4DQ4A

Bovine beta-lactoglobulin complex with linoleic acid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
162
structure length
158
Chain Sequence
b'LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDAENKVLVLDTDYKKYLLFCMENSAEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title Binding of 18-carbon unsaturated fatty acids to bovine beta-lactoglobulin--structural and thermodynamic studies.
pubmed doi rcsb
molecule tags Transport protein
total genus 41
structure length 158
sequence length 162
ec nomenclature
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4dq4A00
1YP6A 2FLJA 5HCDC 4UU2A 3MBTA 3STKA 1NP1A 1QABE 1BLRA 5EDBA 2Q2PA 2HNXA 3B2JA 1QY0A 4ORSA 4TJZA 1TOUA 1OBQA 2X45A 1GT4A 1OEJA 5C0NA 1G7NA 2HLVA 5IO7A 3FIQA 4GNYA 1B4MA 1JZUA 5B29A 4Y0RA 4Y0PA 5H9LA 3BDRA 2OZQA 4ORWA 1TW4A 4OMWA 1CJ5A 1QY1A 4XMGA 1ML7A 3B2HA 3ZQ3A 1DZPA 4IBAA 1YWAA 4NYQA 2PY1A 5KIDA 4TKHA 4YBUA 1HBQA 3NADA 4M7MA 4ZCBA 4IB7A 3STNA 3TGAA 3DSZA 5KICA 2JU7A 3CBSA 1GT1A 4YMYA 1FTPA 2K62A 1PBOA 3C77X 1BRPA 2HMBA 4ZFXA 2O62A 3JSQA 1Z24A 3HWDA 4I9RA 3TF6A 4I3CA 4BVMA 1OPBA 5EZ2A 3WVMA 3WJFA 3S26A 3WJCA 2F73A 4GNWA 4AZRA 3B2LA 2RCTA 1CBSA 2AT5X 5DPQA 5HZ5A 2YG2A 2Q4NA 4RUNA 2R56A 1X8UA 4PSQA 2ACOA 1HQPA 3RZYA 2AT6X 3PP6A 1JYJA 1E02A 3NQ9A 3FELA 3P6GA 3P6DA 1ZNHA 2DM5A 2G78A 5LJHA 4ZHHA 3NR3A 1YUPA 4HPAA 1T68X 4QYNA 1AB0A 4TKBA 5HCEC 1A18A 1B8EA 1QFVA 3D95A 5HCCC 4M6SA 4OS3A 2L68A 4AZNA 1ERBA 5IO6A 1E00A 1A3YA 1UREA 4DQ4A 5HTDA 5HZ9A 1YWDA 3EBWA 3BS2A 1OBPA 3KZAA 1FE3A 4YDBA 1A57A 2LBVA 1LFOA 3C76X 1GT5A 4A60A 3I0AA 2A3FX 4ORUA 1EPAA 2FR3A 1TXLA 3BX8A 2GC9A 4MVKA 4XMDA 3NQ3A 1A2DA 4XMCA 3APUA 1ADLA 5JR8A 1ICMA 3VG5A 1LICA 1G74A 3FA7A 3FR5A 1KZWA 1CBQA 4GE1A 2NNDA 3FENA 5BVSA 1ERXA 2GJ5A 5D4AA 3EBKA 4ZR2A 2Q2MA 4AZOA 3I17A 5B27A 2AKQA 4WFUA 2WQAE 2W2AA 3BU1A 2ANSA 4DQ3A 1BEBA 1BJ7A 4QZTA 4N7DA 2HZQA 1N0SA 3KQ0A 5LJBA 1IFBA 5H9KA 1G5WA 2MM3A 4IAWA 4CK4A 5HZ6A 5HA1A 1AQBA 1IFCA 1HN2A 1EXSA 1IKJA 1YWBA 3STMX 1I4UA 1GKAB 4YFQA 4ORYA 4ZGUA 2L5PA 4QGXA 3NPOA 2W2BA 3PH6A 3AKNA 4GH7A 1LIEA 1EPBA 1PMPA 4IB8A 1AVGI 1X8NA 4EXZA 2XKLA 3VG6A 4ZHDA 3VG3A 1CBIA 1JYDA 1SY2A 2MO5A 3PEDA 1I04A 2QOSC 4ALOA 2FT9A 5HTEA 1G85A 5LJDA 2G7BA 3BSZE 5LJKA 3GAQA 2L67A 1MVGA 2FS6A 5F7GA 3CMPA 4A1HA 1KT7A 2AT0X 3NX1A 3TGBA 4YGHA 3FA8A 1YP7A 2E4JA 3FMZA 3FW4A 3HWFA 4Y0QA 4HPCA 5HZ8A 3CBCA 3U9PC 4ZHFA 3AKMA 3O22A 3ELXA 2OVAA 5DG4A 3BRNA 4NNSA 1UZ2X 1IIUA 1X89A 4ES7A 1ZNGA 3UEWA 1MX7A 1SY0A 1GKAA 1SXUA 3EYCA 5K06A 2LFOA 1L6MA 2ACPX 4GKCA 4EEJA 2N93A 4I3DA 3FEKA 1SY1A 3VG4A 4YFPA 5HBSA 3KFHA 1RLBE 1ZRYA 1FELA 2LBAA 4NLJA 3WJBA 1T0VA 3TZSA 2KTDA 4LZVA 1RBPA 4YCHA 4YKMA 2HZRA 2OFRX 1QFTA 1E5PA 3VG7A 4XMHA 5H8TA 3WBGA 5FAZA 3FA9A 1I06A 1KQXA 3CR6A 5KHPA 2QO5A 3ZUIA 1GX9A 4TKJA 1IW2A 1LIDA 2RCQA 3F9DA 1S2PA 1HMTA 2EU7X 1TVQA 1D2UA 1O8VA 5IO5A 4AYHA 1DF3A 3APVA 5D8JA 1FENA 4ZJ0A 3C78X 2AT8X 3B2IA 2OFMX 1GM6A 3UEUA 4Y0SA 1ZNEA 3TGCA 5LKEA 1S7DA 1NGLA 5CE4A 2Q9SA 3APXA 1VYGA 1KT6A 2K23A 3CQRA 1BSQA 4TLJA 1JBHA 1BSOA 2QM9A 2HYSA 2CZTA 3KFGA 4ORXA 2QO4A 1DC9A 1ZNLA 3SAOA 4BQUA 3BLGA 2AT3X 1CBRA 4TNNA 1SXXA 1SA8A 5F6ZA 1IKEA 5D48A 5F58A 2P8GA 1QQSA 3JS1A 1T8VA 2ASNX 5H9NA 3WJGA 1X8OA 1D3SA 2A13A 3U03A 5F6BA 1LKEA 1KXOA 2FWVA 1YIVA 3OJYC 4NLIA 2R73A 4I3BA 2RD7C 1PEEA 3QKGA 2LKKA 5HA0A 4GRJA 3NX2A 2CBSA 1OEKA 5AQ6A 3P6HA 1B56A 2CBRA 3PH5A 4YH0A 3P6FA 3FW5A 2BLGA 2WUTA 1BWYA 1BBPA 1XKIA 5HWZA 1JV4A 1DV9A 4R0BA 2KT4B 3UEVA 3T1DA 2GTFX 2WR6A 1HMSA 1QG5A 1ZNDA 1XCAA 3KFFA 5LJEA 1LPJA 4OS8A 5L8OA 2JU8A 1S44A 3F8AA 5H9AA 4MVIA 5BVQA 3HWGA 4IB9A 2FTBA 3KFIA 1H91A 1X71A 4AZPA 5HAEA 3K3LA 4WFVA 1OEEA 3PPTA 1B0OA 3D97A 4ODDA 4A1YA 2CM9A 4ZH6A 1AELA 2JOZA 3FR2A 4QAEA 4QYPA 2A2UA 4MVLA 2WSJA 3IA8A 1SXWA 1EQDA 1TOWA 4EDEA 1U18A 1I05A 4ARHA 3P6EA 1JJXA 1X8QA 2IFBA 1ALBA 3BU9A 1BM5A 2R74A 1MUPA 3WJDA 4NNTA 4RUUA 5LKFA 4HFOA 5HZQA 3HWEA 1DFVA 3HK1A 2A0AA 3O19A 5FENA 2FS7A 4LKTA 5LJGA 3MVFA 4OMXA 1HMRA 2W2FA 1FEMA 4HPDA 4IAXA 4ZH9A 3ZUOA 1LIFA 3NP1A 4BOEA 3UEXA 1KT3A 4IMNA 2OVDA 4XMFA 1YWCA 4D6AA 1KQWA 1EW3A 1KGLA 2NP1A 4UU3A 1KZXA 4LKPA 1SY3A 1E06A 4YCEA 3RSWA 4AZMA 1DZKA 5LJCA 4QGVA 1EUOA 2G79A 1DZJA 2LB6A 4YGZA 3FA6A 3O2YA 4YKOA 3FEPA 2X46A 2WWPA 3CWKA 4K19A 5L8NA 4OS0A 2ALLX 4YFRA 2FRSA 3FR4A 5EEDA 1MX8A 1NP4A 2CZUA 5EEEA 5EDCA 2MJIA 1BRQA 2RQ0A 1JJJA 1O1VA 1ACDA 4NYRA 4ZHCA 4WBKA 4YBPA 3WXQA 1KT5A 4EFGA 2POAA 2AL0X 1OPAA 2AMMX 1LF7A 4N7CA 2XSTA 1VYFA 1HBPA 5FFHA 3U0DA 3FLLA 3Q6LA 1GT3A 1LNMA 3B2KA 1U0XA 1U17A 4AZQA 2QO6A 4ZHGA 1KT4A 2NNQA 4I9SA 3P6CA 1OBUA 2OVEA 2WQ9A 1CRBA 4AW8A 5BVTA 4QZUA 3VG2A 4O9SA 1ICNA 1P6PA 2JU3A 2AH7X 4A8ZA 4KIIA 1SXYA 5F1EA 5L8IA 3DTQA 1DZMA 3D96A 4YGGA 2CM4A 5EPQA 1GXAA 1R0UA 4ALBA 3WJEA 1EIOA 3ELZA 4LZUA 2WEXA 1EIIA 1O1UA 3EMMA 1KOIA 1ZNKA 4YDAA 1LIBA 1QY2A 4HPBA 1GGLA 2NNEA 4IB6A 1BSYA 1MDCA 1VPRA 4GETA 3G7XA 1GX8A 3IFBA 1PM1X 5D47A 4D6BA 3APWA 1QWDA 2FR2A 4ORRA 3BY0A 4IMOA 4QGWA 4TQ2A 2WEWA 3L4RA 2L9CA 2A2GA 2JN3A 3EM0A 3PECA 3BX7A 1FDQA 1X8PA 1EALA 4XMEA 2RA6A 2Q39A 4NP1A 5D45A 3CQNA
chains in the Genus database with same CATH superfamily
