4DPOA

Crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
NLYFQSMLAIRVVAKNQVKPEKVQEFMNLCKSLIEETLKEEGCIDYGVYQELENPEILTMLEEWKDEGSLDQHIRSDHFKEIFPLLSECLDKETEINIYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein
publication title Crystal structure of a conserved protein MM_1583 from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Unknown function
total genus 25
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dpoA00
2ZDOA 4YEAA 2BJEA 2PGCA 2RSQA 1X8DA 3HX9A 4OJ1A 1VQYA 1TZ0A 2ROGA 1TR0A 1KVIA 1ULRA 2HLUA 3HHLA 1Y3KA 2KYZA 3HHLC 4U9RA 1P8GA 2GGPB 2K2PA 2FTRA 2K7KA 3FRYA 5F0UA 1YJUA 2AJ0A 1MWYA 1SI9A 2IYGA 2OD6A 2Q3PA 2W4CA 2ASYA 3DCAA 3CJKB 1X0PA 2N4CA 1Y3JA 4Y2IA 1SB6A 1IUJA 1FESA 3I9ZA 4FNHA 1N5TA 1FVQA 1OPZA 2XMKA 2ROPA 1N5VA 3DXSX 1S6UA 2FIUA 3LGNA 5T7LA 2HQIA 3BR8A 2XMVA 1GXTA 3BB5A 2HFOA 3HHLD 3KKFA 4FNIA 5IXUA 1Y0HA 3KG0A 3IWLA 2GCFA 2BBEA 2EW9A 3TRGA 2OP5A 1P6TA 3LGMA 1N5SA 2N7YA 1TL5A 3KG1A 4Y2KA 2K7JA 2LDIA 4YDXA 5B0EA 5B0FA 3KNGA 2QYCA 3HDSA 1RJJA 2QIFA 4ZA1A 1JWWA 5B0GA 2L3MA 4Q2MA 2RMLA 2BJDA 1XBWA 1YRXA 2CRLA 3BGUA 3E8OA 4ZOSA 2BYCA 4OJ3A 5B0BA 2IYIA 4QOTA 3UDCA 1FEEA 2K1RB 2KT3A 1MWZA 3GZ7A 5F0WA 4HL9A 2GA7A 4EFAC 5B0CA 2GV1A 4Y2MA 1OQ3A 3IWXA 3VTIA 4Q2LA 2LQBA 3WDOA 2GGPA 2PD1A 2HIQA 5A6WA 2OMOA 1WD6A 2XMWA 3CJKA 1YJVA 4DL0C 3T9NA 2FB0A 2HFNA 2XMUA 2FHMA 3MCSA 1FVSA 5B09A 1AW0A 1OSDA 5KAKA 3BDEA 1JK9B 2AJ1A 2OD4A 3BN7A 1TL4A 3FMBA 2QLWA 2XMTA 4OJGA 1APSA 3MZIA 2IFXA 4HH0A 2BUNA 4OIXA 4NPOA 1X7VA 1R6YA 2AW0A 1YG0A 2QLXA 2W4PA 3QGPA 2G9OA 5B0AA 4A46A 4F67A 1Q4RA 2XMMA 2KT2A 4HI1A 3HF5A 1AFIA 2ZDPA 2OKQA 2JDJA 1Q53A 2N4DA 1KQKA 3TNVA 4A4JA 4DPOA 2XMJA 1S6OA 2ACYA 2LXFA 2KKHA 1CC8A 1YJTA 1CPZA 1AFJA 1Q8BA 1GXUA 1FE0A 5T7LB 2K1RA 1FD8A 2OFHX 1QUPA 1U7LA 2GFFA 2RU9A 2VV5A 2W4DA 5K9FA 1KVJA 4DN9A 4HI2A 2OAUA 3BM7A 3FGVA 5B08A 1Y9OA 1TUVA 1VQSA 3QMQA 1V3ZA 2ROEA 4NL5A 1URRA 5B0DA 4HH1A 3F44A 1SQEA 1K0VA 2VH7A 5A6PA 3LO3A 2LQ9A 3HHLB 3TOQA 1OQ6A 4A48A 2HLTA 2GO8A 4A47A 2AP6A 1YJRA 3BF4A 1FE4A 3HFKA 3K7RA 1Q8LA 1CC7A 4OJHA 2OFGX 1N5QA 1W2IA 2RILA 1LQ9A
chains in the Genus database with same CATH superfamily
4NLWA 3TZXA 2IDEA 1VMBA 4RW6B 4PG7A 4KH1B 3CUNA 3H5SA 4WF9Q 2EFOA 2VIHA 3OR1A 3L7PA 3KHLA 7AT1B 1I3OB 3H25A 3PW4A 4F36A 1UW9A 3VVUA 3O5TB 2E7WA 5KT4A 2HBZB 2KI2A 3BGUA 4ZJOA 4CCHA 1UFWA 1W25A 5E41A 2B3TB 2BRKA 5DQGA 2HIQA 3WX4A 4ER8A 4C11A 4TQRA 3GP9A 2F3JA 1MU2B 1R8AA 2YKPA 2LCWA 3HSGA 3VALA 4IG3B 3DGVA 1RWXB 1HQ2A 4WFYA 4NMLA 2OFHX 2RU9A 5KT3A 3I4PA 3TVKA 2ZBCA 1NSPA 1D9DA 5DDQC 4UTGA 1HNXF 1PJ7A 2HHVA 3THPA 3UCGA 4AL6A 3BGLA 2YPZA 4P9SA 2CQPA 1WC6A 1YKWA 3EGNA 4ZJLA 4DR6F 4ZLPA 2V2KA 2E1CA 2KB2A 4DQSA 4ZVUB 2OTLS 1FKAF 4GKJF 3IR5B 3UE2A 3BN4A 3N6MA 1JQGA 4USMA 4ELTA 1ZM2A 2FVPA 2YKNB 3PX0A 3OSPA 2HS4A 4O0NA 3TA1A 3SQGA 2DJWA 4HR2A 3T5JA 2BKOA 4UY8T 3OUYB 2CQ0A 2V50A 4J5OA 1RAJA 3T9NA 2HFNA 2WTFA 1NO8A 1RB0A 3KHRA 3L3CA 3TYTA 3FMBA 1EX8A 2ALZA 4ECXA 3CVKA 3LANA 2B4OA 1WJ9A 1S1UB 4WKYA 3HVTB 3CXCR 2VBZA 2VH7A 2DIUA 3HVWA 3W5ZA 3DI6A 3NS5A 1EQMA 3R6GB 3M7VA 4EI2A 2YKQA 3C15A 4ZN3A 3ZZYA 4UUWA 2ZH3A 1U1MA 4PWWA 2R8IA 3DHWC 8AT1B 1P9QC 3IS9B 4PPZA 3Q22A 1VQOS 1Q5YA 2HZAA 4ZA1A 4QQBA 4IKAA 1T05B 1UJ6A 3TEGA 2V4QA 4F26A 2LA4A 2QRRA 3H90A 4A8WA 2YNIB 2XZTB 1TU0B 3C19A 1U2CA 4F04B 3BN7A 4LSLA 3MGJA 3W3SA 1KTQA 2K8GA 4PWUA 3P49B 1VQ8S 3W2WA 5FDLB 4M94A 5MAOA 2K1RA 1M1HA 3QT8A 4O4GB 1SV5B 2HHSA 2CNKB 1TUVA 1C0TA 4PXEA 5E2QA 2DO4A 2MQ8A 3NOGA 3PRDA 1TK0A 3C46A 2WW8A 3A3OB 1U6BA 2W9CA 1Y3KA 2ZKUA 3OR2B 4JI7F 2U2FA 1SB6A 4IH5A 4YMEA 4PXBA 2HBYB 1N34J 1LOUA 1RTIA 1LW0A 2O01C 3M32B 4B3RF 3N01A 1P6TA 1ZM3A 2B9WA 5E3RA 4QW9A 1SJ3P 3KLEA 1JWWA 1SXLA 3LUYA 4DSIA 3LP2A 1Q1KA 1K0TA 3Q2SC 2LKZA 4WKRA 2XLJA 2VG7B 5KTQA 5AJ3F 3QFHA 1C0UB 2HMIB 1HWIA 2Y0BB 3MMCA 3MEKA 3PM9A 2YNGA 2IBOA 1HBUB 1U1NA 2QLXA 4KV8A 3H42A 4L3NA 2POKA 3M2RA 1Q8KA 4C8KA 3GMGA 1VCTA 2KJVA 4KRWA 3MAAB 2GVZB 3ULHA 4DZ6A 2AT1B 5K9FA 3N6NA 3Q89A 4DN9A 3W8PA 2FD2A 2MLYA 2OTJS 3CW2C 4OZ2A 2Q1LA 2RDJA 2QC3A 2HNDB 2N3OA 4OYWA 1M5PC 2QZ8A 4WP3A 3OL6A 5CA5A 4CLUA 1RLCL 1GH8A 2Y1IA 1R0BG 2KTQA 4TY8B 1K1SA 3BB5A 4JI5F 2FJWA 1JNZB 1HPZB 4M1KA 5IV4A 5K8OA 3OSNA 5B0EA 3KNGA 1RTJB 1RT4B 4FBTA 2WSCC 2JVRA 4F3QA 4ZOSA 3UN2A 1YHQS 1URNA 3BH6B 3HD1A 2YH0A 1AUSL 3CT9A 2ASJA 3JQKA 2M70A 5M2RA 1RWOB 3ZZOA 4LJMA 4EYHB 3B54A 2G9OA 1F3FA 4X65F 4RW4A 4ZVQB 2XI3A 4WPAA 1PYOB 2DNNA 3GG1A 2EKNA 5T7LB 2P5VA 3MEGB 1Q81T 1HNIB 2GMJA 2E1AA 3RRKA 3NKYA 3ZTRA 2BJ8A 1NKBA 1IBLJ 2IM0A 3O1LA 3UW1A 3H98A 1CC7A 4YDDB 3RR7A 3W9HA 1X8DA 2V34A 3H2VE 4W90B 2NXCA 5BJRA 3CJ4A 1DAXA 1UAWA 2HS0A 2H1YA 5IM0A 1S1XA 1RA6A 2D1CA 3VAGA 5RUBA 2KDOA 1M5SA 4DR5F 4I6YA 3DN9A 2VA2A 3L95X 3EPIA 2B0GA 4M5KA 4X4QA 1HMVA 4ED1A 1LWCA 3IRXA 1U8WA 4GO7X 4X66F 4DV4J 4ZPCA 2Q66A 3OTEA 4FKXA 2N3LA 2BANA 5BYSA 1X5PA 4FKYA 4X4UA 3AXMA 2J5AA 3LOUA 5LT5A 2XMMA 5M2PA 4C6AA 1S10A 3TJ8A 4H4MB 1V5IB 3RBDA 2IA6A 1XNRJ 2OLWA 2RQCA 5HMXA 4ECUA 3IG1B 3BBBA 1RWPB 3G82A 2DNMA 2EBGA 2ROEA 2XS2A 3PJWA 2UUAF 3KK2B 2YNHA 4G1PA 5KFYA 