4DQ8A

Crystal structure of acetate kinase acka from mycobacterium marinum
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
380
structure length
373
Chain Sequence
NRVVLVLNSGSSSLKFQLVEPDSGMSRATGNIERIPDHDAALRRVFEILAEDDIDLQSCGLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVPHIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLHLGNGASASAVAGGRPVETSMGLTPLEGLVMGTRSGDLDPGVIGYLWRTAKLGVDEIESMLNHRSGMLGLAGERDFRRLRAMIDDGDPAAELAYDVFIHRLRKYVGAYLAVLGHTDVVSFTAGIGEHDAAVRRDTLAGMAELGISLDERRNACPSGGARRISADDSPVTVLVIPTNEELAIARHCCSVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 124
structure length 373
sequence length 380
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4dq8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4dq8A02
4L3QA 3CJ7A 4BRAA 1MWMA 3LDNA 3IUCA 5KQDA 4FWSA 3ZX0A 3BF3A 3GBTA 5LJWA 4DB3A 1YVNA 4BRNA 4CI6A 4QS8A 4GY2B 4BR0A 4CZEA 4E1JA 4DHYA 2E88A 4BG8A 4EHUA 1BO5O 5F0XA 4KBOA 3C0BA 3MCPA 4IWVA 4B1VA 2EWSA 4H5VA 4PKIA 4K43A 3A5NC 2QWRA 4CZGA 4WYBA 1BOTO 3JS6A 3QFPA 2QWNA 3CQYA 2E1ZA 3HM8A 4BQLA 1NGIA 4H5TA 3GOIA 3VEZA 2VYPA 5AQLA 3VEXA 1QZ5A 4PKGA 3HTVA 2GTDA 2Q36A 3O80A 1BG3A 3FFKB 4CBWA 4IJNA 2W41A 3CI5A 4BRHA 4I6MA 4BREA 3O5BA 1SAZA 5BRDA 3DAWA 3GE1A 4EFHA 1U2VA 2F9WA 2E2QA 3C7NA 3SMPA 1BA1A 1Q18A 1GLAG 3BUZB 1D4XA 3AAQA 1GLFO 1V4TA 2A42A 2BUPA 3A5OC 3H6EA 2ZWHA 3FZFA 4FWMA 5JMVA 5KPTA 3SK3A 1WOQA 4BC2A 1QZ6A 2PAVA 2NZTA 4YDUA 2P9IA 2IVOA 2NRHA 3VGLA 4H0XB 3WUHA 2HMPA 4K25A 5BREA 3FLCO 4MO4A 3ENOA 3S41A 3SJHA 5AQVA 4XH1A 3DXKA 5BPNA 4BC4A 5AQUA 3EZWA 1XUPO 5BN9A 4FWLA 1V4SA 1YAGA 4YDUC 1MA9B 4BR9A 1NGEA 5BRHA 2Q1NA 2QWQA 2A5XA 2V52B 4XH5A 1NLVA 1ZBSA 4IZ9A 2BTFA 3ULEA 4CZHA 2PBDA 3MK6A 3QMLA 3UKUA 5KPZA 3D7EO 4ISGA 3B8AX 4BRLA 3CJ1A 1ESVA 4I6MB 2YHXA 5EXWA 4B1UB 4RWTA 2D0OA 5I9EB 3FGUA 4BRCA 5EY4A 4BRGA 2P9UA 1E4GT 1U2VB 3C7NB 4K42A 5AQRA 4BVPA 3CHWA 1BU6O 2P9NA 4H5WA 3O8MA 2IIRA 3HZ6A 4H0PA 3MDQA 5AZIA 4BVOA 1XC3A 2VWBA 2Q97A 3I33A 3DXMB 3IMXA 4JD2A 4BGBA 3DWLA 2FSNA 3HBTA 3MN9A 2P9IB 4EHTA 4BRQA 3VERA 3AAPA 5BPMA 4BC5A 4GNIA 3WQTA 3VETA 2V7YA 3VOVA 1JCFA 1KAZA 2YI1A 3D2FB 3DXKB 5FPMA 2QM1A 3A0IX 3G25A 