4DPOA

Crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
NLYFQSMLAIRVVAKNQVKPEKVQEFMNLCKSLIEETLKEEGCIDYGVYQELENPEILTMLEEWKDEGSLDQHIRSDHFKEIFPLLSECLDKETEINIYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein
publication title Crystal structure of a conserved protein MM_1583 from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Unknown function
total genus 25
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dpoA00
2QIFA 2GV1A 3BF4A 2RSQA 1KVJA 2FHMA 1YRXA 4NL5A 4OJGA 4DL0C 1YJVA 1P6TA 2FTRA 5A6PA 1N5QA 2KT2A 2HQIA 3CJKA 1KVIA 2BUNA 2QYCA 3K7RA 4YEAA 5B0CA 2K7JA 2OFGX 3TOQA 4A48A 1Y0HA 4A47A 2BYCA 3LO3A 2XMVA 2XMWA 2XMUA 4A4JA 5A6WA 1SI9A 1Q4RA 2GGPB 3TNVA 1FVSA 4NPOA 4OJHA 5B0EA 3KNGA 2W4DA 1P8GA 1TL4A 1Y3KA 4OIXA 1VQYA 1APSA 1LQ9A 5B0DA 1YG0A 5K9FA 4HI1A 1V3ZA 4YDXA 1U7LA 1R6YA 2HLUA 2JDJA 2ROEA 1FD8A 4FNIA 1X7VA 2XMTA 1ULRA 3BN7A 4ZA1A 1OSDA 3VTIA 2XMKA 3T9NA 1Y3JA 4HH1A 1X8DA 3TRGA 3HFKA 1VQSA 2OFHX 3FRYA 3I9ZA 3MCSA 1N5SA 1KQKA 3KG0A 2GA7A 3BR8A 1WD6A 1K0VA 3E8OA 3FMBA 2KT3A 3HX9A 2ROGA 2BJEA 3CJKB 1CPZA 2GFFA 4HI2A 1JWWA 3UDCA 5B0BA 1Y9OA 2HLTA 5B08A 3LGMA 4Q2MA 2K7KA 1TUVA 2GCFA 2PD1A 2RU9A 1W2IA 2K2PA 2OAUA 2AW0A 4DN9A 2N4CA 2ROPA 3MZIA 2OP5A 1URRA 2QLWA 2CRLA 1N5VA 2RILA 2ZDOA 2GO8A 3HHLA 1AW0A 3BM7A 1FEEA 1S6OA 4HL9A 1Q8LA 3FGVA 4OJ3A 2FIUA 1TR0A 1QUPA 4Q2LA 4Y2KA 3HHLB 2K1RA 3GZ7A 2LXFA 1AFIA 2VH7A 1Q8BA 1Q53A 5F0UA 1OQ3A 2IYGA 3KKFA 2HIQA 5B09A 1OQ6A 2FB0A 1S6UA 2KYZA 4HH0A 2N4DA 3WDOA 4FNHA 1MWYA 2ASYA 1AFJA 2QLXA 1X0PA 1YJTA 2AJ1A 1YJUA 3HHLC 5IXUA 1TL5A 2AJ0A 4Y2MA 2EW9A 5T7LA 1RJJA 5F0WA 2VV5A 4U9RA 4ZOSA 1OPZA 2OD6A 3BB5A 2OD4A 2PGCA 4DPOA 2HFNA 2ZDPA 1FESA 2LQ9A 3DXSX 2AP6A 3IWXA 1GXUA 5T7LB 4OJ1A 5KAKA 3LGNA 2W4PA 2HFOA 2KKHA 3QGPA 2BBEA 4QOTA 3BDEA 5B0FA 3HF5A 3HDSA 2XMMA 3DCAA 3HHLD 1MWZA 1YJRA 2GGPA 1CC7A 2OMOA 2N7YA 4A46A 2XMJA 4Y2IA 2LDIA 1XBWA 3KG1A 5B0GA 2L3MA 2OKQA 1FVQA 2K1RB 5B0AA 2LQBA 2W4CA 2IYIA 1IUJA 1GXTA 3IWLA 4F67A 1CC8A 2G9OA 1N5TA 1FE0A 1FE4A 3F44A 4EFAC 2RMLA 1SB6A 2BJDA 2Q3PA 3QMQA 3BGUA 2ACYA 1SQEA 1JK9B 2IFXA 1TZ0A
chains in the Genus database with same CATH superfamily
3CCTA 3EGZA 4YUDA 1UFWA 1S9EB 1MMDA 2NREA 3MPDA 1LW0A 2QN6B 4WTOB 4CI0B 2J8AA 3MR7A 1WC6A 2VZ9A 3DNCA 2VFTA 2CQCA 4DFPA 3HVTB 3NNHA 3HSJA 1KONA 2GA7A 4B9LA 2YWHA 4EO8A 7AT1B 3BSAA 5I3QA 3KHRA 2NZCA 2JLEA 1MROB 2UZAA 4YQWA 3H5YA 3W66A 3FBCA 3PW5A 5FDLA 2XEXA 4B3RJ 2F8EX 1U1LA 2RDIA 2VPZB 1OY6A 4NYZA 2UV8G 2ZH3A 5EN1A 3FVYA 1VC5A 3MUVP 5ETSA 2NPIA 1RAOA 3MR5A 3LOUA 2JZ5A 2HBZB 2YNFB 1T95A 3CJ8A 3T1HF 3EPIA 4NX9A 2QSFA 2NXUA 4Y28C 2YNHA 1U6ZA 1RT1B 1EQMA 4WIIA 1M5HA 1K47A 3KHLA 4BWMA 5F8GA 3GJQB 4ZPDA 4JI4F 5H1SV 2J76E 3R27A 1T02A 4YFUA 1UFLA 3PHTA 4GRSA 2HW3A 3G6XA 3D5MA 3HX9A 1HWIA 3J7YI 2ZJPQ 3OUYA 1B0TA 2WVEA 1SUQB 5IM0A 4W98A 1HLWA 2HFSA 3PX4A 5I4MA 5KG5A 1QM9A 4ED2A 2MY8A 5K14B 3OFHA 3F41A 1QJHA 3RBDA 1S59A 5IT9Y 3IWXA 2RDDA 3VVTA 1TFYA 2GIRA 3H7HB 4JP8A 2E5GA 1U2CA 2V4RA 1KR4A 2VBZA 4OYWA 4CYUB 4OYMA 4ECWA 2IC3B 4FYWB 2RSQA 3JXOA 1DLOB 1TK0A 4LFCF 3ZZPA 1HWLA 5E3PA 4L76A 4WFAQ 3PACA 1VQYA 3HVTA 1Q82T 2DEJA 2B4PA 3CUNA 4EWTA 4ZHRA 5E3AA 3U1MA 1N5YB 3G82A 5KT4A 1YSJA 4H4KC 3HSGA 1EP4A 1ZYQA 4HI2A 1PJ5A 4LFCJ 4DU8A 4DS5A 4OI2A 1GX6A 3BBBA 2F65A 1IBLF 5B7WA 3GZ7A 4F3QA 2A6MA 4LFAF 1X5OA 4HKQA 5AE3A 1FRMA 2F1FA 4HTJA 3IBWA 5CD4H 4P10A 5F8JA 2DY9A 3T6BA 2GHVC 1U1PA 1J2VA 1FESA 4AL5A 1U8WA 1JLEB 3CNQP 1IBLJ 1NAQA 3DLKB 1YZ7A 2MQMA 3SZ2A 5B0AA 3TAMB 2MQ8A 1RT4B 3UE2A 4ED0A 2DGQA 3IG1B 3KG4A 4OZNA 4DU7A 4IQMA 1WF0A 4CLPA 2PEBA 1VC0A 3K5OA 5CZVA 1IR1A 3AD9C 3ADAC 3R5GA 4F4KA 2MQQA 3UDLA 2DR6A 2ZNZA 5D15A 3TX0A 4C97A 5LSRA 3EJMA 4I2QB 1SUQA 4ES3A 3PNIA 2ZZTA 3OSPA 2MTLA 5B08A 4DXLA 3CSKA 3MGJA 3SQGA 3V6KA 4ENOA 5EHHA 5K14A 4Y2KA 2OTJS 3M32A 2DHSA 1FRHA 4DR4F 5CCMA 4C8YA 2M4MA 2AT1B 1SH3A 1VQ5S 1VQLS 4E0DA 3QYYA 3H25A 2LQ5A 1J5OA 3IBCB 5B0FA 2PFFB 5CAAA 3N6MA 4CYUA 3G6ES 3H5XA 3GU0A 3OV7A 2O66A 2IC3A 2W4CA 2QA1A 1IUJA 2R8GA 1ZZFA 3PV8A 4HACA 1Q5VA 3E51A 1DLOA 3R7BB 3UCGA 5BJRA 2CNNB 2FVQA 2V9KA 4L74A 4OZ2A 2HQGA 2WSCC 1M5KC 2KL8A 5J2PB 3CCRS 3VVUA 4NASA 2ZH6A 2A2DA 2E1AA 2RHQB 1H0HB 4QWCA 2IRYA 3PRVA 1N0VC 3KLHA 2HVIA 2ROEA 1M1HA 1FD8A 2HS4A 1N5YA 2Y9HA 2VONA 4B9SA 4F0KA 1RKJA 2KTQA 3LGHA 3Q86A 2K7KA 1UA0A 1VK8A 1W2IA 4KR0B 3MMAB 4FXDA 4W92B 3W62A 5KT3A 1U47A 2ZH9A 2KI2A 2FPHX 3JTOA 3Q22A 3SV3A 1B99A 4Z7CA 3B4MA 1HQEB 4AXJA 3F56A 3GSIA 5CYJA 2FC8A 2QV6A 3GMGA 1A0OB 2DXFA 3DLKA 4ELUA 3QGHA 1C1CA 3C2PA 2F4VJ 2W4PA 3Q24A 1N8RT 1NJYA 3JSBA 4KQZA 2V63A 1RAFB 3D6MB 4YHHJ 2MKJA 1RDRA 3V6DB 1RT4A 2G9OA 2VPYB 4KRWA 1S4EA 2IFXA 2X1AA 1QTMA 4RWWA 3AJDA 4I69A 1O51A 1F9EB 3W8GA 1VISA 1JIHA 3L95X 4WFYA 3ZXWA 2FZKB 2CPJA 5DQGA 4KV8B 1B0PA 2M0GB 5D4OA 2CQ4A 1T9VA 1URRA 3RTVA 4F4WA 1YITS 3WX4A 1LWFA 4FZVA 1FEHA 2M70A 2E9TA 4NLWA 2XS5A 2MQNA 3EE3A 4DR3J 3DI6B 2MHNA 3QGPA 3OL6A 4QOTA 2X1BA 2MJUA 5AXKA 2HIYA 4E8UA 1SJQA 2GJFA 4M5KA 2AEMA 2LMIA 3NGKA 2YQ1A 4C8ZA 4M5NA 1R6VA 2DNZA 2HQIA 2HGMA 5J2PA 3D4JA 4ZN3A 3PJXA 2BANB 3GCXP 