4M5GA 4DR4J 4UQTA 2ZNYA 2VPXB 2FTRA 2MMYA 2WVFA 4B9TA 4Y2IA 1UVMA 2E5LJ 4JYAF 1RBOB 1AZSB 2XGPA 2C2EA 4ZVSB 3FMWA 3BR9A 2IPOB 2F8HA 4NLPA 5JXSA 3D67A 4QYZJ 2E1PA 1IKVA 3EXCX 2YX7A 2KRBA 2HQFA 2UUTA 5KT6A 2IY5B 4ZMMA 5KFKA 2NPIA 1WKKA 4GO5X 3VTIA 5IQ6A 2N7CA 4NLRA 3D3BJ 5AE2A 3NP5A 1F5AA 2O66A 4RUCA 2XBPA 1WI8A 2U1AA 3U1LA 3BGRB 1JLBA 5LMNF 3MD3A 1UMJA 5EX3A 3LWLA 1KQKA 4FXVA 2AEJA 3CCQS 2CWKA 2QA2A 2HVEA 3LW5C 4XDDA 2QG9B 1I6JA 5A8KB 2OO4A 2CPYA 3ZFVA 1LWXA 3G87A 1QDUB 2V8VA 2RHQB 1YX2A 1V3RA 1BMQB 4DV6F 3GB0A 2QGFB 2GIRA 3R5DA 1N4LA 3SMZA 2NR0A 1P8GA 2X1BA 1SI9A 3C14A 2H54B 3MD1A 1UPPA 2APOA 1HR0F 2IVFB 2MSTA 3PYEA 1BQMA 2R7OA 1N0VC 4WK1A 3K5LA 2P8IA 3SSSA 2L3MA 1L3KA 2KT5A 4R0EA 2LQ8A 5DETA 2WVCA 4PAAA 2GA7A 2XMAA 2H65B 2VFRA 2H48B 2Z56B 2VD3A 5CD4A 3M8QB 2BABA 1FRKA 1HI8A 1N6QB 4A8YA 2HGNA 3LPYA 2WVDA 4NLYA 3FCWA 2W4PA 1TVRB 2D3OR 2DCLA 2BQUA 3TP2A 3OFFA 1Z2ZA 2KKHA 4N56A 3RB4A 2AYBA 4FP9A 4LQ3A 3JTNA 2GFFA 3BKTA 1BE4A 3C6UB 4C0OC 1S72S 1HHSA 3M4XA 4NXNF 5J2PB 1GMWA 3BF4A 4JP8A 4CWBA 1JLGA 3R5AA 5KG6A 1FNMA 3GSIA 1U49A 3LPEA 1HQUB 3PRBA 2EFGA 2XLIA 3NY0A 1ZAWA 2UUCJ 3BS9A 1ACMB 2RRBA 5F8NA 5DM7Q 4XO0A 1VC5A 1SJRA 4YR2A 2LA6A 1HWJA 1R8PA 2RMLA 2B4VA 4HT5A 4IFVB 2HK2A 3CDWA 3OL8A 1CBKA 3TW0A 3MFHA 3HHDA 2BMBA 5IZHA 1R31A 5ETKA 2CNOB 3FBEA 2CQ1A 3T5LA 1SH2A 1IR2A 1TL4A 4Z7YA 1TV6A 4U67Q 5HVGA 1X7VA 1T0TV 3K17A 4NX9A 4O44A 1RSCA 2GQQA 1EQ0A 1VYAA 3MTKA 1YZ6A 2XYPB 3QATA 4YP3A 3W9IA 2IRXA 4CH1A 1Y5NB 4CIOA 1KEKA 1M5OC 3SFUA 3QAUA 3OD2A 2QN6B 2NREA 1D0EA 3E3XA 4ZVEA 1HFEL 3RW7A 1KS2A 1QAJA 3K89A 1NH7A 4QIEA 3ILOA 2JLGA 2J0XA 5CABA 2IIHA 1ZTWA 4I0WA 2MY8A 2HNZA 2H4WB 1T9VA 1H72C 1ZETA 3IGNA 3D1QA 3J81Y 4LRCA 4OZ3A 2XYGB 1RCOB 2BKPA 4P2XA 4O3OA 2J6UA 2DRAA 2ZHBA 3O44A 4CYUA 1TKDA 3L9ZA 3SCJE 3J7YU 1QVGR 5J2MA 1L3UA 3LALA 3UD5A 2GZOA 4J9PA 2DGXA 1WG5A 3BSAA 1NRKA 2C2RA 5D4OA 4LF6F 4FZVA 1RAAB 3Q8SB 5KG3A 1B0PA 2BOPA 3H2LA 2VPZB 3W61A 2GVDB 1SJ1A 1MG7A 3LP0B 4LF8F 1VQ6S 1X5SA 4DPOA 3UCUP 2UV8A 4DR3F 4YY3J 1WC5A 1RT5A 1JKHB 2DR5A 4DPXA 1PKUA 3KUEA 4OZ1A 2E9RX 4OHXA 1HBMB 1IM6A 2ZFHA 3TR5A 2X3DA 3R9LA 4C3KA 5H9FJ 3KLIB 1CG2A 3VGTA 3ZTPA 2E5HA 2OI2A 3GIIA 1LW2B 4URGA 5HMYA 5IS2A 2DXEA 2LFVA 2C2NA 1JLEA 2YX4A 1C4AA 1RHJB 4NZ6A 1WDTA 4LQ9A 2G1DA 2B5JB 1VBXA 1V9OA 2QYGA 4Q2MA 1YRXA 2X1GA 2VPWB 3M6WA 3IWXA 2OPRA 4IFYA 3KJNB 3HULA 3MOJB 1TELA 1GFWB 4Q8EA 2VU5A 2C2MB 1YRUA 2Z0GA 1H2VZ 3G86A 1RWMB 3DOKB 1S9EA 1VQ5S 5J2QA 3V81A 3A3NB 3VF0B 4USTA 3HF5A 1NK0A 1Q5VA 3PVXA 4EBEA 1JIHA 5DG8A 2AYGA 4P72A 1NJXA 2MQLA 3MTJA 4K0KJ 1S1TB 3AQOA 4ID8A 4HH1A 2NYHA 3QSYB 1UWBA 2ADCA 1YJRA 5L8RC 1NPKA 2D3ZA 4JI0J 2HHTA 1T3NA 4H4OA 3GIJA 1OYEA 4F50A 3HFZB 1R8BA 3VHQA 3CCSS 4KHPF 2BXJA 4WFXA 4DUZF 2RF2A 2MPUA 1YJNS 2QV6A 3IRWP 4C9DA 1TMMA 4OX7A 2XS7A 4A8OA 4CO4A 3N5FA 3QLHA 4DS4A 1EP4A 4EZ9A 3B4MA 3TWZA 3MUTP 2FC9A 2KYXA 2F4VJ 2GJ2A 1U24A 4AQYF 4FF3A 1IR1A 1NLKL 2DNHA 4K59A 1LWFB 3UVJB 3I0SB 1R0AA 1A0OB 4QWCA 1CLFA 1GNKA 2FJDB 2UV8G 2DO0A 4ZVTB 2KN4A 2ZH6A 1VQSA 3K2YA 4R0JA 3RR8A 3CDAA 1RT3B 4QYZK 4ECWA 3FKBA 4B3SJ 3MF5A 4OX6A 3HHKA 4MFBA 2XO6A 3HFKA 2LEBA 5KFSA 2EEYA 2NQPA 2HLUA 3M2VA 1LK7A 1N5YA 1M90T 3H20A 3AB2B 4WFAQ 1FTRA 5J1EB 4FVCA 3K5NA 2BW2A 2MJUA 4CM2A 2H4YB 2CPZA 1L3TA 3AQPA 5HROB 2WAQD 3V6KA 3NEKA 5KFGA 2ZD1B 4JI4J 5IWAF 3THTA 1FFSB 2WW4A 4FYVB 5GAEU 1S48A 2DHXA 3UDVA 4KYZA 4DG1B 3AT1B 3PXGa 1KP6A 2JEIA 4O3NA 2R8KA 2DY1A 3QFWA 2XMJA 4KPYA 2OPPB 4RZRA 4O0IA 4FYWB 4ZCKA 3FFIB 1FRLA 4ZLJA 2W9BA 5E0OA 4MIWA 4JV0A 2DEJA 2ZH9A 2IVMA 4KR0B 3BJYA 3L7OA 5A2QU 2BJ9A 3NGDA 4KKOA 1RABB 4LUBA 3V5RA 1F1BB 2HVIA 2N7YA 3MEDB 4MIAA 1N0UA 1RAGB 4QR0A 3NG8A 3DDKA 4A8SA 1OY8A 3MECA 1NK4A 3NLCA 2YWFA 4PWDA 1U47A 1VLOA 1J5EJ 1AUDA 4X62F 4AFFA 1CULA 4K2JA 4OI1A 5I3QA 1DTTB 1SBRA 5KFDA 4DUYJ 2QA4G 4QIFA 2D3O1 2KXFA 5HSPA 1MU2A 3QT5A 1WG1A 2ZH5A 3NAHA 3VGSA 6AT1B 1I1GA 4WFZA 1Q16B 3JTOA 2XGQA 4JV1A 3K57A 2AWZA 1LNQA 4I68A 3WC2A 5EWEA 1FE4A 2BA9A 1WG4A 2DNRA 4ITSA 1TZ0A 2ABYA 4Z7CA 4DS5A 4YHHJ 2QEXS 4C11B 5DG9A 1I5OB 5I3UB 1N33J 1N5TA 2YQ0A 1U1OA 1IXKA 3M8WA 3LGNA 4Y34A 3BPSP 3Q8YA 2GCFA 3HK2A 3GV5B 4G1IA 3W2VA 3PIOQ 2CNLB 2CRLA 2YKNA 5IV3A 5A6WA 1UFKA 5LSLA 1SQGA 1GTHA 1AT1B 3CMQA 3PKMA 1Y7PA 4NRUA 4HI1A 4RUBA 2J9DA 4DLGA 1VFJA 4P74A 3OVBA 4I56A 5KFJA 3KJQB 4HTIA 4QR1A 2FZGB 2A1BA 4HI2A 1S1UA 3HVTA 3SQGB 4TKTA 1VRUB 3TZYA 1HBOB 4C98A 1QUVA 4OJHA 1HNXJ 1NM2A 2KYZA 4B9MA 3G6ES 1RWUA 3S01A 4TY9A 1FDAA 1XK8A 1YK9A 2A2CA 4DR6J 4CDIA 2R3VA 1FXDA 3M9MB 3B78A 2Y0SD 2ASLA 5HMZA 3IS9A 4GKJJ 2V94A 1WNEA 3A8IA 1AA1B 2CAJA 2OSQA 1KQFB 4ECVA 4QWDA 4C8YA 2VASA 3AAWB 2FLNA 4LF4J 2G2OA 2QSFA 1R7IA 3FDSA 4KJIA 1F3VA 2UVRA 2RRAA 1FX2A 2JC0A 2MYFA 3OPKA 3FEZA 4ZJQA 1RWWB 2FYXA 4LR7A 3C15B 2YNIA 4E0DA 1WUUA 4OQJA 5L38A 3MM8A 3EM1A 2JDJA 2F9DA 1Q53A 3J80U 4ZP6A 1DTQB 1YJTA 1M1GA 3CC2S 3HJVA 4X4RA 4YFUA 4ZVHA 1U2FA 1NUEA 2J0SD 3AD8C 4D3HA 4X4NA 4O4GA 1KOHA 4PG6A 4XPCA 3FVYA 4I2QA 3DDIA 3A4TA 4RNFA 3DRPA 4DOZA 2RS2A 2D69A 4J9VA 3S6EA 1VI7A 1S77D 2CPEA 5D15A 1OMSA 1N32J 3A8KA 4Y00A 3BSNA 4CZCA 