3GL1A 2YJEA 2D1KA 1IJJA 3CJBA 3VGKA 4Y0WA 2P9LA 2QWLA 3CJ9A 3O1BA 4CBUA 1HPMA 1BUPA 4H0TB 3A8YA 3ULEB 2DPNA 3H46O 2CH6A 1HLUA 3A5LC 3VENA 3H3NO 4AM6A 2VCPA 2E20A 3UKUB 2ZGZA 4H0YB 1TYQA 2ASPA 3O6WA 4FWRA 2E2OA 2NLXA 3D2EA 3H3OB 2P9UB 3CJCA 1NGFA 1BWFO 3H1QA 4B1WB 3R6MA 2GUPA 3VEYA 4XEIA 5BN8A 5FPEA 5AQSA 1CZAN 3P4IA 4ISEA 3U4LA 5AZIB 3O1WA 5AQKA 3LDOA 4HWIA 4EIAA 1X3NA 5AFUH 4JD2B 2FLOA 3VEOA 1GLJO 4FWNA 1KAXA 1HUXA 3GDQA 2CGLA 1C0FA 1GLEG 5CE3A 4HTLA 5AQHA 3L0QA 5EOYA 1E4FT 4LC9B 3LDPA 1JCGA 2D4WA 3FZHA 4BR5A 1S22A 1NM1A 3L6QA 4JAXA 4K41A 2P9LB 4CZFA 4PL8A 3CERA 4C23A 3EKUA 3ENHA 2V51B 2CGJA 3QFUA 1X9JA 5BR9A 2P9SA 5LY3A 5AR0A 2ASMA 4BR4A 2GWJA 3WT0A 4BQZA 3KHYA 2QWPA 2AP1A 3CIPA 3WXJA 4MLEA 4PKHA 2YHYA 5AQYA 1TYQB 5AFUA 1OKJA 2Q2RA 3AY9A 1GLBG 3MN7A 3D2EB 1SZ2A 1YUWA 4A62A 2FSKA 1NGBA 1R59O 4FWKA 2OANA 1S3XA 3O08A 3W3DA 1LCUA 5JLHA 3MN6A 4M7XA 4QS7A 2P9PA 3TU5A 3VF4A 4FOIA 3CETA 4ISFA 4FO0A 1DEJA 3R8EA 1K8KA 4A2BA 4FWOA 2HF3A 4PL7A 2I7PA 3ZEUA 1KXPA 1HKBA 2GELA 2AA4A 2E1YA 3M3ZA 3LL3A 4A2AA 5ELZA 1GLDG 3QBXA 5AQJA 3F9MA 2YJFA 4MLHA 1HKGA 2H3GX 1QQMA 2J4RA 1QQNA 4B1YB 3EN9A 1IG8A 1NGJA 1QHAA 4H03B 4RCHA 3FZLA 3I8BA 4BRPA 3EKSA 5LJVA 2P9SB 1TUYA 5JLFA 5JICA 3BEXA 3VESA 4BRDA 4WQ4A 1U6ZA 3WEEA 5B8HA 5AQGA 5BPLA 5AZJA 4BR2A 3A5MC 3FZKA 4M7YA 5BRFA 2Q0RA 5AQPA 4IJAA 4BRIA 4NO7A 4FOEA 2Q0UA 2IVNA 1NGGA 3EL2A 3ATVA 3W0LA 3UB5A 3L4IA 4BC3A 3RSEA 3SLCA 1DKGD 1J6ZA 1QQOA 1ATRA 3LDLA 3ZETA 2A41A 2QXLA 2D0PA 5AQOA 2P9PB 5AQQA 3QB0A 1NWKA 1T6CA 2UYTA 1H1VA 2P9KA 3WXIA 2KHOA 3ID8A 2FSJA 1K8KB 2ZF5O 1YXQA 5EX5A 4EAHD 1MWKA 3ZEUB 4CD1A 3QICA 3ATUA 3CJAA 3AARA 4IXCA 3LM2A 3ZX3A 3VPZA 4FWQA 2E2NA 4DQ8A 2P9NB 1T44A 3MN5A 4MO5A 1KAYA 3KVGA 1NBWA 1NMDA 3FE1A 3TPQA 3U8XA 3EO3A 3U9DA 4FPAA 2W40A 4Z94A 5AQIA 1GLLO 2A40A 3WEEB 5AZJB 4JHDA 2ZGYA 1MDUB 4CBXA 1X3MA 4BRKA 1P8ZA 4B9QA 4CZMA 5AQFA 2E8AA 3RSEB 3WQUA 5FPDA 3CQXA 3ZETB 4CZLA 4BG9A 2GEMA 4BROA 4RTFD 3J8AA 4FWPA 4DCHA 5F1XA 2P9KB 5TKYA 3U9ZA 3UKRA 1ZXOA 3VEVA 5F2RA 1ZC6A 2ASOA 1G99A 3M1FA 3UE5A 4B1XB 3HSCA 3OHRA 4BR7A 3VGMA 3DJCA 5AQWA 3QDKA 2QWMA 3H45C 1T6DA 5KQ8A 1GLCG 1NGCA 4JNEA 5FPNA 3KZBA 4F9OA 