1YP6A 2FLJA 5HCDC 4UU2A 3MBTA 3STKA 3ZW0B 1NP1A 1QABE 1BLRA 5AJCA 5EDBA 1E2TA 2Q2PA 3RDUA 1AVDA 2HNXA 1VWLB 4BGFA 4FBVA 1JQPA 1SWNA 4ON1A 3B2JA 1QY0A 4ORSA 4TJZA 1TOUA 1SRGA 3VHMA 2BS6A 2OFAA 1SRIA 1OBQA 2X45A 1GT4A 1OEJA 2IZIA 4FQBB 1G7NA 2HLVA 2VFBA 5C0NA 4O3YA 1UYNX 5IO7A 3FIQA 3QQ2A 4GNYA 3SOTA 1B4MA 4FBOA 2G5LA 1JZUA 5B29A 1I9HA 1STPA 4Y0RA 4Y0PA 1SWOA 2G8CO 5H9LA 2X8FA 3BDRA 2CAMA 2OL8O 2OZQA 4ORWA 2HKDA 1TW4A 4OMWA 1CJ5A 1QY1A 4XMGA 1ML7A 3B2HA 3ZQ3A 1DZPA 4O49A 4IBAA 1YWAA 4NYQA 2PY1A 4OELA 2UZ2A 5KIDA 4TKHA 4CPHA 4YBUA 1UYOX 1HBQA 3NADA 1SLEB 4M7MA 4ZCBA 1STSB 4IB7A 3D9WA 3STNA 3TGAA 1SWGA 2ZSCA 3DSZA 4BX7B 5KICA 2JU7A 3CBSA 1GT1A 3WZQA 4YMYA 2IZEB 1FTPA 4KH8A 2RTRB 2K62A 1JMZA 1PBOA 3C77X 1BRPA 2HMBA 4ZFXA 5B5FA 2O62A 3JSQA 1Z24A 3HWDA 4I9RA 3TF6A 4I3CA 4BVMA 1OPBA 5EZ2A 3WVMA 3WJFA 3S26A 4JGLA 4CDDA 3OD9A 1RSUB 3ZW0A 3WJCA 2F73A 4GNWA 4AZRA 2KTSA 1NBXA 3B2LA 4CDCA 4BBOA 2RCTA 1CBSA 2AT5X 2RN4A 1HXLA 5DPQA 3RBYA 5HZ5A 2YG2A 1VWQB 2Q4NA 4RUNA 2R56A 1X8UA 4PSQA 2ACOA 1HQPA 1W6FA 3RZYA 2AT6X 3PP6A 1JYJA 2OVSA 1SWRA 1E02A 1VWHB 1SWAA 4Z2VA 3NQ9A 3FELA 3P6GA 2RTKA 3P6DA 1RSTB 3WOVA 3T6FA 2OY5O 1ZNHA 4U8UO 3EW1A 4COTA 2F09A 2DM5A 2G78A 2JW1A 5LJHA 4ZHHA 3NR3A 1YUPA 2A8GA 2X56A 4HPAA 4KC7A 3OBLA 1T68X 1EI5A 4QYNA 1AB0A 3HPEA 5HCEC 4TKBA 1A18A 1B8EA 1QFVA 3D95A 5HCCC 4M6SA 4OS3A 2L68A 3MG5A 1ERBA 4AZNA 1E00A 1A3YA 1UREA 4BX7A 3WYQA 4DQ4A 3WYPA 5HTDA 1JMXA 5HZ9A 1YWDA 3EBWA 3BS2A 1OBPA 3KZAA 1FE3A 1VWAB 1VWCB 4YDBA 4BCSA 4Z6JA 4MEEA 4Z28A 2LBVA 1LFOA 3C76X 4JO6A 1GT5A 4A60A 2A5CA 2A3FX 3I0AA 3T6LA 5K67A 2A5BA 4ORUA 1EPAA 1VWMB 2ZAIA 1SWQA 2FR3A 1TXLA 2OL6O 3SLTA 3BX8A 2GC9A 4MVKA 4XMDA 2OY8A 3NQ3A 1A2DA 4XMCA 3APUA 2IZHB 1SREA 5EPQA 1ADLA 3RWXA 5IRAA 5JR8A 1ICMA 3VG5A 1LICA 2OF9A 1G74A 3FA7A 3FR5A 1KZWA 1CBQA 4GE1A 2NNDA 2X34A 4GGZA 4BX5A 3FENA 5BVSA 1ERXA 2GJ5A 5D4AA 2GH7A 3EBKA 2Z4HA 4ZR2A 2Q2MA 4AZOA 4U8UM 4INNA 3I17A 5B27A 3P02A 4GUZA 2IZCB 4BX6A 2AKQA 4HWMA 4WFUA 2WQAE 5FQ7E 2W2AA 2MWHA 1SWLA 2AF5A 3BU1A 2ANSA 4DQ3A 1BEBA 4IRWA 1BJ7A 4LQZA 4QZTA 4N7DA 4KT5A 1NQMA 2HZQA 1N0SA 2RTIB 3KQ0A 2BC3A 4O4XA 5LJBA 1IFBA 5H9KA 1G5WA 4GGTA 2MM3A 1LCWA 4IAWA 4CK4A 5HZ6A 1N9YA 5HA1A 1AQBA 1IFCA 1HN2A 4MVEA 1SWJA 2BSZA 1EXSA 1AVEA 4NV7A 1IKJA 1YWBA 3STMX 3VU1A 1I4UA 3GE2A 1GKAB 2X4MA 4YFQA 4DCBA 4ORYA 4ZGUA 2L5PA 3FIDA 2OL7A 4QGXA 1N7YA 2DJFA 3NPOA 3HOEA 2W2BA 3PH6A 3AKNA 4GH7A 3X00A 1LIEA 1A57A 4C5PA 1EPBA 1PMPA 2OF8A 4IB8A 1AVGI 1X8NA 3VHHA 4EXZA 3RDOA 2XKLA 3VG6A 3RDQA 1SLDB 1MM9A 4ZHDA 3VG3A 1CBIA 1JYDA 1N9MA 5IRUA 1SY2A 3RDXA 1WBIA 3ZZVA 5IXGA 2MO5A 5IRWA 3VGWA 3PEDA 5IO6A 1I04A 2QOSC 4WHIA 4ALOA 4EQAC 2FT9A 4O3WA 3FYFA 5HTEA 1G85A 1SLGB 2QCBA 1SRHA 5LJDA 1SWHA 2G7BA 3BSZE 1SWUA 4U8UN 4KCAA 5LJKA 2RTQB 3GAQA 2L67A 1MVGA 2FS6A 5F7GA 3CMPA 4L1NA 4A1HA 1KT7A 2AT0X 2FHLA 1Y52X 3NX1A 2OFBA 3FA8A 4YGHA 1YP7A 2E4JA 2RTJA 3FMZA 3FDCA 4U3QA 1KL4A 3FW4A 3HWFA 4Y0QA 4QNIA 4HPCA 5HZ8A 5CSEA 3CBCA 4OKAA 4CDFA 3U9PC 2F01A 4ZHFA 3AKMA 3O22A 3ELXA 2OVAA 5DG4A 2IZFB 3BRNA 3OE3A 4NNSA 2RTDB 1VWJB 1UZ2X 1IIUA 2IZBA 1OSPO 1JJUA 1X89A 4ES7A 1ZNGA 2RTMA 1MX7A 4GU8A 3UEWA 1SY0A 1GKAA 1SXUA 3EYCA 5K06A 2LFOA 3RDMA 1L6MA 2Y3EA 2ACPX 4GKCA 4EEJA 4FBRA 2N93A 4I3DA 1IJ8A 3FEKA 1SY1A 3VG4A 4YFPA 5HBSA 3KFHA 2DJGA 1RLBE 1ZRYA 1FELA 2IZGB 3S60A 2LBAA 1VWOB 4NLJA 3WJBA 1T0VA 3TZSA 2KTDA 2RTLA 4ID2A 4QRLA 5JD2A 2X55A 4LZVA 1RBPA 1LDQA 5B11O 4YCHA 4YKMA 2HZRA 2OFRX 1QFTA 1E5PA 1HQQA 4GD9A 3VG7A 4XMHA 5B3MO 5H8TA 3WBGA 5FAZA 3FA9A 1I06A 1KQXA 2BS5A 3CR6A 3PQSA 4OEMA 5KHPA 2Y3FA 5AJBA 3VHIA 3RY2A 2FKGA 2QO5A 3ZUIA 1GX9A 4TKJA 1KL3A 1IW2A 1LIDA 2RCQA 3F9DA 4GZVA 1VWPB 3RDSA 4Y5DA 1S2PA 1HMTA 1VWKB 1SWDA 2RTCB 2RTNB 2EU7X 4GJVA 4NW4A 1WUBA 1TVQA 1D2UA 1O8VA 1LUQA 4CDEA 5IO5A 4AYHA 1DF3A 5K68A 3APVA 1VWNB 5D8JA 4MISA 5B10O 1FENA 2C1QA 4ZJ0A 3C78X 2AT8X 3B2IA 2OFMX 1GM6A 3UEUA 4Y0SA 1ZNEA 4Y59A 2MF6A 3TGCA 5LKEA 4KC8A 1S7DA 1NGLA 5CE4A 2Q9SA 1VWFB 3APXA 1VYGA 1KT6A 3AEHA 2K23A 2M4LA 2QOMA 4JNJA 2IZKA 1SWSA 3CQRA 1BSQA 1Y0GA 4TLJA 3RE5A 1STRB 1PTSA 1SWTA 3LHNA 1JBHA 3CKFA 1BSOA 2QM9A 2HYSA 2CZTA 2WPUA 3KFGA 4ORXA 2QO4A 3VE2A 4YVBA 1DC9A 3S5VA 1ZNLA 1SWEA 3SAOA 4BQUA 3BLGA 2AT3X 1CBRA 2OY1O 4TNNA 5CHKA 1SXXA 1SA8A 5F6ZA 1IKEA 5D48A 1MOYA 5F58A 1K24A 1VYOA 2P8GA 1VWRB 1JIWI 1QQSA 1NQNA 1T8VA 1VWEB 2ASNX 3JS1A 5H9NA 2Z4IA 3V8UA 3WJGA 2IZAA 1X8OA 4I6SA 1D3SA 2A13A 3U03A 5F6BA 1LKEA 1KXOA 2FWVA 1YIVA 3OJYC 4NLIA 2R73A 4I3BA 4CV7A 4MIRA 2RD7C 4GGRA 1PEEA 3QKGA 2LKKA 5HA0A 4GRJA 1RXJA 3ZI8A 3NX2A 2RTFB 2CBSA 3ZUOA 1OEKA 5AQ6A 1N43A 2BHVA 3P6HA 1KL5A 1B56A 1HY2A 2CBRA 3N91A 3PH5A 3HTYA 4YH0A 3P6FA 3T2XA 3FW5A 3TGBA 2BLGA 2WUTA 1BWYA 1BBPA 1LELA 1XKIA 4DNEA 5HWZA 4U9CA 1JV4A 1DV9A 1SRJA 3MM0A 4R0BA 2KT4B 3UEVA 1I78A 3T1DA 2GTFX 2WR6A 1HMSA 1QG5A 1ZNDA 4Z2OA 1XCAA 3KFFA 5LJEA 2LA7A 1LPJA 1VWIB 4OS8A 5L8OA 2JU8A 3F6ZB 5L3YA 1S44A 3F8AA 5FQ8E 4MVIA 5H9AA 5BVQA 3HWGA 1SWFA 1Y55X 2FTBA 3KFIA 4IB9A 4ML7B 2FKJA 1H91A 1X71A 4AZPA 5HAEA 3K3LA 2C4IA 2QMIA 4WFVA 1OEEA 3PPTA 4ALBA 1B0OA 3D97A 3PK2A 3EC5A 2CM9A 4ODDA 4ZH6A 3WZPA 4A1YA 1AELA 2X8TA 5AEOA 5FQ6E 2JOZA 4U46A 3FR2A 4QAEA 4QYPA 1LDOA 2A2UA 4MVLA 3ZWEA 4O4OA 2WSJA 3IA8A 1SXWA 2Y32A 1EQDA 1TOWA 4EDEA 1U18A 1I05A 4CPIA 4ARHA 3P6EA 5F2BA 1X8QA 1RXHA 1JJXA 2IFBA 4GDAA 5B2AO 1ALBA 3BU9A 1BM5A 2R74A 1MUPA 3WJDA 4B55A 2UYWA 2IZJA 3NQKA 2GTLN 4NNTA 4RUUA 5LKFA 4HFOA 5HZQA 1W5RA 3HWEA 1DFVA 3HK1A 2A0AA 3O19A 2RTOB 5FENA 2RTHB 2FS7A 2I5VO 4LKTA 5LJGA 2AVIA 3MVFA 1Y9LA 4OMXA 1HMRA 2W2FA 1FEMA 1LCZA 4HPDA 3LV4A 1SWPA 1LIFA 3NP1A 4IAXA 1RAVA 4O4UA 4QQ1A 4ZH9A 3S5XA 3UEXA 1FJ1E 1KT3A 4Z27A 1NC9A 3AUMO 4IMNA 2OVDA 3Q34A 1SMPI 1KFFA 4FGIB 4XMFA 5B5GA 4CPEA 1YWCA 3PDFA 4GDZA 4D6AA 1KQWA 3HOLA 3SLJA 1EW3A 3P24A 1KGLA 2NP1A 4UU3A 1KZXA 4LKPA 1HXZA 1SY3A 5BYPA 1E06A 1SWKA 