4DFKA 2UXCJ 3A8EA 2YKNB 3CE8A 3W2VB 2KRBA 3NS7B 2GMHA 1YRUA 4BCAA 1NDKA 2F4FA 4GC6A 5AXLA 3UFCX 4DSEA 2B51A 3MM9B 3M4XA 2BR0A 2XG8A 2CIMA 1DTQB 4TNOA 1BHNA 1AB8A 3MMAA 3ZNJ1 1PIEA 5KG4A 3QO9B 4HYKA 4LREA 1N6QB 5K8NA 2YWKA 1HQEA 1FNOA 3GIKA 3UVJA 1D3WA 4NRUA 3RU0A 4ZOSA 1AZSB 4ZIVA 1MWQA 4ZK7M 3ZZRA 4CLUA 3PO4A 3MR6A 1CLFA 4NA1A 4L3KA 4U67Q 2FY8A 4P9SA 3T19A 5THWA 4P52A 3PX0A 5MAOA 1NO8A 1HQUA 1ZM9A 1DARA 3D1QA 1NLKL 5A8KA 4QYRA 3RAMA 5A2QY 2RAQA 3P5BP 3K8WA 5D4LA 1HW9A 2VL1A 3A1YG 4RBTA 1T05A 3IN5A 3D28A 4M1KA 3PR5B 3MM5B 2BE9B 4B3SF 2AJFE 3K5PA 5LXYA 1IQTA 3GR1A 4LF9J 3PIPQ 4MAKA 4JI3F 3NBPB 3ZNUA 1T9XA 3J7A1 1FEEA 4PWDB 1T0TV 4O0NA 2H51B 2DB1A 2OPQA 2IM2A 3VZHA 4LRCA 2WHOA 3DI6A 4M95A 2GX8A 3HKZD 1LFWA 4DS4A 4LF7F 4RL1A 2ACMA 1H72C 2ZHOA 3EICA 4RJVA 2HZAA 2NLWA 3B78A 3I0RB 4JB8B 1SPBP 3NNCA 3F44A 4EFAC 1JLAB 4ECVA 3K2YA 2W2PP 4EO6A 2GZOA 2FLNA 1Y0HA 4QWBA 3KNAA 2HHSA 3W2VA 4PQUA 2YWEA 4UUXA 1MN9A 2J7WA 3PHEA 1H2VZ 1SL1A 1RTJB 2RIJA 2HVHA 1TUGB 2G0JA 5J1NA 3QO9A 3OR1B 1I1GA 4USUA 2HAFA 2C3UA 1F60B 2AIRB 2E5LF 2FLPA 1UJ6A 1VRTA 2ZBCA 4Q5VA 2MPUA 2O1PA 3QZ8A 1AZSA 5HVFA 2IMWP 3MM7B 2LXIA 2DCLA 4QIFA 2EK1A 4DR1F 2RQMA 1UZHA 2VFUA 1KWMA 4CWBA 4HVZA 4J90A 2C42A 5KFIA 4FYYB 1N5TA 1XNRJ 2Y0SD 5F8NA 2L48A 2L08A 5IT0A 2EXUA 4EZ6A 1RWVB 4UOCA 2OMLA 1FVSA 4LR7A 4FYXB 1XC9A 1LW2B 1RSCA 3QFWA 2UXBJ 1SJFA 1RAIB 2VFRA 1C0UB 4Q7AA 5D78A 4K2XA 3R8YA 4IO1A 1UJ4A 3NBPA 2M9KA 5HK4A 4PWDA 2UVUA 2AGQA 2ZDOA 3QZ7A 2WONB 5IFMA 2Y8YA 2QSWA 4O44A 2DPIA 3RW6A 4DUYJ 5L1IA 4F50A 2AYEA 2DH7A 4EYHB 3ZFVA 4OZ1A 3CDBA 4KO0A 2HRYA 3IS9B 3KK1B 3I0RA 2OHDA 2LDIA 5HLFB 3DGVA 1V5VA 3M9OB 2AGOA 4DPXA 1WELA 4UZCA 2EG1A 3TJ9A 3ET6B 3D3CJ 1UVLA 1SH0A 3ILLA 4EBEA 3TA1A 5E3RA 2ZITA 1IN0A 4GKJJ 1RUSA 5HP1B 5B0CA 1TFWA 2GS8A 1P9QC 4LSLA 1X4HA 1Q4RA 3NGRA 2RKIA 4LF4J 1RTJA 4OZ3A 3JSRA 1RT3B 4GO5X 3VTIA 1N48A 4ZP7A 3R5DA 3R5JB 2BOPA 1UETA 1JXVA 5DDRC 2OEMA 3OR1A 4MKAA 4WU3A 2Z57B 2HFZA 1YJWS 4UW2A 2HVDA 1PBUA 3NGUA 3KK2B 5E2QA 5L1JA 3N5BA 2KJVA 2BKNA 5C42B 1UPMB 3MMCB 3JB9k 3PR4A 1RHJB 1VRQC 3NCRA 3AXMA 3CD7A 4LVNP 3RAQA 3VAJA 4B3TJ 2WW4A 4F4AA 1FKOB 4TKTA 4IOBA 4PEOA 1OY8A 2QLJB 2ZOGA 5SUHA 4ZCLA 1UVMA 3QGGA 1R0BG 3Q8QB 1UWBA 4G1IA 5LMUF 1FK9A 3M6UA 1YJVA 2J0WA 5CCLA 1C1BB 4FVCA 4JV2A 1LW2A 2RH3A 3HPOA 1I5OB 1HNZJ 1FRXA 1TKZA 3V4MA 5KFUA 3EX7B 3IGNA 3ZTOA 2C2RA 3D67A 3PKMA 1CQNA 1JWWA 4G6VB 4KJIA 2EFNA 4C3LA 1RXOB 1QAJA 2BXJA 3MD1A 4NMXA 1S1XA 2YH0A 3UD4P 3X3UA 3VQTA 5EWGA 3G6YA 2UU9J 1PAEX 4F0MA 1Y4ZB 4LSZB 1H2UX 2L9WA 2B9EA 2OUGA 4YR2A 1YBUA 1V6HA 1SIWB 5J1EA 2RQCA 1K1SA 3KK1A 4TU8A 4CLTA 3CCQS 2PE8A 2HHXA 1R0CB 5KFTA 2I9SA 1F0XA 3I55S 4DL4A 3JTNA 1IWGA 1CJTB 1RAAB 3LO3A 3SMZA 3F73A 2J9DA 2D3O1 1LWEA 4O3SA 3BGRB 1VC6A 3ZC4A 3CXCR 1T11A 2HK2A 1PG5B 1SCJB 1PCAA 2CG4A 2EBEA 2VODA 2P6TA 1EETA 3UDVA 3CIZA 3KK2A 4QW9A 1RWXB 1HI0P 1RTHA 2QL7B 5C42A 4A8OA 1XMQF 2QLBB 3PCOB 2ABYA 4B3MF 3BGFA 5T41A 3MMCA 2CA9A 5GAHU 3SQOP 2Q6BA 4ITSA 1FD2A 3HT3A 2ASLA 1NCLA 4JV1A 3CCJS 2LQ9A 1HNXF 3CJ5A 4OHXA 1WACA 1X31C 4FP9A 1VQ7S 1Q0NA 4DQSA 2EPIA 2DTJA 1SKRA 5CQGA 4CQ1A 2N3LA 2UUTA 2APOA 1TZ0A 1NSQA 2R8KA 2FD2A 1KVJA 1GMWD 3TQ1A 1P6TA 1UA1A 1C1BA 4TU7A 5HO4A 4Y34A 4CO0A 4QCLA 2W8KA 2UVRA 3ZTSA 3KLEA 1TAUA 2Z56B 5ETVA 1BQXA 1UKUA 1S1TB 1TMMA 5EWEA 1MW7A 2ZH5A 2FVCA 3WBZA 4WJBA 2MY7A 4J9KA 1HD0A 3HXMA 3OJSA 2WK4A 3ENQA 3H40A 2OH2A 1ZH5A 3Q89A 1RP5A 2G2OA 1ZAXA 4Y2AA 3PFEA 2XS7A 4WZQA 2BJ1A 4F3OA 4L75A 3SCKE 2XO6A 2HHUA 2EBGA 1FX4A 1XJWB 1WKLA 1UAWA 4CO4A 3CC4S 1RJJA 4IR9A 4LIRA 2H9ZA 3CCSS 4ZVGA 1GT8A 4WZMA 5CABA 1JLBB 4JI1J 3MMJA 2JL9A 4GO7X 3OL9A 5KG3A 5AJ3J 2DGOA 2H48B 4DV0J 2Z2YB 3CDAA 4HEA9 1CJTA 1I94J 3ZZTA 1X4CA 1X9SA 3MPYA 3AHPA 3GSDA 2ZJQQ 1IBKF 3BGRA 2CPIA 5A6WA 1VJQA 2WZ1A 2J7KA 3MOZA 4BC9A 3J80U 3DLGB 2DYAA 1T03B 3TJ8A 2U1AA 1JLQB 5D6GA 2CAJA 4LRBA 4DR6F 3DHXA 4OX8A 4QIGA 1HNWF 4NLSA 1U26A 1YRTA 3GYXB 3PJ9A 5KFXA 3KLVA 3PRBA 4JI7J 2D41A 2W2MP 4DPTA 3M8WA 1S6UA 1HYSA 4DR6J 4AYBD 1UMJA 4RNNA 3GV7B 1NZ8A 2YQ3A 1SBRA 2E7XA 3L9ZA 2GVDB 3PEHA 4OYBA 4LF8J 4DJBA 2W9BB 2B9XA 1D9DA 5HJXA 3I4PA 3M30A 4WYLA 2UXDJ 2B8QA 3QMQA 2ZVIA 3IRXA 3OVSA 2EVZA 4Q0BA 1VQ4S 4S0MA 4ZPVR 2DRDA 2R7SA 5HQ8A 4DPUA 1EX8A 5C25B 4UQTA 2NR0A 2W2QP 4NLDA 4PG6A 1M5OC 4E2FB 3KLGA 2FYXA 1NK5A 2YKAA 3HFKA 1U6FA 1SC6A 4OI1A 3DYAA 3J7ZT 2Y3YA 4BS2A 2H4YB 2HK3A 4B3OA 4WK1A 1QE1A 2DHXA 4F25A 5L9XA 4ED4A 3VCDA 1PSDA 4FNHA 2UUCF 2KM8B 1JKHB 5F0WA 4DPOA 2ZFHA 3P4UB 4X4RA 5T7LB 4KC5A 4B9NA 3CB4A 4JI8F 3UCZP 2GGPA 1Q8KA 3J81U 4WIQA 3T6JA 1VBKA 1YBAA 4ZJQA 2XLKA 4Q45A 2YY3A 2UUCJ 1VCTA 3AJ2A 7FDRA 1RTIB 4OJGA 4WFBQ 4RR5A 2YKOA 2PFDA 2DHAA 5LL6d 2M52A 4NEYA 4L6V3 4DSIA 1FJEB 3NXZA 4J9NA 5F8LA 1JLQA 3G71S 4AUKA 2LKZA 1L3VA 4ECYA 2AGPA 3CCZA 3GTYX 1F9HA 3R7SB 1S1UB 5IWAJ 4YR0A 3SSRA 5LMNJ 3EVOA 2MZQA 2VJUA 3TO8A 4D3HA 1GNKA 4EZ9A 4JUZA 4IRDA 4YMEA 4N8NA 1GTHA 1REVA 2HMIB 2AJ0A 2G13A 2EW9A 2I8EA 1VQ8S 5DLFA 5ETKA 3M1VB 3MEDB 2ZBIA 2CNOB 3LW5C 2HAIA 3T5LA 1FE0A 1QSYA 4LR8A 2BMBA 5FD1A 1VFJA 2YWGA 2XMWA 1U4BA 3O5TB 3CCVS 1CEZA 5A76A 