5AQTA 5EVZA 2F9TA 4BRMA 1DGKN 3GG4A 2HOEA 3DXMA 1WUAA 2FXUA 4IO8A 1LOTB 4WQ5A 3WXKA 3FR0A 5E84A 2GWKA 2QW9A 3WXLA 3LDQA 3BP8A 1NGDA 1TUUA 4JHDB 3D2FA 3IDHA 3MMVA 1EQYA 1ATNA 4O5FA 3SMSA 4FL9A 2V7ZA 4M63C 1JCEA 1HKCA 4WQ5C 4FPBA 4CD3A 2CH5A 3VF6A 3IFRA 3VF2A 4H0VB 5ADXH 3O4WA 5KPRA 3M6GA 5AQNA 1BA0A 4CJ7A 4JN4A 3JXUA 4XH4A 2CGKA 2E2PA 4CZKA 3UKRB 1RDWX 1BDGA 4J8FA 4AM7A 2FF3B 4B1ZA 1C0GA 1HX1A 1NGHA 2A3ZA 4H0OA 2QWOA 1ATSA 3HI0A 1Z6RA 3QBWA 2I7NA 2WUSA 2YCHA 1RFQA 3VEWA 4CZJA 4NB4A 2Q31A 3H1VX 5AQZA 1Y64A 2IVPA 2ITMA 4WQ4C 1RGIA 3BF1A 1HJOA 3FZMA 1NGAA 4BGAA 2YHWA 4BRFA 4H5RA 4CZIA 3LM9A 3R9PA 1SQKA 3ZX2A 4FSVA 4QS9A 5AQMA 5AQXA 2A6AA 5ADXA 4A61A 1Z05A 5E26A 4H5NA 4O8KA 2FF6A 1XQSC 2HF4A
chains in the Genus database with same CATH superfamily
2VGMA 3HYFA 3NF9A 3M8SA 1MWMA 3IRXA 3BF3A 5M1FA 3HP9A 4DB3A 3MXMA 4KAZA 3OBWA 3QLHA 4AHVA 4QS8A 4GY2B 3RVCA 4BG8A 3DLLL 4JI5K 3PLAA 3P31A 3ZT0A 4MFBA 3M8QA 3TAGA 4KBOA 3OYIA 4CJRA 3NBPA 2ZE2A 4H4MA 4IWVA 4B1VA 1SKRA 4H5VA 3CMEN 1Q82O 3PO5A 4DFMA 5E41A 2IDOA 3JS6A 1UOCA 3SV4A 4Z4GA 3CF5L 1NOYA 5HBMA 5GAHP 1JLBA 3D45A 3GOIA 2VYPA 4NLCA 4DTMA 4PKGA 1ZYQA 3O80A 4IOCL 3QEXA 3OJUA 3FFKB 1NK6A 4IJNA 3K5NA 4NYNA 4LD0A 1P90A 4JI8K 4FJHA 5BRDA 1N34K 4PY5A 3GE1A 3AA3A 2F9WA 2FBXA 3TAFA 1TAUA 3PIOL 3AA5X 4B3MK 1GLAG 2KKZA 1FJGK 1V4TA 5HRNA 3A5OC 1KD1O 2ZWHA 4FWMA 5JMVA 3MEEA 1WSFA 1QZ6A 2PAVA 5GINA 4YDUA 1Q7YO 2AJQA 3AVAA 3MECA 2UU9K 3AVLA 4HUFA 4DS4A 1WLJA 3M5RA 3THWA 2R7YA 3DXKA 2HHHK 5AQUA 2FBYA 1V4SA 4FLUA 4NYFA 3ZSOA 1NGEA 1EO1A 4CGHA 3CCVN 3E66A 5JVHL 4JS5A 3OYFA 1NLVA 1ZBSA 4JKFA 1OH8A 1J53A 4LF8K 3CFOA 3CCSN 5AJ3K 4YOTA 2KLAA 5KPZA 4CEOA 3LPTA 1NKEA 1VQ5N 1DTQA 2HBMA 4BRLA 1ESVA 3AGKA 3O9QA 2YHXA 5EXWA 2D0OA 3P1GA 5EY4A 1J54A 4B9VA 2P9NA 3ZT2A 2YNHA 2D0AA 5SZTA 3NMUA 2Q97A 4UY8O 4ID5A 1DT9A 3I33A 1ASVA 3SUPA 4FJGA 2LSNA 3IG1A 3PX0A 3DWLA 3E1YA 2FSNA 5FLXO 3PV8A 4B9UA 3AAPA 3L2UA 2VQFK 2OPPA 1O13A 3CXCM 3THXA 1YJWN 5FPMA 2YJEA 3L2VA 4DSLA 1TK5A 3CJBA 3LAMA 4Y0WA 2P9LA 1RT7A 1RBSA 2ATQA 3PX4A 3P39A 2DPNA 5C15A 1S1UA 1OH6A 4A59A 4Y1DA 4CJLA 3UKUB 2HNYA 3HM9A 3OYNA 4FK2A 4FLZA 3CCQN 4FYDA 4DR1K 2E2OA 