2X8SA 1W4TA 2OYBO 4YCEA 3RSWA 2RTEB 3WZNA 3RKGA 4AZMA 1DZKA 4GJSA 5LJCA 2C1SA 4I60A 4QGVA 1EUOA 2G79A 1DZJA 2IZDB 2LB6A 4YGZA 3FA6A 3O2YA 4YKOA 3FEPA 2X46A 4PJ2A 2WWPA 3CWKA 4CPFA 1SWBA 4I95A 4CSBA 4K19A 5L8NA 4OS0A 4BX5B 2ALLX 4YFRA 2FGSA 2FRSA 3FR4A 2VDFA 5EEDA 1MX8A 2ZAGA 4NV8A 1NP4A 1SRFA 2CZUA 2IZLB 5EEEA 5EDCA 2MJIA 2GTLO 4BJ8A 1RXKA 1BRQA 4Z2PA 2RQ0A 1JJJA 4BX6B 1VWDB 2YMSA 1O1VA 1ACDA 4NYRA 5CYBA 4ZHCA 3NBXX 4WBKA 4YBPA 1MEPA 3WXQA 1KT5A 4EFGA 2POAA 2I5ZO 1PBYA 1NDJA 2AL0X 1VWBB 1OPAA 2AMMX 1LF7A 4IABA 2XSTA 1VYFA 1HBPA 1SWCA 4N7CA 5FFHA 3U0DA 3FLLA 3Q6LA 1GT3A 1LNMA 2PI3O 1U0XA 3B2KA 3JQOA 2KD2A 5D45A 3ZW1B 4L3RA 3CKGA 1U17A 2FHNX 4AZQA 2QO6A 4ZHGA 1KT4A 3SZJA 2NNQA 4I9SA 3P6CA 3WZOA 1OBUA 2OVEA 2WQ9A 1GX3A 1CRBA 4AW8A 5BVTA 4QZUA 3VG2A 4O9SA 1ICNA 1P6PA 4BOEA 2JU3A 3H3IA 2AH7X 4A8ZA 4KIIA 1SXYA 5F1EA 3ZW2A 5L8IA 1LCVA 3DTQA 1DZMA 2JGSA 3D96A 3LTWA 2CM4A 3PQUA 1GXAA 1Y9TA 1R0UA 3D4RA 4O4SA 4YGGA 4JHQA 3SZHA 3RY1A 2OY7A 3ELZA 3VPJE 3WJEA 4LZUA 1EIOA 2WEXA 2GTLM 2JMBA 1O1UA 3EMMA 3MX7A 3T2WA 3SZIA 1EIIA 1KOIA 1ZNKA 4O3ZA 4O3XB 1Y53X 1MK5A 4YDAA 1VWGB 1LIBA 1QY2A 2X32A 2KW1A 1GGLA 2NNEA 4HPBA 1BSYA 1MDCA 1VPRA 4IB6A 4GETA 3RE6A 3SLOA 3G7XA 1GX8A 3IFBA 2VFCA 4ZGFA 1PM1X 5D47A 4CPHB 4D6BA 3APWA 1QWDA 2FR2A 4ORRA 3UAQA 2MHDA 3BY0A 4IMOA 4QGWA 2RTPB 4TQ2A 3EW2A 3KVNA 2WEWA 4GK9A 3L4RA 1SLFB 3VE1A 2L9CA 2A2GA 2RTGB 4EKVA 2JN3A 3EM0A 3PECA 2RTBB 3BX7A 1K3BA 1FDQA 1X8PA 2BT9A 2RTAA 1EALA 4XMEA 1N4JA 2RA6A 2Q39A 4NP1A 1DF8A 3ZW1A 3E3CA 3CQNA
chains in the Genus database with same CATH topology
1YP6A 2FLJA 5HCDC 4UU2A 3MBTA 3STKA 3ZW0B 1NP1A 1QABE 1BLRA 5AJCA 5EDBA 2Q2PA 2HNXA 4FBVA 4ON1A 3B2JA 1QY0A 4ORSA 4TJZA 1TOUA 2BS6A 1OBQA 2X45A 1GT4A 1OEJA 4FQBB 1G7NA 2HLVA 5C0NA 4O3YA 5IO7A 3FIQA 4GNYA 3SOTA 1B4MA 4FBOA 1JZUA 5B29A 4Y0RA 4Y0PA 5H9LA 2X8FA 3BDRA 2OZQA 4ORWA 1TW4A 4OMWA 1CJ5A 1QY1A 4XMGA 1ML7A 3B2HA 3ZQ3A 1DZPA 4O49A 4IBAA 1YWAA 4NYQA 2PY1A 5KIDA 4TKHA 4YBUA 1HBQA 3NADA 4M7MA 4ZCBA 4IB7A 3STNA 3TGAA 3DSZA 5KICA 2JU7A 3CBSA 1GT1A 4YMYA 4KH8A 1FTPA 2K62A 1PBOA 3C77X 1BRPA 2HMBA 4ZFXA 2O62A 3JSQA 1Z24A 3HWDA 4I9RA 3TF6A 4I3CA 4BVMA 1OPBA 5EZ2A 3WVMA 3WJFA 3S26A 4JGLA 3OD9A 3ZW0A 3WJCA 2F73A 4GNWA 4AZRA 2KTSA 3B2LA 2RCTA 1CBSA 2AT5X 2RN4A 5DPQA 3RBYA 5HZ5A 2YG2A 2Q4NA 4RUNA 2R56A 1X8UA 4PSQA 2ACOA 1HQPA 3RZYA 2AT6X 3PP6A 1JYJA 2OVSA 1E02A 3NQ9A 3FELA 3P6GA 3P6DA 3WOVA 1ZNHA 4U8UO 2F09A 2DM5A 2G78A 2JW1A 5LJHA 4ZHHA 3NR3A 1YUPA 4HPAA 4KC7A 3OBLA 1T68X 1EI5A 4QYNA 1AB0A 4TKBA 5HCEC 1A18A 1B8EA 1QFVA 3D95A 5HCCC 4M6SA 4OS3A 2L68A 4AZNA 1ERBA 5IO6A 1E00A 1A3YA 1UREA 4DQ4A 5HTDA 5HZ9A 1YWDA 3EBWA 3BS2A 1OBPA 3KZAA 1FE3A 4YDBA 1A57A 2LBVA 1LFOA 3C76X 1GT5A 4A60A 3I0AA 2A3FX 4ORUA 1EPAA 2ZAIA 2FR3A 1TXLA 3BX8A 2GC9A 4MVKA 4XMDA 3NQ3A 1A2DA 4XMCA 3APUA 3RWXA 1ADLA 5JR8A 1ICMA 3VG5A 1LICA 1G74A 3FA7A 3FR5A 1KZWA 1CBQA 4GE1A 2NNDA 3FENA 5BVSA 1ERXA 2GJ5A 5D4AA 3EBKA 2Z4HA 4ZR2A 2Q2MA 4AZOA 4U8UM 4INNA 3I17A 5B27A 3P02A 2AKQA 4HWMA 4WFUA 2WQAE 5FQ7E 2W2AA 2MWHA 3BU1A 2ANSA 4DQ3A 1BEBA 4LQZA 1BJ7A 4COTA 4QZTA 4N7DA 4KT5A 4O4XA 2HZQA 1N0SA 3KQ0A 5LJBA 1IFBA 5H9KA 1G5WA 2MM3A 4IAWA 4CK4A 5HZ6A 5HA1A 1AQBA 1IFCA 1HN2A 4MVEA 1EXSA 1IKJA 1YWBA 3STMX 3VU1A 1I4UA 3GE2A 1GKAB 4YFQA 4ORYA 4ZGUA 2L5PA 4QGXA 3NPOA 3HOEA 2W2BA 3PH6A 3AKNA 4GH7A 1LIEA 1EPBA 1PMPA 4IB8A 1AVGI 1X8NA 4EXZA 2XKLA 3VG6A 4ZHDA 3VG3A 1CBIA 1JYDA 1SY2A 3ZZVA 2MO5A 3PEDA 1I04A 2QOSC 4WHIA 4ALOA 4EQAC 2FT9A 4O3WA 3FYFA 5HTEA 1G85A 5LJDA 2G7BA 3BSZE 4U8UN 4KCAA 5LJKA 3GAQA 2L67A 1MVGA 2FS6A 5F7GA 3CMPA 4L1NA 4A1HA 1KT7A 2AT0X 3NX1A 3TGBA 4YGHA 3FA8A 1YP7A 2E4JA 3FMZA 4U3QA 3FW4A 3HWFA 4Y0QA 4QNIA 4HPCA 5HZ8A 3CBCA 3U9PC 4ZHFA 3AKMA 3O22A 3ELXA 2OVAA 5DG4A 3BRNA 3OE3A 4NNSA 1UZ2X 1IIUA 1X89A 4ES7A 1ZNGA 3UEWA 1MX7A 4GU8A 1SY0A 1GKAA 1SXUA 3EYCA 5K06A 2LFOA 1L6MA 2ACPX 4GKCA 4EEJA 4FBRA 2N93A 4I3DA 3FEKA 1SY1A 3VG4A 4YFPA 5HBSA 3KFHA 1RLBE 1ZRYA 1FELA 3S60A 2LBAA 4NLJA 3WJBA 1T0VA 3TZSA 2KTDA 4ID2A 4QRLA 4LZVA 1RBPA 4YCHA 4YKMA 2HZRA 2OFRX 1QFTA 1E5PA 3VG7A 4XMHA 5H8TA 3WBGA 5FAZA 3FA9A 1I06A 1KQXA 2BS5A 3CR6A 3PQSA 5KHPA 5AJBA 2QO5A 3ZUIA 1GX9A 4TKJA 1IW2A 1LIDA 2RCQA 3F9DA 4GZVA 1S2PA 1HMTA 2EU7X 4NW4A 1TVQA 1D2UA 1O8VA 5IO5A 4AYHA 1DF3A 3APVA 5D8JA 4MISA 1FENA 4ZJ0A 3C78X 2AT8X 3B2IA 2OFMX 1GM6A 3UEUA 4Y0SA 1ZNEA 3TGCA 5LKEA 4KC8A 1S7DA 1NGLA 5CE4A 2Q9SA 3APXA 1VYGA 1KT6A 2K23A 2M4LA 3CQRA 1BSQA 4TLJA 3LHNA 1JBHA 1BSOA 2QM9A 2HYSA 2CZTA 3KFGA 4ORXA 3VE2A 2QO4A 1DC9A 3S5VA 1ZNLA 3SAOA 4BQUA 3BLGA 2AT3X 1CBRA 4TNNA 1SXXA 1SA8A 5F6ZA 1IKEA 5D48A 5F58A 2P8GA 1JIWI 1QQSA 3JS1A 1T8VA 2ASNX 5H9NA 3V8UA 3WJGA 2Z4IA 1X8OA 4I6SA 1D3SA 2A13A 3U03A 5F6BA 1LKEA 1KXOA 2FWVA 1YIVA 3OJYC 4NLIA 2R73A 4I3BA 4CV7A 4MIRA 2RD7C 1PEEA 3QKGA 2LKKA 5HA0A 4GRJA 3ZI8A 3NX2A 2CBSA 1OEKA 5AQ6A 2BHVA 3P6HA 1B56A 2CBRA 3N91A 3PH5A 4YH0A 3HTYA 3P6FA 3FW5A 2BLGA 2WUTA 1BWYA 1BBPA 1XKIA 5HWZA 4U9CA 1JV4A 1DV9A 4R0BA 2KT4B 3UEVA 3T1DA 2GTFX 2WR6A 1HMSA 1QG5A 1ZNDA 1XCAA 3KFFA 5LJEA 2LA7A 1LPJA 4OS8A 5L8OA 2JU8A 3F6ZB 1S44A 3F8AA 5FQ8E 4MVIA 5H9AA 5BVQA 3HWGA 4IB9A 2FTBA 3KFIA 4ML7B 1H91A 1X71A 4AZPA 5HAEA 3K3LA 2QMIA 4WFVA 1OEEA 3PPTA 1B0OA 3D97A 4ODDA 4A1YA 2CM9A 4ZH6A 1AELA 2X8TA 5AEOA 5FQ6E 2JOZA 3FR2A 4QAEA 4QYPA 2A2UA 4MVLA 3ZWEA 4O4OA 2WSJA 3IA8A 1SXWA 1EQDA 1TOWA 4EDEA 1U18A 1I05A 4ARHA 3P6EA 1JJXA 1X8QA 2IFBA 1ALBA 3BU9A 1BM5A 2R74A 1MUPA 3WJDA 3NQKA 2GTLN 4NNTA 4RUUA 5LKFA 4HFOA 5HZQA 3HWEA 1DFVA 