1G4CA 1GXLA 2P6SA 4AXIA 3IBFB 4J9OA 5KFYA 4OX7A 5DETA 3KHHA 3AD8C 4KGZB 1TL3B 2CJAA 3PEJA 2Z2MA 4R0JA 3FCVA 3CD6S 1IJEB 4PG7A 5H9FK 4DCOB 2OIHA 1PKUA 1Y9OA 2RDJA 2Q43A 4QIEA 5BXIA 3WIVA 1FDDA 4WXOA 4ZPCA 2KFNA 3BGLA 2DGSA 1O5JA 3HD2A 1H98A 3SDEA 1REGX 3BJYA 1YJTA 1QAXA 3RUBL 5KT7A 5T7LA 2RD5C 1KSPA 1JJCB 2VKZG 3HDSA 2XMMA 1VJWA 2DR9A 2K1RB 2CPZA 3JTPA 4JI0F 3VGUA 5F8IA 3US5A 1YK9A 1RTIA 1FJGF 4RZRA 2FLOA 1RZMA 2ZD1B 4K4ZA 4PXCA 2FY1A 2OELA 4OZ5A 3EUNA 2XGQA 1U24A 4KY3A 2RNEA 2M8DB 4CLLA 1N32F 3CJ3A 3I96A 1FJGJ 3U27A 1S5ZA 2AZ3A 2NSBA 2V8PA 1K44A 2DH8A 2IVMA 3TI0A 4FBUA 2V2KA 1KLNA 4MTPA 2W9CA 4FKYA 2E7WA 2VB6A 4DV1F 1MN7A 4USMA 1D9AA 4OYZA 1FRJA 3POTA 2BE2A 3BO4A 4IG3B 5KFFA 5F0UA 2W9AA 3FDSA 1FKPA 3BBFA 1KLMB 2DH9A 1BLUA 1PAUB 1VLOA 3GV5B 4KHPJ 3T1AA 3MEDA 4F02A 6FDRA 2ASDA 2DNRA 1PO6A 2CPHA 4LFBF 1M90T 3B8HA 3BQ1A 2YKMB 2ZH7A 2KDOA 2GV1A 4IO9Q 1BGXT 1TK5A 2ZE2B 3TX8A 4JV5F 1FFGB 3R2DJ 1TTHB 1FWPA 3BSCA 2CKWA 4DF8A 3U02A 1UJ5A 2LXUA 4URGA 4AFFA 5GAHI 4ANEA 3UPFA 3FBFA 3U7JA 2KG1A 2ZH4A 4U7CA 2V94A 4JV5J 2PT0A 2GFFA 2R7RA 2EC2A 5GADI 1IBMF 4GKKF 3W64A 2M7SA 2BV3A 4NE9C 3H42A 2KHDA 5IS2A 3OHBA 3QAUA 3W9HA 4NLXA 3M2RA 2QA2A 2R4FA 4LT6A 4CM0A 1U0HB 1UVKA 3OHAA 1IKVB 2GJIA 1B0VA 4Y2MA 2WBMA 4DL2A 1JXEA 4P7TA 3EWGA 4HDGA 2FHKA 1OJ4A 1Y11A 4ERDA 4CO1A 1XBWA 3MFHA 1MG7A 4F36A 2V6AA 3TP2A 5KFBA 3C14B 5D3GA 2ZD1A 2WB1D 2QEXS 3CJRA 1LWCA 3TAQA 3TUJC 4X4PA 2JWNA 4PUOB 1S72S 2V50A 4Z2XA 2HQFA 5FLXU 4DR2F 1FDAA 2OFHX 1QVFR 4M5DB 4LQ9A 4PKDB 1HD1A 2ZKUA 3NGDA 3LUYA 2N4CA 1EARA 4MKBA 4Q43A 1CJKA 2HGLA 1FT8A 3OTBA 4IG3A 3FUYA 1KLMA 4R5PB 2F8MA 3JQMA 5KFJA 1KRPA 4C3MA 3T1YF 2VKRA 2FZGB 2CVEA 3UW1A 2VV5A 2KFYA 5KOXA 3CTRA 3L4BC 4DEZA 4FXWA 2XWYA 4QU6A 1RK8A 3Q8PB 1G1XA 4A8MP 5KFQA 1UFKA 4I64A 3OTEA 3NEKA 3TARA 4BWJA 2HNZB 2YKMA 2NXCA 1RT2A 1NH7A 4DPWA 2ZE2A 4OV6A 3NKYA 4JI2J 3PYDA 2WTFA 1YKWA 2PC6A 3M6WA 5IC4B 2HGNA 4NPOA 1SKWA 5K20B 3JQJA 3I9V9 3PYGA 1GK8A 5CYMB 5HBMB 1UW4A 3KXDA 4K5RA 4O3NA 4USWA 4U96A 5DDQC 2Z2LA 2ROGA 1WG1A 3FKBA 2RRAA 4J9UE 2HHQA 4RU2A 2DGTA 1I3OB 3OXLA 5L39A 1D8YA 4J9PA 2VOPA 1NK4A 1S1WB 4I7FB 2ASYA 4ID5A 2QC3A 2UUBF 2J0SD 4Y6IA 4IG0A 4WF9Q 4ZPTR 3VGTA 1E6YA 3P6YC 2QYGA 2B0GA 3TVZA 2R2UA 4DG1B 3QAEA 3H8YA 2I2YA 5D4NA 2QMWA 3CCWA 4PUOA 4RW8A 1XERA 1TMJA 1TL7A 4ZPAA 2AEFA 3JAMY 5A0YA 1X9MA 1TL4A 2VG6B 2JLFA 3MPVA 4X4OA 1SJ4P 1OSDA 2PI4A 5C5JA 1ZM4A 1XNQF 4MIBA 2O01C 3QRPA 1U1QA 4ER8A 3GIJA 1ZTTA 1TKTA 1G2EA 1VQPS 5D0GA 4R5PA 4DV3J 2DKOB 3ENAA 2CNKB 2F8HA 3TUZC 5KFWA 2CQ1A 2AV5A 1BMQB 4B9UA 2CJQA 2AJ1A 2DNLA 3Q2SC 2WVFA 1IKYB 2BACA 4NI2A 3L3CA 3JS9A 1HKAA 2HZCA 3FK4A 3KG1A 2ZH2A 2J5AA 1NPPA 4LMZA 1ZTWA 3WHIA 4H4MB 3FBEA 3PJWA 1BE4A 4ED1A 1SVDA 2HURA 5A6PA 2LA4A 1LXNA 1IKXB 4TLQA 2OFGX 1A6LA 1UZDA 2E29A 2W24A 5F9NA 3AFGA 3S7RA 2HWTA 3I6PA 4A8SA 3MHYA 3D1HA 3PO5A 1ZZNA 3HZGA 2XULA 3BREA 2AYMA 2HBRB 2BM0A 2XMKA 4FPIA 4DI6A 1LXJA 4W90B 2KT3A 3MM6A 1S9FA 4YDDB 3QWUA 2OTLS 2C2OB 4MIWA 3KDNA 3OR2A 2ZM6F 4P2MA 2ZWOA 4NEZA 5U47A 2R7XA 4NZ7A 3MCOA 2B9YA 1AT1B 2DR5A 5A8RA 1XQIA 3WX8A 1KQFB 1LK7A 4ICLA 3NWRA 5DS7A 4KFBA 1RWPB 5IXUA 4DV2F 4D3GA 3UN5A 3A4TA 4ILMA 3UN2A 3M8PB 4USJC 4QJVA 4DG1A 2BVZA 2KG0A 3NMRA 1XTZA 2HWIA 3HSDA 2Y1RI 3PW7A 3AXKA 2NXJA 2ILZA 2AJ2A 1HW8A 4C98A 2DNMA 4WKRA 4URQU 1WC3A 3JYTA 4JI6J 4RLEA 4ZVPB 3GCWP 4RW4A 1JLFB 2V5HG 1JJ2R 2PSZA 2HKEA 1QAYA 1UW9A 2IJRA 1U45A 3MM8B 4O3QA 4X4UA 3K59A 2GAHC 1VR6A 4KHRA 1U2RA 3JQKA 4OMFG 1OWXA 3BR8A 3TZXA 3UD3P 1S77D 2AWZA 2J0XA 4A8FA 3OFGA 4C0HA 5I3UB 4IOAQ 1KN6A 4J91A 5GMKa 3TYTA 1Y5IB 1NU4A 1HNVB 4Q2LA 5KT6A 3MEKA 4DZ6A 2LEAA 5KG0A 1Q8BA 2FB0A 4MIAA 1IKYA 3QRQA 4AQYF 3GYGA 4K4UA 1RWUA 2VFSA 2DRBA 2KT5A 3QIPB 1NK8A 1DRZA 4TQRA 3DN9A 2HHTA 3PXGa 3KLIB 2V9WA 3A3PB 3UI3A 3G2XA 1NUEA 1PGZA 2DIUA 3MEGB 2VQFF 4O3OA 2J6TA 4X64F 3TJAA 4M5JA 2KFZA 4H4MA 3KTQA 1NJZA 1CJVA 4H4OA 3KMSA 2MGZB 2F3JA 2QTWA 4LF5F 2Q3PA 2YNIB 4Z7YA 1GH8A 3KUGA 3P45B 3UNGC 5DLGA 4DV7J 1JNRB 3CO9A 1FFWB 4ILRA 1RAHB 3AH6A 2EEYA 4X64J 4TN2A 3DKDA 1JJHA 4MMOA 4V1Ak 1IKWB 1RISA 4OYIA 4CH1A 5BR8F 3KG0A 2QX0A 1HBNA 4MH8A 2IIHA 3K57A 2IDLA 3R5CA 1MNEA 2JSXA 5L1KA 3QNWB 1ZA2B 3H90A 4AD6A 1MWYA 2M3DA 3DRPA 3NNAA 3R5BA 1JLCB 4LF2A 4K7QA 4L3NA 2ZOFA 1CC7A 1HPZB 3TA0A 3IFEA 1DFDA 4X4TA 2L9DA 1LK5A 1N33F 4MFBB 1Y10A 4JYAF 1PJ7A 3K7RA 5EX3A 2YPYA 3M8RA 2XMUA 3FZ2A 1ACMB 2HBQB 3GP9A 3LP0A 1M5SA 3P96A 4HH1A 4CH0S 3OL8A 4N8OA 3D9BA 4U7UD 3OTOF 3FFIA 3MECB 4ECUA 1HBOA 5I3UA 1SC1B 2HHPA 3N79A 3CIMA 2CZ4A 1Z2LA 3TUPA 3QT7A 1HNVA 1NDCA 2CPEA 1TKDA 3PYEA 3C6UB 2KB2A 2Z8QA 3AD7C 3DOLA 3ICLA 4RUHA 5HROB 1OYEA 2G1DA 3BB5A 3GR0A 4PWWA 1TKXA 3FEZA 2B43A 4NXNJ 4BLGA 4IDKB 2FJXA 5KG6A 3HHKA 3IM8A 3M2UB 1SJRA 4ZITA 2XS2A 1SQGA 2B7BB 4PG5A 4OV1A 4DUZJ 4DQPA 4ECQA 1BY9A 5C7PA 4IUFA 3HVWA 4B3RF 2AQ4A 4NA3A 1RT6B 1P27B 4FF3A 4GVBA 3O3LA 1IKWA 4OLPA 4R25A 4OYPA 2ZHBA 4K4YA 3KHGA 4C11A 4ES1A 3J7Z5 1H7WA 2NYHA 2KZMA 4DR5J 4RBUA 2BRLA 5HQMA 4WFNQ 1X0FA 4EMDA 2HLTA 4KH1B 3Q2TC 4ECRA 2PD1A 3SSQA 5E3QA 3CCUS 3FRZA 2SXLA 2R2TA 1HBUA 2OPPA 4DPYA 2BZ2A 