3ZZTA 4XTTA 2FLPA 3OR2A 2B9XA 2Y3YA 4LSLB 4NE9C 4ZLLA 3VWSA 3FSIA 2VG6A 4MK8A 1FDNA 2CYYA 1WWHA 5K8PA 3EZ5A 4IDKB 1RXOB 3W2WB 2ZOFA 3PW5A 3ZZ0A 2K1RB 3PFOA 2V4RA 2KRRA 2VFUA 3QRQA 1C0TB 3CJ2A 1LWEA 5GVQA 2VG7A 3BGFA 1C0UA 4H54A 2HMIA 3OJSA 4NPOA 1YG0A 4PQAA 4N5SA 3SEOA 5A8WA 1CC8A 1HARA 4ZVFA 5IT0A 3D28A 1RTIB 1PGZA 1LW0B 3UD3P 1LXNA 3GE9A 4OI2A 4I4BA 3D3CJ 1NDLA 3KLEB 3BO2A 3OLBA 3LP2B 4DX5A 4DX6A 2E66A 2XZWA 2FVSA 3MMCB 4WP9A 1YI2S 3F0NA 1B0VA 5KFVA 2V8PA 4BWJA 2XSFA 1HYSB 2HNDA 2DHSA 2YNGB 4I7FA 3Q8QB 4QIWD 3FCVA 1NJZA 1QAXA 4R8UB 4KV8B 4DL7A 2MQNA 1R3NA 4WU3A 1QE1B 3TA0A 4TY8A 2KVQE 4B3RJ 2K3KA 3D2WA 5ETOA 5KFEA 3VZHA 4ECQA 1YTYA 3EVWA 4Y65A 2DKOB 5HJXA 3R5BA 1IBLF 3G96A 2B8PA 3T5HA 5E3PA 1DHMA 1QM9A 1APSA 3T1AA 2V8HA 4OIXA 1FJEB 5KFQA 4OZNA 4P2FA 1DQ9A 2I5JA 2FHOB 2XY5A 1QUPA 4YB1P 4DL2A 2BQRA 1NCLA 4NA2A 1S0OA 1SJFA 2ILYA 1SJ4P 3QQCD 2J8AA 3CCJS 4TU7A 1RGVA 5D0HA 2VC0A 5GAHI 5ETNA 4NA1A 2OD6A 3DCAA 3J7A1 5D8HB 1Q7YT 4IRKA 4FNHA 3KHHA 3DXSX 4MH8A 1ZM4A 4OZLA 1F5BA 4PXCA 1MN9A 5F3ZA 3AD7C 3BQ1A 2BEFA 3JXOA 1IBMJ 3ZO7A 1NZAA 3RB0A 1O0PA 2ZVIA 2R2UA 4V19X 4P7VA 3OTCA 4WP8A 4TN2A 2GGPA 3CJ3A 1OJ4A 1CJUB 3UDLA 1AYEA 4OHYA 4DV7J 3E01A 1NZ8A 3ENAA 4DR4F 2RNEA 4WYLA 3QGPA 3QJLA 5U47A 5IM0B 1S1XB 3IO1A 3M8SA 4X65J 2LECA 1JJ2R 2YWKA 2KZZA 4ILMA 4H4MA 4C8OA 3GQCA 3MPWA 4ETZA 3MFIA 1K0VA 4UY85 3HZEA 2C28A 4JV5F 3P5BP 1HMVB 4PABA 3KK3A 3GCXP 1DY3A 3NGSA 3IRXB 4F2SA 3KK2A 4LT6A 2WONB 3IBCB 2F65A 4PUOB 3ONQA 3K8VA 1X4DA 4YDXA 4GRSA 1AZSA 1X4BA 2R9LA 1WTBA 1S12A 2JEFA 2HAIA 2I38A 2GV1A 3MR3A 3J80Y 3WDOA 3G82B 4F7VA 1NB2A 3CJKA 1YJVA 4MMOA 4J91A 2QE5A 2YNHB 1F0XA 3LQVA 4OV6A 4X66J 1JLQA 2C3UA 3FSXA 3FBCA 3DLLQ 3QIDA 4NLDA 3VAIA 2DNOA 2FJVA 3OTDA 2X7IA 3DRSB 1F9FA 2B51A 3PJ9A 3BGRA 1B7YB 4ZIVA 4L76A 4J9SA 3NS6A 3G9CA 2OHDA 1TL1B 1DFDA 3FQLA 3ETOA 3RG6A 4F0MA 1EKRA 3ENQA 1SC6A 2V2VA 3CJ0A 1S49A 4B08A 5G0RB 3JB9k 2CADA 3HHLC 2UUAJ 5F0UA 4KIAA 2CQCA 3I9ZA 3AJDA 1FWKA 1S79A 5LOQA 4I64A 1REVA 1WC1A 3SCKE 1CJVA 5ETPA 2PMHA 2A6OA 3K59A 3W5YA 1JLBB 1RKIA 4KSEB 5C5JA 2QYCA 4JYAJ 1JLAA 2DISA 1TKXB 1KDNA 3QWUA 2WBRA 4LBPA 1FKPB 2QJ3A 2KZMA 3P4UB 2Y8YA 5B09A 3KFWX 1U48A 1VHIA 1WF0A 2MQMA 1JJCB 2Y1LB 4H4KA 1X4CA 3C14B 3M8QA 5E3CA 3MXHP 3TAMB 2BDPA 1YLXA 1KVJA 2UUCF 1ELOA 2QX0A 1SQEA 2ZZNA 1IBKJ 2K3IA 3C6UA 3I87A 5KFMA 2ZC3A 1S6PB 2AEFA 2GW8A 1S0VA 5J2PA 5IC4B 1MWYA 3FBFA 2IYGA 4LFCF 4DV6J 3AXKA 3E51A 4WZMA 4QWBA 1PO6A 3M8RA 1OPZA 1RI7A 4RW7A 1XMQF 5T14A 5CZXA 1HQUA 1T9WA 1HR0J 4F4YA 1NU4A 4OX9J 4KFBA 2M2BA 2AD9A 2GIFA 3KHGA 3G71S 2VQFF 2CUYA 2D9OA 1M5KC 3OVAA 5K20B 1VOMA 2FZKB 3OHBA 4O3RA 4BDPA 4FBUA 1JLGB 3M8YA 2B8QA 2NS1B 1NDCA 1EKSA 3I5CA 1SIWB 1YVFA 1BUXA 3N9UC 1H7WA 2B7CB 5CHCB 5I4MA 1TP7A 4B9LA 1WELA 4NI2A 4DEZA 3IM8A 1YJWS 2KO1A 3BGOP 3NNCA 1UVKA 1BLUA 1HBNA 4PQUA 4N76A 3EE3A 4R5PA 2W2PP 3TJAA 2J0QD 2DNQA 4TU8A 2C2DA 2LMIA 2YWGA 1TV6B 2HAFA 1HNWF 2CVIA 4BS2A 4TXSA 2FDNA 2KXNB 2JEGA 2DEIA 2X1FA 2M5YA 2F9JA 3TVZA 1ZA1B 1MWZA 4J9LA 4YY3F 2RUGA 2EC0A 1S9FA 1HNZJ 2HFVA 1E6YA 3RB6A 2IVYA 3GJQB 4OYBA 3TANA 1Q4RA 4G65A 2H5EA 2HNZB 3NBPB 4FF4A 5DJBA 4RJVA 4B3OB 2I2YA 1Q82T 4KB7A 1CEZA 1S4FA 2GVDA 5KG1A 2BE9B 2CQ3A 4CO2A 4DV0J 1JKHA 1DLOA 2W24A 2AMCB 2VOOA 3OV7A 1ZZFA 3R1HA 2R8HA 2H3EB 2Y1RI 3MM5B 3FQKA 2HSEB 1SH3A 2OEJA 2LEAA 4ZP9A 3MR5A 1IUJA 1X60A 1FNXH 4NCGB 1TQLA 1LW2A 1N36J 4TYBA 1WHYA 2ZNZA 4M5JA 2V69A 5KFOA 2YY3A 2WOMB 4PG8A 3QO9A 2ZE2B 3QJJA 1VRTA 1TKTA 2PIIA 1IKWA 1RT5B 3QWPA 4IQMA 3QT7A 2C3MA 4QIVA 8RUCA 4DSEA 2XMWA 4ECYA 4OZ5A 4K0KF 4WK3A 1C1CB 4U96A 2HHPA 3QT6A 4DF8A 4RX6A 1FRMA 2OKQA 3TUJC 4RNMA 3DOKA 2ACYA 4N8OA 1JLEB 2DR7A 3DLGB 3CEDA 3V4MA 2G0IA 1HD0A 1PCAA 2FLLA 4LF8J 2V4JB 2KFNA 5DDRC 5B0DA 3MM7A 4WYWA 2HQCA 5CYQA 2JH3A 3AJ1A 1S1TA 5ETMA 1M0SA 1CS4A 2AJFE 1Y11A 2VKRA 1ZA2B 1WORA 3FEXB 4DX8H 1FK9A 1S9EB 3C3LA 1HHTP 3V81B 3HP6A 4LRDA 5KFCA 4P6QA 2UVWA 1RAHB 4CNYA 1TKZA 2QIFA 3TI0A 5GMEA 1FJCA 3H40A 3PX4A 2ADBA 3GZ7A 3PYFA 2KH9A 3BSOA 2ZH4A 2WSFC 2JLEA 2YBVA 3K0JA 4L73A 3H5YA 1F9EB 4CLKA 4H4OB 5HN0A 5E3AA 4CO1A 1Q8BA 4DX7A 1KVKA 2HBQB 5K14A 4DCPB 2W4DA 4CP5A 3GV8B 4WZQA 2RF2B 1HI1A 2J9EA 4QZVB 5AXMA 2VFSA 2UXCJ 3SQOP 3TVYA 3W5XA 2WZ1A 2D7SA 5GMKa 6FD1A 1GXLA 3R5CA 5HBMB 4AE5A 1S1WA 5DM6Q 1OYDA 1X4AA 4YR3A 2VG5B 1EP4B 5JVHQ 4NLGA 4F02A 2YX1A 4LREA 3I55S 4LF5F 4HACA 4LIRA 1NAQA 3WHIA 4OHVA 1WF2A 2HEKA 1R0AB 5J1EA 2JVOA 4L6V3 1NJWA 4IOAQ 2QA4S 1D1UA 2GAGC 4RWWA 2MZTA 2I1RA 4RO0A 1WC0A 4X4TA 2GHWA 1WTFA 4DPTA 2DGOA 5F8LA 2GQCA 1RTDA 3HKWA 2LYVA 4MFBB 1W2BR 2VL1A 3CDUA 2WB4A 5HK4A 4M5DB 3M2VB 3FC9A 4L75A 1KFSA 4F4XA 4AQYJ 1N5YB 4XPEA 3CTRA 1JXLA 5DZ6A 1FX4A 4KAIA 3QJPA 2ZITA 4YR0A 3IN5A 3NMAA 2K06A 4P7TA 5CYJA 5GADI 3DLHA 3R1LA 1UJ5A 3JQMA 3QMQA 1Y10A 1UPMB 1SL1A 2LQJA 1X31C 3RUBL 4CLTA 2OPPA 1SUQA 4HT7A 3DRRB 2NSCA 5KFPA 4LF2A 3CC7S 2ERRA 3GYNA 1VQYA 3FFIA 3KUGA 1BQXA 2OPSB 1VGYA 2F7VA 1CSJA 1X4FA 2ZWOA 1T9YA 2A18A 3M2UB 1NHKL 4G1QB 4B9SA 3KTQA 3SBMA 1WC3A 4DQIA 1SL2A 1AROP 3OHAA 3FZ2A 3RBXA 1OS5A 2AV5A 3KG4A 3ETMA 2UZAA 2IC3B 3ZNUA 4QR2A 