3HK1A 2A0AA 3O19A 5FENA 2FS7A 4LKTA 5LJGA 3MVFA 1Y9LA 4OMXA 1HMRA 2W2FA 1FEMA 4HPDA 4IAXA 3LV4A 4O4UA 1LIFA 3NP1A 4QQ1A 4ZH9A 3S5XA 3ZUOA 3UEXA 4BOEA 1KT3A 4IMNA 2OVDA 1SMPI 4FGIB 4XMFA 1YWCA 4GDZA 4D6AA 1KQWA 3HOLA 1EW3A 3P24A 1KGLA 2NP1A 4UU3A 1KZXA 4LKPA 1SY3A 5BYPA 1E06A 2X8SA 4YCEA 3RSWA 3RKGA 4AZMA 1DZKA 5LJCA 4QGVA 1EUOA 2G79A 1DZJA 2LB6A 4YGZA 3FA6A 3O2YA 4YKOA 3FEPA 2X46A 4PJ2A 2WWPA 3CWKA 4I95A 4CSBA 4K19A 5L8NA 4OS0A 2ALLX 4YFRA 2FRSA 3FR4A 5EEDA 1MX8A 2ZAGA 1NP4A 2CZUA 5EEEA 5EDCA 2MJIA 2GTLO 1BRQA 2RQ0A 1JJJA 2YMSA 1O1VA 1ACDA 4NYRA 5CYBA 4ZHCA 3NBXX 4WBKA 4YBPA 3WXQA 1KT5A 4EFGA 2POAA 2AL0X 1OPAA 2AMMX 1LF7A 4IABA 2XSTA 1VYFA 1HBPA 4N7CA 5FFHA 3U0DA 3FLLA 3Q6LA 1GT3A 1LNMA 3B2KA 1U0XA 3JQOA 3ZW1B 2KD2A 4L3RA 1U17A 4AZQA 2QO6A 4ZHGA 1KT4A 2NNQA 4I9SA 3P6CA 1OBUA 2OVEA 2WQ9A 1CRBA 4AW8A 5BVTA 4QZUA 3VG2A 4O9SA 1ICNA 1P6PA 2JU3A 3H3IA 2AH7X 4A8ZA 4KIIA 1SXYA 5F1EA 3ZW2A 5L8IA 3DTQA 1DZMA 3PQUA 3D96A 4YGGA 2CM4A 5EPQA 1GXAA 1Y9TA 1R0UA 3D4RA 4O4SA 3VPJE 3WJEA 4ALBA 1EIOA 3ELZA 4LZUA 2WEXA 2GTLM 2JMBA 1O1UA 3EMMA 3MX7A 1EIIA 1KOIA 1ZNKA 4O3ZA 4O3XB 4YDAA 1LIBA 1QY2A 4HPBA 2KW1A 2NNEA 1GGLA 4IB6A 1BSYA 1MDCA 1VPRA 4GETA 3G7XA 1GX8A 3IFBA 4ZGFA 1PM1X 5D47A 4D6BA 3APWA 1QWDA 2FR2A 4ORRA 3UAQA 2MHDA 3BY0A 4IMOA 4QGWA 4TQ2A 2WEWA 4GK9A 3L4RA 3VE1A 2L9CA 2A2GA 2JN3A 3EM0A 3PECA 3BX7A 1FDQA 1X8PA 2BT9A 1EALA 4XMEA 2RA6A 2Q39A 4NP1A 5D45A 3ZW1A 3E3CA 3CQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YP6 A;  2FLJ A;  5HCD C;  4UU2 A;  3MBT A;  3STK A;  1NP1 A;  1QAB E;  1BLR A;  5EDB A;  2Q2P A;  2HNX A;  3B2J A;  1QY0 A;  4ORS A;  4TJZ A;  1TOU A;  1OBQ A;  2X45 A;  1GT4 A;  1OEJ A;  5C0N A;  1G7N A;  2HLV A;  5IO7 A;  3FIQ A;  4GNY A;  1B4M A;  1JZU A;  5B29 A;  4Y0R A;  4Y0P A;  5H9L A;  3BDR A;  2OZQ A;  4ORW A;  1TW4 A;  4OMW A;  1CJ5 A;  1QY1 A;  4XMG A;  1ML7 A;  3B2H A;  3ZQ3 A;  1DZP A;  4IBA A;  1YWA A;  4NYQ A;  2PY1 A;  5KID A;  4TKH A;  4YBU A;  1HBQ A;  3NAD A;  4M7M A;  4ZCB A;  4IB7 A;  3STN A;  3TGA A;  3DSZ A;  5KIC A;  2JU7 A;  3CBS A;  1GT1 A;  4YMY A;  1FTP A;  2K62 A;  1PBO A;  3C77 X;  1BRP A;  2HMB A;  4ZFX A;  2O62 A;  3JSQ A;  1Z24 A;  3HWD A;  4I9R A;  3TF6 A;  4I3C A;  4BVM A;  1OPB A;  5EZ2 A;  3WVM A;  3WJF A;  3S26 A;  3WJC A;  2F73 A;  4GNW A;  4AZR A;  3B2L A;  2RCT A;  1CBS A;  2AT5 X;  5DPQ A;  5HZ5 A;  2YG2 A;  2Q4N A;  4RUN A;  2R56 A;  1X8U A;  4PSQ A;  2ACO A;  1HQP A;  3RZY A;  2AT6 X;  3PP6 A;  1JYJ A;  1E02 A;  3NQ9 A;  3FEL A;  3P6G A;  3P6D A;  1ZNH A;  2DM5 A;  2G78 A;  5LJH A;  4ZHH A;  3NR3 A;  1YUP A;  4HPA A;  1T68 X;  4QYN A;  1AB0 A;  4TKB A;  5HCE C;  1A18 A;  1B8E A;  1QFV A;  3D95 A;  5HCC C;  4M6S A;  4OS3 A;  2L68 A;  4AZN A;  1ERB A;  5IO6 A;  1E00 A;  1A3Y A;  1URE A;  4DQ4 A;  5HTD A;  5HZ9 A;  1YWD A;  3EBW A;  3BS2 A;  1OBP A;  3KZA A;  1FE3 A;  4YDB A;  1A57 A;  2LBV A;  1LFO A;  3C76 X;  1GT5 A;  4A60 A;  3I0A A;  2A3F X;  4ORU A;  1EPA A;  2FR3 A;  1TXL A;  3BX8 A;  2GC9 A;  4MVK A;  4XMD A;  3NQ3 A;  1A2D A;  4XMC A;  3APU A;  1ADL A;  5JR8 A;  1ICM A;  3VG5 A;  1LIC A;  1G74 A;  3FA7 A;  3FR5 A;  1KZW A;  1CBQ A;  4GE1 A;  2NND A;  3FEN A;  5BVS A;  1ERX A;  2GJ5 A;  5D4A A;  3EBK A;  4ZR2 A;  2Q2M A;  4AZO A;  3I17 A;  5B27 A;  2AKQ A;  4WFU A;  2WQA E;  2W2A A;  3BU1 A;  2ANS A;  4DQ3 A;  1BEB A;  1BJ7 A;  4QZT A;  4N7D A;  2HZQ A;  1N0S A;  3KQ0 A;  5LJB A;  1IFB A;  5H9K A;  1G5W A;  2MM3 A;  4IAW A;  4CK4 A;  5HZ6 A;  5HA1 A;  1AQB A;  1IFC A;  1HN2 A;  1EXS A;  1IKJ A;  1YWB A;  3STM X;  1I4U A;  1GKA B;  4YFQ A;  4ORY A;  4ZGU A;  2L5P A;  4QGX A;  3NPO A;  2W2B A;  3PH6 A;  3AKN A;  4GH7 A;  1LIE A;  1EPB A;  1PMP A;  4IB8 A;  1AVG I;  1X8N A;  4EXZ A;  2XKL A;  3VG6 A;  4ZHD A;  3VG3 A;  1CBI A;  1JYD A;  1SY2 A;  2MO5 A;  3PED A;  1I04 A;  2QOS C;  4ALO A;  2FT9 A;  5HTE A;  1G85 A;  5LJD A;  2G7B A;  3BSZ E;  5LJK A;  3GAQ A;  2L67 A;  1MVG A;  2FS6 A;  5F7G A;  3CMP A;  4A1H A;  1KT7 A;  2AT0 X;  3NX1 A;  3TGB A;  4YGH A;  3FA8 A;  1YP7 A;  2E4J A;  3FMZ A;  3FW4 A;  3HWF A;  4Y0Q A;  4HPC A;  5HZ8 A;  3CBC A;  3U9P C;  4ZHF A;  3AKM A;  3O22 A;  3ELX A;  2OVA A;  5DG4 A;  3BRN A;  4NNS A;  1UZ2 X;  1IIU A;  1X89 A;  4ES7 A;  1ZNG A;  3UEW A;  1MX7 A;  1SY0 A;  1GKA A;  1SXU A;  3EYC A;  5K06 A;  2LFO A;  1L6M A;  2ACP X;  4GKC A;  4EEJ A;  2N93 A;  4I3D A;  3FEK A;  1SY1 A;  3VG4 A;  4YFP A;  5HBS A;  3KFH A;  1RLB E;  1ZRY A;  1FEL A;  2LBA A;  4NLJ A;  3WJB A;  1T0V A;  3TZS A;  2KTD A;  4LZV A;  1RBP A;  4YCH A;  4YKM A;  2HZR A;  2OFR X;  1QFT A;  1E5P A;  3VG7 A;  4XMH A;  5H8T A;  3WBG A;  5FAZ A;  3FA9 A;  1I06 A;  1KQX A;  3CR6 A;  5KHP A;  2QO5 A;  3ZUI A;  1GX9 A;  4TKJ A;  1IW2 A;  1LID A;  2RCQ A;  3F9D A;  1S2P A;  1HMT A;  2EU7 X;  1TVQ A;  1D2U A;  1O8V A;  5IO5 A;  4AYH A;  1DF3 A;  3APV A;  5D8J A;  1FEN A;  4ZJ0 A;  3C78 X;  2AT8 X;  3B2I A;  2OFM X;  1GM6 A;  3UEU A;  4Y0S A;  1ZNE A;  3TGC A;  5LKE A;  1S7D A;  1NGL A;  5CE4 A;  2Q9S A;  3APX A;  1VYG A;  1KT6 A;  2K23 A;  3CQR A;  1BSQ A;  4TLJ A;  1JBH A;  1BSO A;  2QM9 A;  2HYS A;  2CZT A;  3KFG A;  4ORX A;  2QO4 A;  1DC9 A;  1ZNL A;  3SAO A;  4BQU A;  3BLG A;  2AT3 X;  1CBR A;  4TNN A;  1SXX A;  1SA8 A;  5F6Z A;  1IKE A;  5D48 A;  5F58 A;  2P8G A;  1QQS A;  3JS1 A;  1T8V A;  2ASN X;  5H9N A;  3WJG A;  1X8O A;  1D3S A;  2A13 A;  3U03 A;  5F6B A;  1LKE A;  1KXO A;  