2OI2A 3OBIA 5HANA 3SIPB 1W25A 1RTZA 4DQQA 1JLCA 5HL7Q 3PYFA 2BKPA 2EKNA 1GXUA 2MZRA 4RW9B 5KFMA 1HPZA 1R8PA 5HVHA 5GAEU 3V5RA 5C2GA 2K8GA 3C46A 4QPTA 4P7VA 3K8VA 3VF0B 5KFAA 4DL0C 3GB0A 3DDIA 2CQHA 3NAIA 2WB4A 4USTA 5ADZA 2PO4A 4K2JA 5B0EA 2Y0BB 2XCPA 3I5CA 3OT9A 2XSJA 2L9NA 3G4SS 2BJ8A 3C66A 3P3DA 6AT1B 4LBPA 1WC0A 1HIYA 1VGYA 2IMOA 1S12A 2CJXB 4IQXA 4OX6A 2R7TA 3MCNA 3C6UA 2WOMB 2QLWA 3BKTA 3ONQA 3BM7A 2B8PA 4OJ3A 1WDDA 3NL0A 2FHJA 1AA1B 4FS2A 4C0OC 2X51A 1NRKA 2VG7B 3E01B 2MKIA 1U1MA 3BKFA 1OSCA 5HQLA 1S9EA 1M1KT 4M5MA 4NZ0A 2FLLA 3MAQA 4IDKA 2C3OA 4I6AA 4V19J 1FDBA 3M2UA 1CULB 5B0GA 2LYVA 3LPYA 3DOMB 3KMQA 1CC8A 1VBYA 4PABA 4I6WA 5DQIA 1NKCA 1NK0A 4QPXA 1RT6A 4ZVTB 3ETMA 3SXLA 2VA3A 4LF6F 3IA0A 3R1LA 1Y3KA 4C8KA 3TA2A 4R8UB 4E98A 1UCNA 4ELVA 4K50A 1MROA 3MTKA 4FNIA 3B6BA 2U2FA 2MEWA 4ED3A 1RGVA 3FCHA 1VYAA 2BJEA 2D9OA 4FN5A 4X62J 3M9NB 3DLLQ 1B3TA 2OSRA 2QA4S 4LF6J 2Q6CA 5GAGI 5IC6B 5DDOC 2GW8A 1HL6A 2YNFA 2EFQA 2X1FA 5C24B 1RWOB 2MDAA 5H9FJ 4RW9A 4NZ6A 2PGCA 1RT1A 1S4FA 2RQ4A 2V8HA 2R7VA 4OQJA 2QRRA 1S6QB 3BKUA 1O0PA 2BQ3A 4HLBA 1JX4A 3BZQA 4IR1A 1H2TZ 2YX1A 3UWTA 4X66J 2ZC3A 3DRRB 3NG8A 2J9CA 2A2CA 2RRBA 3BR9A 5KFKA 3THVA 3PKYA 1S48A 2NPFA 3D6HB 4RUBA 4OLOA 1CPZA 2WOMA 1S1VB 2KJWA 4WYWA 2XM3A 2XCAA 1SKSA 2HHHJ 1FRKA 2B3TB 3E01A 1QUPA 3BYRA 1DQ8A 2NXEA 3D7SB 4ZVFA 3ISZA 3GJSB 1ZPVA 3S6EA 1K73T 4NWBA 1S79A 3D66A 2OPRB 5K8OA 2BW7A 4U8YA 2ADBA 3IWNC 2AD9A 4TQSA 4KYZA 3M8QB 5K8MA 2EKYA 3PW4A 2AP6A 3V6HA 2KKHA 4KT0C 3C15B 5L8RC 3DOMA 1LWXA 3GFHA 2L3MA 3O1LA 2MKSA 1XR7A 4EYIB 1YI2S 2W7OA 2AEJA 1NK9A 1N56A 4DFMA 1WEXA 4TYAA 3V4IB 3RR8A 4IRKA 4BHQA 4EBDA 5H9EJ 3OLAA 2NQPA 2BUNA 3A8KA 1OYDA 3P8BB 4F4YA 3KNGA 2P2CB 2F4VF 3CD5A 4X4NA 1WUUA 3HI9A 1ULRA 3GPAA 5HATA 3FRYA 4YHHF 4ZLNA 1AYEA 2B4UA 4OZLA 2XZWA 3O6QA 2DHGA 1S99A 1GEHA 4LSNB 1JLEA 2QL5B 4QWAA 2IA0A 2VPWB 4DV6F 3D2WA 3BPSP 2IHR1 2W1BA 1OMSA 3DOKB 2NUUG 2LXFA 3TAMA 5C24A 3KKFA 1EQ0A 2IVFB 3T9ZA 1TL1B 3NOCA 4IRCA 1HBMB 3ZTRA 3IG1A 3CCMS 1JB0C 2G2ZA 1IVZA 5T14A 1VS3A 1S6QA 5JVHQ 4DV6J 5KFGA 1VIXA 1FTRA 3VR1A 5LSLA 2R3VA 2NS1B 1TP7A 5CHCB 2WW8A 1N4LA 1YZ6A 1HNIB 1FXLA 3J7YU 2JC0A 3GILA 2MJNA 1SIZA 4I2QA 2KT2A 2HG4A 1CBKA 3CJTA 4DX8H 1TU0B 3DRRA 4DR3F 4GVLA 4ECSA 4KH0B 3SCIE 1X4DA 3MR2A 3UR3C 2VBXA 2HLUA 2UUAJ 2KN4A 2GAGC 1QTNB 3S8SA 1KQKA 3CDEA 4MKYA 4UOHA 3ZZYA 2DRAA 1WDTA 3CJKB 1SV5B 3W61A 3DFEA 2AZ1A 5KG7A 5AXMA 2VASA 3H2VE 4KKOB 2A18A 3BN4A 4C48A 2LP4A 4O0IA 2CQGA 4WFXA 1IJFB 2E1MC 1AFIA 4R0EA 2OPRA 1KTVA 3DGPB 4OHVA 2UXCF 4K0KJ 4CO2A 2LA6A 2A10A 4QYZK 3F0NA 4NLGA 1YJUA 4ZKAA 4ZLJA 1HARA 1EIYB 2DIVA 1IM4A 3KDOA 1JNZB 2Y1LB 2R8HA 2JOQA 4QWDA 4TYBA 1HFEL 5KFSA 3C15A 2HFOA 2MKCA 2BBEA 3CDUA 2OGUA 1HHTP 1YJRA 2HNYB 2FJDB 1TELA 4LRFA 2A3JA 4DWIA 2WAQD 2MB0B 3C3LA 5F41A 1RHMB 1SB6A 4OX9J 3CMAS 2F9JA 3O2IA 4O3RA 4F04B 3VALA 1RWWB 1KS2A 2JX2A 1HMVB 1RWMB 2NCKL 3CJSA 5ETQA 2D1CA 4JI5J 1XMOJ 3G9CA 4X65J 1AUSL 5B0DA 3EVWA 2EC0A 5K9FA 2YX4A 2FGOA 3C16B 1IXKA 2IJNA 3GJTB 4Y0FA 3KUEA 2PDAA 2P9EA 2C3PA 3UDEA 3OL7A 3DMJB 5DG9A 2GNKA 3L7PA 4ZCIA 3QSYB 4HL9A 1N36J 3FGVA 2ZJRQ 1YLXA 3UN3A 4JOUA 4P72A 1URNA 5KT5A 5JJBA 3V6DA 1C0TB 5KT2A 4IH5A 1HBMA 3QJPA 4QWEA 2R42A 3MPUB 2GVZB 3VGVA 3KJQB 1Y00A 2C1EB 4I67A 4CP5A 3DCAA 1RLDA 3BH7B 2RVJA 3CW2C 3MEEB 4KE5A 4RW6B 1WHXA 4LF9F 1S49A 3QRRA 3IM9A 4KGKA 2HRUA 4KV8A 1H7XA 1S0OA 2VD3A 3LAKA 3G96A 1NSKL 3N9UC 3LTOA 3LA0A 2LECA 4OIXA 2F7VA 2LEPA 3EXYA 1V3ZA 2AX1A 2JDJA 1IM6A 4P2XA 3H20A 3BV8A 4O4GB 4PG8A 1UEUA 3EDRB 1K0VA 3FQKA 1U8SA 2GQCA 2BA9A 4J37A 4MK9A 5GAEI 4DQIA 5A8WB 4UT4A 5MLCV 4ETXA 1NPRA 2DR7A 3HHLB 1IR0A 2Q66A 1S97A 3CT9A 4ZPBA 5C2CA 4CIOA 3BH6B 1KFSA 3U1LA 1N0UA 1K9MT 1Q86T 1FCAA 1W26A 2N82B 2CPYA 1VBXA 1OPZA 1K1QA 2IY5B 3VAMA 3DXSX 4A8QA 2XY7A 1RHKB 3D1OA 2BANA 1HI1A 2AHOB 5HMYA 4USVA 2R2RA 2YKNA 1Z2ZA 4QU7A 2UVWA 3NCPA 3PFOA 2YNGB 3FSXA 2VQEF 3MM9A 3CWJA 2HWHA 1DTQA 1NHVA 4YB5A 3FSYA 2CFXA 3WZ0A 4HT5A 4DN0A 3LP2B 1D0EA 1TVRB 4YP3A 1KQGB 1H73A 2W2OP 4DCPB 4P71A 1N6QA 4DQRA 3QJJA 1RCXB 1WTFA 2EG2A 2VQEJ 1R6YA 4HHUA 5E5NA 2G0IA 3T9NA 1X8DA 1P1LA 3MCSA 5J2NB 1NXIA 2DNGA 1PYSB 3DMJA 1XNRF 4EGLA 2XY5A 5SZTA 3CCES 3S1TA 4DV5J 3QBCA 2HQCA 4ZP6A 3RRKA 4B08A 3HSZA 3MMBB 4FKXA 4HTIA 2WVCA 2E5HA 3IMQJ 1UVNA 2BABA 4AL6A 5IV3A 1YQHA 1VQ9S 2UXBF 2GC8A 3CULA 3CDWA 2M2BA 4U9RA 3Q8SB 4NXMJ 1JJ4A 5KAKA 1YDLA 3CMES 1KDNA 3D0HE 2ZKTA 3IGVA 3R97A 4UQGA 3TVKA 5GMDA 1VHIA 4KTQA 2FDNA 5LSOA 3MM5A 1NDPA 3MAAB 3LAMA 3MR3A 5HSPA 3RBEA 4DUYF 5EWFA 2XMVA 4ZP9A 5CA5A 4GC7A 4N7TA 3RRHA 3PRDA 2KRRA 2VJVA 4O4GA 4DV4J 2JLGA 3TRGA 3R1HA 4DR7J 4MYUA 1WC4A 3A13A 3PDNA 1KC8T 2ATCB 4N5SA 1B64A 4KAIA 1XEZA 3LWLA 4CLWA 1HR0J 2YNHB 4DFJA 2XO7A 2CDRB 2VC0A 3NWGA 4XDCA 1WOSA 5A8WA 3Q8UA 1Z4UA 5KFPA 2KHCA 3HHLA 3I32A 1Q8LA 1KP6A 2LQJA 4GKJF 2GQ2A 1BXNA 3B54A 1WTBA 4X84A 4ANCA 5CD4A 3K89A 1HQ2A 5AT1B 1NHUA 1JLAA 1GMUA 4P75A 4LF4F 1AFJA 2HEKA 2QZ8A 2WVDA 3UCUP 3OUYB 3T5KA 4AE5A 4F0HA 2HS3A 5IM0B 1U0SA 4CM2A 4WU2A 1Z1ZA 2YNGA 2PIIA 1FKAF 2QMXA 1UTAA 1F9FA 1MU2B 4OI4A 1RYSA 4LRAA 2OSQA 