 5A8KA 4WBFA 3P49B 2AGQA 1JX4A 1S9GB 3QQCD 3TUIC 4B9VA 2DHAA 4JI7J 2O67A 1MW7A 4CLZA 4J9OA 1UVKA 4EZ9A 4JI3J 1VQLS 1EQ0A 4Z7YA 2HFSA 2RQCA 3J81j 3KMSA 3NAHA 1N5YB 4TYBA 3HVRA 1EETB 1FRKA 5BYQA 5IT4A 2FC8A 4Q2LA 3CDWA 4P10A 2W4CA 3KLVA 3HHNB 3NCPA 3Q8UA 2QTWA 1NHVA 2QO3A 3DXSX 3SQGA 1HNVA 5KG0A 3V4IA 1BMQB 2HBZB 2BOPA 1HBNA 4BC7A 1FA0A 5A8RA 5CCLA 5I4MA 2AZ1A 2WOMA 4AYBD 3AXMA 2ZBPA 3WHIA 3NGDA 2J0QD 1FT8A 1MU2B 2HFVA 4YHHJ 5KAKA 4NLVA 4HKQA 4A8YA 1FXDA 3GG0A 3N9UC 2L9DA 2M70A 2DJWA 5F8IA 3FFIA 5CAAA 2MHNA 1W2BR 3TJAA 3AODA 2AMCB 3I9ZA 4C0OC 2VIHA 1WORA 3K17A 5E33A 3R7SB 4ER8A 2Q66A 4KHMA 1NPRA 2QIFA 3CCWA 1JMTA 4ED8A 1T9WA 4UF4A 3Q2TC 3KJVA 4QU7A 3OR1B 2FGCA 2OD6A 3B82A 5GAEI 2V8GA 4ITSA 4DLGA 2HHHJ 4GO7X 1O5JA 2BUNA 1RTHB 3ZTQA 3LH2S 4LFBF 4RU9A 1X0PA 3D3BJ 4PXDA 1RHJB 1RT3A 3GFYA 2HIQA 3HFZB 5E3PA 4F36A 4C3MA 7FDRA 3MR3A 3KDOA 3AB4B 3FQLA 4K4XA 4EEYA 3H5XA 3LP1B 3HHLB 3E01B 3LPYA 4USJC 4Y28C 1XMQF 2KFNA 2DH8A 5F3ZA 1ZH5A 2OLWA 3DLLQ 2ZFHA 4C97A 1D09B 1S57A 2RQMA 1S6PB 4JI1J 2WVCA 1RWPB 1U1NA 1TKTB 4L73A 4ZVQB 2XI3A 2C2DA 2J7KA 1Q95G 3DLKA 2PA8D 2ZDOA 2J0WA 4PXEA 2MZQA 1NDCA 3X3UA 4I2PA 4NLGA 3UE2A 4CH0S 5J2NA 2EI5A 2ZVIA 1OY8A 4PG7A 4RW7A 4NXMF 4AUKA 1ZPVA 3IFEA 3UDEA 3MECB 2IM3A 3MCNA 1FWLA 2EG1A 1V6HA 3U1MA 1U1PA 2V8VA 2XMWA 3W8GA 4JV5F 1DTQA 1DTTA 3O44A 4YN3B 1LXNA 2EFNA 2VB6A 1LFWA 4K5SA 1X7VA 3RUBL 3EGVA 1XK8A 1KD1T 2BDPA 1KOHA 3QIDA 4DUZF 4LF9F 1PBUA 4N7TA 4ANEA 1A9NB 1CJTA 3POTB 2QLFB 1VK8A 3TUZC 1RU2A 1JLFA 3GZ7A 4ZVGA 3W2WA 4KGXB 2IA6A 3QRRA 3DOKB 4E0DA 5A8WB 3ITHA 4DUZJ 4LF9J 2Z2YB 2CVIA 2B9EA 4M5NA 4JI6F 1HKAA 2RKIB 3M6WA 4TNOA 1Y5LB 3KJVB 3NNAA 4OYXA 1F6TA 4LQ9A 3AJ1A 2C1EB 2WSCC 4NLYA 2YH0A 5D3GA 3DCAA 1ZM9A 4CLLA 5B0FA 3CCTA 2HNZA 5J2PA 4ZVTB 4F26A 1X0FA 1FRMA 1CJVB 1UW9A 3B4MA 2G9OA 2HVDA 3BZQA 4N8NA 4DV5F 1KVKA 2BKNA 3IGVA 5KFFA 1WTBA 1SJFA 5B0EA 4P2FA 3E51A 5HMYA 1SQFA 3PR5B 4G1QB 4RKUC 1JJ2R 4XDDA 2QA4S 4K4UA 1IKWB 3KLGB 5J2PB 2MMYA 5KT7A 3LA0A 1N52B 2H65B 2VDHA 3VVTA 3SDEB 4QW9A 1T94A 1UZHA 1R8HA 1YX2A 2F7VA 2OPQA 2HQCA 2MGZA 2R7RA 3NNHA 1DLOB 3G6XA 4X4SA 3C3LA 2GS8A 4DV7F 1WC5A 3PW7A 1RHQB 3LALA 4RR5A 4PKDB 3H8YA 5FDLB 1KEKA 2BJEA 4R0JA 4DG1B 2CRLA 2VG7A 3DI6A 3OR2A 2DCLA 5DJBA 1FWPA 4B3OB 4I7FB 4ZPDA 1N88A 2O5DA 4NEZA 1UVMA 5F3TA 2FVRA 4E2FB 1E6VB 3HFVA 2MGZB 2DGSA 5F0UA 5D0EA 4B3RF 2XM3A 3CCSS 2G1HA 2NXCA 1A7GE 3PRDA 4IYQA 2K7JA 1F0XA 4I2QB 5HAOA 1NKBA 1X4GA 2CQCA 3DRSB 4AXJA 3UD3P 3OR2B 1YWXA 1T3OA 4WXOA 2RDJA 3A8KA 1FXLA 4GC7A 5IT9U 2B9YA 4ECVA 3R8YA 4KGKA 2BJ9A 1RWNB 3EVWA 3TA0A 2QLXA 4TQRA 2KT5A 1WJ9A 3CGIA 3F44A 4R5PB 1WG4A 4MIAA 3W9JA 3OLAA 1FKAF 4O3SA 4O3RA 4P2MA 2IPOB 4OJ3A 2FYXA 3PX6A 1YBAA 2WHOA 5DZ6A 4IUFA 1VCTA 1FE4A 1CULA 2HQ3A 4OX7A 2F8MA 3IG1A 1TK8A 3SCIE 2XY6A 3R5GA 2L48A 5A6PA 3UN2A 3CC7S 1SJRA 4L72B 4FNHA 1RTIB 2ASJA 3QRQA 2F65A 4QPXA 1PILA 2DD8S 3TEGA 1T8EA 