5IWAJ 4EGLA 2W9BB 3QGIA 4FYYB 1J5OA 3GR0A 4GVBB 2XM3A 3KJVB 1S7IA 4HKQA 4Y2AA 3V2UC 1U09A 4P2SA 5ETLA 4KKOB 3MPYA 4F4WA 1BHNA 2XLKA 2XULA 1KR4A 2IJFA 2BOAA 4HDHA 5C24A 5CD4H 3GIRA 1YJ7A 3MECB 4RUHA 2CG4A 4PWDB 3BREA 3AOAA 2DGWA 5AE1A 4OX8A 2RAQA 1CULB 5KFUA 2IM1A 4P2MA 4J9OA 4JI3F 3UO0A 1Y0HA 2I0XA 4IRCA 3RGIA 1S59A 5I3UA 3MPUB 4L72B 3W66A 1XBWA 2UUWA 3U27A 2FGCA 3ET6A 2CJQA 4ICLA 4FF1A 4WBFA 4FF2A 1XNQF 5ETRA 2DNZA 2CXEA 4X62J 2COLA 4F8RA 3BBFA 2UVUA 4FPIA 3H4BA 3PO5A 4ZVPB 3CCUS 2ZOMA 2CQBA 2OAUA 3CE8A 5F8MA 3EDRB 4UOFA 2FVRA 2ZH8A 3W2VB 1V5VA 3BKUA 1HL6A 2IM3A 3HX9A 4LF4F 3D7SB 1S7HA 2UXBF 1X4GA 1VRUA 4EO8A 1HBOA 1NH8A 2OELA 4LBIA 4J9QA 3BR8A 3SDEA 3OXLA 5J1PA 3MM6A 1PSDA 3CJQA 4M5HA 4OYZA 1Q86T 3SIPB 2LLZA 4TLRA 2HNYB 3KLFA 1FO1A 2EI5A 4A8MP 2DCUB 1RTHA 2XG8A 3EXYA 2F5GA 1B64A 4L3KA 2E5IA 2OIHA 2E9TA 1F5CA 2HZVA 1S9GB 3AA9A 5GAEI 1VISA 2UP1A 2OH2A 2ZZMA 4N7TA 2QFJA 1R6VA 4RBVA 2HW3A 1VIOA 1IKXB 4USUA 1TAQA 2MTLA 1S57A 2RQKA 1YWXA 1RYSA 2DPIA 2IHR1 2HG4A 1N32F 5GAHU 5JVGQ 4E98A 2DRBA 1DTQA 4QPTA 1TL3B 3MI7X 2VONA 2GO8A 2XY7A 3MAHA 3FRYA 4DFKA 1N56A 2AJ0A 4UW2A 3CJTA 4RW9A 4DPUA 3O2IA 3NXZA 1H98A 3UI3A 4MK7A 1F2GA 3IM9A 3G8SA 5B0FA 2XB2D 3MM8B 3VZIA 3I4HX 1OWXA 2RQ4A 5DRKA 4ZVOB 4KPCA 1WHXA 2PMWA 3MURP 2L9WA 4RPFA 5HATA 2WSEC 1T7PA 2ZUAA 3ELHA 5IOLA 1QTMA 4IDKA 2PD1A 1FNOA 2IJNA 4ALZA 2MZQA 1V3SA 2JFDA 1P9YA 1CQNA 4DCJB 2Z8QA 4I2QB 3SFGA 4JB8B 3DRPB 3P8BB 5FD1A 4ANDA 5KFIA 4PZVA 4KGKA 2AJ2A 1CPZA 3GYXB 4ED5A 2VG6B 1IQZA 4V19J 3ILIA 4B9VA 2W2NP 4A47A 3UD4P 4CNZA 1ZPVA 3RB3A 1QD1A 2Z30B 1LV5A 1G6BA 1NDPA 3EX7B 2W4CA 3IC1A 1LWEB 3A1YG 3K5MA 4IH6A 1YGYA 1IQTA 5D4PA 3MWBA 1FDBA 4ZIWA 4TU9A 1XERA 2OP5A 5KFLA 1HYSA 3G6XA 3CCES 5A8WB 2AX1A 2ZHAA 4QPXA 1RT7B 3H59A 2MQQA 4R8UA 3DM2A 3BYRA 4C8ZA 1GAOA 2UUBF 1QE1A 4AXIA 2EFNA 2AZ1A 3OBIA 5IQQA 3GR1A 1FVSA 3HKZD 2M9KA 3PHEA 2ZKTA 3RYLA 2XY6A 1WOSA 2KXHA 1UETA 3QGHA 3MZIA 2LU2A 4WTYA 3S7RA 1X5TA 4B9UA 1RYRA 1XR6A 5DQIA 5LL6d 2WHOA 2WVBA 4I7FB 3HMJG 1U1PA 3OJUA 3V6JA 3D6MB 3TAPA 3SZ2A 3MAQA 3D6HB 5KG7A 1IBMF 1GX5A 3FJ2A 2RILA 4OYIA 3EUNA 2R2TA 2NUUG 5IT9U 2Q43A 4ZPTR 2ZJRQ 2UXDJ 1S4EA 4DV7F 2GMHA 2GIQA 2I5JB 1VQKS 5BYRA 2YKOA 1DQ8A 1QLNA 1RWVB 1PBUA 3RAXA 2E5GA 3JQJA 4QW8A 4K4VA 2Q6BA 4MT1A 5IC6B 1R6YA 3ISNC 3P3DA 1CJUA 2CPIA 4ILLA 2J0WA 3CJRA 1ROFA 4KT0C 4ECZA 5DGBA 1VJWA 2NZCA 4YQWA 3MUMP 2RS8A 4BHQA 2VJUA 1WSRA 3WIVA 2NXUA 2XQCA 2MJNA 2O3DA 2V2QA 3O3LA 5L9XA 1HNVB 2ZDOA 3UFCX 4DL6A 2GGPB 5CAAA 2FGOA 1S99A 4FN5A 1KTVA 1RZMA 3PCOB 3HHLD 3E01B 2SXLA 3QRRA 4K4UA 2YKAA 4DSFA 2WONA 4GKKJ 3M6XA 3PEHA 3NL0A 2E5JA 3RRHA 2PT0A 4PUOA 1QY7A 3NCRA 1FTCA 1VLYA 4J9RA 1RKJA 1S0NA 4OI0A 2DGUA 3PNIA 4P10A 4KBIA 4U7UD 4PG5A 1B70B 4O3PA 3IXQA 2LP4A 5C25B 3C66A 3ZZUA 1IR0A 3OQ2A 2DNPA 3KK3B 3WBZA 1NSAA 4OFZA 3H8YA 3OT9A 1EETB 3UWTA 2BQ3A 2PI4A 2VFTA 2HS3A 5HVFA 2V9WA 4CT9A 5L1KA 2D74B 3HLUA 2G1HA 2AJ4A 1QVFR 3DRSA 5I42B 1KWMA 1U1QA 4JI8F 3KLGA 1WEYA 3JYTA 4NLOA 1TL1A 3DMJB 1XR5A 5K5MA 3F56A 2MGZB 3CJKB 4JBCA 4JV5J 1FESA 1KQGB 2EXUA 4DR2F 1FFGB 1S6UA 5G0RA 1BQNB 1JLQB 3SV3A 2BM0A 4NLQA 4JUZA 3C16B 2HYIB 3HDSA 1Q79A 2CKWA 5B0GA 1NHUA 1ZZNA 4K5RA 1U1KA 3T1YJ 2RU3A 3DGPA 2BE7D 4EFAC 1BY9A 4ES2A 3N79A 3QZ7A 4AD6A 1TKXA 3GIKA 1AW0A 1V6HA 4NWBA 1CQMA 1IBKF 1FKPA 2MHEA 4EEYA 3Q8VA 2F4FA 2XCPA 3GG0A 2QMWA 3A13A 3WC0A 2NPFA 1IWAA 4Q44A 1FE0A 5ETQA 2YWWA 1NPPA 2BV3A 1REVB 1CJVB 1L3VA 3BBCA 3PW0A 4NL5A 2RHSB 3AHPA 3FUYA 3TAMA 4DL5A 3J7AN 3OW2R 1JLAB 1RACB 1FT8A 4ZCMA 3DYAA 3OXGA 4OX9F 4OJ1A 4ZP8A 1TK5A 2EVZA 1UEKA 1S6PA 1JX4A 1PIEA 2LVWA 2OPQA 4MTPA 1LEOA 2L9DA 2BM1A 1TL5A 3BQ2A 1F9HA 3MMBA 4Q45A 3EGVA 1JLFB 4DZDA 2B6AB 2H5IB 1GEHA 3IBFB 3HI9A 1MROB 1RLDA 2Y9HA 3BDEA 3M1VA 3O8WA 4WCEQ 4EU0A 4O3SA 2NUHA 2B4PA 5H1SV 4QU6A 2B7BB 4WFNQ 3WQPA 4RW7B 1WOPA 4RNHA 1WEXA 3TUIC 3ZXWA 3Q24A 2L41A 3GV7B 5IT9Y 1Y9OA 2GHPA 1RT6B 2DH7A 1RWNB 4A48A 1OY9A 4C0HA 3DOMB 5D6GA 4K7QA 2G13A 4LF7F 4KFBB 4KC5A 3PJXA 4HEA9 1XWLA 2XWXA 1HNZF 3DU5A 2HRYA 2XMKA 3BO4A 5H9EK 3ZTQA 5ETSA 3IR7B 3L4BC 3PKYA 2V5HG 1X9SA 4LFCJ 2EG2A 4M5NA 1N5SA 4W4MA 4XAKA 1NEEA 2IA0A 5KG0A 2EKYA 4TLQA 2VB6A 4CLLA 2E1RA 3VAKA 1XMQJ 2MSSA 4ED4A 2KT3A 5E7OB 3M05A 1O5JA 2VBYA 2LQBA 1RHMB 1YBUA 1PYTA 1XQIA 4Q5VA 2Z2ZA 2VC1A 4N41A 5BR8F 4DV0F 1YDLA 2DY9A 3CCVS 5JUMA 4QYRA 4NI2B 5SUHA 3VGUA 3PZPA 2VQFJ 2XNQA 2W1BA 4FYXB 3S8SA 3EICA 1HBNB 4PQUB 4YN3B 1WKLA 2JC1A 1RISA 4R5PB 2HFSA 2GO9A 1HD1A 1FWPA 3H4DA 4LRBA 2V8DA 3PIPQ 2UU9F 1RQ0A 1N36F 3NBPA 1U0HB 5B08A 1PG5B 2JFKA 4B3OA 4USKA 5GAGI 2PMZD 1Y00A 5JMNA 5KOWA 5DLFA 4K50A 1NK7A 4U8YA 2XS5A 2AGPA 2UVVA 4C8LA 3EGWB 1E6YB 2HQIA 1X9WA 3MM5A 3UQSA 2A10A 1QJHA 3NGUA 4Y2KA 5J1NA 1R0CB 2NXJA 4LBHA 4NCGA 2R7WA 1R8HA 1HNWJ 2GQ2A 5HQMA 1DQAA 4IYQA 2MXYA 5F9NA 4UZBA 1X0FA 4WE1A 2QFIA 5C42A 2WOMA 2IMWP 2BRLA 2ZE2A 1L5UA 2JOQA 2FJEB 4DV5J 1DLOB 4O23A 1RADB 3VR1A 5GADU 5KFFA 1FDDA 4X4PA 1VK3A 4C2MA 5LMUJ 2LDYA 1C1CA 2W9AA 3A12A 3GSDA 4ZVGA 3C6TA 1KC8T 2OGUA 5L1JA 1UVJA 2LXFA 4JI1F 3KOAA 2XHWA 1JLCB 4TYAA 4HDGA 1W7WA 3DLGA 4NCAA 3LO3A 3HHLB 