2JC1A 1TVRA 2HFVA 1L5UA 3EGWB 4IOCQ 2V69A 1B7YB 4WXWA 5ETLA 2JFDA 2O5DA 4KGVB 4B3TF 3PIOQ 5J2NA 5E33A 3K58A 3S01A 2ZNYA 1C4AA 1SC4B 2ZUGA 3HJVA 1VIOA 2F9DA 3MM7A 3GFXA 4J9MA 5G4DA 3MMBA 2V34A 1FXRA 3TZZA 2BQRA 1YJ7A 1ICEB 4ZHRB 3M6VA 2NYIA 1HNZF 2GO9A 1PILA 3G82B 1X0PA 5L46A 2DY1A 3HMJG 1NBEB 2ALYB 1EP4B 5J1PA 1U1OA 2ZHAA 4YB6A 2PMZD 3FNNA 2CQPA 4DOZA 5CXTA 3WQPA 4ZCMA 1VQOS 2YKQA 1H74A 1FVQA 5I42B 3MAAA 4F67A 1C0UA 1UEKA 1FF2A 4MT1A 2UU9F 2FZCB 3I56S 3N4WA 2FJBB 1SC3B 1XMBA 3FSIA 4DLEA 2RU3A 4FBTA 3CPWR 3KYLA 2WONA 3ZZZA 2QGFB 3N28A 3RB6A 4NRTA 2DT9A 3AB2B 4ZVUB 4NLYA 3A8IA 2GIFA 4DDFA 4ZP8A 3WIUA 4OZ0A 1RKIA 1NPKA 1L3SA 1Q7YT 8ATCB 1UEVA 3FJ2A 3IS9A 1CVJA 3T1HJ 5HLFA 1KD1T 2MZSA 2MSSA 3ET6A 4URSA 2PA8D 4ECXA 3C8YA 2IM1A 3NCQA 1F2HA 3ITHB 3PZPA 3W65A 2OD4A 3KK3B 5HP1A 1BQMB 1FERA 4WWSA 2IJFA 2CQ0A 4JI4J 3A8JA 8AT1B 3SQGB 1I51B 2OMOA 3ENVA 1UL3A 2I0XA 1MU2A 3VAHA 1FX2A 3M32B 2JEIA 2ZBPA 1RT3A 3J80Y 2ZBRA 2ATLA 3EMTA 3P5TL 3OSNA 4FF4A 2KZZA 2E1CA 3Q8RB 1KBRA 3AOCA 1J5OB 2CYYA 2DD8S 2H4WB 1T9UA 2JVOA 2JFKA 1RBAA 1YG0A 2CNLB 4HACB 1VQSA 2JH3A 5AE1A 5ETRA 4K4SA 1T3NA 4OYAA 3MD3A 5HJYA 1VQ6S 4DX5A 3ZO7A 1FKOA 1JXLA 3M8SA 2CZ9A 2YX7A 3L7OA 4DSFA 1TR0A 4CLZA 2CJKA 1R27B 3KLHB 3W8PA 2VH7A 4FVMA 2COLA 5IOLA 1D09B 1NSPA 2YVSA 3SI8A 2XYGB 4USIA 2CWXA 2BJ7A 5I42A 2CJ9A 2OKQA 2DGXA 2DXEA 2IYIA 3I5BA 3CJ0A 1EAYC 1YJ9S 4CT9A 3BGUA 3BF4A 5FIIA 4U95A 1QSLA 1C1CB 4N41A 1ZOTA 3N6LA 4LFAJ 2RF2B 3DC2A 3Q8YA 2PMHA 1YHQS 2F40A 4JI1F 3NLCA 3GQCA 3M05A 3HVRA 1Y3JA 4ELTA 1VQNS 4TY9A 5AJ3F 1Q79A 1ZPWX 5DGAA 3GIIA 4DV0F 1I94F 3W9JA 4I6YA 1VHFA 5ETMA 1H6KX 2XHCA 3ZZ0A 3J81Y 5F8MA 4AT1B 3H2UB 4ED5A 3ITHA 5M2UA 3KK3A 1BQMA 4XPEA 2ZZNA 2HVEA 4X4QA 4PXBA 4IH6A 3K5MA 3QJLA 4YOEA 1LWFB 1S0MA 1CS4B 2C2KB 2P5VA 2EK6A 4JI7F 4K4VA 3SFGA 1BWVA 3SEOA 2FTRA 4MKVA 5IT9U 3H5SA 3ENWA 4NLQA 1S7IA 2XBPA 3DDKA 2E66A 2GHPA 1ROFA 1S7HA 4DR4J 2D3UA 4LF8F 5IV4A 2BM1A 2EFPA 4O3PA 1ELOA 2FC9A 3KJFB 3W60A 2UXDF 3EZUA 1RAGB 2XI3A 2BX6A 2XQCA 1KQSR 4CO5A 2ROPA 4RO0A 3RB0A 2FIUA 2V8DA 4QIVA 1Q53A 3QATA 2FHOB 2NSCA 4C8MA 5KG2A 2QLXA 3QSIA 4J9VA 3GIRA 1WSRA 3IAM9 5EDWA 5J2QB 3RJMB 5ETNA 4OJ1A 1Q95G 4F7VA 4L73A 2XMJA 4UOFA 1S1TA 4DBQA 2LFVA 2EFVA 3VWSA 4PCQA 5K5MA 4ZN1A 3QIDA 2NXNA 3UVJB 2YWWA 4DX7A 4O4RA 4NL5A 2R7QA 1NZAA 1V5IB 3O44A 2RF2A 1TQLA 4IH7A 2IM0A 2QO3A 4IFVB 1X5PA 5RUBA 4NCGB 3BPDA 1R8HA 3HP6A 3RZAA 1HQUB 4F4ZA 1N5SA 2E44A 2R7OA 3V2UC 4CZCA 3ZTPA 5A8KB 1BQNB 1M5PC 4WCEQ 3AAWB 3GG1A 5D0HA 1JLBA 1U49A 3QLHB 3BO3A 2VBWA 5L9NA 1T05B 3SYZA 1WF1A 2AU0A 4B9MA 4PYAA 3PM9A 2KYZA 5KG1A 1Q16B 1K0TA 2XNRA 1RE1B 4UY8T 2UP1A 2PA3A 1R43A 1HA1A 3OVAA 3CEDA 1D9FA 1FWLA 2EFOA 3LGNA 2BQUA 3K0JA 2WRMA 4NLUA 3M9MB 1ZETA 1XN9A 4HHJA 1CS4A 5IWAF 3KFWX 2OPQB 5LMNF 1RYRA 3DLGA 3H4BA 4MK8A 1T03A 2ZVSA 2MKYA 1RABB 2R8IA 3KJVB 3N5FA 5D8HB 4Q8EA 3ETOA 3OD2A 1KTQA 4RW7B 3UR0A 3MPWA 1HWKA 1Q8IA 1U7LA 3V81B 1LV5A 4ZA1A 2XYHB 4X4SA 1PC5A 2HHWA 4NYPA 2GVDA 1RADB 3HVAA 2AW0A 2W9BA 3MZIA 4PQUB 2XLJA 3HKWA 1NJWA 2A6OA 3GIMA 4PXDA 3QT8A 5CYQB 1RBLA 3O8WA 3D3BJ 1U25A 1KHWA 5J2QA 4DHVA 1G3OA 3TZWA 4RKUC 3VZIA 4C0BA 2C2NA 1EKSA 4EBCA 5C25A 1PJ6A 2DEIA 2F63A 1VRTB 2V4QA 3TR5A 3RW7A 1XR5A 2C2DA 1EHWA 3W3SA 4WP3A 1RU2A 1HHQA 3BYPA 1RHUB 4IFVA 4A47A 5LXRA 1RT5B 4NCGA 3ELHA 1NKEA 2F5GA 3MCMA 2FUG9 2GQQA 1VOMA 1RT7B 1UVJA 3H4DA 4LR9A 3THPA 4NMLA 3RB4A 1BQNA 2Y8WA 3OXFA 3OXGA 1F3FA 3IC1A 1JKHA 4NCBA 4Q2MA 2JEFA 3QLHA 2H1YA 3GFYA 1LOUA 4C7QA 2KXNB 1XIQA 3NY0A 4K5SA 4IKAA 2R7UA 2ADCA 1CSJA 5D77A 5DM7Q 2IBKA 3BSNA 2XZTB 3CJ4A 3RR7A 1GAOA 3LPEA 3SV4A 3L7UA 2XY6A 4ED7A 5HMZA 5DO2A 4ED8A 3TEGA 3D0IE 4B3SJ 1PYTA 2QMUB 2XNQA 2C3MA 4O44B 1AXQA 4N47A 1DTTB 2V2ZA 5FLXY 2LU1A 3UQSA 4QYZJ 3KJVA 3SCLE 2D7SA 3ISNC 1FA0A 4JI3J 1F5BA 4PQAA 3LWMA 4KGXB 4H54A 1KVIA 2Y1JA 1S1UA 4YEAA 4RW7A 2OEJA 2RS2A 1U02A 2HQ3A 4KO0B 4WKYA 3EYZA 4J9RA 1WI8A 4ALZA 3V81A 4KHPF 2WBRA 2B4OA 3BN7A 4LF7J 3EGVA 3NP5A 2JVRA 5L38A 3NMAA 2HMIA 2HBYB 2VBYA 9ATCB 2MSTA 3LF0A 2IRXA 4LSLB 2Z30B 4DLGA 5H9EK 4TLRA 1WC5A 5JVGQ 3M1VA 2NUHA 1X4GA 1S6OA 2RKIB 5CYQA 2VDIA 4FF2A 1DAXA 2G4BA 1DHMA 3AB4B 2ZZMA 3G86A 5B09A 4O23A 1DZ5A 4U6PA 2V0NA 4TU9A 4QR1A 4YB7A 2C2ZB 4G3IA 3E2EA 2EI5A 4ZVEA 1L3TA 4A46A 3FEXB 4CNZA 2B9WA 2QFJA 1R31A 5J2MB 1TL3A 4P73A 4C8LA 4XDDA 1RLCL 2DVIA 2FJAB 1YRXA 1WNEA 1RT5A 2D3OR 2E5LJ 5F8HA 2N3OA 3SBMA 1RT7A 1J27A 1Y7PA 2RT3A 5KOWA 2AJQA 4DR1J 1UWBB 3QQCD 5A2QU 1FK9B 2C22A 2AJ4A 3H59A 4ZVSB 2K2PA 5BYRA 2KYXA 2I38A 1SL0A 5LOQA 4DL3A 2K1RA 4MYTA 1TKZB 3MXHP 1RQ0A 1BWEA 2Y1IA 2HYIB 1EZZB 5LM7E 3KWMA 3A3NB 2V67A 2IDEA 3MOJB 2K3KA 2ZDPA 4P6QA 3R9LA 1I6JA 3VAGA 1S1XB 3QPIA 1LFPA 2E5IA 1DTTA 3IR7B 2KH9A 3AJ1A 2BJDA 4CNYA 2FHMA 2LLZA 1BUXA 5J1EB 3TW0A 3OPKA 1VMBA 2J0QD 1UWAA 4WE1B 4PR6A 1NMEB 4P2FA 3R3TA 4Y65A 3W2WB 1V3SA 1FO1A 5GMEA 4A8KA 4ILLA 1G7CB 2AX0A 1VRUB 2M8HA 3D54A 2ALZA 3QT6A 2BJ9A 2D3ZA 4LJMA 3P49B 1A9NB 1HWJA 5F3ZA 1X4BA 4ZPWR 2OP5A 1S9GB 4JI2F 3KLFB 2AYGA 1LWEB 3UD5A 2HVZA 2CG8A 3AT1B 4MJKA 2GJ2A 5KTQA 4EK2A 1F3VA 2RHSB 3BS9A 1YTYA 2YH1A 1B7FA 