2WONB 2LA6A 3S7RA 2P8IA 5E7OB 2AYBA 1QSSA 2Y8WA 4FYDA 3DRPA 5KFNA 4WYWA 1P9YA 2XLIA 1UFLA 1FWKA 5IXUA 3I0SA 3QJLA 4OI6A 2B8QA 1S1UA 5DQGA 3LAKA 5HVHA 2IM1A 2DEIA 1RCOB 2KT3A 2ZBIA 5D0HA 4N47A 3B4DA 3J7ZT 1O8BA 4Y65A 2HBYB 4PG4A 1VQ4S 2DR9A 2GHVC 2J0SD 5I42B 3M4XA 3M8QA 1XMBA 5B0GA 1Q86T 4WTYA 1FNOA 1WOOA 2XTJP 4K8RA 3DLEA 2E1CA 3VR1A 3K0JA 1MWYA 1R27B 3DDIA 4KB7A 4EO8A 1ROFA 2PD1A 4NRTA 4DZ6A 2I5JA 1PAEX 2IA0A 4WK3A 4F4KA 1SH2A 1FESA 4KO0B 1JKHB 2LKZA 1NNDA 3V6DA 2KKHA 2ZHAA 2ZH9A 2E9ZA 2CPHA 3F0NA 3B6BA 4C4WA 4IG3A 1EX8A 3EVOA 1F3FA 1RAHB 4FP9A 2VJUA 4ZLLA 4ED7A 3MCSA 1SKUB 3MUTP 4FS1A 1RT5B 4G1IA 2B51A 5DDPC 4JI4F 2EWHA 2FGOA 4PAAA 4U7UK 4H4MA 5G0RB 3NBPB 1KLMA 2XMAA 3V4MA 2JLEA 2IRXA 2DPIA 4DV2F 2IC3A 2VQEF 1FRHA 2OH2A 3W8PA 1SPBP 5AXNA 4LIWA 4QWAA 1KP6A 1AZSB 3FZ2A 2CG4A 2MZSA 3N6LA 5EHHA 2KN4A 4U6PA 2OPSB 3PYEA 1RAGB 2HPUA 5HP1B 2HGMA 4H4MB 3WC0A 5CZXA 4B9SA 1S59A 5M2RA 3BDPA 2K2PA 2UXDJ 3CJ8A 3NWGA 1UA0A 2XWXA 3D0GE 4CNZA 4EI2A 2D3OR 1VC0A 1DQ8A 3BO3A 2QZ8A 4YB7A 1WHXA 1F5CA 2HLUA 1FRLA 1WHVA 3C46A 5AXLA 2CQ3A 1YJRA 2Q79A 3JSYA 4CP5A 3OL8A 3QSIA 5FD1A 4Q2MA 5D4PA 2FJEB 4FDFA 3KLFB 3CCUS 2X1BA 3DKDA 2CPJA 2FC9A 3DOMB 3HJVA 2ZKUA 5L46A 2N4DA 3IR7B 2DR5A 1Q16B 4JI6J 2YKAA 5KFLA 4B9UA 3GJRB 4RJVA 3BJYA 2R2TA 1N5YA 3ZNUA 2MXYA 3MAAB 4RU2A 3KJFB 4NLTA 2N3OA 1VJWA 2WAQD 2ZITA 4U96A 2FQQB 5M2UA 1NLKL 2IC3B 2NLWA 2YNIA 3MD1A 3MF5A 4Z7CA 2AIRB 1JLCA 4A8QA 2CPIA 3PVXA 4LRBA 4NL5A 3TZYA 3TA1A 2VKZG 2HLTA 4J9UE 3M30A 1B4SA 4ZITA 4NLXA 1WSRA 4O4GA 4DL0C 3DXBA 2GMHA 2IJFA 4ZLJA 1U6BA 1RTHA 2QGFB 1H7XA 4UOCA 4FXWA 2DK2A 4NCGB 1GXLA 5LXRA 4DFJA 3VALA 3L7PA 2HVIA 4UZBA 3A3NB 4PUOB 1Y11A 2CQDA 2QL9B 2YWFA 1NMEB 3WX4A 4KHRA 5GADI 2W4PA 4O4RA 3GJQB 4AT1B 3CDUA 1JLGA 1S1VB 3D1OA 1CJKB 3VCDA 3UCUP 3D66A 4XAKA 1S7IA 3LP1A 1TTHB 2W2PP 5KFSA 4WXWA 3Q8YA 3U02A 4X64F 2GV1A 4CO0A 1NSAA 2JLFA 3T1HJ 4ZJLA 1U6ZA 1M1KT 4UOFA 2KT2A 1V3ZA 2AYMA 1MU2A 4KFBB 1SL0A 1X31C 3SXLA 4ED5A 1M5SA 4EO6A 3T9ZA 4CDIA 3RB4A 3MCOA 2W9CB 3ADAC 3QAEA 1VHIA 3DNCA 2H9ZA 3AOAA 3JYTB 1N32J 4HTIA 2F4VF 2XY7A 2JRSA 3G8QA 2UU9F 3DFEA 5T7LA 1NDPA 2PFDA 3A4TA 1N34J 2ZC3A 3KHHA 3D68A 2HIYA 3BQ0A 4PZVA 4DBQA 2QL5B 5KFIA 2LFVA 4ZVEA 5L1IA 2MZTA 5DETA 1P1TA 2NPFA 2BE2A 5KFHA 1RJJA 3TAMA 5G0RA 4A8XA 4G1QA 3M6VA 1DTTB 1WF2A 1IR0A 5F9NA 4OYOA 1C0UB 2PDAA 3AOBA 4X4QA 5AE2A 2C2OB 3NWRA 3DLJA 3GP9A 4QIWD 4DR1J 1MROA 1U7LA 2KZMA 1D8ZA 2GHPA 3FEZA 4USIA 1I94F 1MMLA 3T1AA 3T19A 5KG3A 4F2RA 1Z4UA 5L1LA 2R7TA 3M8YA 3NGUA 3KLIB 4PXBA 2LU2A 3MM6B 1FK9B 4FYYB 3OBIA 3RG6A 2E7VA 2VQEJ 2CUYA 3R7NB 3UVJB 3V6JA 5CH7B 4CYUB 1C4AA 1F5AA 2AJ1A 2W7OA 2BABA 3CDAA 1EZZB 3Q8QB 5HBMA 4DPWA 1W2IA 3A8IA 2XNQA 1OSCA 4F3QA 1TAQA 4X65F 1Z1ZA 2E1RA 1QVFR 2QL7B 3BS9A 4CH7A 2YWWA 1K1SA 3LUYA 3C6UA 2IVFB 3OJUA 2HRYA 2OEKA 1YHQS 5HROB 4LRDA 4YQWA 1X4EA 2ASYA 2XY5A 3W5YA 5LT5A 1YTYA 4DCOB 3RBDA 