2FWV A;  1YIV A;  3OJY C;  4NLI A;  2R73 A;  4I3B A;  2RD7 C;  1PEE A;  3QKG A;  2LKK A;  5HA0 A;  4GRJ A;  3NX2 A;  2CBS A;  1OEK A;  5AQ6 A;  3P6H A;  1B56 A;  2CBR A;  3PH5 A;  4YH0 A;  3P6F A;  3FW5 A;  2BLG A;  2WUT A;  1BWY A;  1BBP A;  1XKI A;  5HWZ A;  1JV4 A;  1DV9 A;  4R0B A;  2KT4 B;  3UEV A;  3T1D A;  2GTF X;  2WR6 A;  1HMS A;  1QG5 A;  1ZND A;  1XCA A;  3KFF A;  5LJE A;  1LPJ A;  4OS8 A;  5L8O A;  2JU8 A;  1S44 A;  3F8A A;  5H9A A;  4MVI A;  5BVQ A;  3HWG A;  4IB9 A;  2FTB A;  3KFI A;  1H91 A;  1X71 A;  4AZP A;  5HAE A;  3K3L A;  4WFV A;  1OEE A;  3PPT A;  1B0O A;  3D97 A;  4ODD A;  4A1Y A;  2CM9 A;  4ZH6 A;  1AEL A;  2JOZ A;  3FR2 A;  4QAE A;  4QYP A;  2A2U A;  4MVL A;  2WSJ A;  3IA8 A;  1SXW A;  1EQD A;  1TOW A;  4EDE A;  1U18 A;  1I05 A;  4ARH A;  3P6E A;  1JJX A;  1X8Q A;  2IFB A;  1ALB A;  3BU9 A;  1BM5 A;  2R74 A;  1MUP A;  3WJD A;  4NNT A;  4RUU A;  5LKF A;  4HFO A;  5HZQ A;  3HWE A;  1DFV A;  3HK1 A;  2A0A A;  3O19 A;  5FEN A;  2FS7 A;  4LKT A;  5LJG A;  3MVF A;  4OMX A;  1HMR A;  2W2F A;  1FEM A;  4HPD A;  4IAX A;  4ZH9 A;  3ZUO A;  1LIF A;  3NP1 A;  4BOE A;  3UEX A;  1KT3 A;  4IMN A;  2OVD A;  4XMF A;  1YWC A;  4D6A A;  1KQW A;  1EW3 A;  1KGL A;  2NP1 A;  4UU3 A;  1KZX A;  4LKP A;  1SY3 A;  1E06 A;  4YCE A;  3RSW A;  4AZM A;  1DZK A;  5LJC A;  4QGV A;  1EUO A;  2G79 A;  1DZJ A;  2LB6 A;  4YGZ A;  3FA6 A;  3O2Y A;  4YKO A;  3FEP A;  2X46 A;  2WWP A;  3CWK A;  4K19 A;  5L8N A;  4OS0 A;  2ALL X;  4YFR A;  2FRS A;  3FR4 A;  5EED A;  1MX8 A;  1NP4 A;  2CZU A;  5EEE A;  5EDC A;  2MJI A;  1BRQ A;  2RQ0 A;  1JJJ A;  1O1V A;  1ACD A;  4NYR A;  4ZHC A;  4WBK A;  4YBP A;  3WXQ A;  1KT5 A;  4EFG A;  2POA A;  2AL0 X;  1OPA A;  2AMM X;  1LF7 A;  4N7C A;  2XST A;  1VYF A;  1HBP A;  5FFH A;  3U0D A;  3FLL A;  3Q6L A;  1GT3 A;  1LNM A;  3B2K A;  1U0X A;  1U17 A;  4AZQ A;  2QO6 A;  4ZHG A;  1KT4 A;  2NNQ A;  4I9S A;  3P6C A;  1OBU A;  2OVE A;  2WQ9 A;  1CRB A;  4AW8 A;  5BVT A;  4QZU A;  3VG2 A;  4O9S A;  1ICN A;  1P6P A;  2JU3 A;  2AH7 X;  4A8Z A;  4KII A;  1SXY A;  5F1E A;  5L8I A;  3DTQ A;  1DZM A;  3D96 A;  4YGG A;  2CM4 A;  5EPQ A;  1GXA A;  1R0U A;  4ALB A;  3WJE A;  1EIO A;  3ELZ A;  4LZU A;  2WEX A;  1EII A;  1O1U A;  3EMM A;  1KOI A;  1ZNK A;  4YDA A;  1LIB A;  1QY2 A;  4HPB A;  1GGL A;  2NNE A;  4IB6 A;  1BSY A;  1MDC A;  1VPR A;  4GET A;  3G7X A;  1GX8 A;  3IFB A;  1PM1 X;  5D47 A;  4D6B A;  3APW A;  1QWD A;  2FR2 A;  4ORR A;  3BY0 A;  4IMO A;  4QGW A;  4TQ2 A;  2WEW A;  3L4R A;  2L9C A;  2A2G A;  2JN3 A;  3EM0 A;  3PEC A;  3BX7 A;  1FDQ A;  1X8P A;  1EAL A;  4XME A;  2RA6 A;  2Q39 A;  4NP1 A;  5D45 A;  3CQN A; 
#chains in the Genus database with same CATH topology
 1YP6 A;  2FLJ A;  5HCD C;  4UU2 A;  3MBT A;  3STK A;  3ZW0 B;  1NP1 A;  1QAB E;  1BLR A;  5AJC A;  5EDB A;  1E2T A;  2Q2P A;  3RDU A;  1AVD A;  2HNX A;  1VWL B;  4BGF A;  4FBV A;  1JQP A;  1SWN A;  4ON1 A;  3B2J A;  1QY0 A;  4ORS A;  4TJZ A;  1TOU A;  1SRG A;  3VHM A;  2BS6 A;  2OFA A;  1SRI A;  1OBQ A;  2X45 A;  1GT4 A;  1OEJ A;  2IZI A;  4FQB B;  1G7N A;  2HLV A;  2VFB A;  5C0N A;  4O3Y A;  1UYN X;  5IO7 A;  3FIQ A;  3QQ2 A;  4GNY A;  3SOT A;  1B4M A;  4FBO A;  2G5L A;  1JZU A;  5B29 A;  1I9H A;  1STP A;  4Y0R A;  4Y0P A;  1SWO A;  2G8C O;  5H9L A;  2X8F A;  3BDR A;  2CAM A;  2OL8 O;  2OZQ A;  4ORW A;  2HKD A;  1TW4 A;  4OMW A;  1CJ5 A;  1QY1 A;  4XMG A;  1ML7 A;  3B2H A;  3ZQ3 A;  1DZP A;  4O49 A;  4IBA A;  1YWA A;  4NYQ A;  2PY1 A;  4OEL A;  2UZ2 A;  5KID A;  4TKH A;  4CPH A;  4YBU A;  1UYO X;  1HBQ A;  3NAD A;  1SLE B;  4M7M A;  4ZCB A;  1STS B;  4IB7 A;  3D9W A;  3STN A;  3TGA A;  1SWG A;  2ZSC A;  3DSZ A;  4BX7 B;  5KIC A;  2JU7 A;  3CBS A;  1GT1 A;  3WZQ A;  4YMY A;  2IZE B;  1FTP A;  4KH8 A;  2RTR B;  2K62 A;  1JMZ A;  1PBO A;  3C77 X;  1BRP A;  2HMB A;  4ZFX A;  5B5F A;  2O62 A;  3JSQ A;  1Z24 A;  3HWD A;  4I9R A;  3TF6 A;  4I3C A;  4BVM A;  1OPB A;  5EZ2 A;  3WVM A;  3WJF A;  3S26 A;  4JGL A;  4CDD A;  3OD9 A;  1RSU B;  3ZW0 A;  3WJC A;  2F73 A;  4GNW A;  4AZR A;  2KTS A;  1NBX A;  3B2L A;  4CDC A;  4BBO A;  2RCT A;  1CBS A;  2AT5 X;  2RN4 A;  1HXL A;  5DPQ A;  3RBY A;  5HZ5 A;  2YG2 A;  1VWQ B;  2Q4N A;  4RUN A;  2R56 A;  1X8U A;  4PSQ A;  2ACO A;  1HQP A;  1W6F A;  3RZY A;  2AT6 X;  3PP6 A;  1JYJ A;  2OVS A;  1SWR A;  1E02 A;  1VWH B;  1SWA A;  4Z2V A;  3NQ9 A;  3FEL A;  3P6G A;  2RTK A;  3P6D A;  1RST B;  3WOV A;  3T6F A;  2OY5 O;  1ZNH A;  4U8U O;  3EW1 A;  4COT A;  2F09 A;  2DM5 A;  2G78 A;  2JW1 A;  5LJH A;  4ZHH A;  3NR3 A;  1YUP A;  2A8G A;  2X56 A;  4HPA A;  4KC7 A;  3OBL A;  1T68 X;  1EI5 A;  4QYN A;  1AB0 A;  3HPE A;  5HCE C;  4TKB A;  1A18 A;  1B8E A;  1QFV A;  3D95 A;  5HCC C;  4M6S A;  4OS3 A;  2L68 A;  3MG5 A;  1ERB A;  4AZN A;  1E00 A;  1A3Y A;  1URE A;  4BX7 A;  3WYQ A;  4DQ4 A;  3WYP A;  5HTD A;  1JMX A;  5HZ9 A;  1YWD A;  3EBW A;  3BS2 A;  1OBP A;  3KZA A;  1FE3 A;  1VWA B;  1VWC B;  4YDB A;  4BCS A;  4Z6J A;  4MEE A;  4Z28 A;  2LBV A;  1LFO A;  3C76 X;  4JO6 A;  1GT5 A;  4A60 A;  2A5C A;  2A3F X;  3I0A A;  3T6L A;  5K67 A;  2A5B A;  4ORU A;  1EPA A;  1VWM B;  2ZAI A;  1SWQ A;  2FR3 A;  1TXL A;  2OL6 O;  3SLT A;  3BX8 A;  2GC9 A;  4MVK A;  4XMD A;  2OY8 A;  3NQ3 A;  1A2D A;  4XMC A;  3APU A;  2IZH B;  1SRE A;  5EPQ A;  1ADL A;  3RWX A;  5IRA A;  5JR8 A;  1ICM A;  3VG5 A;  1LIC A;  2OF9 A;  1G74 A;  3FA7 A;  3FR5 A;  