3H3OB 3OW2M 1BWFO 4CGDA 3R6MA 4PQUA 2A1RA 2NRVA 3O3HA 3OY9A 2P5OA 5BN8A 1CZAN 1L3TA 4OGCA 5AZIB 3HVTA 3AO2A 4MDAA 2Y1JA 3ZT1A 4CIGA 4HWIA 4DQRA 3I56N 4FWNA 1KAXA 1C0FA 2GBZA 1GLEG 1E4FT 4KHQA 4HCCA 4Z4FA 4WFAL 5FRNA 1S22A 3EY1A 1NKCA 4CZFA 5HRSA 3SCXA 3AVCA 2CGJA 1X9JA 5LY3A 2ASMA 3C6TA 4AHCA 2GWJA 4LF9K 3H08A 4BE0A 4W5NA 2QWPA 4JK9A 4E89A 1J9AA 3WXJA 4AHSA 3TAEA 2YNIA 4KH4A 3RR7A 1JXBA 1A5WA 4ELVA 4JKCA 4A62A 2FSKA 1LAWA 4FWKA 3OYMA 3KK1A 4QS7A 4CFAA 3CETA 4YOYA 3ZSZA 3NH0A 1BQMA 1YF5L 4DV6K 3PUFA 4FWOA 2VG6A 3PO4A 2I7PA 3OYCA 4KRFA 3DLBA 3QIPA 2QEXN 2E1YA 2WBNA 4DSEA 3QBXA 2QKKA 5M1KA 3F9MA 3LZJA 1UA0A 2HBLA 3DRPA 3CCJN 4KHYA 4FJ5A 4B1YB 4DFKA 4X62K 4J2BA 1QHAA 1WAJA 3SQ4A 4E1NA 4RCHA 5HP1A 4J2AA 4J2EA 4CGGA 4BRPA 4M45A 3EKSA 1BIUA 2P9SB 3AGRA 1TUYA 5JICA 3BEXA 4KHWA 4WQ4A 3MX2A 5AZJA 4M3XA 4BR2A 3A5MC 1VQ4N 4PWDA 3ZYYX 2RF2A 4BRIA 1NGGA 3ATVA 3W0LA 4CEBA 4JV5K 1WBBA 1DKGD 3ZETA 3LDLA 2A41A 4DR5K 5AQOA 4OGEA 3ZSXA 3G4SN 2P9KA 4OLBA 4OLAA 1K8KB 2ZF5O 2NRXA 4EAHD 3ZEUB 2HBJA 2QI2A 5GIPA 2YKNA 3ATUA 4FJ8A 1WBDA 3AARA 4B08A 2DFEA 4GMJB 4LF7K 3LANA 1KLMA 1EX4A 5JVGL 3QNNA 5HRPA 4CHNA 1KAYA 1RT1A 2O8BB 1BI4A 4FK4A 4W5RA 4CCHA 4Z94A 4JKHA 2DY4A 4DV1K 4KI6A 4IEIA 4CGFA 3WEEB 2ZGYA 4FZYA 4BRKA 1P8ZA 2RE2A 3IKMA 4B9QA 4AHUA 3KD1E 4O4GA 4BROA 2Z1GA 4F2RA 1NK9A 3A2FA 5TKYA 3VEVA 3UKRA 2WC9A 4N76A 1RDDA 4DR4K 3SV3A 3M1FA 4DV0K 4B1XB 3VA0A 3V9XA 3OHRA 1KCFA 3QDKA 2G8IA 5KQ8A 1T6DA 4CJVA 3KIOA 3KZBA 4F9OA 1DTTA 4DV7K 2HOEA 1VRTA 4LF5K 1CXQA 1L5UA 3PY8A 3KK2A 3THYB 2GWKA 3CG7A 3K0SA 3C6UA 5HL7L 1I94K 1WSIA 3SI6A 2FBVA 4CHQA 4KHUA 4YOWA 5KTQA 4M63C 1QVGM 4WQ5C 4AH9A 3RR8A 2E6LA 2RHKA 2KQ2A 4OKJA 4OVLA 3HT3A 4OKEA 1BA0A 4C8NA 1IBLK 1VSDA 4I9LA 3IAYA 1BDGA 3CC4N 2A3ZA 3T1YK 1KFSA 4CEFA 1ATSA 3VQ7A 2WUSA 3G71N 3VEWA 4PUOA 4J2DA 4GV9A 3MX5A 3LWMA 4KB0A 2ITMA 2HHWA 3QINA 3BF1A 3TAMA 4CFBA 4CZIA 1B92A 1IKXA 5AQMA 2A6AA 3SAFA 3ISNC 4HTUA 1XQSC 4O5FA 4L3QA 3CJ7A 2ZJPL 4JI4K 1QS4A 5DMRA 1HMVA 1A5VA 4CJ3A 3ZT4A 4CECA 1L3VA 1BL3A 4X64K 4BRNA 4CESA 4B8AB 3SBGA 4BR0A 1CZBA 4E1JA 4DSJA 1Q9XA 4U7BA 5F0XA 3O9UA 3VQQA 2FBTA 2O8CB 5J2QA 3MCPA 2Z1HA 3TAQA 4PKIA 