2GIRA 3R2CJ 4LMZA 1WC4A 3I5CA 3JS9A 1QSYA 2XEXA 5SUHA 2YQ0A 1H2VZ 1QM9A 4RBTA 2KM8C 4NLWA 4Q0BA 1T9TA 3FKBA 3I55S 1BXNA 4N56A 2ERRA 1NKCA 4B9MA 3SDEA 3DGPA 2OIHA 1UVLA 4W90B 2YY3A 2YWGA 4DU7A 4HHHA 3CD6S 3GV8B 4DSJA 3W2VB 3FRYA 3GPAA 3IS9A 4Q45A 2HMIB 1F5BA 1UJ4A 1VRTB 1CSJA 2JWNA 3QGGA 4CIOA 3LANA 1LWEB 1REVA 2DNYA 4CO4A 3K59A 1BQNA 4J91A 2DITA 2LXUA 2RQKA 3TYTA 2W8KA 4Q43A 3JTPA 3KHGA 4UOGA 2XLJA 1IBLF 3M2VA 3NCRA 2UVRA 1FD2A 4FN5A 1GTHA 2JEFA 2OTJS 2F63A 3MMBA 4USWA 1SV5B 2IAJA 1U6FA 2RNEA 3TAQA 4DV1F 1U4BA 4NEYA 5D0GA 3PG9A 3ETMA 1U1KA 4WPAA 3RJMB 3A13A 5ETPA 3SCJE 1U45A 2HMIA 4EFAC 3SEOA 1S1XA 2XO6A 1WC6A 2HG4A 1FI4A 5AJ3F 2ZZTA 1GMUA 3M32A 1S9FA 4NLUA 2U2FA 2DR8A 3HSJA 2GMLA 3OJSA 4ZK7M 4LF7F 1ZA1B 5J2QB 1NDKA 5HVFA 5AJ3J 1R8BA 4C8ZA 3CJTA 2E5LJ 1G2EA 3CO0P 3CJ2A 5KG7A 1P27B 2R9LA 5KT5A 3D6HB 4HYKA 4YEAA 2KFZA 3TRGA 2R2SA 5KOXA 1N34F 4EBEA 2HS4A 3MUVP 3GV5B 3FBBA 3NG8A 4U7CA 2C28A 4UUXA 4DV1J 1KQFB 4USKA 3DGVA 3OHAA 4ZVHA 4ID5B 2YWHA 1F3VA 2CPYA 5BR8J 1WELA 2LQ8A 1VIXA 1OY6A 4QWEA 1R8PA 4DV7J 4FYWB 1X4DA 3PKMA 1YJVA 2B4PA 2ROPA 3IRXB 5DS7A 3VQSA 1NHUA 1RA6A 2OPRB 4KH1B 4NI2B 2R7XA 3GFZA 5K8OA 2EC0A 2JOQA 2MQ8A 2L3MA 1QJHA 4RUBA 1H73A 4K5RA 2CPDA 2DGWA 1U0HB 1Z2ZA 3MWBA 4OX9F 3HXMA 1F60B 1BQMA 1ZAXA 2DRBA 4PYAA 5IOLA 4IFVA 3IR6B 1RDRA 2VPWB 2RSQA 2XSJA 3NRBA 5IQQA 1C1BA 2JJ4D 4C9DA 1TUGB 1HNIA 3KUEA 4OJHA 3TANA 1M5OC 3QGHA 1KC8T 1VBXA 2HQDA 3HHLC 2ILZA 2LMIA 4EMDA 2NZ4A 3PTWA 2YNGB 5IC4B 1M5VC 3OUYB 1IQTA 4DSEA 1G7CB 4N77A 3EGWB 1TMMA 5B0AA 2K3IA 3PACA 5JUMA 3V6KA 2RDDA 4QJVA 2VG5B 2BANA 4ZIVA 4DSLA 5ETKA 4ZOSA 2V9WA 1S6UA 1IUJA 3KNAA 4G3IA 5IS2A 2IJNA 4C0BA 3LWMA 1L3SA 2GAHC 1SKWA 1HWIA 3FBEA 4UW2A 4LF5F 3A1YG 1VQSA 1YGYA 5CABA 3KHLA 3K7RA 1UETA 4M5IA 3M2VB 2ILYA 2L9NA 2P2CB 4ELTA 1TKTA 4PPZA 2JEGA 2QMUB 3PYGA 1I94J 2R7QA 1VRUB 4ES1A 1XNQF 2MEWA 4O3QA 1RT4B 2AJ2A 2G2OA 3MM8A 1AROP 2ADCA 1RYSA 4TXSA 2FUG9 2P6SA 1APSA 5KG5A 1Q1KA 2DBBA 1ZA2B 2M3DA 3P6YC 3FMWA 1S79A 2DGXA 2KU7A 5DG9A 1VIOA 3G71S 3CPWR 4ECXA 4JI4J 1KVJA 1XQIA 3V81A 3MECA 1RAAB 1I51B 1U24A 2GO9A 3TVYA 2WOMB 3WIVA 4JI5J 1OPZA 1FCAA 3TJ8A 1X4BA 1X4AA 2OEMA 2H51B 2OFGX 3M6XA 2WSEC 4WJBA 5DZ7A 3CCES 1D9DA 1HWUA 2Z56B 2AX1A 3CWJA 3OTOJ 2YKQA 1S72S 2CFXA 4WFZA 3PFEA 4RNMA 3V2UC 2XMKA 5H9EK 3MFIA 3KLEA 1RWKB 3V81B 4K50A 4DDFA 2WTFA 2SXLA 3CCJS 3UR3C 1BY9A 4YMEA 3R97A 4BWJA 3HVTB 4GKKF 2DXFA 4I6WA 5L1KA 2R8HA 4JI2J 1YQHA 2P9CA 1VRUA 3O2IA 1HD0A 4ES3A 5GAEU 7FD1A 3TJ9A 4WFAQ 3AY0A 2E5LF 1XMQJ 2W4DA 1RWWB 4W98A 4ZIWA 2R8KA 1K0TA 1KQSR 1CEZA 1VLOA 3T41A 3CCLS 2KRBA 1Q81T 2EEYA 2B7BB 1E6YA 1NAQA 2A3JA 3NLCA 3SMZA 3GB0A 5CD4A 2G0IA 5BR8F 4YR3A 2PI5A 1HD1A 4J9PA 4ZPTR 4U8YA 4Y2AA 2MZRA 4H54A 3AFGA 2NREA 2GW8A 2RUSA 1C1CB 3CJ3A 4USTA 2AJ4A 2F9DA 4FKXA 4ED6A 5FIIA 2B4OA 1JLGB 1S1VA 2WBMA 1LOUA 2AJQA 2LYVA 2Z0GA 3LF0A 1LK5A 2YNGA 4ZVUB 1R89A 