1KZW A;  1CBQ A;  4GE1 A;  2NND A;  2X34 A;  4GGZ A;  4BX5 A;  3FEN A;  5BVS A;  1ERX A;  2GJ5 A;  5D4A A;  2GH7 A;  3EBK A;  2Z4H A;  4ZR2 A;  2Q2M A;  4AZO A;  4U8U M;  4INN A;  3I17 A;  5B27 A;  3P02 A;  4GUZ A;  2IZC B;  4BX6 A;  2AKQ A;  4HWM A;  4WFU A;  2WQA E;  5FQ7 E;  2W2A A;  2MWH A;  1SWL A;  2AF5 A;  3BU1 A;  2ANS A;  4DQ3 A;  1BEB A;  4IRW A;  1BJ7 A;  4LQZ A;  4QZT A;  4N7D A;  4KT5 A;  1NQM A;  2HZQ A;  1N0S A;  2RTI B;  3KQ0 A;  2BC3 A;  4O4X A;  5LJB A;  1IFB A;  5H9K A;  1G5W A;  4GGT A;  2MM3 A;  1LCW A;  4IAW A;  4CK4 A;  5HZ6 A;  1N9Y A;  5HA1 A;  1AQB A;  1IFC A;  1HN2 A;  4MVE A;  1SWJ A;  2BSZ A;  1EXS A;  1AVE A;  4NV7 A;  1IKJ A;  1YWB A;  3STM X;  3VU1 A;  1I4U A;  3GE2 A;  1GKA B;  2X4M A;  4YFQ A;  4DCB A;  4ORY A;  4ZGU A;  2L5P A;  3FID A;  2OL7 A;  4QGX A;  1N7Y A;  2DJF A;  3NPO A;  3HOE A;  2W2B A;  3PH6 A;  3AKN A;  4GH7 A;  3X00 A;  1LIE A;  1A57 A;  4C5P A;  1EPB A;  1PMP A;  2OF8 A;  4IB8 A;  1AVG I;  1X8N A;  3VHH A;  4EXZ A;  3RDO A;  2XKL A;  3VG6 A;  3RDQ A;  1SLD B;  1MM9 A;  4ZHD A;  3VG3 A;  1CBI A;  1JYD A;  1N9M A;  5IRU A;  1SY2 A;  3RDX A;  1WBI A;  3ZZV A;  5IXG A;  2MO5 A;  5IRW A;  3VGW A;  3PED A;  5IO6 A;  1I04 A;  2QOS C;  4WHI A;  4ALO A;  4EQA C;  2FT9 A;  4O3W A;  3FYF A;  5HTE A;  1G85 A;  1SLG B;  2QCB A;  1SRH A;  5LJD A;  1SWH A;  2G7B A;  3BSZ E;  1SWU A;  4U8U N;  4KCA A;  5LJK A;  2RTQ B;  3GAQ A;  2L67 A;  1MVG A;  2FS6 A;  5F7G A;  3CMP A;  4L1N A;  4A1H A;  1KT7 A;  2AT0 X;  2FHL A;  1Y52 X;  3NX1 A;  2OFB A;  3FA8 A;  4YGH A;  1YP7 A;  2E4J A;  2RTJ A;  3FMZ A;  3FDC A;  4U3Q A;  1KL4 A;  3FW4 A;  3HWF A;  4Y0Q A;  4QNI A;  4HPC A;  5HZ8 A;  5CSE A;  3CBC A;  4OKA A;  4CDF A;  3U9P C;  2F01 A;  4ZHF A;  3AKM A;  3O22 A;  3ELX A;  2OVA A;  5DG4 A;  2IZF B;  3BRN A;  3OE3 A;  4NNS A;  2RTD B;  1VWJ B;  1UZ2 X;  1IIU A;  2IZB A;  1OSP O;  1JJU A;  1X89 A;  4ES7 A;  1ZNG A;  2RTM A;  1MX7 A;  4GU8 A;  3UEW A;  1SY0 A;  1GKA A;  1SXU A;  3EYC A;  5K06 A;  2LFO A;  3RDM A;  1L6M A;  2Y3E A;  2ACP X;  4GKC A;  4EEJ A;  4FBR A;  2N93 A;  4I3D A;  1IJ8 A;  3FEK A;  1SY1 A;  3VG4 A;  4YFP A;  5HBS A;  3KFH A;  2DJG A;  1RLB E;  1ZRY A;  1FEL A;  2IZG B;  3S60 A;  2LBA A;  1VWO B;  4NLJ A;  3WJB A;  1T0V A;  3TZS A;  2KTD A;  2RTL A;  4ID2 A;  4QRL A;  5JD2 A;  2X55 A;  4LZV A;  1RBP A;  1LDQ A;  5B11 O;  4YCH A;  4YKM A;  2HZR A;  2OFR X;  1QFT A;  1E5P A;  1HQQ A;  4GD9 A;  3VG7 A;  4XMH A;  5B3M O;  5H8T A;  3WBG A;  5FAZ A;  3FA9 A;  1I06 A;  1KQX A;  2BS5 A;  3CR6 A;  3PQS A;  4OEM A;  5KHP A;  2Y3F A;  5AJB A;  3VHI A;  3RY2 A;  2FKG A;  2QO5 A;  3ZUI A;  1GX9 A;  4TKJ A;  1KL3 A;  1IW2 A;  1LID A;  2RCQ A;  3F9D A;  4GZV A;  1VWP B;  3RDS A;  4Y5D A;  1S2P A;  1HMT A;  1VWK B;  1SWD A;  2RTC B;  2RTN B;  2EU7 X;  4GJV A;  4NW4 A;  1WUB A;  1TVQ A;  1D2U A;  1O8V A;  1LUQ A;  4CDE A;  5IO5 A;  4AYH A;  1DF3 A;  5K68 A;  3APV A;  1VWN B;  5D8J A;  4MIS A;  5B10 O;  1FEN A;  2C1Q A;  4ZJ0 A;  3C78 X;  2AT8 X;  3B2I A;  2OFM X;  1GM6 A;  3UEU A;  4Y0S A;  1ZNE A;  4Y59 A;  2MF6 A;  3TGC A;  5LKE A;  4KC8 A;  1S7D A;  1NGL A;  5CE4 A;  2Q9S A;  1VWF B;  3APX A;  1VYG A;  1KT6 A;  3AEH A;  2K23 A;  2M4L A;  2QOM A;  4JNJ A;  2IZK A;  1SWS A;  3CQR A;  1BSQ A;  1Y0G A;  4TLJ A;  3RE5 A;  1STR B;  1PTS A;  1SWT A;  3LHN A;  1JBH A;  3CKF A;  1BSO A;  2QM9 A;  2HYS A;  2CZT A;  2WPU A;  3KFG A;  4ORX A;  2QO4 A;  3VE2 A;  4YVB A;  1DC9 A;  3S5V A;  1ZNL A;  1SWE A;  3SAO A;  4BQU A;  3BLG A;  2AT3 X;  1CBR A;  2OY1 O;  4TNN A;  5CHK A;  1SXX A;  1SA8 A;  5F6Z A;  1IKE A;  5D48 A;  1MOY A;  5F58 A;  1K24 A;  1VYO A;  2P8G A;  1VWR B;  1JIW I;  1QQS A;  1NQN A;  1T8V A;  1VWE B;  2ASN X;  3JS1 A;  5H9N A;  2Z4I A;  3V8U A;  3WJG A;  2IZA A;  1X8O A;  4I6S A;  1D3S A;  2A13 A;  3U03 A;  5F6B A;  1LKE A;  1KXO A;  2FWV A;  1YIV A;  3OJY C;  4NLI A;  2R73 A;  4I3B A;  4CV7 A;  4MIR A;  2RD7 C;  4GGR A;  1PEE A;  3QKG A;  2LKK A;  5HA0 A;  4GRJ A;  1RXJ A;  3ZI8 A;  3NX2 A;  2RTF B;  2CBS A;  3ZUO A;  1OEK A;  5AQ6 A;  1N43 A;  2BHV A;  3P6H A;  1KL5 A;  1B56 A;  1HY2 A;  2CBR A;  3N91 A;  3PH5 A;  3HTY A;  4YH0 A;  3P6F A;  3T2X A;  3FW5 A;  3TGB A;  2BLG A;  2WUT A;  1BWY A;  1BBP A;  1LEL A;  1XKI A;  4DNE A;  5HWZ A;  4U9C A;  1JV4 A;  1DV9 A;  1SRJ A;  3MM0 A;  4R0B A;  2KT4 B;  3UEV A;  1I78 A;  3T1D A;  2GTF X;  2WR6 A;  1HMS A;  1QG5 A;  1ZND A;  4Z2O A;  1XCA A;  3KFF A;  5LJE A;  2LA7 A;  1LPJ A;  1VWI B;  4OS8 A;  5L8O A;  2JU8 A;  3F6Z B;  5L3Y A;  1S44 A;  3F8A A;  5FQ8 E;  4MVI A;  5H9A A;  5BVQ A;  3HWG A;  1SWF A;  1Y55 X;  2FTB A;  3KFI A;  4IB9 A;  4ML7 B;  2FKJ A;  1H91 A;  1X71 A;  4AZP A;  5HAE A;  3K3L A;  2C4I A;  2QMI A;  4WFV A;  1OEE A;  3PPT A;  4ALB A;  1B0O A;  3D97 A;  3PK2 A;  3EC5 A;  2CM9 A;  4ODD A;  4ZH6 A;  3WZP A;  4A1Y A;  1AEL A;  2X8T A;  5AEO A;  5FQ6 E;  2JOZ A;  4U46 A;  3FR2 A;  4QAE A;  4QYP A;  1LDO A;  2A2U A;  4MVL A;  3ZWE A;  4O4O A;  2WSJ A;  3IA8 A;  1SXW A;  2Y32 A;  1EQD A;  1TOW A;  4EDE A;  1U18 A;  1I05 A;  4CPI A;  4ARH A;  3P6E A;  5F2B A;  1X8Q A;  1RXH A;  1JJX A;  2IFB A;  4GDA A;  5B2A O;  1ALB A;  3BU9 A;  1BM5 A;  2R74 A;  1MUP A;  3WJD A;  4B55 A;  2UYW A;  2IZJ A;  3NQK A;  2GTL N;  4NNT A;  4RUU A;  5LKF A;  4HFO A;  5HZQ A;  1W5R A;  3HWE A;  1DFV A;  3HK1 A;  2A0A A;  3O19 A;  2RTO B;  5FEN A;  2RTH B;  