4JBCA 1EETB 1MWZA 3MF5A 3R6GB 4Y2IA 2CPXA 5J2MA 3HHDA 1RTHB 2JHEA 1NDLA 3D6FB 3CMQA 3OW2R 4F2RA 1RHRB 3SFUA 5IZHA 3D0GE 4A8WA 3OQ2A 3MTJA 1HWUA 2O67A 1FNMA 5E0OA 3A12A 4TY8B 1D1UA 3GG0A 5FJ4A 2WVBA 2X1GA 4USKA 3SSSA 3TOQA 1F5AA 2JEJA 2AMCB 2W7PA 4FF1A 1H3DA 3CJ2A 4PPZA 1KKHA 1WOOA 4Y00A 3VAIA 4YS2A 3I0SB 2LVWA 4HDHA 2Q1LA 3HJFA 1U0HA 3HM9A 1F5CA 1IKVA 3HFZB 2BJ3A 1ZBTA 2M88A 2X7IA 3TANA 3KLEB 2RU9A 4L72B 1FWKA 3QFHA 4FS1A 5LMUJ 3DRYA 2V8GA 3C14A 4OHZA 2W8LA 1ITPA 4HH0A 2DNKA 4LVOP 2MMYA 1TL5A 1F2GA 4B02A 1NJXA 1XK8A 4CLKA 3HF5A 1RB0A 3T5HA 4TVAB 4Q44A 1SJ3P 2HNDB 1R8CA 2D9PA 4DV3F 1SQEA 2MQLA 4M5DA 3H5UA 1TAQA 3MUMP 1DY3A 4WE1A 2C3YA 1U09A 2M5YA 2LCWA 2DK2A 3N0VA 3W2WA 4H4KA 5DQHA 1N54B 2XMAA 1VRUA 2QG9B 3MURP 2DCUB 3H2LA 1NK6A 1DQ9A 4ED6A 3DDNA 4K8RA 2CQ2A 2IAJB 1S9GA 3OTCA 4OI3A 1Q7LB 3KLFA 5I3PA 3HCXA 1T3OA 4XPCA 2D74B 2DJWA 3W5YA 3DM2B 1NHKL 4XK8C 5DDPC 3PW2A 3UO0A 1N88A 2HNZA 2QFIA 1YIJS 3WDOA 1GMWA 1CJUB 4DSLA 2P9GA 2VA2A 2XB2D 2POKA 1EB0A 5E3CA 3KJNB 2CXEA 4DSJA 4YR3A 2ASJA 3IWLA 1KHVA 4PG4A 5CYMA 5HBMA 3GONA 2ZWPA 2ACYA 4TY8A 1HYSB 1JK9B 2CVIA 4NYOA 5GADU 5KFNA 3EVMA 1S0VA 4WFZA 1LNQA 2IBOA 2W7AA 1XMQJ 1SI9A 4X4VA 1R8BA 4B3MJ 9RUBA 3M30B 3DLBA 3I0SA 1S10A 1FJCA 1X7VA 1AUDA 1U48A 3IRXB 1S1WA 4I7FA 1HNXJ 1RA7A 5GVQA 1RA6A 4Q0BB 4ZJLA 1H38A 4PXEA 1QVGR 4RUCA 4C2MA 1LEOA 4A8XA 4JI6F 3AOAA 4UZBA 1N5VA 2DNOA 4CDIA 1X4FA 5HMXA 4HHHA 3EGNA 3KLGB 5EX0A 3BDPA 1N34F 1KNZA 2GMLA 3DYAB 1FRLA 2WSEC 1ZM3A 1FFSB 2MKKA 1S0NA 2HNDA 2ZH1A 2YBVA 4B3OB 2VG6A 4OYXA 1QE1B 2MZ1A 1R7IA 2H3EB 1N34J 3NGTA 3TQEA 4WP9A 3U1NA 4Y2CA 1RTDB 2VU5A 5EGYA 4NLPA 2ZC4A 4ZLLA 2RJZA 5IT4A 2GGPB 3CC2S 4F4XA 3AA9A 1WHVA 1SJ1A 4RU9A 4OI0A 3I31A 5F9LA 2HS0A 4I0WA 2IAJA 1KOOA 2VOOA 3VHQA 2JNJA 4KPYA 3G6VA 3PY8A 5HI7A 1NEEA 4ZVQB 3DM2A 3DXBA 5DG8A 2CQDA 3MWBA 4DV7F 2OJ3A 1S76D 5DZ6A 4HT7A 1CJUA 5DRKA 3B4DA 1IBKJ 4RNMA 3BBCA 1M0SA 3OTDA 1IKXA 5CZXA 4F3MA 3TUIC 3DLHA 3BQ2A 1M5VC 4C8NA 1O6XA 3HT0A 1C4CA 4FPRA 2LQBA 5F3TA 1NH8A 4WPAA 2HPUA 1HNWJ 2C2EA 1QSSA 3AODA 1REVB 2ERRA 2XYPB 4C6AA 2DR8A 3M6XA 1QD1A 4USHA 1T7PA 1VI7A 2DHHA 4ETZA 3CF5Q 1NSAA 3DHWC 5E41A 4ZVHA 1APSA 2YXLA 4C4WA 1JLGB 4ZIWA 3T5JA 1KEKA 2ZUAA 3DRSB 1F6TA 3FMBA 5D4PA 2BKOA 3M8PA 4G65A 2W2NP 4NLRA 5ETPA 5IQQA 4M5LA 2ZOMA 1HI8A 3G8QA 4ZDNA 1Q1KA 1OO0B 2K3IA 1OQ3A 4DL6A 1QUVA 3HLUA 2DNNA 1D8ZA 3RB3A 2ILYA 5D0RA 2B4VA 3MDFA 2XC9A 1WC1A 2OD6A 5M2PA 1YJNS 1BD6A 4RUAA 1JLFA 2I5JB 1ZAWA 2MXYA 2UVVA 5DGBA 2X3DA 2C2MB 2H54B 3LH2S 3MM8A 5KFOA 2B6AB 3SDEB 4RNFA 1RTDA 2C28A 2HQDA 4IYQA 1W7WA 5IQ6A 5KFVA 3Q23A 1T8EA 2KVQE 4QR2A 5DJBA 4EI2A 3AQOA 3MI7X 2W4DA 1RHQB 4M8LA 1R0AB 4NXNF 2VF3A 3VAFA 4G1QB 3N01A 4JI8J 3FZBA 3QIPA 4K4TA 3GE9A 5DZ7A 2DGUA 3THTA 3KLIA 3CVKA 4DUZF 3MEGA 4PRFA 3T3FA 3BSOA 2MGZA 2YNIA 1VK3A 2Z0GA 3HHLC 1CG2A 2PEHA 5BYQA 1FJ7A 2BOAA 2W9CB 2EWHA 2CJBA 2QA4G 1WHYA 4DSKA 3AQPA 4DR5F 2MZJA 5KFHA 1NB2A 5ETTA 3POTB 3PW0A 2A1BA 2BE2B 2CPFA 1FKPB 3TWZA 4DL7A 2MKHA 4BC7A 4NLVA 2H5JB 5EUHA 4DX6A 5KFEA 1PC4A 5HN0A 2DXDA 4UUWA 3OLBA 4FYVB 1DJ0A 2KU7A 2O3DA 4ZLPA 1B70B 1SH2A 1VLYA 1QDUB 4ZVOB 1JLGA 3DRSA 2BRKA 5D0EA 3K17A 1XR6A 5LJ5Y 1ZAVA 2XGPA 5JXSA 4ANDA 4Q8FA 1FDNA 1SQFA 1SXLA 2V2QA 1K8AT 2GO8A 1AW0A 3C6TB 2FJWA 1WJ9A 4KPCA 1QLNA 1OQ6A 5KFLA 4UY85 3LP1B 2YTCA 1S6PB 3WC0A 1P1TA 4MFBA 1V3RA 2I5JA 2XLIA 2MLYA 1A7GE 2AF6A 1RWKB 2CQBA 3CO0P 3EZ5A 3DU5A 2B6AA 2ZH8A 1SL2A 1IBCB 1YGYA 2Z2ZA 3M2RB 2ZEJA 1ZA1B 1GXTA 1FE4A 1QY7A 2B7CB 4OHWA 2KVIA 4QQBA 4RX6A 4ECTA 1WHWA 4J9SA 3MECA 1N5QA 4XTTA 2QL9B 4W4MA 4WTYA 1BC6A 1U1NA 2DPJA 2BYCA 2FJEB 2H5EA 4PAAA 2G0CA 2FQQB 3VQSA 1WKJA 3ISND 1YVFA 3Q8VA 1R0AA 4MK7A 2XWXA 4G1QA 5D3GB 2YQ0A 4QZVB 4CTAB 3W5ZA 5HROA 4CLFA 4LF1A 1LWCB 4PWUA 5KFZA 3I87A 1WOPA 4K59A 5LJ3Y 3ZZOA 2DO0A 5JUMA 2G2YA 4JI0J 2YPZA 3H0PA 1TUWA 3EZOA 3W9IA 4ZVRB 1T9WA 3I4HX 3PTWA 2E7VA 2CPDA 3KOAA 3BO2A 3RYLA 2OEKA 4EEYA 1MLAA 3BEGB 2HZVA 1N32J 3PG9A 3DLJA 5ITHA 2IM3A 1CJKB 2YKPA 4X62F 4C9DA 4ECZA 2FHJD 1MMLA 3AOBA 1OY9A 3VGSA 2MQOA 4I68A 1M1GA 4RPFA 3FEYB 4DV1J 2QYCA 4N76A 2IPOB 3LALA 1RU1A 3R7NB 4CRJA 3IXQA 2I1RA 3GFZA 3M7VA 1X5SA 1RT2B 4P2SA 2J6UA 4ES2A 1IR2A 3ULHA 3HHEA 3E8OA 2OLWA 3UDCA 5B0BA 3LGMA 3VV2B 1TUVA 2HSEB 2GCFA 2MZTA 3C6TA 4M5GA 5KFRA 4LFBJ 1J5EF 3BQ0A 3J7AN 3C19A 1WF2A 5LT5A 3LP1A 4X66F 3CCLS 1S6PA 2HIQA 3G8TA 3FC9A 1JMTA 1RAEB 2R8JA 2HFUA 4I56A 2KXHA 2HFNA 4B17A 3PVXA 4C8OA 3N6NA 1WEZA 4CLYA 1J5EJ 1FNXH 2L41A 2RS8A 3RBZA 4YN3B 2P9CA 1NNDA 2HHHF 2FVRA 2XHWA 1IBMJ 4GKKJ 2JJ4D 4ID5B 3TZYA 4YB1P 1RWNB 1GMVA 2LEBA 2VICA 3W1YC 4IG0B 1E6YB 2OPSB 1EKRA 4LBHA 1MMNA 1FI4A 4F8RA 4A4JA 2RQKA 1JQGA 2QT7A 2J9EA 3TNVA 2DNHA 1DQAA 4DZDA 4CTAA 2V4JB 2JEGA 2VG7A 1KFDA 4V19X 4NOHA 2J8SA 2AYBA 4RW8B 1TK8A 1TL7B 1IWAA 3ZZUA 1U6BA 4ZS6A 4G1PA 5A0YB 1HHSA 2VC1A 4WBFA 1CULA 2GIQA 2V2VA 3EM1A 3R5AA 1W2BR 4NCAA 2YWFA 1NJIT 2RRNA 1PYOB 1GFWB 3J81j 1TKTB 3BDEA 3IO1A 4DR2J 2GHWA 2KXFA 1WWHA 4J5OA 3HK2A 4R8UA 2CJYB 4JV0A 2E5JA 1NB7A 2H5IB 2MQPA 2R2SA 4OL8A 2K06A 4F2SA 2J6SA 1OIAA 1GX5A 4NI2B 4XIUA 1AROP 4FDFA 2RB7A 5G0RB 