1YSJA 2XQCA 5KG4A 1TV6A 3N5FA 2M5YA 2PGCA 2QLWA 1RCXB 3CD0A 4HACB 2BQ3A 2CQPA 3M2RA 3HDSA 3R2DJ 2J7WA 1TL4A 3M9OB 3BB5A 3PR4A 4PUOA 2B8PA 2HFUA 5MAOA 2W2QP 2NXJA 2VQFF 4JYAF 3GJTB 4O0NA 3TW0A 1DQ9A 1X5PA 2BYCA 2Q1LA 4HVZA 3QT7A 4OI3A 5C2GA 3JYTA 2L9WA 4WE1B 4K4WA 1YRTA 2KYXA 3TR5A 3CDEA 1ACMB 1NPKA 3M1VA 4DR6J 5F8NA 4QZVB 3J81U 4DS5A 1X5SA 2HVEA 1GNKA 4MK7A 1HL6A 3H25A 4UY85 4F4WA 1PSDA 1T9XA 1VQNS 3MEEB 3DOMA 4DR7J 3BR9A 4CT9A 4I2QA 4DV4J 2PMHA 1S99A 4C11B 3EPGA 3W60A 1LWFA 2B6AB 2HNDB 4DR2F 3ZZZA 1TZ0A 1RBLA 3WDOA 5CA5A 2V69A 4B3RJ 1RKJA 3NOGA 3TVKA 2D1CA 3OSNA 3TUPA 1QUVA 1TL7B 1RT6B 2IRUA 2M0GB 2KFYA 4UY8T 5HL7Q 3KWMA 4ZPAA 5DM6Q 1K9MT 2JL9A 3PJ9A 3ONQA 1KSPA 3C14B 2FJVA 3G82A 3LO3A 4DSFA 3CD7A 5D15A 3EZUA 4KIAA 1KTQA 1F9FA 4EYIB 3MEDB 4CLFA 5HMZA 1HLWA 2CIMA 4NA3A 1RHRB 1X8DA 3HKZD 4JV0A 2ZC4A 4LSLA 5E5NA 4Q5VA 2J6TA 5IT9Y 2IVMA 4C8YA 3BBCA 3RRKA 2HWIA 3UVJA 4QWBA 4DR5J 1HFEL 2CA9A 1JLEB 3M1VB 3PEJA 1KVIA 1O51A 4DR2J 1JLBA 4DR7F 1FD8A 4R5PA 2O3DA 2CNLB 3UNGC 2VPYB 3IM8A 3PRVA 3Q2SC 1NPPA 4MKVA 2EFVA 2ZZNA 4ZPBA 2ZOFA 3QT6A 1S6QB 2Q6CA 1R7IA 2E7WA 2WK4A 2ZH5A 3VAJA 1XIQA 1HNZF 2XGPA 2DNMA 3P5BP 1LWCA 4RWWA 2MKIA 1IBMJ 3EYZA 3DU6A 2RIJA 5A0YA 2MQQA 3G6YA 4B3MJ 2NR0A 2H3EB 2RKIA 1JWWA 1K73T 3MPWA 3C16A 3MMJA 2ZBRA 2ZBQA 4I7FA 3BSNA 3SCLE 1SC1B 2GNKA 3ZTPA 5J1EB 2RRBA 4GVBB 2MSSA 2I5JB 4OYZA 3UWTA 3QZ8A 3BN7A 2DR6A 2C42A 2CZVC 1OQ6A 3H4DA 2HAFA 3NY0A 1V5IB 3U27A 5IT0A 2AJFE 2KVQE 3DM2B 3BREA 5KFUA 4ZCMA 3G87A 1CQNA 3FVYA 5CYMB 2C3PA 2C2MB 2GCFA 4RL1A 1HMVA 1PC5A 3D2WA 3B78A 5HQLA 4LREA 1JJ4A 3UD4P 1MMDA 3DLGB 1I6JA 1S77D 3FSYA 4ZKAA 2FVSA 3QLHA 2DXDA 2H54B 1C1BB 1GXTA 3EXYA 1XJWB 1FNMA 4LF1A 4URGA 4C8OA 4WZMA 1CLFA 4IFVB 3GILA 1BE4A 2IAJB 3KK3A 3IO1A 2UXCJ 1Y00A 4ECYA 1MSWD 2RS2A 2LEBA 4HT5A 1IBLJ 2DGOA 5C24B 2ALZA 2UV8A 2UUAJ 4I6YA 4RW6B 3EXCX 3ZXWA 3HM9A 4AFFA 1Z2LA 3GMGA 5J1EA 3J7YI 4EBCA 3W64A 2M4MA 4ILLA 4MYUA 2KXFA 2OPQB 2WBRA 2HBQB 2XS5A 4QCLA 1T3NA 3OL6A 3OT9A 3I5BA 3H5YA 2VPZB 3KDNA 1B0TA 4CQ1A 1VYAA 3G9CA 2ZH4A 3NMRA 1IJEB 1XC9A 1T02A 4P2XA 2PSZA 2XG8A 1B0VA 3DRPB 4IKAA 4RO0A 2XLKA 1NK4A 5IV4A 2MZ1A 2Q6BA 3QIPB 3OW2R 2R4FA 3KG0A 3L95X 2AX0A 4Y2CA 3KK2B 3EMTA 1UFWA 4F4XA 1RAEB 2LXIA 4CLYA 1UWBA 1RTDB 1QE1B 2DNHA 4MIWA 2R42A 4TU7A 2Z58B 1NK9A 1G6BA 4F8RA 3M8PA 3IG1B 2NSBA 1S1WB 3OFGA 2V4RA 4DR4J 2RQ4A 1QUPA 5DDQC 3B54A 3A8EA 2U1AA 5FDLA 5KFDA 4OL8A 2W1BA 4UT4A 2KHDA 2VG7B 1YBUA 3MM5A 5DRKA 3PW4A 4U9RA 4LR9A 2XBPA 2N7YA 1RZMA 3MAAA 2LLZA 4IQMA 3IBFB 4IG0A 1NB7A 3QO9B 3PIPQ 2VPXB 2XZWA 4ZP8A 2DEJA 4Y2KA 4PWDB 3ZTOA 4OI0A 5F8JA 2PE8A 4QIEA 3TUJC 2M88A 4UZCA 4I68A 1C0TB 3M05A 3HSDA 2PEBA 1HBNB 3PCOB 3PDNA 3R6GB 2AQ4A 1SC4B 2PO4A 2VA3A 4GO5X 2D74B 2HHQA 1CPZA 2KHCA 3GV7B 3MR7A 3UDVA 2ZH8A 3HLUA 4E8UA 3CT9A 2FZKB 2QA2A 3EM1A 2MQNA 2BEFA 4NZ6A 4DL4A 2GVZB 1S12A 2OJ3A 3FSXA 3MM5B 1RT2A 1TMJA 2N82B 