2FS7 A;  2I5V O;  4LKT A;  5LJG A;  2AVI A;  3MVF A;  1Y9L A;  4OMX A;  1HMR A;  2W2F A;  1FEM A;  1LCZ A;  4HPD A;  3LV4 A;  1SWP A;  1LIF A;  3NP1 A;  4IAX A;  1RAV A;  4O4U A;  4QQ1 A;  4ZH9 A;  3S5X A;  3UEX A;  1FJ1 E;  1KT3 A;  4Z27 A;  1NC9 A;  3AUM O;  4IMN A;  2OVD A;  3Q34 A;  1SMP I;  1KFF A;  4FGI B;  4XMF A;  5B5G A;  4CPE A;  1YWC A;  3PDF A;  4GDZ A;  4D6A A;  1KQW A;  3HOL A;  3SLJ A;  1EW3 A;  3P24 A;  1KGL A;  2NP1 A;  4UU3 A;  1KZX A;  4LKP A;  1HXZ A;  1SY3 A;  5BYP A;  1E06 A;  1SWK A;  2X8S A;  1W4T A;  2OYB O;  4YCE A;  3RSW A;  2RTE B;  3WZN A;  3RKG A;  4AZM A;  1DZK A;  4GJS A;  5LJC A;  2C1S A;  4I60 A;  4QGV A;  1EUO A;  2G79 A;  1DZJ A;  2IZD B;  2LB6 A;  4YGZ A;  3FA6 A;  3O2Y A;  4YKO A;  3FEP A;  2X46 A;  4PJ2 A;  2WWP A;  3CWK A;  4CPF A;  1SWB A;  4I95 A;  4CSB A;  4K19 A;  5L8N A;  4OS0 A;  4BX5 B;  2ALL X;  4YFR A;  2FGS A;  2FRS A;  3FR4 A;  2VDF A;  5EED A;  1MX8 A;  2ZAG A;  4NV8 A;  1NP4 A;  1SRF A;  2CZU A;  2IZL B;  5EEE A;  5EDC A;  2MJI A;  2GTL O;  4BJ8 A;  1RXK A;  1BRQ A;  4Z2P A;  2RQ0 A;  1JJJ A;  4BX6 B;  1VWD B;  2YMS A;  1O1V A;  1ACD A;  4NYR A;  5CYB A;  4ZHC A;  3NBX X;  4WBK A;  4YBP A;  1MEP A;  3WXQ A;  1KT5 A;  4EFG A;  2POA A;  2I5Z O;  1PBY A;  1NDJ A;  2AL0 X;  1VWB B;  1OPA A;  2AMM X;  1LF7 A;  4IAB A;  2XST A;  1VYF A;  1HBP A;  1SWC A;  4N7C A;  5FFH A;  3U0D A;  3FLL A;  3Q6L A;  1GT3 A;  1LNM A;  2PI3 O;  1U0X A;  3B2K A;  3JQO A;  2KD2 A;  5D45 A;  3ZW1 B;  4L3R A;  3CKG A;  1U17 A;  2FHN X;  4AZQ A;  2QO6 A;  4ZHG A;  1KT4 A;  3SZJ A;  2NNQ A;  4I9S A;  3P6C A;  3WZO A;  1OBU A;  2OVE A;  2WQ9 A;  1GX3 A;  1CRB A;  4AW8 A;  5BVT A;  4QZU A;  3VG2 A;  4O9S A;  1ICN A;  1P6P A;  4BOE A;  2JU3 A;  3H3I A;  2AH7 X;  4A8Z A;  4KII A;  1SXY A;  5F1E A;  3ZW2 A;  5L8I A;  1LCV A;  3DTQ A;  1DZM A;  2JGS A;  3D96 A;  3LTW A;  2CM4 A;  3PQU A;  1GXA A;  1Y9T A;  1R0U A;  3D4R A;  4O4S A;  4YGG A;  4JHQ A;  3SZH A;  3RY1 A;  2OY7 A;  3ELZ A;  3VPJ E;  3WJE A;  4LZU A;  1EIO A;  2WEX A;  2GTL M;  2JMB A;  1O1U A;  3EMM A;  3MX7 A;  3T2W A;  3SZI A;  1EII A;  1KOI A;  1ZNK A;  4O3Z A;  4O3X B;  1Y53 X;  1MK5 A;  4YDA A;  1VWG B;  1LIB A;  1QY2 A;  2X32 A;  2KW1 A;  1GGL A;  2NNE A;  4HPB A;  1BSY A;  1MDC A;  1VPR A;  4IB6 A;  4GET A;  3RE6 A;  3SLO A;  3G7X A;  1GX8 A;  3IFB A;  2VFC A;  4ZGF A;  1PM1 X;  5D47 A;  4CPH B;  4D6B A;  3APW A;  1QWD A;  2FR2 A;  4ORR A;  3UAQ A;  2MHD A;  3BY0 A;  4IMO A;  4QGW A;  2RTP B;  4TQ2 A;  3EW2 A;  3KVN A;  2WEW A;  4GK9 A;  3L4R A;  1SLF B;  3VE1 A;  2L9C A;  2A2G A;  2RTG B;  4EKV A;  2JN3 A;  3EM0 A;  3PEC A;  2RTB B;  3BX7 A;  1K3B A;  1FDQ A;  1X8P A;  2BT9 A;  2RTA A;  1EAL A;  4XME A;  1N4J A;  2RA6 A;  2Q39 A;  4NP1 A;  1DF8 A;  3ZW1 A;  3E3C A;  3CQN A; 
#chains in the Genus database with same CATH homology
 1YP6 A;  2FLJ A;  5HCD C;  4UU2 A;  3MBT A;  3STK A;  3ZW0 B;  1NP1 A;  1QAB E;  1BLR A;  5AJC A;  5EDB A;  2Q2P A;  2HNX A;  4FBV A;  4ON1 A;  3B2J A;  1QY0 A;  4ORS A;  4TJZ A;  1TOU A;  2BS6 A;  1OBQ A;  2X45 A;  1GT4 A;  1OEJ A;  4FQB B;  1G7N A;  2HLV A;  5C0N A;  4O3Y A;  5IO7 A;  3FIQ A;  4GNY A;  3SOT A;  1B4M A;  4FBO A;  1JZU A;  5B29 A;  4Y0R A;  4Y0P A;  5H9L A;  2X8F A;  3BDR A;  2OZQ A;  4ORW A;  1TW4 A;  4OMW A;  1CJ5 A;  1QY1 A;  4XMG A;  1ML7 A;  3B2H A;  3ZQ3 A;  1DZP A;  4O49 A;  4IBA A;  1YWA A;  4NYQ A;  2PY1 A;  5KID A;  4TKH A;  4YBU A;  1HBQ A;  3NAD A;  4M7M A;  4ZCB A;  4IB7 A;  3STN A;  3TGA A;  3DSZ A;  5KIC A;  2JU7 A;  3CBS A;  1GT1 A;  4YMY A;  4KH8 A;  1FTP A;  2K62 A;  1PBO A;  3C77 X;  1BRP A;  2HMB A;  4ZFX A;  2O62 A;  3JSQ A;  1Z24 A;  3HWD A;  4I9R A;  3TF6 A;  4I3C A;  4BVM A;  1OPB A;  5EZ2 A;  3WVM A;  3WJF A;  3S26 A;  4JGL A;  3OD9 A;  3ZW0 A;  3WJC A;  2F73 A;  4GNW A;  4AZR A;  2KTS A;  3B2L A;  2RCT A;  1CBS A;  2AT5 X;  2RN4 A;  5DPQ A;  3RBY A;  5HZ5 A;  2YG2 A;  2Q4N A;  4RUN A;  2R56 A;  1X8U A;  4PSQ A;  2ACO A;  1HQP A;  3RZY A;  2AT6 X;  3PP6 A;  1JYJ A;  2OVS A;  1E02 A;  3NQ9 A;  3FEL A;  3P6G A;  3P6D A;  3WOV A;  1ZNH A;  4U8U O;  2F09 A;  2DM5 A;  2G78 A;  2JW1 A;  5LJH A;  4ZHH A;  3NR3 A;  1YUP A;  4HPA A;  4KC7 A;  3OBL A;  1T68 X;  1EI5 A;  4QYN A;  1AB0 A;  4TKB A;  5HCE C;  1A18 A;  1B8E A;  1QFV A;  3D95 A;  5HCC C;  4M6S A;  4OS3 A;  2L68 A;  4AZN A;  1ERB A;  5IO6 A;  1E00 A;  1A3Y A;  1URE A;  4DQ4 A;  5HTD A;  5HZ9 A;  1YWD A;  3EBW A;  3BS2 A;  1OBP A;  3KZA A;  1FE3 A;  4YDB A;  1A57 A;  2LBV A;  1LFO A;  3C76 X;  1GT5 A;  4A60 A;  3I0A A;  2A3F X;  4ORU A;  1EPA A;  2ZAI A;  2FR3 A;  1TXL A;  3BX8 A;  2GC9 A;  4MVK A;  4XMD A;  3NQ3 A;  1A2D A;  4XMC A;  3APU A;  3RWX A;  1ADL A;  5JR8 A;  1ICM A;  3VG5 A;  1LIC A;  1G74 A;  3FA7 A;  3FR5 A;  1KZW A;  1CBQ A;  4GE1 A;  2NND A;  3FEN A;  5BVS A;  1ERX A;  2GJ5 A;  5D4A A;  3EBK A;  2Z4H A;  4ZR2 A;  2Q2M A;  4AZO A;  4U8U M;  4INN A;  3I17 A;  5B27 A;  3P02 A;  2AKQ A;  4HWM A;  4WFU A;  2WQA E;  5FQ7 E;  2W2A A;  2MWH A;  3BU1 A;  2ANS A;  4DQ3 A;  1BEB A;  4LQZ A;  1BJ7 A;  4COT A;  4QZT A;  4N7D A;  4KT5 A;  4O4X A;  2HZQ A;  1N0S A;  3KQ0 A;  5LJB A;  1IFB A;  5H9K A;  1G5W A;  2MM3 A;  4IAW A;  4CK4 A;  5HZ6 A;  5HA1 A;  1AQB A;  1IFC A;  1HN2 A;  4MVE A;  1EXS A;  1IKJ A;  1YWB A;  3STM X;  3VU1 A;  1I4U A;  3GE2 A;  1GKA B;  4YFQ A;  4ORY A;  4ZGU A;  2L5P A;  4QGX A;  3NPO A;  3HOE