4YNQA 2VWJA 3A5NC 2QWRA 4CZGA 1U48A 1BOTO 3OYDA 4U67L 3HOSA 1KLNA 3QFPA 2QWNA 5CR4A 4YOVA 4BQLA 2HHVA 2O8DA 5AQLA 1QZ5A 3L2QA 1WSHA 2O8FB 4MQ3A 1S6PA 3BY5A 2PZSA 3CI5A 4BRHA 4I6MA 5D3GA 4BREA 1ITGA 1YT3A 4YHHK 3L2RA 1U2VA 1VSLA 2X6NA 4NCBA 3KWGA 3AVKA 3J7YP 1JKHA 1GLFO 4KFBA 2A42A 4K8ZA 2BUPA 4E7KA 4MDBA 3R1XA 3LP0A 2XRIA 3KKSA 4M3RA 2NUBA 3MXIA 2NZTA 3TR8A 2OZSA 2P9IA 2IVOA 3LZIA 1C0UA 3KLEA 5BREA 5CY4A 4OPJA 4MO4A 1HPZA 3S41A 3SJHA 3AVMA 3L8BA 3E9OA 4XH1A 3CCMN 3BZKA 1VSMA 3OYHA 4JI0K 1MA9B 4BR9A 4QAGA 1QTMA 2Q1NA 2QWQA 4K0KK 2V52B 3M8RA 4XH5A 1IKVA 4DR2K 3K5MA 4RW4A 4IZ9A 2BTFA 3ULEA 2XY5A 2XY8A 4CZHA 4M3YA 5CYMA 2D0BA 3QMLA 1HNXK 3NVKA 1RDAA 1F21A 4NXMK 4B1UB 2P9UA 1JXEA 3G0ZA 3E9PA 3C7NB 3K5LA 2JWLA 5AQRA 4BVPA 1TV6A 3TSUA 2G8KA 4IG3A 3I0SA 4H0PA 3MDQA 3PSFA 3PSIA 2O4IA 1KVBA 3TSQA 1C1CA 3DXMB 4CK1A 1OH5A 5C42A 4FJ7A 3IMXA 1G15A 1UWBA 3MN9A 4EHTA 1S1VA 1RTHA 1LV5A 3VERA 1SUQA 1C0TA 1N33K 2G8VA 4CF8A 1HNVA 3P38A 4LF6K 2YI1A 1SV5A 2O8EA 3GL1A 1C0MA 5I42A 1Q8IA 3J7AP 1B9DA 4H0TB 3OTOK 3C6HA 1RTDA 3A5LC 1FKPA 3DOKA 3HVRA 2E20A 3C6AA 4H0YB 4FW2A 1OH7A 3CCUN 1TYQA 3SUQA 4F2SA 2RKIA 3O6WA 2NLXA 1ZBUA 3CJCA 1NGFA 3H1QA 2EX3A 3VQCA 2GUPA 3SPZA 4H8KA 3PIPL 4XEIA 2WONA 4I2PA 5FPEA 4KV8A 1HQUA 3VQBA 4JYAK 2W6LA 3V6DA 1REVA 4EIAA 4JD2B 2KW4A 3MCAB 4CJSA 3QERA 3GDQA 1SL0A 5CZ2A 2IAJA 4RW9A 1X9MA 3CMAN 3L0QA 4GVMA 4E19A 5EOYA 3HPGA 1TK8A 4JAXA 4B3RK 3SUNA 1KC8O 1JLFA 4FJKA 3ENHA 2V51B 3QFUA 2UUAK 1XHZA 3ENBA 1T8EA 1A5XA 3WT0A 4HCBA 3CIPA 1GOCA 2YHYA 3AV9A 5AQYA 1QQCA 2X6SA 2XHBA 2WOMA 4CVNE 2Q2RA 2D0CA 4DQSA 3D2EB 5GAGP 3SNNA 3HK2A 3O9SA 1T3VA 2HB5A 4G1QA 1TKXA 4CEZA 4DTRA 3VTIA 2P9PA 4FCYA 1YIJN 1ILYA 1TKZA 3VMFB 4ISFA 5C2FA 4B3OA 3R8EA 3LDSA 4O5BA 1VQKN 1KXPA 2NRTA 3M3ZA 3JSMA 4A2AA 5ELZA 1X9WA 3LAKA 4MLHA 2J4RA 1KRPA 4F3TA 4JRPA 1HNZK 1NGJA 4GVEA 5KGXA 3NH1A 3I8BA 4BE2A 4DQQA 2OZMA 3MAQA 5JLFA 1D9DA 3NGZA 3I55N 3K9JA 4DSIA 5AQGA 1EP4A 2F7TA 4M7YA 4OKKA 5BRFA 4IJAA 1NNEA 2F8SA 3CD6N 4KHNA 3F73A 3UB5A 4JI3K 3RSEA 1N32K 3SLCA 4CF2A 4LFAK 1ATRA 2OPQA 2QXLA 4CJWA 1VQ9N 2UYTA 4DV3K 4FLYA 4FLXA 3WXIA 3L2WA 2WTUA 3EEQA 2JLEA 4CJEA 3NF6A 3BZCA 1XMOK 