2HEKA 2ALYB 3JSMB 3RB0A 1NJZA 1RUSA 2P9EA 2JNJA 2LVWA 1JNZB 4LBHA 4O3PA 4DUTA 4OZ0A 2J8AA 5HP1A 4HDGA 3H5UA 3EE3A 4IO9Q 3D9BA 4KHPJ 2F4VJ 4EGLA 1S48A 4B3TJ 4NXNJ 3I56S 3SSQA 4ZN1A 3KLHB 1C2PA 4ZHRA 4EK2A 3VAKA 3TOQA 6FD1A 2W9CA 2M52A 1H6KX 1GK8A 1O0PA 5AXKA 2ASDA 1N5SA 1RHMB 5C42B 1VQ7S 1T7PA 1AXQA 3N0VA 4C2MA 5LSOA 2PI4A 3Q22A 1VR6A 3Q23A 1PC4A 1VJQA 4GMKA 4X62F 3SSSA 1HI1A 4Y0FA 3POTA 4HTJA 2BQUA 3I5AA 4FBTA 4XK8C 1HBOB 3ENAA 2K8GA 4MK9A 1IKXB 1H98A 2H4YB 2LA4A 2ZNYA 2FZCB 1TR0A 2J76E 1HARA 4BHQA 5LJ3Y 1DARA 4N5SA 3CW2C 3VAGA 4ECUA 1XR7A 3RR7A 1FDNA 1FE0A 1P1LA 2HFOA 4C0HA 4DR3F 4MKYA 3AHPA 2MLYA 4M5LA 1RAOA 4IOCQ 4LF4F 2JHEA 4NI2A 1KHWA 3JSBA 4WE1A 1EJ7L 5EWEA 3OVBA 1ITPA 3C8YA 2NSCA 3HVAA 4C8LA 4X4UA 4YS2A 4MTPA 2ACMA 4HR2A 2J9CA 3HVTA 4DXLA 4DF8A 1DAXA 3CD5A 4Y2IA 1KDNA 2MJNA 4ED2A 2NQPA 2QFIA 2L08A 2DYAA 1JJCB 3S6EA 8AT1B 3ZZRA 1YG0A 4FBUA 3CEDA 4LF4J 1LKZA 4G65A 2V2VA 1UTAA 3PXGa 3TZWA 3GIIA 3PY8A 3F56A 1YK9A 2Z2LA 5A8RB 4DL2A 5HN0A 5B0BA 2B43A 3PYFA 1ZTWA 2CKWA 2LXFA 3OLBA 3OVAA 1HNVB 2R2UA 3QGIA 1U8WA 4CLUA 1RLDA 1VRTA 4B9TA 3KJQB 4DPOA 2RU3A 2YTCA 4RWXA 2C3YA 4RUCA 5KT2A 4YFUA 4LQ3A 3QWUA 3DLBA 2R8GA 1FXRA 4TYAA 4KYZA 4DX6A 1RACB 1SIWB 2NXNA 4WU2A 3BBFA 3W5ZA 1WNEA 1WI8A 5CZVA 5IWAF 5HLFB 1T11A 4P74A 2CJBA 2E44A 5ETRA 1KRPA 4ERDA 3P45B 2DNQA 2AGOA 2MLXA 1FHTA 1VQ9S 1OPIA 1RTJA 3KUHA 4LF2A 1CG2A 1HQ2A 5I3UA 2A18A 2PFFB 2COLA 2DHGA 3DDKA 5BJRA 4Q8EA 2Y1LB 2VOPA 3MM8B 2D41A 3H59A 4IQXA 2VC1A 4K7QA 4OV1A 2R7VA 3AD9C 1LW2A 5KG1A 4ZJOA 1VQ6S 4YB5A 1MWQA 1HQEA 2RAQA 4IFYA 2GGPA 1RLCL 4PQUA 4QU6A 5CYQB 5KFQA 5THWA 3IS9B 3K58A 1ZAWA 2AU0A 1P9QC 5K8MA 1URRA 2XULA 2YKOA 2VFUA 3MR2A 1U25A 5IFMA 4AL5A 4KGMA 3MPDA 4ATNA 1DY3A 5HQMA 3OD2A 3ITHB 4NRUA 5HATA 5LMNF 3JAMY 4DFKA 1LWXA 4DV5J 4IDKA 1IKWA 2CJYB 2MLZA 1HPZA 5CCMA 4OV6A 3QMQA 4LIRA 1T05A 1K0VA 2H48B 4PABA 3K5PA 1HBMB 1LNQA 3L9ZA 3PJXA 3RU0A 1SJQA 3SZ2A 2UUBJ 2VQFJ 1SB6A 1EB0A 2I38A 4KO0A 2B6AA 2HNDA 2V2QA 3K57A 1S1UB 5LMNJ 1UVNA 3ISNC 5I3UB 4F4ZA 2GIFA 2GVDA 2E9TA 1T9UA 1KBRA 3KJNB 2CQ1A 1YJ9S 2UU9J 3VAIA 1BQXA 1KN6A 3R27A 3JSRA 4B02A 2ZOMA 4ALZA 4ANDA 4MK8A 1IWAA 4GC6A 3KG4A 2R2RA 3PRBA 5LMUF 3AJ2A 1HNWF 4ID5A 4CT8A 1JXEA 3IWNC 2R7WA 1E6YB 4OHZA 3RZAA 1XMOF 4KH0B 1SH0A 4N76A 4D3GA 3ZZTA 2BJ7A 4C3KA 2KI2A 2OPRA 4CH1A 4KKOB 2MKYA 1BWEA 3M8SA 2V50A 1K47A 3MEGA 1R6VA 4C3LA 1BWVA 3CCMS 3LPEA 3OXLA 2VFTA 1NM2A 2RRNA 1ZM4A 1T05B 1NK0A 1UKUA 4OLOA 4NYOA 1N54B 2XSJB 3CDBA 4X64J 3ICLA 2FLNA 1CULB 3HF5A 5JMNA 1PYOB 4NCAA 2EBEA 5L8RC 3OL9A 1RWUA 4WP3A 4TQSA 1GMWA 1PG5B 1XERA 2G13A 2ABYA 5KFJA 1YLXA 5CYMA 4K4TA 5EN1A 3GYXB 4RW9B 1NHKL 4U95A 2MKJA 5KFCA 4RZRA 2YKMA 2V34A 4X84A 4DG1A 3UDLA 4OLPA 2F8EX 3QWPA 2UVVA 3IA0A 2AKWB 2QYGA 4JOUA 2JC1A 1OY9A 1FRXA 1OYEA 3GU0A 3HSGA 3SFGA 3KK1B 1Y10A 4KHPF 4LR8A 3CJKA 4ICLA 3VHQA 1FFGB 4I1TA 3FBCA 5D6GA 1KLNA 3THVA 4HI1A 