3V6JA 4ATNA 1FTCA 3T1YJ 4YDXA 2VDHA 4KIAA 4KGMA 3CJQA 2FVSA 1WD6A 3ILOA 4I4BA 1L3UA 2RUSA 3CC7S 4UF4A 2R9LA 4DMZA 3D68A 4OI6A 2QJ3A 2OAUA 2RUGA 2RILA 1ZM2A 1Y5LB 2ZBQA 2J7UA 3NS6A 4RNHA 4A8YA 1Q78A 2W25A 2E9ZA 2N4DA 1O8BA 4CLSA 3MM6B 2WCXA 2UUAF 4ZCKA 2JRSA 3B82A 4M94A 2KO1A 1Y5NB 3OR2B 1F1BB 1YWXA 1RI7A 1LKZA 4C3KA 4F26A 4GMKA 1FXDA 1Q5YA 5A8RB 4X2BA 1FHTA 7FD1A 3E3XA 1WSVA 1CQMA 4ICLB 4CH7A 4KFBB 4DUTA 2QIFA 2OPSA 1E6VB 3Q0AA 1ZS6A 4K0KF 2K7JA 1S1VA 4QW8A 4FYDA 3ZTQA 1WI6A 3T41A 2DNPA 4LIWA 1XWLA 1VQMS 2CWKA 2V4JA 5HAOA 3I82A 4BBYA 3GLJA 3RG6A 1VQKS 2UUBJ 2XMTA 5L1LA 1WKKA 3JYTB 2A0FB 2BW2A 2VPXB 3GWCA 2PI5A 4RW4B 3M8QA 4OX9F 4HR2A 2FJVA 5JMNA 4OHYA 2HHVA 6FD1A 4DN9A 4LRDA 2LU2A 2J9DE 3FMWA 3CGIA 4KB7A 5HMWA 3DLEB 5ETOA 4Y3CA 1EJ7L 1X4EA 2MLXA 4JI5F 1MSWD 3HD1A 1XMOF 2V68A 2BE7D 4X65F 3V4IA 4B9TA 1RACB 4B9VA 4RWXA 3IAS9 3TEHB 3RGIA 2DGVA 2DBBA 2IVYA 3MAHA 3NRBA 1NM2A 3A3OB 1U2FA 4KHMA 1R3NA 1XNQJ 4CO3A 1Q81T 2H65B 4KSEB 1N36F 5K8PA 3RRGA 4LUBA 3JSMB 2DNYA 2VFVA 5G0RA 2B56A 2AKWB 5GAGU 2DISA 2QE5A 3I5AA 2E1RA 4LSNA 3ILIA 3R6LB 1TV6B 5KFDA 3NOGA 3HHNB 3DOKA 1CJVB 4H4OB 3DRXA 1N52B 3VAKA 1NK7A 4CCHA 1TL1A 2CQ3A 4NLOA 5DG7A 1U1RA 2DITA 4J7CA 2XTJP 2E1PA 1UVIA 4I2PB 1C2PA 2FGCA 2CADA 3G87A 2IRUA 2B5JB 3CD0A 3NS5A 3TVYA 5KFCA 2W01A 4FXVA 3L09A 1GQEA 2G1HA 4QR0A 3RAXA 1HNIA 2UV8A 1HBNB 5M2RA 1DBDA 3OVBA 2VUGA 4XAKA 4N56A 4KBIA 4DCJB 3EPGA 2N7YA 2EFGA 2E9RX 3W5XA 3IP0A 2RMLA 1E6VA 1T9YA 3HZEA 2ZM6J 4DF4A 4QBUA 3DRPB 3CJKA 1SV5A 1OPIA 4ID8A 1R8AA 2DNQA 4TXSA 3HO1A 3UNYA 4LBIA 4KKOA 1KOHA 3JSYA 1FRIA 1X4AA 4RNOA 4J9LA 1P8GA 2CZVC 1LQ9A 1T9TA 3IR5B 4K4XA 3GJRB 3QWPA 3GYNA 3ILJA 3OFEA 4DV2J 3DGPA 3I9ZA 1G6BA 4QIWD 5AE2A 5BYSA 1RAJA 2BEFA 3JAMU 3MFIA 4RBVA 3DLEA 4OZJA 2CRLA 1SKUB 1PBAA 2XZDB 2HNYA 3M2VB 3LP0B 2NZ4A 2KM8C 2LDYA 2VG5B 3X1LB 3FQLA 4OFZA 1RCOB 3FFIB 4OYOA 1HBOB 4M5IA 2HRTA 1QAIA 3HFVA 3EXCX 1HMVA 1GTEA 4LQ3A 4I1TA 1IQZA 1VDHA 4IFYB 2CDQA 4DV5F 3BGOP 1RBOB 3DOLB 2QLFB 4CT8A 3C16A 1YX2A 2RE1A 5CH7B 4Z37A 3JSMA 1UPPA 1L3KA 3R2CJ 2D69A 3MUTP 2VHGA 3QGIA 2CQIA 1OS5A 1KVKA 4P74A 4A48A 1LW0B 1TKXB 2Q79A 1TV6A 4K4WA 2WSFC 4DL5A 2XI2A 4OJHA 2CUYA 4NXMF 3SCJE 4EUVA 5DM6Q 3KUHA 4HI1A 4AQYJ 1C0TA 2OO4A 1WG4A 4UOGA 2GVZA 2VQFJ 4I2PA 2MYFA 1VBZA 2B5JA 4PPDA 4LF5J 3MEEA 4GVBB 4RW6A 3G8SA 3D6TB 4WP8A 4M5HA 3PX6A 4C11B 4DV4F 3DU6A 5FDLB 4DR7F 2X3GA 3Q83A 2DGWA 1HR0F 2I6WA 4N77A 4J9QA 1HBUB 3EDQB 5BR8J 2OPPB 3K5NA 2V8VA 1S57A 4PZVA 1R89A 4BDPA 3IR6B 1U1KA 3OFFA 1P9YA 3LQVA 2MHEA 2R7WA 2BDPA 1X60A 4U8VA 1T94A 2GMJA 3H98A 3LANA 4AL7A 2FVPA 1WORA 4NLTA 2DO4A 2Z4PA 3AA8A 2PN6A 3QT5A 3TAPA 4EU0A 1X5TA 4ZJOA 2IA6A 5AXNA 2PMWA 2VIHA 3M8YA 3FCWA 3NAHA 2LQ8A 1V9OA 3M2VA 3AY0A 8RUCA 3OJUA 4PYDA 1UP1A 3K5LA 3WC2A 2MLZA 2VG5A 5E7OB 2UUWA 2XSJB 1N33J 4YY3F 3RBXA 2N7CA 2IYGA 4M63A 1B4SA 4JYAJ 5HVGA 4WK3A 3GV8B 3W7BA 4U7UK 2P8IA 1WG5A 3M8ZA 3W63A 1YBTA 3LP2A 3NGSA 1X9WA 2Z58B 4IFYA 1NKBA 4UTGA 3HHLD 2XSFA 4YY3J 4NA2A 1DURA 1WEYA 3OTOJ 4XO0A 3FBBA 4ZMMA 3IRWP 3HULA
chains in the Genus database with same CATH topology
2JC0A 3CCTA 3GILA 3EGZA 2MJNA 4YUDA 1RTIB 1HWUA 1UFWA 1S9EB 2O67A 1MMDA 1SIZA 1FNMA 2NREA 4OJGA 5E0OA 4TY8B 1LW0A 4I2QA 2KT2A 1D1UA 2HG4A 3GG0A 4WFBQ 5FJ4A 4DX8H 2X1GA 4CI0B 3SSSA 3TOQA 3DRRA 2YKOA 4DR3F 2J8AA 2DHAA 1F5AA 4ECSA 2JEJA 3SCIE 1X4DA 5LL6d 3MR2A 2M52A 2W7PA 4FF1A 4L6V3 4DSIA 2VZ9A 1H3DA 3CJ2A 4PPZA 1FJEB 3DNCA 3UR3C 4J9NA 4Y00A 3VAIA 2VBXA 2VFTA 2HLUA 5F8LA 3I0SB 2LVWA 4HDHA 2CQCA 1JLQA 2Q1LA 3HVTB 4AUKA 3G71S 4DFPA 3HJFA 2KN4A 3NNHA 2LKZA 1L3VA 4ECYA 3S8SA 1KONA 3HM9A 2AGPA 1F5CA 3CCZA 1KQKA 2GA7A 1IKVA 3CDEA 4B9LA 4MKYA 3ZZYA 2DRAA 3CJKB 1SV5B 2YWHA 3DFEA 1S1UB 5KG7A 1ZBTA 2M88A 4YR0A 4EO8A 5AXMA 3KLEB 3TANA 2RU9A 3SSRA 4L72B 2VASA 3BSAA 3H2VE 5I3QA 4KKOB 2A18A 3BN4A 2MZQA 3KHRA 4O0IA 2CQGA 3TO8A 4WFXA 2JLEA 4D3HA 4FS1A 1IJFB 1GNKA 2E1MC 1MROB 4EZ9A 1AFIA 4R0EA 2OPRA 4JUZA 3DRYA 2V8GA 4IRDA 1KTVA 4OHVA 4YMEA 2UXCF 2UZAA 4YQWA 4OHZA 3H5YA 2W8LA 4HH0A 4CO2A 2DNKA 4N8NA 2LA6A 2A10A 3PW5A 5FDLA 1GTHA 4LVOP 4NLGA 1REVA 2HMIB 1YJUA 2XEXA 2MMYA 1TL5A 2AJ0A 2G13A 4ZKAA 1HARA 2EW9A 2F8EX 2DIVA 1F2GA 1IM4A 1JNZB 4B02A 1U1LA 2R8HA 2RDIA 2I8EA 2JOQA 2VPZB 4TYBA 4QWDA 1HFEL 5EN1A 4NYZA 2UV8G 5KFSA 2ZH3A 1NJXA 1VQ8S 3FVYA 5DLFA 1VC5A 3MUVP 2HFOA 2MKCA 1XK8A 2BBEA 3CDUA 3HF5A 3M1VB 1HHTP 1YJRA 2NPIA 3MEDB 2HNYB 2FJDB 3MR5A 3LOUA 2JZ5A 3T5HA 2ZBIA 3LW5C 4Q44A 2A3JA 2HAIA 1SJ3P 4DWIA 3T5LA 2HNDB 2WAQD 2MB0B 2YNFB 3C3LA 1FE0A 1QSYA 1R8CA 1T95A 5F41A 1SB6A 3T1HF 2D9PA 4DV3F 1SQEA 5FD1A 2MQLA 4M5DA 3CMAS 2F9JA 3O2IA 4NX9A 3EPIA 3H5UA 4O3RA 1TAQA 2QSFA 3MUMP 3VALA 2NXUA 4Y28C 1VFJA 4WE1A 2YNHA 1U6ZA 2C3YA 1U09A 1RT1B 1KS2A 2JX2A 1HMVB 2YWGA 4WIIA 2M5YA 1M5HA 2LCWA 2DK2A 2XMWA 3KHLA 3N0VA 3W2WA 1U4BA 2D1CA 3O5TB 3CCVS 1CEZA 4H4KA 1GXLA 2P6SA 4BWMA 1N54B 4AXIA 5DQHA 5F8GA 4J9OA 3G9CA 5KFYA 4OX7A 5B0DA 1VRUA 2EC0A 4ZPDA 5K9FA 5DETA 4JI4F 5H1SV 3KHHA 2YX4A 3MURP 2DCUB 2FGOA 2J76E 3R27A 1TL3B 3H2LA 1T02A 4YFUA 1NK6A 1UFLA 1IXKA 2IJNA 1DQ9A 2CJAA 3PEJA 