3B6OA 4JKEA 4YOUA 4RW6A 3ASMA 3NCIA 1JLQA 3LM2A 1IBKK 1N36K 2JGUA 2X78A 1RNHA 3VPZA 4DUZK 4IO9L 5KRSA 1EWRA 1IKYA 3KVGA 3U8XA 4YY3K 4O0JA 4KREA 3TTFA 3U9DA 1S5JA 2ETJA 4JKGB 3PX6A 3QO9A 4Z4IA 4CHOA 1U04A 3F2KA 4JHDA 1MDUB 4CBXA 1X3MA 2E6MA 4BWJA 4FM1A 3KKRA 2XY6A 5AQFA 4Q0BA 2WFBA 1VSJA 2O4GA 4BG9A 4V19S 5HROA 3KLFA 2HNZA 2IOCA 3J8AA 3V9SA 2ITGA 2G8HA 3U9ZA 1BHLA 1ZBFA 3DRSA 2HW3A 4B3TK 2YHBA 3HSCA 4LSLA 2UUCK 2NNWA 4KPYA 1S1WA 1NGCA 4AILC 4PA1A 4ZTJA 4BRMA 5FRMA 2F4VK 4CF1A 3OVNA 3DXMA 3L4QA 4FM2A 2OA8A 4IO8A 4O0IA 3CC2N 1IG9A 1LOTB 3WXKA 3NGIA 1T03A 4M3ZA 2QTDA 1D5AA 3J81O 3LDQA 1XC9A 5C0YA 2E5LK 3IS9A 4FVUA 5M1PA 1YJ9N 3IDHA 3V9ZA 3HSTB 1X9SA 1YI2N 4RG8A 4GKJK 3LP2A 3OYAA 4FPBA 2ZQBA 3VQEA 4F4KA 4H0VB 3O4WA 3BDPA 5AQNA 3QEIA 3OYGA 1WNSA 3JXUA 1NJWA 4WFBL 2E2PA 1RDWX 4QOZB 4J8FA 4Y1CA 1NGHA 3ZCMA 4KB1A 3TTDA 5EU7A 1NJYA 2QWOA 3ZT3A 3QBWA 2I7NA 3NVMA 4F3OA 1VQ7N 1TVRA 4B9LA 1YITN 4FJNA 5AQZA 3NH2A 3HP6A 4BGAA 4BRFA 4IFVA 3KK3A 2YHWA 4H5RA 3LM9A 1WSEA 5GADP 5H1SQ 3T1HK 5ADXA 4CW7B 4DTXA 4H5NA 4BACA 2HF4A 1Y97A 1IH7A 4BRAA 5FDLA 4E3SA 1LWFA 3LDNA 3IUCA 5KQDA 4FWSA 3SYZA 1W0HA 4CEAA 3CPWM 1B9FA 5J2NA 3OYJA 4CI6A 4CZEA 4DHYA 3AVNA 2ZM6K 2E88A 2YHAA 4EHUA 3UIQA 3E9LA 2BE2A 2EWSA 3DLRA 1HYZA 4BE1A 3CQYA 1VQ8N 1XHXA 2W42A 5JS1A 2B6AA 3CFPA 4Z4EA 2ZD1A 2Q36A 4ELUA 1JLGA 4DF4A 2GX9A 4DTPA 4CBWA 4LH5A 3S3NA 3VQAA 2QK9A 1RBUA 3AVIA 1RT2A 3O5BA 1SAZA 3HRGA 3DAWA 5GAEP 2YNFA 2UXBK 2D5RA 1BGXT 4DG1A 4EFHA 2UXDK 2E2QA 3S3OA 3CFRA 1Z26A 3AAQA 4KH6A 3VN5A 3H6EA 2BANA 3VQ6A 2PFUA 5KGWA 1TK0A 3OYLA 2Q3SA 4IEEA 3VGLA 3WUHA 2HMPA 1I39A 4K25A 1RT4A 3FLCO 4PHTX 3VQ5A 4A57A 4I2QA 5AQVA 3TANA 3DLGA 3EZWA 1XUPO 4WE1A 4Z4HA 3K9KA 4FWLA 1U4BA 1YAGA 4YDUC 4KTQA 4Z0UA 5BRHA 4IOAL 5CYQA 1FK9A 2PBDA 3MK6A 3DYAA 3UKUA 3D7EO 2IS3A 5TKWA 4KHSA 4CJTA 2OTJN 2E4LA 4BWMA 4RWTA 1K73O 2I5JA 5I9EB 3N4PA 1NOZA 1E4GT 4K42A 4LFCK 1BCMA 3CHWA 1BU6O 3HZ6A 4BVOA 5AZIA 2VWBA 2B4JA 1ASWA 5CHIA 4AQYK 4CGJA 1K6YA 5DM6L 3HBTA 1RT6A 1XNQK 4CJ5A 4ILGB 1CXUA 1RCHA 5C25A 1JL2A 5BPMA 4BC5A 4GNIA 4W5QA 1XMQK 2HHTA 3WQTA 2HBKA 3VETA 2V7YA 4DTOA 3AO3A 1JCFA 3THWB 1KAZA 3D2FB 4M41A 3DXKB 