2RU9A 1YRXA 3IWXA 4FF2A 2HHUA 4J9QA 1OJ4A 4IH7A 5K8PA 5IZHA 1Y3JA 4DL6A 3MOJB 3BGFA 4LFBJ 1JIHA 8RUCA 4JB8B 1GFWB 2OI2A 3TI0A 4FYXB 4F7VA 5T41A 2KXHA 2D3UA 1JLQB 3TA2A 5KFZA 1TKZB 2VF3A 3C15B 3R6LB 4L3KA 4A46A 1J5OA 4ENOA 5DLGA 5DLFA 2KO1A 3W63A 3SV4A 1TL3A 4LRCA 4CLTA 3LWLA 1QTMA 4ZP9A 2KTQA 2LP4A 3SBMA 3ZZUA 2OELA 2I2YA 4YY3J 2HVHA 2KG0A 2R7SA 1XNQJ 5KT6A 4PCQA 4RNFA 1UEKA 2QLJB 2Z57B 1MNEA 3QPIA 2QG9B 3LAMA 3ZNJ1 4USHA 3OFFA 5L39A 5DG7A 5F8GA 1S6PA 1U2CA 3TQEA 2AYEA 4A8KA 3EGZA 1JLQA 1R0AB 1J5OB 5HK4A 2VFVA 3BO2A 3H4BA 4ZA1A 4K4SA 4A47A 4HH0A 3CCVS 3B8HA 4ZPWR 4DQRA 1TFWA 4N41A 2BJ3A 4K0KJ 1S6OA 4NYPA 3G4SS 3I87A 2DGUA 4O3NA 2EC2A 1IM6A 2LCWA 3GQCA 3J7Z5 2OO4A 1KTVA 4DEZA 3GR1A 3BQ2A 3UNYA 3N4WA 1WF0A 3I4PA 3EUNA 3MM7B 1BQMB 4OX6A 4DX7A 4M95A 3UW1A 4K4ZA 3UR0A 2YWEA 4WFBQ 1N5QA 3LGMA 5E3AA 1YI2S 2FVPA 1VS3A 1ZM3A 2V4JA 3G86A 2FJAB 3HHKA 2OEJA 2ZE2A 3NGTA 2CG8A 9ATCB 5KT3A 1RT7B 3WZ0A 5C2CA 5I42A 1RI7A 2WW4A 1XNRJ 5K20B 2FHKA 1OS5A 3MEGB 4ES2A 2VH7A 3MM7A 4Z2XA 1Q79A 3R5JB 4B9LA 2G2YA 1S9EA 1Q4RA 2IIHA 1S97A 3SYZA 4O23A 2KZZA 3JTNA 3VGSA 5A8WA 4DV4F 3MMCB 4ZVSB 4IRCA 3HT3A 4K0KF 2CQBA 3C6TB 2CZ4A 5DGAA 2EBGA 1U26A 1RAIB 3CC4S 1UPPA 1HBUA 5CQGA 3AB2B 4I64A 2RS8A 2ZJPQ 3RB6A 3V6DB 1S4FA 1SC6A 2N7CA 2DCUB 3CJ5A 4ECRA 1XEZA 1U1RA 1FJCA 5FLXY 2GAGC 2JX2A 2NCKL 3ISND 1WEZA 4FVMA 4RW6A 5HVGA 4XIUA 2R8JA 4DCPB 3W7BA 1UWAA 2B7CB 8ATCB 2ZD1B 2VL1A 4X2BA 3S1TA 3EGNA 3K2YA 1F9HA 2AV5A 4OYAA 2ZH6A 1N33F 1EAYC 1WHYA 1QY7A 4J9VA 4OZJA 2XZTB 3S01A 1YDLA 2BVZA 4AXIA 3ILOA 1RAJA 1FX4A 4RUAA 3PHEA
chains in the Genus database with same CATH topology
5A8KB 5JVGQ 1KFDA 4HH1A 1FERA 1HNXF 1XR6A 1TL1B 2HAIA 1N36F 1SIZA 1PO6A 5KFGA 4O4GB 1YIJS 3MXHP 5HMWA 1XN9A 3DRRB 4ILRA 2IYIA 3OL7A 2APOA 4Q7AA 1T03B 1LQ9A 2O66A 4I2PB 3K8VA 1KQKA 3MR6A 4B3TF 4NXNF 2JEJA 3DLKB 3CJ4A 2DVIA 1QAYA 4DOZA 2FLLA 4CCHA 3KG1A 3PW2A 1UMJA 3D1HA 1Y3KA 1SBRA 2GIQA 4TU9A 3KNGA 4IR9A 4KV8A 4CI0B 3ENVA 5B7WA 3OFHA 4KFBA 4B3SF 2YNIB 4G1PA 3LP2B 1RT2B 2O1PA 3M8RA 2XCPA 2CDQA 1NU4A 5A2QY 3TNVA 1MWZA 3M9NB 3ZZYA 1NH7A 2KB2A 4OIXA 4WFNQ 3I0RB 4KC5A 1UAWA 3VF0B 3PJWA 1VQKS 3RW6A 1TFYA 1UW4A 3UFCX 1HPZB 3M30B 1RTJB 3BQ1A 2R7UA 4O0IA 2BE2B 1FRJA 3BDEA 3SV3A 3AQPA 1SJ4P 3KTQA 3LP0A 3BGRB 4KRWA 4ELVA 1HQEB 3R5AA 1U49A 3T5KA 1YVFA 2D9PA 2DR7A 4MFBA 3BGUA 2N3LA 2VZ9A 3LP0B 3W2VA 1EETA 4Y2MA 4TU8A 1L3KA 3QZ7A 1RKIA 2DH9A 1VQPS 4CO3A 2FHMA 1ZOTA 2X1GA 2BR0A 2MKCA 4EUVA 1WHWA 3M6UA 3PX4A 1L3VA 4XPCA 1L5UA 3X1LB 2ROGA 1VQ8S 1DHMA 4LJMA 1JB0C 2F9JA 2ADBA 4FS2A 3QAUA 3H2VE 1SQEA 2C2RA 1G3OA 2LU1A 3R1HA 3PX0A 5AE3A 4LFCF 2VOOA 2GJ2A 2MKHA 2HFZA 1UEUA 4HL9A 1IQZA 3ETOA 2BA9A 4BBYA 4KSEB 3I96A 1WD6A 5KFBA 2OTLS 4JUZA 3HHLD 2I9SA 5D8HB 1U8SA 1FJCA 4B9NA 4BDPA 3UPFA 5CYQA 4B08A 1OSDA 1RT5A 1R3NA 3MAQA 1QE1A 1QAJA 5E3RA 2DIVA 2C3UA 2MYFA 4OFZA 3FQKA 3NS6A 2FTRA 4URQU 4DFMA 