3QO9B 5AXKA 1RAEB 1HLWA 1VRTB 2V4JA 3PW7A 1MN7A 1TKTB 1IKWB 3SCIE 3I5AA 3HT0A 3DLBA 5D0GA 3RJMB 2VA3A 1ZTTA 3GCWP 4OMFG 2J9CA 4OZJA 1L3SA 5SZTA 1RCXB 2E1MC 1O51A 3I56S 3JSMB 4AL5A 2J76E 1Z1ZA 1S6QA 3N5BA 1Q7LB 1DRZA 3G8QA 2UXCF 4ELVA 2FHJD 1S1VA 2CJKA 2CZ4A 4NXMF 1JK9B 3MM7B 1J27A 5CYQB 1WDDA 3C8YA 2XMTA 2FHKA 1CS4B 4RUAA 2VQEF 4I2PA 2M88A 1ZAVA 3P5TL 2JNJA 4A8QA 4PRFA 1FK9B 1N52B 3QYYA 4DR7J 1GMUA 1FJ7A 4YB5A 2FVQA 2Y1JA 1TKZB 4I69A 1K73T 3OTOF 5CQGA 1WEZA 2QMUB 3ILLA 2PGCA 2QT7A 1TR0A 1XEZA 5L39A 5HBMA 1VQNS 2ROPA 3T6JA 3RBZA 1KLNA 4OZ0A 1E6VB 2VG5A 3HHEA 3UNGC 4CO3A 2PN6A 3I32A 2ZOGA 1O8BA 2XYHB 3N0VA 3GONA 4OYXA 1SKRA 2O1PA 2MB0B 2M8HA 1VHFA 1CJTA 1ZAXA 5K14B 2DT9A 3NCPA 2W7PA 4M63A 3EJMA 3FK4A 3KDOA 1UA0A 1Y5LB 4DV3F 4DL4A 1RHKB 1SC4B 2FJXA 3NWRA 2QTWA 2AGOA 1SJQA 5AT1B 1D8ZA 5LJ3Y 1S1WB 1PC5A 3EPGA 5BXIA 3DLKA 3SSRA 1FRHA 4HACB 3F41A 1TMJA 3HT3A 4FPRA 4M5DA 3GFHA 3CDEA 4FDFA 4WJBA 2DXDA 3WZ0A 3LF0A 1X4HA 1TFYA 4BCAA 1RAFB 2JWNA 1H7XA 1G2EA 3G6YA 3MCMA 4PYDA 4LMZA 3PYDA 2GHVC 4ED2A 3OLAA 4UUXA 2AEMA 4Y2CA 3PYGA 3A8JA 3DRRA 3AOBA 4FVMA 1RTDB 2P2CB 1N54B 4IQXA 3IWLA 2LXIA 2OPSA 4NYOA 4DQPA 2BW7A 4LF5J 1JB0C 1HW9A 4KQZA 3M2UA 3E8OA 5A8RA 2L48A 4G1QA 4Q8FA 5B0BA 1P1TA 4USVA 2V6AA 3QPIA 3TARA 1TL7B 3PX6A 5L1LA 2QL7B 2J7WA 2FQQB 1SUQB 2EFPA 1QSSA 2W7OA 2CQDA 2IC3A 4DV1J 1TUGB 2G2YA 4CT8A 2B56A 2MLZA 1DBDA 2VF3A 4JI6F 2DH8A 3ADAC 2FJAB 4I67A 9RUBA 4GVBA 3Q8RB 3Q8UA 3KJVA 2W8LA 4LF9J 1GXUA 2VODA 1U7LA 2IDLA 2DNLA 3CO9A 3W9JA 3N4WA 3BDPA 2RUSA 2PC6A 1VQ7S 4FS1A 4B3TF 2XC9A 1FJGF 4B9NA 3DHXA 2RDIA 2ASDA 2E7VA 4YEAA 2J7KA 2ROGA 4UOHA 1VC6A 3PV8A 4C7QA 5CXTA 3TEHB 2PSZA 2KM8B 1RAIB 1U8SA 1J5OB 6FDRA 5F8JA 4NEZA 2BBEA 4PYAA 4B3MF 2HVZA 3HSDA 2F63A 4U7UK 5EDWA 4ED8A 4BBYA 3WX8A 4LR8A 5KFHA 3TQ1A 3VAMA 4QOTA 4HL9A 3MMAA 4ETXA 2O67A 2P6SA 1XTZA 3LP1A 2RQMA 1U6FA 4K4TA 3ZZRA 5C24B 3GTYX 3TUZC 3KK1A 1PYSB 1S5ZA 1UCNA 1UVLA 5AXNA 1RT2B 4AL7A 1A9NB 1UP1A 3LH2S 1DARA 2VBXA 3D0IE 4QJVA 2QLJB 4C0BA 4DSLA 4KHMA 1B99A 3GILA 1D3WA 4DCOB 3K58A 3JSYA 3CDBA 3ET6B 4K4SA 3THVA 1SC1B 4PR6A 1TK8A 4DN0A 3EGZA 4ICLB 5LSOA 2N4CA 3AOCA 1HI0P 3CCRS 2QO3A 1XIQA 2CDQA 3VCDA 5IXUA 1T9TA 3QIPA 3CCMS 5F8GA 5KFAA 3VV2B 4LVNP 3DRYA 4JI3J 5K8NA 2RDDA 5HJYA 2DTJA 5ITHA 3GJTB 3CD0A 4A8KA 1C1BA 2HNYA 1ZS6A 2FB0A 2MZSA 4USWA 3GJSB 3OVSA 2V8GA 2X51A 4W98A 2XHCA 4OJGA 1S9GA 3KJFB 3ITHA 3EVMA 2XSJA 4OI6A 1XNQJ 4X4OA 3W7BA 4C3LA 3CD6S 2V67A 1WACA 1MMNA 4J37A 5HVHA 1U25A 3TZZA 3SDEB 1IKXA 3QAEA 2I6WA 3MM6B 4DMZA 1KLMA 3VQSA 3POTB 3KLFB 1T9XA 1XMBA 3LA0A 1RTHB 2BE2A 4A8FA 2XI2A 2OSRA 1TL3A 2AJQA 1NK6A 3RRGA 2OEMA 1KBRA 4CQ1A 3CCZA 3X1LB 2KHCA 4NLTA 2UXBJ 2MZRA 5D78A 3Q23A 2HFOA 5IFMA 4ECRA 3TRGA 4LFAF 1SQFA 4ZLNA 3KUHA 3SYZA 3DOLA 2F1FA 3MEEB 1U26A 5CH7B 3UDCA 4JI2J 2HGMA 2HHHJ 2ZBPA 3UDEA 2YNFB 3G8TA 3SI8A 1H74A 3D6TB 4CTAB 1I94F 1IN0A 2W2OP 3PG9A 3HD2A 3TZWA 1JJHA 3MDFA 3FBBA 3J81U 1WI6A 4EYIB 4WIQA 4RW9B 1FRIA 3HVAA 1IKYA 3DLEA 2B9YA 2Q6CA 5F8HA 1TFWA 3H7HB 4QCLA 3U1MA 3MOZA 1SKUB 3PR5B 2MEWA 1ULRA 4DDFA 3WIUA 1G3OA 4C3MA 2QMXA 4LRAA 3CPWR 4DR1F 4GC7A 4ID5A 1XR7A 4X4VA 5I3PA 4NYPA 1FCAA 1VBZA 1WHWA 2EK1A 4ZHRB 3HSJA 2HHUA 3U1NA 3M6UA 4OI4A 4ZPVR 2BYCA 1G4CA 3CIZA 2B9EA 3IAS9 1PBAA 2EC2A 2RRNA 1RT7A 2AKWB 4B17A 5KT5A 1YBTA 2BR0A 5A2QY 1QAYA 4O4RA 4ZPAA 3J7ZT 2CQ2A 1HW8A 3NOCA 3VAFA 4U7CA 5ADZA 4IO9Q 2UXDF 2AGQA 3DNCA 4CI0B 3ISND 1IM4A 2C3OA 2VV5A 2R2RA 1Y4ZB 4HTJA 5D3GA 2AZ3A 2GNKA 4Z2XA 5KG5A 3X3UA 3RAQA 2MKKA 3RU0A 2DD8S 3DM2B 1T9UA 1N5QA 1C2PA 3GWCA 4K2XA 2ZJPQ 2IAJB 4LSNB 2R7XA 2L9NA 2XMVA 4P75A 2AF6A 3LGMA 1C4CA 1B7FA 2EG1A 4C4WA 3CSKA 5CCLA 2MDAA 5ETVA 5L46A 3TX8A 2Z4PA 4LSZB 4NRTA 7FDRA 1U4BA 1YIJS 4X84A 2OMOA 4EO6A 1RHQB 4HHUA 2VDHA 2UUBJ 3L7UA 5F3TA 1TAUA 2QLWA 1A7GE 1S97A 1WOOA 4ES3A 5AXLA 1N48A 1OO0B 1Z4UA 3ZZZA 4MKVA 2NLWA 2MLXA 1S6OA 3OTBA 4F25A 1AFJA 2DR6A 2FC8A 4CM0A 1GTEA 3SSQA 4RU9A 2HHWA 2BACA 4OLOA 4USIA 9ATCB 4GKKF 2A0FB 4KGZB 3V4IA 1UL3A 3I0RB 5KFBA 3DDNA 2OEKA 4RNOA 2F8MA 4BC7A 1NSKL 2HWIA 5F9LA 1HNVA 2R8JA 5HANA 3B6BA 4E2FB 3JTPA 3LAKA 3C2PA 2GMLA 3PRVA 3TO8A 4IOBA 1HWLA 2J9DE 3EDQB 1NNDA 3NS7B 1K8AT 3V6DA 4E8UA 4LVOP 5EUHA 3PY8A 3QGGA 3R97A 1EZZB 2PA8D 2JSXA 1OPIA 1T11A 4A46A 1CJKB 3HM9A 4HVZA 5C25A 1MMDA 4W92B 3TNVA 4NEYA 2YWHA 2NCKL 3S1TA 3BM7A 3MUVP 3US5A 1EETA 3KLVA 4JV2A 1XMOJ 4P71A 5HLFA 2XZDB 3CD5A 1MW7A 4DQRA 3T1YF 2ZBIA 3CO0P 5I42A 4RNNA 2YKMA 4RBUA 3M8PA 2EFQA 3MPDA 3DFEA 3OL7A 1FVQA 3DMJA 2C22A 2KFZA 4WU2A 2AQ4A 4LF1A 4NZ0A 2MGZA 4X64J 2HHQA 2ZHOA 3HZGA 5A0YA 3KNAA 3BO3A 1VK8A 3HO1A 1T94A 4NA3A 2FJBB 7FD1A 4F4ZA 1BQNA 2HBRB 4RKUC 4NLUA 2HWTA 2C2ZB 2Z58B 2GAHC 2ZM6F 4G6VB 2G4BA 3AY0A 3C16A 4IOCQ 2AYEA 3DRXA 3T3FA 2G2ZA 1F60B 4KHRA 4DFMA 3KLGB 3JYTB 2DGVA 2DK2A 3QNWB 5GAGU 4TQSA 4DPWA 3OFEA 3L09A 3UN5A 4KO0B 3MMJA 4EWTA 3D66A 4EUVA 2C2KB 4IO1A 2PO4A 3IGVA 2YVSA 2V0NA 3T19A 4OI3A 2QLFB 4ILRA 4WFBQ 2IBKA 2R7VA 4TNOA 1F2HA 1BWVA 1D09B 4I1TA 2OFGX 3CB4A 3DGPB 1EIYB 2J6SA 2GS8A 3R7NB 4EK2A 1K47A 4JI8J 4Q0BB 1FEHA 2EBEA 1P27B 1N5VA 4M95A 1WKJA 