4DTSA 2QM1A 3DLHA 3A0IX 3NHGA 1IJJA 2QWLA 4BY9C 4CBUA 3NFAA 5IWAK 3TARA 3AVBA 3A8YA 4M3WA 3H46O 4JS4A 1HLUA 3DI6A 1T7PA 3H3NO 3ZSVA 4QCLA 2VCPA 2KZMA 4CF0A 2ZGZA 4FJMA 2ASPA 3WNEA 4I9QA 3TWHA 4FWRA 4FW1A 5HLFA 2Z1JA 3AO4A 4AHRA 1VQON 5AQSA 4C1NI 4JI1K 4ISEA 3P83D 5AQKA 3KLHA 4IFEA 4E7LA 4FJ9A 1ZBIA 4O44A 4CHZA 3S9HA 4F8RA 1Q86O 3CPEA 1VK0A 5A2QO 4FM0A 3T3FA 4IDHA 1IBMK 1NK0A 1MU2A 2KZZA 2VG5A 4FVMA 3D0PA 3VQ8A 5CE3A 4GW6A 5AQHA 3THXB 1X1PA 2Z1IA 3AVHA 3L6QA 1UAXA 4K41A 3LWLA 2P9LB 4PL8A 3CERA 5HRRA 4CE9A 2RN2A 5BR9A 2P9SA 5AR0A 1FXXA 4BR4A 4YFUA 1E3MA 1NK5A 3KHYA 1SL2A 1O1WA 4MLEA 1BCOA 4PKHA 4M42A 5AFUA 1OKJA 4M3UA 1GLBG 3HOTA 4N41A 2FC0A 1SZ2A 3SAHA 4LF4K 1YUWA 3D6RA 4DTJA 1W7AA 4R79A 1R59O 1S3XA 3O08A 3W3DA 5MLCQ 3QEPA 4CIEA 4B9NA 5JLHA 4M7XA 2IGIA 3V81A 3VF4A 3KK7A 4EP4A 3EYZA 4WCEL 3VQPA 4FO0A 1K8KA 4A2BA 4YOXA 2HF3A 4CJQA 4N5SA 1TKDA 2G8UA 3ZEUA 1NK7A 2AA4A 3LL3A 2UXCK 2YJFA 3SPYA 1VQ6N 2KFNA 1N8RO 2HHXA 1LWEA 1S1TA 1IG8A 1KVAA 3QEVA 2OPSA 4H03B 1CZ9A 4CK2A 3FZLA 4CJUA 2O8BA 4YORA 5LJVA 4DSKA 4EP5A 5GIOA 1IV0A 3VESA 4BRDA 4DLGA 1NU0A 1WN7A 4DQIA 1U6ZA 3WEEA 5B8HA 3LPUA 2YNGA 1RT5A 5HOOA 5AQPA 4FOEA 1EKEA 2Q0UA 4FLVA 4CFDA 4A5BA 1QSSA 4JK8A 1BIZA 3L4IA 1QVFM 3G10A 1J6ZA 2D0PA 5AQQA 5LL6Z 4OPKA 3ZSRA 1H1VA 2KHOA 3E01A 3HL8A 1S9EA 1VHXA 1ASUA 1LW2A 1RILA 4W5TA 4ILJA 1YXQA 5EX5A 3V9WA 2HHUA 4Q5VA 4CD1A 3J80O 3QICA 4IXCA 1QSYA 3ZX3A 4JKBA 2QXFA 3C95A 3F9KA 4FWQA 4DQ8A 3O4NA 4RW7A 3O3FA 1VQPN 3MN5A 4MO5A 2F8TA 1NMDA 3FE1A 3TPQA 1D9FA 3O9TA 5DM7L 4DF8A 3Q7CA 4DS5A 4FPAA 3THYA 3NF7A 3MEGA 4FJLA 4LFBK 3MWPA 5AZJB 4ID1A 5BR8K 2OCEA 2OTLN 4JEPA 4CHPA 3ZSQA 4CZMA 5FPDA 3CQXA 3ZETB 1U45A 2JWKA 2P51A 2GEMA 4FWPA 1KVCA 1OVYA 5F1XA 2P9KB 5SWMA 2QA4N 4EZ6A 4DR6K 1ZC6A 4NLBA 3HJFA 1G99A 1GOBA 3QEWA 3AVGA 3CCRN 5LMNK 3VGMA 4HVJA 1YTUA 3DJCA 4DSFA 5T7BA 3DM2A 1GLCG 2EHGA 4JNEA 3OA9A 5FPNA 1HNIA 3B6PA 1NK4A 3BGRA 3G6EN 3GG4A 3VQ4A 4CJKA 1WUAA 2HMIA 4JK7A 5M1NA 1BI4B 4WQ5A 4CIFA 3FR0A 4A5AA 5E84A 2QW9A 3WXLA 3BP8A 1NGDA 4C8LA 4ELTA 3AVJA 3D2FA 3HPHA 3AA2A 1ATNA 4OJRA 1JLEA 2V7ZA 3ZSYA 1YHQN 1NJIO 1HKCA 4DV2K 3WXMB 3CYMA 3VF6A 3IFRA 5KPRA 5ADXH 5M1OA 