1H3DA 5LL6d 1IKYB 3T6BA 5DM7Q 2W7PA 3M2UA 4WK1A 3I4HX 3G6VA 2UXCF 3D28A 2DNRA 3CF5Q 3C2PA 3N6NA 2V0NA 5U47A 4NLPA 3R3TA 2OSQA 4KV8B 1NK8A 1CVJA 4YDDB 5JVHQ 3PFOA 1RTIA 1L3TA 3FNNA 2CJKA 2Z2MA 2V94A 4UQGA 5K14A 2KVIA 4KKOA 1HR0F 3CIMA 4NCBA 3RRGA 3UCZP 1X5OA 1GH8A 3TQ1A 4CZCA 4WZQA 1LW2B 1NJIT 2DO4A 2CJAA 4AL6A 5HQ8A 4RLEA 4X4NA 3UI3A 2WONA 3IBWA 5CXTA 2ZH1A 3U1LA 2B9XA 1BD6A 1HW9A 1YJUA 1JLAA 2FLPA 4BWMA 4RW8A 2NUHA 2KJVA 2V5HG 4QIVA 3H40A 2RB7A 4K59A 1VQOS 3MM9B 2ATLA 3I9V9 5IM0A 3CCQS 1N5TA 3E2EA 4J9MA 2XWYA 2MY8A 3J81Y 1VQYA 2BACA 2RE1A 2EK1A 3IN5A 2W8LA 1L3UA 4P7VA 1IBMF 5E2QA 4O44A 1LW0A 3HZGA 3OVSA 3MZIA 4WFYA 1VFJA 2EFGA 1U1MA 2JVOA 1UJ6A 4FZVA 3VZIA 2QRRA 4RUHA 3CXCR 2ACYA 3N01A 3QYYA 5D4LA 3THTA 4Y00A 1SXLA 3HI9A 2DIUA 3MMCA 2KG1A 2DTJA 3MAHA 1X9SA 2RJZA 2YKPA 3T1YF 1ZBTA 4J9NA 5KFYA 4OZ1A 2QA1A 3G6ES 4DR5F 4A4JA 1C0TA 2FJDB 2IYGA 2OMLA 4ECWA 1U2RA 5EGYA 3PO5A 3Q0AA 4HT7A 2LEAA 4N8OA 2DRAA 4ECQA 4K4VA 1Y5NB 4M8LA 3QJJA 2ZKTA 4J9RA 2ZUGA 4ZS6A 3DLEB 2VG6B 2R8IA 2RVJA 1FTRA 4YUDA 2RF2A 2EW9A 4MMOA 2MJUA 4YR0A 4DN9A 3DHXA 5KFAA 1VHFA 4IO1A 2P5VA 1J2VA 3NBPA 2YNHB 1RGVA 1UVIA 4Q8FA 2J5AA 4A48A 2V4JB 5K14B 3MR5A 2PA3A 3QO9A 4V19J 4TLQA 4ILMA 1VI7A 2RT3A 2RH3A 5LXYA 2IHR1 3O3LA 1FDAA 1EP4A 5EWFA 3HHLA 1TKZA 3DRRA 3V5RA 4PRFA 4FF3A 2B5JB 3GFXA 3DOLA 3L3CA 3DMJA 3BSCA 2PC6A 2OKQA 1WI6A 2VUGA 5LJ5Y 4F4YA 1NKEA 1IBKF 2E29A 3DDNA 1UWBB 4OJ1A 2LDIA 2MSTA 2UUWA 5D78A 5F9LA 1RTDA 4FXVA 2NPIA 5EDWA 2YQ3A 3H2UB 4X4RA 1HQUB 2KXNB 2QSFA 3CIZA 3T1HF 2DO0A 4OZLA 5J2NB 5D4NA 1Y9OA 4B17A 3KYLA 2JVRA 3ZC4A 3Q8RB 3VAFA 1RQ0A 2VFRA 4LSLB 2DNLA 2VBXA 1V3RA 1VOMA 1RT3B 5G4DA 4IRDA 1EP4B 1YJTA 1AFJA 1JLCB 4O44B 2HWTA 2OD4A 4RNOA 2QYCA 1IN0A 1ZM2A 2FIUA 3OV7A 2IRYA 2KJWA 4OI2A 1YJWS 2DISA 2H5EA 3W2WB 3FDSA 2EKYA 3MMAA 1WF1A 1QLNA 1SUQA 1X4HA 1SI9A 2QSWA 4X4VA 3VWSA 3J80Y 2F1FA 1HHSA 2UV8G 4EU0A 3L7OA 4WYLA 3OTOF 3R1LA 2B4UA 1S76D 3I0RA 4M5DA 3QLHB 5KTQA 4YP3A 3PKYA 4H4OB 1N56A 2WB1D 2J0XA 4H4KC 3MEKA 3G8TA 2F40A 2QFJA 4MKBA 1YRUA 5FJ4A 1TQLA 1LWFB 3O5TB 3RAMA 2VASA 3KKFA 1N0UA 4ZPCA 3R5DA 4RW4A 5H1SV 3MPVA 4LSNA 3MFHA 3RB3A 2K1RB 3HJFA 2KYZA 2IBOA 1NK7A 4EBDA 2OFHX 2ASLA 1H7WA 4HI2A 4J5OA 3D0IE 3MURP 1D0EA 2X1FA 1B7FA 2ZZMA 5E0OA 2E5IA 3RAXA 4C11A 3WC2A 1VQMS 1HW8A 1XWLA 3OHBA 1TV6B 1DJ0A 1W25A 2VC0A 4RNNA 3R5BA 1VBYA 4C8KA 1RT6A 3FRZA 4NOHA 2CPEA 4L6V3 4ZP7A 3OR1A 4CO2A 3N79A 5CYJA 3IGNA 4NA2A 4XDCA 1FNXH 1K1QA 3PNIA 5KFPA 5JXSA 4AQYF 5KT4A 4R8UA 2IM2A 3T9NA 5DQIA 4X66F 1KR4A 2F8HA 5C5JA 1X5TA 1XBWA 2HWHA 4IRKA 1S0VA 4Y6IA 2JLGA 2PMZD 4LUBA 4BS2A 1TL1A 3IWLA 3OXFA 3UQSA 3DOKA 2CQ0A 3MTKA 1GX5A 1N48A 2IM0A 3NS5A 3GE9A 4IOBA 1ZZFA 5D4OA 1U1LA 4NLQA 1SL1A 2FHOB 3HZEA 2O01C 2BM1A 2WB4A 4Y34A 2XGQA 4PQUB 2AJ0A 2RD5C 3CJKB 2D7SA 4DR1F 5IM0B 1RT4A 1JXLA 4F02A 1UP1A 4BC9A 3IRWP 1IKVA 4DSIA 5E41A 2XMMA 1Q53A 1AFIA 4JBCA 1OIAA 