3CMES 5FJ4A 3I82A 2V68A 4DR2J 4EBDA 2DB1A 2G0JA 4UZCA 4K5SA 1ZBTA 4Y28C 3R8YA 2W8KA 5HP1B 2CQ4A 4ZCIA 2FPHX 3QBCA 1JNRB 1WD6A 4IRDA 1JLFA 2FY1A 2B6AA 3MCOA 3DYAB 3W65A 3D9BA 2AJ1A 1MROA 1ZOTA 4ZVRB 5KOXA 1SH0A 3KMSA 1RBLA 5CYMB 1UJ4A 4K4ZA 4BLGA 2MHNA 2R8GA 1T8EA 3GPAA 2M3DA 2OPQB 2RVJA 3W8GA 1HQEA 4K4XA 1BGXT 3IP0A 1G1XA 3NGRA 4P52A 1VQPS 1FRXA 1QSLA 2AP6A 3MMBB 1RP5A 1Q8LA 4NASA 1RT6A 3JAMU 2CZVC 3DOMA 3Q83A 2VUGA 3KKFA 1RBAA 2KG1A 3M1VB 2VKZG 2AIRB 1FKOB 5HAOA 5B7WA 1H6KX 1RJJA 1T03A 2EPIA 4PEOA 3R3TA 3DKDA 5LXYA 3IWNC 4NOHA 4HYKA 3VGVA 3CWJA 3ILJA 3DXBA 3CCTA 2MKCA 2P9CA 4CO5A 5DZ7A 2EWHA 1NK8A 4U6PA 3TX0A 2YWEA 3RBEA 4LFBF 3LTOA 1X9MA 1FXLA 4ANCA 3TAQA 1HWUA 1N8RT 1U1LA 3K7RA 5KFTA 1U0HA 1H3DA 3ENVA 4DFJA 4OV1A 4XIUA 1XC9A 4YOEA 4C8NA 4U9RA 2K7KA 2DGTA 1AXQA 2Q3PA 4LF7J 2MY7A 4DV5F 2KU7A 3ZTSA 3MPVA 2FLOA 4HLBA 2GX8A 4DV2F 3I9V9 2DH9A 5LMUF 3T1HF 3CCWA 3TUPA 3NMRA 2MKSA 1KD1T 2VJVA 4DPYA 3NWGA 2WRMA 1K1QA 1BC6A 1KONA 1WSVA 3MM9B 4DFPA 5THWA 4ZCLA 1O6XA 3K5OA 2PA3A 4NLVA 2FY8A 5D4NA 1RU2A 1UKUA 1UFLA 3IR6B 4HH0A 3M30B 3GJRB 3GIMA 5BR8J 4KE5A 4IG0B 2GJIA 4YS2A 3BSCA 3D68A 2AU0A 2OMLA 3NGKA 1VQLS 4RU2A 3FGVA 1UVNA 2RKIA 3TQEA 1VBKA 2UU9J 3R2CJ 1JLCA 1RT1A 1FXRA 1REGX 1RWKB 1B4SA 5IT4A 4DUTA 4WE1B 4HHJA 4A8XA 5C42B 3Q86A 3HHLA 3KLHA 1MMLA 1VDHA 2DGQA 2DNYA 1GX6A 3HFVA 2J8SA 4RWXA 2R7TA 2LQ5A 2HGLA 4QU7A 4OYMA 2GJFA 3D0GE 4ZKAA 3ZZPA 4R25A 5J2NA 3C6TB 4RW8A 1ZYQA 1KKHA 2YTCA 3AA8A 1OSCA 3NNAA 2IYIA 4OLPA 3U02A 1RUSA 4I6AA 2XCAA 2JX2A 4DR7F 1HHQA 4Y2MA 2PEBA 3FRZA 3JSMA 4ED6A 2ZZTA 2J7UA 3MCSA 2ZJQQ 4RW6A 2HKEA 1U1RA 3D1HA 2KFYA 1NJYA 3EMTA 2ZC4A 1KFDA 3CJ8A 1H2TZ 1FERA 1KRPA 3T6BA 1R27B 2DHHA 2RIJA 2MKYA 4JI1J 4IH7A 5A76A 3W1YC 2CG8A 1X4EA 4DU8A 1YITS 2QLBB 2CPFA 1S6QB 5HQ8A 4LRFA 4IG3A 3W63A 3OR1B 2M4MA 3BH7B 1S1VB 3ZC4A 4Y0FA 1K44A 1GXTA 2MZ1A 1T02A 2DNKA 3RTVA 4ZPDA 4U95A 3NAIA 2NZ4A 3IA0A 1E6VA 2DYAA 2E7XA 4I2PB 1KN6A 3GLJA 3H5UA 4K4WA 2B43A 4M8LA 4USHA 2ZBRA 2M8DB 1PAUB 2CDRB 2HZCA 4ZK7M 3NRBA 5T41A 3VAHA 4RBTA 4CO0A 1IVZA 2DR8A 5M2UA 1JJ4A 1JMTA 4NXMJ 4K4YA 3NNHA 4OYAA 3AJ2A 1KHWA 3EYZA 1NXIA 3JAMY 1Q95G 3CMAS 2VQEJ 3OUYA 1V3ZA 4BC9A 4GVLA 1NPRA 5A6PA 4TVAB 2JRSA 3CNQP 2PFDA 1CJTB 2FUG9 1U6ZA 1X5OA 2VICA 2HHXA 1LKZA 2HFZA 3OTOJ 4HHHA 1YJUA 5D4LA 3MR2A 1IJFB 1VBYA 4UOGA 4FNIA 2CPDA 1SCJB 3PO4A 2VFVA 4DV1F 2I9SA 2BX6A 2JL9A 1T95A 2EK6A 4JOUA 3FNNA 3N28A 3DLKB 1ITPA 1XJWB 1UEVA 1CVJA 4LF9F 1D9FA 2R7RA 1UZDA 2AHOB 3IMQJ 3T5KA 4WTOB 4QWEA 1UA1A 3A8EA 2RT3A 3FZBA 5C2CA 1P1LA 1JXVA 1FF2A 1TL7A 2MKHA 2DXFA 3UNYA 4DV3J 3MR7A 2CPHA 1FRJA 1M5VC 1VQ4S 1T05A 4UQGA 2H51B 1NK5A 1Q78A 2LU1A 2YXLA 3DI6B 4WIIA 5H9FK 3ZTOA 1URRA 1DJ0A 2YQ3A 5JJBA 4Y3CA 2PE8A 2M7SA 5A8RB 3PR4A 2ACMA 2LEPA 2CPJA 5DO2A 4M5MA 1N34F 3P96A 1ZM9A 1DZ5A 4WWSA 1X0PA 3VVTA 1LK5A 3CULA 3K8WA 3MCNA 4V1Ak 5FDLA 1B3TA 1SV5A 3W62A 3OFHA 2IJRA 4EZ6A 4ATNA 4MAKA 4MKAA 1NK9A 2CJAA 2QSWA 4FYDA 2JZ5A 3HCXA 1VC0A 5E3QA 1EHWA 3SCLE 3HVRA 4GMKA 3LWMA 4Q43A 4AXJA 4OHZA 1A6LA 4FS2A 2HK3A 2BVZA 3M32A 3HJFA 2HRUA 2CJBA 4DL3A 4QBUA 4YUDA 4ES1A 3EZUA 2E44A 2IRYA 3JSBA 1RAOA 2BJ3A 1RT2A 4JI6J 1PAEX 2ZH1A 1KHVA 4X2BA 1VR6A 2O5DA 4PKDB 4Y6IA 3MR6A 4J9UE 2W9CB 1KQSR 1NKEA 2HQ3A 2YH1A 1N88A 5HO4A 2XWYA 2F40A 4IR1A 1HBUA 3D6FB 4B3TJ 1PILA 4BWMA 3CCLS 4DJBA 3RZAA 3MMAB 1FJGJ 3LP1B 1GMWD 4D3GA 2P9GA 3CJSA 3MAAA 3KK1B 2GVZA 4CLYA 2HIYA 3UN3A 4PCQA 3D54A 5L1IA 2ZH7A 2LDIA 2E29A 3I96A 4B3MJ 3N6LA 4Q7AA 5MLCV 5GMDA 3K5PA 4JI7J 3PFEA 3UR3C 2CQHA 3M2RB 1VRQC 3AB4B 2X3GA 5DDPC 2WBMA 1HPZA 5F8IA 4H4KC 4B02A 1VS3A 2CPXA 1RTJA 3CJ5A 4CLPA 1RT4A 4A4JA 4OHWA 2HFUA 3UCZP 4C97A 1SVDA 5AJ3J 3QIPB 4PXDA 4F3MA 1FFWB 1YQHA 4F4KA 3U7JA 2V2ZA 2Z2YB 4J90A 3JS9A 1S0MA 1NMEB 1RTZA 3HXMA 4JI2F 3POTA 2HHHF 3P45B 1C1BB 2IRUA 2K2PA 2M0GB 1M5HA 5T7LA 1U02A 4LR9A 1I51B 3ITHB 2XSJB 3MEGA 4KH0B 3DC2A 1HNIA 3A3PB 1M1KT 2BJDA 4EBCA 4DV4F 2PEHA 2FHJA 1XN9A 4DF4A 1KLMB 1EJ7L 2ZUGA 2C1EB 3MEEA 4DL0C 3JSRA 3IFEA 4RW4B 3W64A 4JI5J 2Z2MA 2R7UA 2BE2B 2YNFA 4PG4A 2IFXA 2BUNA 4CTAA 1XNRF 4DBQA 3ENWA 2MQPA 4DSJA 1DURA 1PJ5A 2N4DA 1MLAA 3H0PA 2YPYA 1NKCA 2V9KA 2VDIA 4QWAA 1JXEA 3DOLB 2A6MA 4FXWA 4ANEA 3VQTA 1RA7A 2E5LF 1UW4A 3R5GA 1VQMS 2RSQA 4CRJA 1SL0A 4UT4A 4K8RA 1K9MT 2W2QP 1Y3JA 3P6YC 1GMVA 1H2UX 2QL9B 4FXDA 1R43A 3IAM9 3IG1A 3H5XA 2VPYB 2FZCB 2NSBA 2DNGA 1LWCB 2P9EA 5H9EJ 3I5BA 4ED7A 3AH6A 2G0CA 4LFAJ 2A3JA 1S76D 2BANB 4ED0A 1IKYB 3DLEB 4ZHRA 1RHUB 1OQ3A 1HIYA 5EWGA 1OIAA 2WVEA 3I6PA 2HQGA 4DR5J 1Z2LA 1I94J 2MKIA 3ICLA 4MJKA 2BJ1A 3FSYA 2ZWPA 4PPDA 4ID5B 3NGTA 3GFZA 4YB6A 3OXFA 2J6TA 2R7QA 4NZ7A 5LXRA 1NHVA 1UZHA 4P73A 3KMQA 2C42A 1HWKA 1OQ6A 3LAMA 1OY6A 4URQU 3IBWA 2HVHA 5D77A 3VAJA 4RR5A 2BJEA 3R7SB 5LM7E 2W25A 2ZH2A 1UWAA 3T41A 1FHTA 1IKVB 5KFXA 2IAJA 4AT1B 4DR1J 4NLSA 4LSNA 4F0KA 3BPDA 5A8KA 2ZVSA 3PHTA 2DPJA 3MHYA 1ICEB 2Y8WA 4DWIA 4YB7A 1NSQA 1RK8A 1TTHB 2CJYB 3UR0A 2R4FA 4CH0S 3OFGA 2VOPA 1YBAA 2CJXB 1FWLA 5D3GB 2XO7A 5C7PA 4I6WA 2B4UA 4N47A 1LXJA 1AFIA 5F41A 4J7CA 4X4SA 1YZ7A 5FIIA 3UPFA 1HA1A 3D1OA 4DQQA 2I8EA 2ILZA 1NBEB 