4Y0FA 2Z2MA 4R0JA 2HW3A 4ED6A 2PDAA 3G6XA 3CD6S 2P9EA 1IJEB 3D5MA 3DDNA 3HX9A 2C3PA 1HWIA 3J7YI 3OL7A 2CQ2A 4PG7A 2ZJPQ 3OUYA 2OIHA 1B0TA 2IAJB 1S9GA 1Y9OA 3OTCA 2RDJA 3DMJB 2Q43A 1Q7LB 4OI3A 3KLFA 1SUQB 5I3PA 5DG9A 4QIEA 5IM0A 2GNKA 3L7PA 4ZCIA 1FDDA 1T3OA 4XPCA 2D74B 2DJWA 4HL9A 4WXOA 3FGVA 4ZPCA 3PX4A 2KFNA 3DM2B 4XK8C 2ZJRQ 5DDPC 3BGLA 2DGSA 4JOUA 1O5JA 3PW2A 5I4MA 1URNA 5KT5A 1N88A 5JJBA 5KG5A 1QM9A 2HNZA 4ED2A 2MY8A 1H98A 3V6DA 1C0TB 5KT2A 4IH5A 5K14B 3SDEA 1HBMA 3OFHA 4QWEA 1YIJS 3QJPA 3F41A 3WDOA 3BJYA 1YJTA 1QAXA 4DSLA 5KT7A 5T7LA 1QJHA 2P9GA 3RBDA 2VA2A 1Y00A 5IT9Y 3IWXA 2RD5C 1KSPA 2XB2D 2POKA 4I67A 1TFYA 5E3CA 2VKZG 3HDSA 2XMMA 2GIRA 3DCAA 2RVJA 3MEEB 4KE5A 1VJWA 4RW6B 1WHXA 4LF9F 1S49A 4DSJA 2E5GA 4YR3A 2DR9A 2ASJA 2K1RB 2CPZA 3JTPA 4JI0F 2V4RA 1KR4A 3IWLA 5F8IA 2VBZA 1KHVA 3US5A 4PG4A 5CYMA 5HBMA 4ECWA 1RTIA 1FJGF 2IC3B 4RZRA 4KGKA 2ACYA 2FLOA 4TY8A 1JK9B 1HYSB 2CVIA 2HRUA 2RSQA 2ZD1B 4KV8A 4NYOA 4PXCA 4K4ZA 2FY1A 5GADU 4OZ5A 5KFNA 1H7XA 1DLOB 3EUNA 2XGQA 1S0VA 1U24A 1S0OA 2VD3A 4WFZA 1TK0A 2RNEA 3LAKA 2M8DB 4LFCF 2IBOA 2W7AA 3G96A 3N9UC 3ZZPA 1HWLA 1SI9A 5E3PA 1N32F 1R8BA 4X4VA 4WFAQ 3M30B 4OIXA 3PACA 2LECA 3DLBA 3CJ3A 1VQYA 2F7VA 2LEPA 3I0SA 3HVTA 3EXYA 1S10A 1Q82T 1FJCA 3I96A 1V3ZA 2B4PA 3CUNA 2AX1A 2JDJA 1X7VA 1AUDA 3U27A 4EWTA 4ZHRA 5E3AA 1U48A 3IRXB 3U1MA 3H20A 1S1WA 1N5YB 4I7FA 2NSBA 4O4GB 4PG8A 1RA7A 1UEUA 5GVQA 1RA6A 5KT4A 4Q0BB 1K0VA 1YSJA 4H4KC 1H38A 2DH8A 1EP4A 1ZYQA 2IVMA 4PXEA 3FQKA 4HI2A 3TI0A 1U8SA 4FBUA 1QVGR 2V2KA 4RUCA 2GQCA 4MTPA 4C2MA 2BA9A 2W9CA 1KLNA 2E7WA 2VB6A 4A8XA 4DS5A 4J37A 4OI2A 4JI6F 4MK9A 1N5VA 1GX6A 5GAEI 1IBLF 4DV1F 4DQIA 2DNOA 5A8WB 5MLCV 4ETXA 1X4FA 2DR7A 5HMXA 1D9AA 3HHLB 5B7WA 1FRJA 3GZ7A 3POTA 4F3QA 1IR0A 2BE2A 1S97A 3CT9A 3BO4A 3EGNA 4IG3B 5KFFA 3KLGB 2Q66A 4ZPBA 5F0UA 3FDSA 1FKPA 1X5OA 5EX0A 2W9AA 4LFAF 4HKQA 4CIOA 5AE3A 3BDPA 1FRMA 1KLMB 2DH9A 2F1FA 1N34F 1KFSA 1BLUA 3U1LA 1N0UA 3IBWA 4HTJA 1Q86T 1K9MT 5CD4H 5F8JA 1KNZA 1FCAA 2N82B 2GMLA 2GHVC 3T6BA 2CPYA 1U1PA 3DYAB 1J2VA 1VBXA 1OPZA 3GV5B 1K1QA 1FESA 3T1AA 1FRLA 3VAMA 4AL5A 3DXSX 2WSEC 1ZM3A 3MEDA 1JLEB 4A8QA 4F02A 2XY7A 3D1OA 1NAQA 2BANA 3DLKB 1HI1A 6FDRA 2MKKA 1S0NA 5HMYA 2ASDA 2HNDA 2ZH1A 2R2RA 2MQMA 4B3OB 2VG6A 3SZ2A 2DNRA 2YKNA 1PO6A 1Z2ZA 5B0AA 3TAMB 4QU7A 2CPHA 4LFBF 1QE1B 2MZ1A 1M90T 2UVWA 3NCPA 1R7IA 3PFOA 3B8HA 2YNGB 3FSXA 2VQEF 3BQ1A 2YKMB 2ZH7A 1RT4B 3MM9A 3UE2A 4ED0A 2KDOA 2GV1A 3U1NA 4Y2CA 3CWJA 2DGQA 3IG1B 1RTDB 2HWHA 4IO9Q 1BGXT 3KG4A 1TK5A 2ZE2B 1DTQA 3TX8A 1NHVA 4OZNA 4YB5A 3FSYA 5EGYA 4IQMA 4JV5F 1WF0A 2CFXA 3WZ0A 4HT5A 4DN0A 3LP2B 4NLPA 1VC0A 2ZC4A 1D0EA 1TVRB 4YP3A 3K5OA 5CZVA 2RJZA 5IT4A 1KQGB 2GGPB 3CC2S 4F4XA 3BSCA 3AA9A 1N6QA 1WHVA 2CKWA 4DQRA 3U02A 1WTFA 2EG2A 4DF8A 4F4KA 3QJJA 1R6YA 5E5NA 1SJ1A 2MQQA 3UDLA 4RU9A 1UJ5A 2LXUA 2ZNZA 3T9NA 4URGA 5LSRA 1X8DA 4C97A 4AFFA 5GAHI 4OI0A 1P1LA 3I31A 3MCSA 5F9LA 3UPFA 2HS0A 5J2NB 3U7JA 2KG1A 2ZH4A 4U7CA 4I0WA 2IAJA 1KOOA 2V94A 2DNGA 2VOOA 3DMJA 4I2QB 1XNRF 1SUQA 4KPYA 2PT0A 4ES3A 3G6VA 3PNIA 3OSPA 2GFFA 2R7RA 3PY8A 5B08A 4EGLA 2XY5A 5HI7A 5SZTA 5GADI 3CCES 1IBMF 1NEEA 4GKKF 3S1TA 2M7SA 3DM2A 3DXBA 4ZP6A 3RRKA 2BV3A 3CSKA 3MGJA 3SQGA 4B08A 3V6KA 3MMBB 5DG8A 2CQDA 2KHDA 5EHHA 4HTIA 3MWBA 4DV7F 5IS2A 3OHBA 5K14A 3QAUA 4Y2KA 2OTJS 2OJ3A 2E5HA 1S76D 4NLXA 3M32A 3M2RA 2QA2A 2DHSA 1UVNA 2R4FA 1FRHA 2BABA 4LT6A 4AL6A 4HT7A 5DRKA 1YQHA 1UVKA 4DR4F 5CCMA 1VQ9S 3OHAA 4C8YA 1IKVB 2M4MA 2GJIA 2UXBF 3B4DA 1B0VA 2GC8A 4RNMA 1SH3A 4Y2MA 3CULA 2WBMA 1M0SA 3CDWA 2M2BA 3OTDA 4U9RA 1VQ5S 1VQLS 1IKXA 4DL2A 4E0DA 1JXEA 3Q8SB 3QYYA 4P7TA 1JJ4A 5KAKA 3CMES 5CZXA 4F3MA 3TUIC 3H25A 4HDGA 2LQ5A 1J5OA 2FHKA 3DLHA 3BQ2A 5B0FA 1M5VC 2PFFB 3D0HE 2ZKTA 4C8NA 4ERDA 4CO1A 3IGVA 1XBWA 1C4CA 3N6MA 4UQGA 3TVKA 3MFHA 3G6ES 4KTQA 3H5XA 3OV7A 4FPRA 2O66A 2IC3A 2LQBA 2W4CA 2FDNA 1NH8A 2QA1A 1IUJA 5F3TA 3TP2A 5KFBA 2R8GA 5D3GA 2HPUA 1ZZFA 5LSOA 2ZD1A 2C2EA 1QSSA 3PV8A 3MM5A 3E51A 2WB1D 2QEXS 3LAMA 1DLOA 1REVB 3UCGA 1LWCA 5BJRA 2ERRA 3TAQA 3TUJC 3MR3A 2FVQA 2V9KA 4X4PA 3RBEA 2DR8A 3M6XA 2JWNA 2WSCC 4DUYF 4PUOB 1M5KC 5EWFA 1S72S 2XMVA 4USHA 4ZP9A 5CA5A 1T7PA 5J2PB 4GC7A 1VI7A 4ETZA 3CCRS 2ZH6A 3CF5Q 2A2DA 2E1AA 3DHWC 5E41A 1H0HB 4QWCA 2IRYA 4ZVHA 3RRHA 1N0VC 1APSA 4Z2XA 3PRDA 2KRRA 3KLHA 2HVIA 2ROEA 4DR2F 1FD8A 2HS4A 1N5YA 4O4GA 1FDAA 2JLGA 3TRGA 4C4WA 1JLGB 3R1HA 4MYUA 2OFHX 3T5JA 1QVFR 1KC8T 3PDNA 1KEKA 2VONA 4N5SA 4M5DB 1B64A 4KAIA 3DRSB 1XEZA 4LQ9A 4PKDB 3LWLA 4B9SA 1RKJA 1HD1A 3FMBA 2ZKUA 2KTQA 2YNHB 3NGDA 5D4PA 4DFJA 3LUYA 2XO7A 2K7KA 3M8PA 2VC0A 1VK8A 3NWGA 4XDCA 1W2IA 5A8WA 1UA0A 1Z4UA 4KR0B 2N4CA 4MKBA 3MMAB 4Q43A 5KFPA 2KHCA 4FXDA 3HHLA 2HGLA 3I32A 1FT8A 3OTBA 4NLRA 4W92B 1Q8LA 5IQQA 2LQJA 5KT3A 4IG3A 4GKJF 2GQ2A 1U47A 1WTBA 4X84A 2ZH9A 2ZOMA 1HI8A 3G8QA 2KI2A 2FPHX 1KLMA 3JTOA 4ZDNA 1Q1KA 3Q22A 4R5PB 1OO0B 2F8MA 1OQ3A 2K3IA 5KFJA 4DL6A 1QUVA 1NHUA 3SV3A 1JLAA 3HLUA 1KRPA 3B4MA 2DNNA 1D8ZA 1HQEB 4AXJA 4C3MA 2VKRA 3T1YF 3RB3A 4LF4F 2ILYA 1AFJA 2QZ8A 3F56A 5CYJA 2B4VA 2FC8A 2CVEA 3UW1A