4FXDA 2E5GA 2F3JA 3ENQA 4DV0F 3CMES 1OQ3A 5KOWA 2GQ2A 2Y1IA 4IH5A 1PGZA 2AGPA 4PXCA 4A8WA 4FF4A 2CPZA 3HP6A 2HGLA 1N6QA 1B64A 5F8HA 3EX7B 1RA7A 4DWIA 2AW0A 3GIMA 4KPYA 2FLOA 2HHTA 1SL2A 2HVZA 1RYRA 3IR5B 4RX6A 1NJXA 1LWEA 1REVB 1TKXB 2A1BA 1NO8A 2XMJA 2A10A 2HQIA 4Y3CA 3RTVA 4DS4A 1BLUA 2YKMB 3KFWX 2XC9A 1KHVA 4B3MF 1N6QB 4NYZA 4DHVA 1RP5A 2E5JA 4ZMMA 4JI7F 1IKXA 4B3OA 2BRLA 3RAQA 4HDHA 2ZJQQ 2CQHA 1HNIB 4EWTA 3MMBB 2BANB 1HHTP 1DBDA 2M8HA 4FVCA 1HBMA 4J37A 4WIIA 1JLAB 2MHEA 4QQBA 2J9EA 2JZ5A 1Y4ZB 1ZPWX 5K5MA 2Y1RI 4GKJF 1Q8LA 3MHYA 4MIBA 4HHJA 5D77A 2DH7A 1LFPA 4JI5F 3H98A 2ZD1A 5LSRA 3LGNA 2YX1A 4ED1A 4FPRA 2G4BA 1JK9B 2FVQA 1R43A 1V3SA 2G1DA 2QMXA 5B0DA 1NEEA 2DGVA 3FJ2A 1IM4A 3O8WA 1S0MA 1UA1A 2KM8B 5DDOC 2JEIA 3FZBA 1D8YA 4QYRA 2XHWA 2X51A 2FHJD 2QEXS 4PG5A 2W24A 2WRMA 1HWLA 2XO7A 2QMWA 3RBEA 4WU3A 3DMJB 1VMBA 4ZCLA 1X4CA 2EG2A 3AA9A 3CE8A 4MKAA 3HHDA 2FY1A 5GVQA 2MY7A 1QSLA 4JV2A 4KJIA 4LVNP 5AE1A 2JH3A 4I4BA 5C42A 5B09A 1ZTTA 1R31A 3RR7A 4QBUA 1GAOA 4OQJA 4Q44A 2DGQA 5GAHU 1S1TB 2LECA 2Y1JA 4QIGA 1TL5A 2YH1A 4I0WA 4DQIA 4WKYA 5E3QA 1URNA 1N0VC 1M5HA 2CJQA 4KTQA 5T14A 3IXQA 1V9OA 1SV5A 2C3OA 2LEPA 3U7JA 1WACA 3OSPA 5BYRA 1IKVB 2VG5A 2Q43A 4LVOP 2KDOA 2ZE2B 3E8OA 1N4LA 2PEHA 5AXMA 1S10A 5C25B 4IFYB 1KFSA 4DJBA 4A8SA 2ZHBA 3VQTA 2FVCA 4F2SA 1D9AA 1FKOB 3OUYA 1LV5A 3KOAA 4PG8A 2J9DA 3P3DA 1D3WA 4ECTA 1N5VA 1DZ5A 3GG1A 2HHPA 3O6QA 1TKDA 3VTIA 2AF6A 2FHJA 2RUGA 5IQ6A 5HI7A 3KLHA 2A2DA 1FVQA 4QOTA 3NNCA 3BEGB 2XMUA 3H5SA 3VZHA 1I1GA 3N5BA 4IG0B 2HFNA 1U1QA 1TL3B 5ADZA 4MFBB 3QGPA 1QAIA 1ULRA 2OSRA 3K5OA 5C25A 4OI1A 3BF4A 2YKNA 3CMAS 2Z4PA 4DV6F 1DURA 2X3GA 3U1NA 3PO4A 5MLCV 2WW8A 3IC1A 4CO5A 2EK6A 1XR5A 3IAM9 4PWUA 4OHWA 1HWJA 3HMJG 3K8WA 2GHWA 5F0WA 2HHWA 1R0AA 2AYGA 4H4OA 1LXJA 2K7KA 1WG1A 2I0XA 3JSMA 5DO2A 4ZDNA 1LW0B 2XMVA 4CNYA 2W9BA 4OMFG 4U67Q 3VAHA 4ETXA 4NZ7A 4JI8F 1VK3A 2B5JA 1TP7A 3P5TL 2VA2A 2VG6A 2ZNZA 4YHHF 5KFWA 4QR0A 4R25A 3Q24A 3V4IB 1HMVB 2W9BB 3OTBA 3GSDA 1AUDA 2V2KA 3T6JA 1ZAVA 1NJYA 2MZJA 1U48A 1RT7A 2NS1B 2CQ4A 1RK8A 3MMAB 2HNZB 2VBYA 2RRAA 1ZETA 4ZCKA 1Y5IB 3HPOA 1FJEB 1CC7A 4LF8F 2XNRA 3H2LA 1LK7A 4ZLPA 3K5MA 4DQQA 4DSKA 1M5KC 4J9SA 5KG2A 3FFIB 4QIFA 4ECSA 5DG8A 1TK0A 2YNFB 2UP1A 5HBMB 4YOEA 1E6VA 2HZCA 2RF2B 3HFKA 5LSLA 4MJKA 1SUQB 5B08A 3PV8A 2V8HA 1DFDA 5HLFA 2QT7A 1HI0P 1FK9A 5L38A 3C6UB 1U2FA 1GQEA 1MMNA 2NUUG 2VFSA 3IAS9 2XI2A 3CTRA 5J1NA 4DEZA 2MDAA 1DTQB 4D3HA 4X65F 2GA7A 1TVRA 3NMAA 1XNRF 2VD3A 4YDXA 1S0NA 4M63A 3G96A 2CJ9A 4NLOA 1Q8IA 3LQVA 3P96A 4RBUA 2FDNA 3CSKA 5L1JA 2DHSA 3KK2A 3EZ5A 2B4VA 2DNKA 5H9FJ 4C8NA 4K4YA 2FB0A 2V9KA 3DRSA 2KRRA 4C7QA 1B0PA 4DL7A 2UUTA 3DOLB 1S1WA 2W25A 1MROB 2YNFA 2BQRA 1UEVA 2HS3A 2VBZA 2N4CA 4M1KA 1DRZA 2XS2A 4PG6A 3M9MB 4JI1F 4DQSA 2MB0B 2QE5A 1VGYA 1A6LA 3T3FA 1Q82T 2LQ9A 4DF4A 3MM6A 2VONA 3UCGA 1VC5A 5DGBA 4NCGA 4PQAA 5GAGU 3DLGA