2D41A 3D4JA 3CF5Q 1PJ6A 4CLZA 2ATCB 3ZNJ1 2KL8A 1IJEB 2HLTA 1EARA 4LIWA 1GK8A 1N6QA 1W2IA 3GYGA 2PDAA 2KG0A 4ELUA 1TVRA 5LMNJ 2ATLA 1BQMB 2IM2A 2RE1A 3TA2A 2RJZA 3I0RA 3QZ8A 3TJ9A 3GU0A 2YQ1A 2JHEA 2JJ4D 4Z37A 2EW9A 3M9OB 1Q8IA 4MYTA 2MQOA 2HRTA 4GC6A 3O6QA 5L9NA 3I31A 4UOCA 3PDNA 2CFXA 1D8YA 1R89A 3KDNA 4ERDA 1LFWA 5ETTA 2FHMA 4ED3A 2DBBA 1XMOF 3V4IB 5FLXU 1FI4A 4KGMA 2W01A 1YJ9S 3HHNB 4G3IA 5B0AA 2OJ3A 2D9PA 4MYUA 1CJKA 4X64F 4IFVA 1UTAA 5G4DA 3DLJA 1MSWD 3TOQA 5BYQA 4KGXB 4DLEA 3AD9C 3QSIA 3V6DB 2R2SA 1QTNB 1YRTA 3J81j 2AX0A 3KXDA 8ATCB 5DLGA 2R42A 1VIXA 3EVOA 2F8EX 1IWGA 3G6VA 4NXNJ 3CIMA 3FEYB 2DITA 1SIZA 2BKNA 1U2RA 3R27A 1UEUA 2KHDA 4M5IA 5B0CA 2JEJA 3B82A 4M5LA 1ZPWX 3BQ0A 2H9ZA 2CQGA 2HURA 2X1AA 3M6VA 4OYOA 2P6TA 2KJWA 5HLFB 4O44B 1RE1B 3EWGA 2ALYB 1IBCB 2HPUA 4NMXA 4UF4A 4ZPBA 2YKMB 4F67A 2BZ2A 1VQ9S 1U0SA 3M8PB 2ZDPA 3EZOA 1B0TA 3NCQA 4NCBA 3DU6A 1NDKA 2W7AA 4CLWA 3G2XA 4KO0A 5A0YB 2C3PA 1Q0NA 2RD5C 1GT8A 5HI7A 3M9NB 3F73A 5K8MA 1BWEA 3ISZA 2E9ZA 5KT7A 1KVIA 1LFPA 5EWFA 1BD6A 4S0MA 3RW6A 3LP0A 3B4DA 2NXEA 1AB8A 4C48A 1SKSA 4CYUB 1R8CA 5KG2A 2N82B 5LSRA 5J2MB 4Q0BA 2Z57B 3Q0AA 3KG1A 5KFWA 2ZEJA 1HBMA 3Q2TC 4ECSA 5C2GA 1RHRB 1EB0A 4C8MA 4J9KA 2R7SA 3KLIA 5F0WA 2MZJA 1HKAA 2PI5A 4F0HA 2XMUA 2ZM6J 5HP1A 5CCMA 2KM8C 4AUKA 2QL5B 1F6TA 1FD2A 4WXWA 3B8HA 5KFNA 2B5JA 2KT2A 3W60A 5EGYA 5HMWA 4J9MA 2ZBQA 2C2OB 1FD8A 2KVIA 4NLXA 5CYMA 1PC4A 2JLFA 4JI0F 4LF6J 1QSYA 1WC4A 2DHAA 4L74A 4DSKA 2RB7A 4OL8A 3D5MA 4IR9A 4N77A 4ZPWR 1LQ9A 2WK4A 1VJQA 2H5JB 3J7Z5 2ASYA 2V63A 2DGSA 1YSJA 3PW2A 4DR3J 3SXLA 3BZQA 5KFRA 5EHHA 3R5JB 2A2DA 4ZP7A 3GFXA 2OPRB 4DI6A 2CIMA 2LXUA 1FA0A 4IFYB 3G4SS 3Q8PB 1FKOA 1ZH5A 2W2MP 1HQEB 2F4VF 3CGIA 5DG7A 2Q79A 3RAMA 5J2QB 1BXNA 4USJC 1KNZA 3KWMA 5KAKA 5EN1A 1NJIT 2OD4A 1RDRA 2PFFB 2CWXA 1KSPA 1TUWA 5AE3A 2MKJA 2AYMA 2AW0A 1H0HB 1T3OA 5D0RA 5D0EA 1UWBB 4B3SF 4ZS6A 2IMOA 2XTJP 4CLSA 3BYPA 2DVIA 5CZVA 5E33A 1T03B 2DHGA 3F44A 2CJ9A 1SC3B 3OL9A 5DS7A 2CVEA 2C3YA 1LWFA 3UVJA 3HPOA 1U45A 3I0SA 4ZITA 1WF1A 2DRDA 3SV4A 4F4AA 2FIUA 5KG4A 3KG0A 3FCHA 2K7JA 1RT3A 5FLXY 2DIVA 1WHVA 2XEXA 4JI4F 2HVDA 3QLHB 1MWQA 4EMDA 5DDOC 3R2DJ 1EAYC 1FEEA 3E2EA 3CC4S 4U8VA 3D0HE 1SKWA 2VHGA 1G7CB 1UVIA 4KHPJ 1OSDA 4DU7A 4J9NA 3MM9A 5E5NA 3J7YI 4DUZJ 4URSA 2CNNB 2CZ9A 1Y5IB 3KYLA 1MNEA 2NYIA 5DGAA 4MKBA 5HL7Q 5HROA 3M30A 3PACA 5LJ5Y 4IG0A 4DHVA 2VZ9A 2ZD1A 4ZDNA 5HQLA 2L08A 1D9AA 3GFYA 4N8NA 2M52A 2HWHA 3PEJA 4XK8C 1H73A 4LFBJ 5EX0A 2D3UA 2VBWA 4ENOA 1GQEA 3BV8A 2NXNA 3R6LB 4XDCA 2DR9A 2CA9A 3BKFA 4DG1A 2QA1A 3CD7A 4OYPA 2GC8A 1NB7A 5KT2A 4O3QA 3PTWA 4KY3A 2WCXA 2BJ7A 2FVCA 4CLFA 3LGHA 4DV2J 5KFZA 1J5EF 3T1HJ 3BEGB 4OJ3A 3M8ZA 1RU1A 1SPBP 2RH3A 4ZN1A 3T9ZA 4RL1A 4Q2LA 4MK9A 3HSZA 2RKIB 4AYBD 2EFVA 4MKYA 4DUYF 4KGVB 1RT1B 4WXOA 3QRPA 1W26A 3R7BB 3MEDA 3KLHB 4DXLA 5DQHA 4MIBA 2OUGA 1H38A 4ECTA 4IUFA 4NYZA 3AODA 4F2RA 2XNRA 2HQDA 3V6HA 3AFGA 4CH7A 2Z2LA 1KOOA 4QIGA 2CQIA 4RLEA 1QAIA 5J2NB 4RW8B 2LQ9A 3H2UB 4YHHF 1J2VA 4KTQA 1DTTA 2WB1D 4F3OA 1N33F
chains in the Genus database with same CATH topology
2ZDOA 4NLWA 3UFCX 1RT6A 4RNFA 3DRPA 4DOZA 4DL6A 2GGPB 2RS2A 2CZVC 3S6EA 1VI7A 3DOMA 2FGOA 1S99A 1S77D 2CPEA 4FN5A 1VMBA 1KTVA 4RW6B 4PG7A 2VUGA 4Y00A 3CUNA 3BSNA 4CZCA 3H5SA 3ZZTA 3HHLD 3E01B 3KKFA 2FLPA 3OR2A 2B9XA 4WF9Q 2EFOA 2KG1A 4LSLB 3M1VB 2SXLA 3OR1A 3VWSA 3FSIA 3L7PA 2VKZG 3KHLA 2VG6A 4MK8A 3H25A 3PW4A 4K4UA 1FDNA 2YKAA 1FKOB 4DSFA 2CYYA 1WWHA 2WONA 3M6XA 5B7WA 3PEHA 1H6KX 1RJJA 3O5TB 5K8PA 2EPIA 1T03A 2E5JA 3R3TA 3EZ5A 2PT0A 4IDKB 3RRHA 4PUOA 2E7WA 5LXYA 1QY7A 3NCRA 5KT4A 1FTCA 3IWNC 1VLYA 3W2WB 4J9RA 2KI2A 3BGUA 2ZOFA 3PW5A 1RKJA 4NOHA 1S0NA 4CCHA 4OI0A 3ZZ0A 1UFWA 2K1RB 4HYKA 3PFOA 2DGUA 2V4RA 2KRRA 1W25A 3PNIA 5E41A 2VFUA 4KBIA 2B3TB 2BRKA 5DQGA 3CWJA 1C0TB 2HIQA 3DXBA 3CCTA 2MKCA 3CJ2A 3WX4A 1LWEA 4PG5A 4C11A 4TQRA 5GVQA 2F3JA 4O3PA 3IXQA 2P9CA 4CO5A 2VG7A 3BGFA 3C66A 5C25B 1C0UA 3ZZUA 1MU2B 4H54A 1IR0A 1R8AA 2HMIA 3OQ2A 2DNPA 2YKPA 3WBZA 3OJSA 3KK3B 2LCWA 4NPOA 2EWHA 3VALA 1YG0A 4IG3B 4PQAA 4OFZA 3H8YA 4N5SA 3SEOA 1NK8A 4U6PA 5A8WA 1CC8A 1EETB 1HARA 4ZVFA 3UWTA 5IT0A 2BQ3A 3D28A 4WFYA 2PI4A 1RTIB 2VFTA 1PGZA 4NMLA 2OFHX 1LW0B 2RU9A 5KT3A 3UD3P 2YWEA 3RBEA 3I4PA 4LFBF 1LXNA 2HS3A 2V9WA 3TVKA 4CT9A 5L1KA 2ZBCA 2D74B 1X9MA 3GE9A 3HLUA 1D9DA 5DDQC 1FXLA 2AJ4A 4OI2A 4I4BA 1QVFR 3DRSA 5I42B 3TAQA 1HWUA 1N8RT 3KLEB 3BO2A 1HNXF 2HHVA 1U1LA 3OLBA 3LP2B 1U1QA 3K7RA 3THPA 3UCGA 4JI8F 5KFTA 3KLGA 1WEYA 1H3DA 3BGLA 3JYTA 3ENVA 4AL6A 4NLOA 4DFJA 1TL1A 4OV1A 3DMJB 4XIUA 2CQPA 1XC9A 1XR5A 5K5MA 2E66A 2XZWA 3F56A 4YOEA 4C8NA 2MGZB 2FVSA 3EGNA 4U9RA 4DR6F 3MMCB 2K7KA 1YI2S 2DGTA 1AXQA 1B0VA 5KFVA 2Q3PA 3CJKB 4ZLPA 2V2KA 4JBCA 2E1CA 2KB2A 2MY7A 4BWJA 1FESA 1KQGB 4DV5F 2XSFA 4DQSA 4DR2F 1FKAF 2OTLS 1HYSB 4GKJF 2HNDA 2DHSA 2KU7A 2YNGB 3IR5B 3UE2A 3MPVA 1S6UA 3BN4A 3N6MA 5G0RA 2FLOA 4I7FA 4ELTA 4HLBA 1BQNB 2GX8A 4QIWD 3Q8QB 4DV2F 1JLQB 1ZM2A 2FVPA 3I9V9 2DH9A 1NJZA 2YKNB 3SV3A 1QAXA 2BM0A 4NLQA 4JUZA 4R8UB 5LMUF 3T1HF 4KV8B 4DL7A 3PX0A 3OSPA 2HS4A 