A;  2W2B A;  3PH6 A;  3AKN A;  4GH7 A;  1LIE A;  1EPB A;  1PMP A;  4IB8 A;  1AVG I;  1X8N A;  4EXZ A;  2XKL A;  3VG6 A;  4ZHD A;  3VG3 A;  1CBI A;  1JYD A;  1SY2 A;  3ZZV A;  2MO5 A;  3PED A;  1I04 A;  2QOS C;  4WHI A;  4ALO A;  4EQA C;  2FT9 A;  4O3W A;  3FYF A;  5HTE A;  1G85 A;  5LJD A;  2G7B A;  3BSZ E;  4U8U N;  4KCA A;  5LJK A;  3GAQ A;  2L67 A;  1MVG A;  2FS6 A;  5F7G A;  3CMP A;  4L1N A;  4A1H A;  1KT7 A;  2AT0 X;  3NX1 A;  3TGB A;  4YGH A;  3FA8 A;  1YP7 A;  2E4J A;  3FMZ A;  4U3Q A;  3FW4 A;  3HWF A;  4Y0Q A;  4QNI A;  4HPC A;  5HZ8 A;  3CBC A;  3U9P C;  4ZHF A;  3AKM A;  3O22 A;  3ELX A;  2OVA A;  5DG4 A;  3BRN A;  3OE3 A;  4NNS A;  1UZ2 X;  1IIU A;  1X89 A;  4ES7 A;  1ZNG A;  3UEW A;  1MX7 A;  4GU8 A;  1SY0 A;  1GKA A;  1SXU A;  3EYC A;  5K06 A;  2LFO A;  1L6M A;  2ACP X;  4GKC A;  4EEJ A;  4FBR A;  2N93 A;  4I3D A;  3FEK A;  1SY1 A;  3VG4 A;  4YFP A;  5HBS A;  3KFH A;  1RLB E;  1ZRY A;  1FEL A;  3S60 A;  2LBA A;  4NLJ A;  3WJB A;  1T0V A;  3TZS A;  2KTD A;  4ID2 A;  4QRL A;  4LZV A;  1RBP A;  4YCH A;  4YKM A;  2HZR A;  2OFR X;  1QFT A;  1E5P A;  3VG7 A;  4XMH A;  5H8T A;  3WBG A;  5FAZ A;  3FA9 A;  1I06 A;  1KQX A;  2BS5 A;  3CR6 A;  3PQS A;  5KHP A;  5AJB A;  2QO5 A;  3ZUI A;  1GX9 A;  4TKJ A;  1IW2 A;  1LID A;  2RCQ A;  3F9D A;  4GZV A;  1S2P A;  1HMT A;  2EU7 X;  4NW4 A;  1TVQ A;  1D2U A;  1O8V A;  5IO5 A;  4AYH A;  1DF3 A;  3APV A;  5D8J A;  4MIS A;  1FEN A;  4ZJ0 A;  3C78 X;  2AT8 X;  3B2I A;  2OFM X;  1GM6 A;  3UEU A;  4Y0S A;  1ZNE A;  3TGC A;  5LKE A;  4KC8 A;  1S7D A;  1NGL A;  5CE4 A;  2Q9S A;  3APX A;  1VYG A;  1KT6 A;  2K23 A;  2M4L A;  3CQR A;  1BSQ A;  4TLJ A;  3LHN A;  1JBH A;  1BSO A;  2QM9 A;  2HYS A;  2CZT A;  3KFG A;  4ORX A;  3VE2 A;  2QO4 A;  1DC9 A;  3S5V A;  1ZNL A;  3SAO A;  4BQU A;  3BLG A;  2AT3 X;  1CBR A;  4TNN A;  1SXX A;  1SA8 A;  5F6Z A;  1IKE A;  5D48 A;  5F58 A;  2P8G A;  1JIW I;  1QQS A;  3JS1 A;  1T8V A;  2ASN X;  5H9N A;  3V8U A;  3WJG A;  2Z4I A;  1X8O A;  4I6S A;  1D3S A;  2A13 A;  3U03 A;  5F6B A;  1LKE A;  1KXO A;  2FWV A;  1YIV A;  3OJY C;  4NLI A;  2R73 A;  4I3B A;  4CV7 A;  4MIR A;  2RD7 C;  1PEE A;  3QKG A;  2LKK A;  5HA0 A;  4GRJ A;  3ZI8 A;  3NX2 A;  2CBS A;  1OEK A;  5AQ6 A;  2BHV A;  3P6H A;  1B56 A;  2CBR A;  3N91 A;  3PH5 A;  4YH0 A;  3HTY A;  3P6F A;  3FW5 A;  2BLG A;  2WUT A;  1BWY A;  1BBP A;  1XKI A;  5HWZ A;  4U9C A;  1JV4 A;  1DV9 A;  4R0B A;  2KT4 B;  3UEV A;  3T1D A;  2GTF X;  2WR6 A;  1HMS A;  1QG5 A;  1ZND A;  1XCA A;  3KFF A;  5LJE A;  2LA7 A;  1LPJ A;  4OS8 A;  5L8O A;  2JU8 A;  3F6Z B;  1S44 A;  3F8A A;  5FQ8 E;  4MVI A;  5H9A A;  5BVQ A;  3HWG A;  4IB9 A;  2FTB A;  3KFI A;  4ML7 B;  1H91 A;  1X71 A;  4AZP A;  5HAE A;  3K3L A;  2QMI A;  4WFV A;  1OEE A;  3PPT A;  1B0O A;  3D97 A;  4ODD A;  4A1Y A;  2CM9 A;  4ZH6 A;  1AEL A;  2X8T A;  5AEO A;  5FQ6 E;  2JOZ A;  3FR2 A;  4QAE A;  4QYP A;  2A2U A;  4MVL A;  3ZWE A;  4O4O A;  2WSJ A;  3IA8 A;  1SXW A;  1EQD A;  1TOW A;  4EDE A;  1U18 A;  1I05 A;  4ARH A;  3P6E A;  1JJX A;  1X8Q A;  2IFB A;  1ALB A;  3BU9 A;  1BM5 A;  2R74 A;  1MUP A;  3WJD A;  3NQK A;  2GTL N;  4NNT A;  4RUU A;  5LKF A;  4HFO A;  5HZQ A;  3HWE A;  1DFV A;  3HK1 A;  2A0A A;  3O19 A;  5FEN A;  2FS7 A;  4LKT A;  5LJG A;  3MVF A;  1Y9L A;  4OMX A;  1HMR A;  2W2F A;  1FEM A;  4HPD A;  4IAX A;  3LV4 A;  4O4U A;  1LIF A;  3NP1 A;  4QQ1 A;  4ZH9 A;  3S5X A;  3ZUO A;  3UEX A;  4BOE A;  1KT3 A;  4IMN A;  2OVD A;  1SMP I;  4FGI B;  4XMF A;  1YWC A;  4GDZ A;  4D6A A;  1KQW A;  3HOL A;  1EW3 A;  3P24 A;  1KGL A;  2NP1 A;  4UU3 A;  1KZX A;  4LKP A;  1SY3 A;  5BYP A;  1E06 A;  2X8S A;  4YCE A;  3RSW A;  3RKG A;  4AZM A;  1DZK A;  5LJC A;  4QGV A;  1EUO A;  2G79 A;  1DZJ A;  2LB6 A;  4YGZ A;  3FA6 A;  3O2Y A;  4YKO A;  3FEP A;  2X46 A;  4PJ2 A;  2WWP A;  3CWK A;  4I95 A;  4CSB A;  4K19 A;  5L8N A;  4OS0 A;  2ALL X;  4YFR A;  2FRS A;  3FR4 A;  5EED A;  1MX8 A;  2ZAG A;  1NP4 A;  2CZU A;  5EEE A;  5EDC A;  2MJI A;  2GTL O;  1BRQ A;  2RQ0 A;  1JJJ A;  2YMS A;  1O1V A;  1ACD A;  4NYR A;  5CYB A;  4ZHC A;  3NBX X;  4WBK A;  4YBP A;  3WXQ A;  1KT5 A;  4EFG A;  2POA A;  2AL0 X;  1OPA A;  2AMM X;  1LF7 A;  4IAB A;  2XST A;  1VYF A;  1HBP A;  4N7C A;  5FFH A;  3U0D A;  3FLL A;  3Q6L A;  1GT3 A;  1LNM A;  3B2K A;  1U0X A;  3JQO A;  3ZW1 B;  2KD2 A;  4L3R A;  1U17 A;  4AZQ A;  2QO6 A;  4ZHG A;  1KT4 A;  2NNQ A;  4I9S A;  3P6C A;  1OBU A;  2OVE A;  2WQ9 A;  1CRB A;  4AW8 A;  5BVT A;  4QZU A;  3VG2 A;  4O9S A;  1ICN A;  1P6P A;  2JU3 A;  3H3I A;  2AH7 X;  4A8Z A;  4KII A;  1SXY A;  5F1E A;  3ZW2 A;  5L8I A;  3DTQ A;  1DZM A;  3PQU A;  3D96 A;  4YGG A;  2CM4 A;  5EPQ A;  1GXA A;  1Y9T A;  1R0U A;  3D4R A;  4O4S A;  3VPJ E;  3WJE A;  4ALB A;  1EIO A;  3ELZ A;  4LZU A;  2WEX A;  2GTL M;  2JMB A;  1O1U A;  3EMM A;  3MX7 A;  1EII A;  1KOI A;  1ZNK A;  4O3Z A;  4O3X B;  4YDA A;  1LIB A;  1QY2 A;  4HPB A;  2KW1 A;  2NNE A;  1GGL A;  4IB6 A;  1BSY A;  1MDC A;  1VPR A;  4GET A;  3G7X A;  1GX8 A;  3IFB A;  4ZGF A;  1PM1 X;  5D47 A;  4D6B A;  3APW A;  1QWD A;  2FR2 A;  4ORR A;  3UAQ A;  2MHD A;  3BY0 A;  4IMO A;  4QGW A;  4TQ2 A;  2WEW A;  4GK9 A;  3L4R A;  3VE1 A;  2L9C A;  2A2G A;  2JN3 A;  3EM0 A;  3PEC A;  3BX7 A;  1FDQ A;  1X8P A;  2BT9 A;  1EAL A;  4XME A;  2RA6 A;  2Q39 A;  4NP1 A;  5D45 A;  3ZW1 A;  3E3C A;  3CQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...