2MQNA 1R3NA 3CCWA 4WU3A 3HDSA 2HYIB 3NMRA 3TA1A 1QE1B 3SQGA 3TA0A 2MKSA 4TY8A 1KD1T 1Q79A 2CKWA 2DJWA 5B0GA 3NWGA 2WRMA 1NHUA 2K3KA 1ZZNA 1K1QA 4K5RA 1U1KA 3D2WA 3T5JA 2RU3A 1BC6A 1KONA 3DGPA 4EFAC 1BY9A 4ES2A 5KFEA 4UY8T 3VZHA 3N79A 3OUYB 3MM9B 4DFPA 2CQ0A 5THWA 3QZ7A 4ZCLA 4ECQA 1YTYA 4J5OA 1TKXA 1RAJA 3T9NA 2HFNA 4Y65A 3K5OA 2PA3A 2WTFA 3GIKA 4NLVA 1AW0A 1NO8A 1V6HA 4NWBA 5D4NA 1CQMA 3R5BA 1IBKF 1FKPA 1IBLF 2MHEA 3G96A 3KHRA 3L3CA 1UKUA 1UFLA 4EEYA 3TYTA 3T5HA 3FMBA 5E3PA 3IR6B 1DHMA 1QM9A 2ALZA 1APSA 4HH0A 3T1AA 3M30B 2V8HA 4OIXA 3GIMA 4ECXA 5KFQA 4KE5A 1FJEB 4IG0B 2XCPA 4OZNA 3CVKA 3GG0A 2QMWA 1DQ9A 3LANA 2I5JA 2B4OA 3WC0A 2GJIA 2FHOB 1S1UB 2NPFA 4WKYA 3HVTB 3BSCA 4Q44A 2XY5A 1FE0A 2AU0A 2OMLA 3NGKA 3CXCR 1VQLS 1QUPA 4YB1P 2BV3A 1REVB 2VBZA 4DL2A 2BQRA 4RU2A 1L3VA 3FGVA 4NA2A 3PW0A 2RKIA 1S0OA 1UVNA 4NL5A 3AHPA 2VH7A 3TAMA 4DL5A 2DIUA 1JLCA 3HVWA 2ILYA 1SJFA 1SJ4P 3DI6A 3NS5A 1JLAB 4ZCMA 1FT8A 1RT1A 2J8AA 1FXRA 3OW2R 3CCJS 4TU7A 3DYAA 3OXGA 1RGVA 5IT4A 2YKQA 4WE1B 2VC0A 4HHJA 4OX9F 3ZZYA 4OJ1A 5GAHI 4A8XA 5C42B 4UUWA 3HHLA 4ZP8A 3KLHA 1TK5A 2ZH3A 1U1MA 2R8IA 1MMLA 2DGQA 2EVZA 3DHWC 4NA1A 2OD6A 3DCAA 2DNYA 3J7A1 1GX6A 5D8HB 1P9QC 1Q7YT 3IS9B 4IRKA 4PPZA 4FNHA 4RWXA 2R7TA 1S6PA 1JX4A 2LQ5A 3KHHA 3Q22A 3DXSX 2HGLA 4QU7A 2LVWA 2OPQA 4MH8A 4MTPA 1VQOS 1ZM4A 4OZLA 2L9DA 1F5BA 3D0GE 2BM1A 3ZZPA 4ZKAA 4PXCA 1TL5A 5F3ZA 4R25A 3BQ1A 5J2NA 4ZA1A 3C6TB 4RW8A 4QQBA 4IKAA 3BQ2A 1T05B 1ZYQA 1UJ6A 3MMBA 2YTCA 1NZAA 4Q45A 2V4QA 1JLFB 1O0PA 3AA8A 1OSCA 3RB0A 3NNAA 2IYIA 4F26A 2LA4A 4OLPA 2B6AB 3U02A 2R2UA 2QRRA 4I6AA 2XCAA 4V19X 2JX2A 3HI9A 4DR7F 4Y2MA 1MROB 4P7VA 3FRZA 3JSMA 3OTCA 4TN2A 2GGPA 4A8WA 4ED6A 3CJ3A 2YNIB 2J7UA 3MCSA 3UDLA 2ZJQQ 4RW6A 3BDEA 4OHYA 3BN7A 3E01A 4LSLA 3MGJA 3M1VA 4DR4F 2RNEA 3O8WA 4WYLA 1U1RA 4WCEQ 3D1HA 2KFYA 3QGPA 3QJLA 1NJYA 3W3SA 4EU0A 4O3SA 1KTQA 2ZC4A 2K8GA 4PWUA 1KFDA 5U47A 3P49B 1VQ8S 2NUHA 2B4PA 1H2TZ 5H1SV 4QU6A 3W2WA 2B7BB 1FERA 5FDLB 1KRPA 5IM0B 1S1XB 3T6BA 1R27B 4M94A 4WFNQ 3IO1A 5MAOA 2K1RA 3M8SA 4RW7B 2LECA 4RNHA 4O4GB 1SV5B 2RIJA 2YWKA 1WEXA 1JJ2R 4ILMA 2HHSA 3TUIC 2KZZA 3Q24A 2L41A 3GV7B 5IT9Y 4IH7A 1Y9OA 1TUVA 4H4MA 4C8OA 1C0TA 3GQCA 3MPWA 4ETZA 4PXEA 5E2QA 2DO4A 3MFIA 2GHPA 1X4EA 1RT6B 1K0VA 2DH7A 4A48A 4UY85 4C0HA 5D6GA 1YITS 3HZEA 2G13A 2C28A 3PRDA 4LF7F 1TK0A 2CPFA 4JV5F 1HMVB 1S6QB 3C46A 4KFBB 4KC5A 5HQ8A 2WW8A 3PJXA 4HEA9 3KK3A 1XWLA 3IRXB 4F2SA 1U6BA 2W9CA 1Y3KA 2XWXA 2ZKUA 3OR2B 4IG3A 4JI7F 3OR1B 3KK2A 2M4MA 4LT6A 1U1OA 1HNZF 2U2FA 3DU5A 1SB6A 4IH5A 1S1VB 4YMEA 2HRYA 2WONB 4PXBA 1LOUA 2XMKA 3ZC4A 4Y0FA 3BO4A 4PUOB 1RTIA 1GXTA 2MZ1A 3IR7B 1LW0A 1T02A 2O01C 3PKYA 2DNKA 2V5HG 3M32B 4B3RF 1X9SA 2EG2A 3N01A 3K8VA 3ONQA 1P6TA 3RTVA 1N5SA 1X4DA 4ZPDA 1ZM3A 4XAKA 2B9WA 5E3RA 4YDXA 1NEEA 2IA0A 3NAIA 4QW9A 1SJ3P 5KG0A 2EKYA 3IA0A 1E6VA 2E7XA 2VB6A 4I2PB 4TLQA 3KLEA 2NZ4A 1JWWA 2E1RA 3VAKA 1SXLA 3LUYA 1X4BA 4DSIA 3H5UA 4K4WA 3LP2A 1Q1KA 2MSSA 2B43A 4M8LA 2R9LA 1WTBA 1K0TA 3Q2SC 4USHA 2LKZA 2KT3A 2JEFA 5E7OB 2HAIA 3M05A 1O5JA 2M8DB 4WKRA 2XLJA 2I38A 2VG7B 5KTQA 2GV1A 5AJ3F 3MR3A 2VBYA 1C0UB 2HZCA 2LQBA 3J80Y 3WDOA 2HMIB 1HWIA 4ZK7M 3MMCA 4Q5VA 3MEKA 3CJKA 1YJVA 2VC1A 4MMOA 3PM9A 4N41A 3NRBA 5BR8F 4DV0F 2QE5A 5T41A 3VAHA 2YNGA 4RBTA 2YNHB 3CCVS 5JUMA 4CO0A 4QYRA 5SUHA 1F0XA 3LQVA 2IBOA 2DR8A 1JLQA 1HBUB 1U1NA 5M2UA 1JJ4A 2C3UA 3FSXA 3PZPA 1JMTA 2XNQA 2QLXA 4KV8A 3DLLQ 3QIDA 3S8SA 1HBNB 4PQUB 4K4YA 4L3NA 4NLDA 2POKA 2JC1A 3NNHA 1RISA 3M2RA 4R5PB 3VAIA 4C8KA 3GMGA 2KJVA 2DNOA 2GO9A 4KRWA 3AJ2A 1HD1A 3H4DA 1KHWA 2FJVA 3OTDA 3EYZA 3DRSB 3ULHA 1F9FA 2B51A 2V8DA 3PIPQ 3BGRA 2UU9F 1RQ0A 3JAMY 4J9SA 5K9FA 3CMAS 1N36F 3N6NA 4DN9A 3NBPA 3NS6A 3OUYA 3G9CA 5B08A 2FD2A 2JFKA 1V3ZA 4BC9A 1TL1B 4B3OA 5GAGI 1DFDA 3FQLA 3ETOA 2OTJS 5A6PA 2PMZD 1Y00A 2JRSA 2Q1LA 3ENQA 1SC6A 5KOWA 5DLFA 2RDJA 4K50A 2FUG9 1NK7A 2XS5A 1U6ZA 3CJ0A 2AGPA 1X5OA 2UVVA 2HNDB 2HHXA 1S49A 1LKZA 2HFZA 4B08A 2N3OA 5G0RB 3JB9k 3HHLC 1M5PC 4C8LA 5F0UA 1YJUA 5D4LA 3EGWB 3MR2A 2QZ8A 3OL6A 4KIAA 2CQCA 1IJFB 3I9ZA 5CA5A 1E6YB 1GH8A 2Y1IA 1VBYA 1S79A 2HQIA 4I64A 4TY8B 1X9WA 2KTQA 1K1SA 3BB5A 3MM5A 4FNIA 3UQSA 4JI5F 2FJWA 2A10A 2CPDA 1JNZB 1REVA 1HPZB 4M1KA 3SCKE 3PO4A 2PMHA 2VFVA 4DV1F 3K59A 5K8OA 1QJHA 3OSNA 2I9SA 4Y2KA 1JLBB 1M5KC 1RKIA 5B0EA 5J1NA 4KSEB 3KNGA 5C5JA 2QYCA 4NCGA 1RTJB 2JL9A 2R7WA 1RT4B 4FBTA 1T95A 1R8HA 2EK6A 3FNNA 4JOUA 3N28A 2WSCC 3DLKB 2GQ2A 1JLAA 1CVJA 1UEVA 2JVRA 1DQAA 2DISA 4ZOSA 4F3QA 1TKXB 4LF9F 1YHQS 1URNA 4IYQA 2MXYA 5F9NA 3QWUA 1D9FA 2R7RA 4WE1A 1X0FA 2WBRA 1FKPB 5C42A 2WOMA 2KZMA 2YH0A 2BRLA 2ZE2A 2IMWP 1L5UA 3CT9A 2JOQA 2FJEB 3T5KA 2ASJA 4QWEA 1UA1A 5B09A 3A8EA 2M70A 1DLOB 4O23A 3KFWX 2RT3A 3FZBA 3VR1A 5GADU 1U48A 1P1LA 5M2RA 1WF0A 5KFFA 2MQMA 1FF2A 1FDDA 2MKHA 3ZZOA 4LJMA 4X4PA 1VK3A 4C2MA 4EYHB 4H4KA 2LDYA 1C1CA 2CPHA 2G9OA 2W9AA 3GSDA 1X4CA 1FRJA 4X65F 4ZVGA 1M5VC 4RW4A 3M8QA 2XI3A 3C6TA 5E3CA 1VQ4S 1T05A 3MXHP 1KC8T 5L1JA 1UVJA 2LXFA 4JI1F 4UQGA 3KOAA 2XHWA 1NK5A 2DNNA 1Q78A 2LU1A 3GG1A 5T7LB 3TAMB 2BDPA 1JLCB 3DI6B