3JYTA 2BH1A 4CJ7A 3JAMO 2PYLA 3K5OA 4OO1J 2O8CA 2CGKA 1QSLA 3UKRB 1VQLN 2W6KA 4CJPA 2FF3B 5J2PA 1C0GA 3HI0A 4DU3A 1Z6RA 1RFQA 3NE6A 4CZJA 4HUGA 1IO2A 4NB4A 1FKOA 2Q31A 3H1VX 2IVPA 1HJOA 3FZMA 1NGAA 2O8FA 2NRZA 3OJSA 3ZX2A 4A61A 1Z05A 3AO1A 4O8KA 3QIOA 4FLTA 2IC3A 3CC7N 4DV5K 2HHQA 3RMCA 1SKWA 3ZX0A 3EE8A 3ITHA 4TSXA 1ZBHA 3GBTA 5LJWA 2VGNA 2PY5A 1NMNA 3DLKA 4KTWA 1YVNA 3TABA 3KTQA 1RDUA 4IFYA 3CQ8A 1EWQA 2HVIA 5KI6A 1BO5O 2P1JA 3C0BA 2GV9A 2BDPA 3S3MA 4C8MA 1JLCA 2VQEK 1RTJA 4K43A 1VSKA 4BDPA 4WYBA 4GV3A 3C65A 4B9TA 3DRRA 3P5JA 1L3SA 1TGOA 3L3VA 2E1ZA 4JKDA 4FZXC 2DTUA 3HM8A 1NGIA 1T05A 3THVA 4H5TA 4FK0A 3OYKA 3VEZA 3VEXA 4DR7K 2VG7A 3HTVA 2GTDA 4BDYA 1BG3A 4HHTA 4GV6A 4IG0A 2W41A 3Q7BA 4DLEA 4EZ9A 1U49A 4R5PA 1S72N 1HR0K 3C7NA 2HSTA 4CEDA 4CK3A 3SMPA 1BA1A 3CCLN 1Q18A 4DKWA 3BUZB 1D4XA 3I8DA 4LSNA 3RTVA 3ID6A 3SQ1A 3FZFA 4KTZA 5KPTA 1YJNN 3SK3A 1WOQA 4BC2A 1WSJA 3U6FA 5C24A 1K9MO 4E0DA 1WB9A 3T1AA 2NRHA 4H0XB 1RDCA 3ENOA 3OS0A 5BPNA 4BC4A 4H4OA 5BN9A 3OS2A 3L3UA 3V1QA 2A5XA 4CF9A 2O8DB 4BDZA 2DFHA 3KWIA 1EETA 3U3YA 2NRWA 4ISGA 3B8AX 4C8OA 3CJ1A 4I6MB 1D8YA 1RBRA 1N5YA 4G9ZA 1DLOA 4UQGA 3FGUA 4BRCA 4BRGA 4OPHA 2VWKA 3O4QA 1U2VB 3O3GA 3VQDA 4DU4A 4RW8A 1TL1A 3ALYA 4H5WA 3O8MA 4AF1A 2IIRA 2Y1IA 1VSFA 1XC3A 2YKMA 1U47A 5KRTA 4C8KA 1LW0A 4IOXA 5DK5A 3DLEA 4IDKA 4JD2A 4FJIA 3ZSWA 4BGBA 3U3GA 4ZHRA 2P9IB 2YX6A 3V4IA 4E1MA 4BRQA 3RMDA 1VRUA 4DV4K 1Z25A 4W5OA 3R3LA 2PYJA 3VOVA 3RWUA 3NDKA 3G25A 2D1KA 2OYQA 3VGKA 3OBYA 3O1BA 3CJ9A 4GKKK 1RT3A 1HPMA 1BUPA 3SZ2A 1K8AO 4FZZA 3ULEB 1C1BA 1OVQA 2CH6A 4DMNA 3VENA 3TSPA 4AM6A 4DU1A 3LALA 1W2BM 5K14A 3NF8A 1HNWK 3AA4A 3WNGA 4KHPK 2KTQA 3D2EA 1XWLA 2P9UB 3CCEN 4B1WB 3VEYA 3VQ9A 1CLQA 1S9GA 4B3SK 3LP1A 4OPAA 3K58A 1VSHA 4CFCA 4N56A 3P4IA 3U4LA 1S1XA 3O1WA 4X65K 3KLGA 1VSIA 2XY7A 4FJJA 3LDOA 3V1OA 4K8XA 1N6QA 1NG9A 3OYEA 1NJZA 1X3NA 4N47A 3HPOA 3EE9A 5AFUH 2FLOA 3VEOA 1C6VA 1GLJO 1HUXA 2CGLA 1J5OA 1W97L 3T7ZA 2DFFA 4HTLA 3OYBA 3KD5E 4LC9B 5J1EA 3LDPA 1JCGA 3I0RA 2D4WA 1VSEA 3FZHA 4BR5A 2O8EB 2XO7A 1NM1A 1YTAA 4ZTFA 1HQEA 3CM5A 4C23A 1R0AA 3EKUA 2BGGA 4FLWA 1QHTA 4BQZA 3SAGA 2AP1A 4ILHA 4JKAA 3TI0A 1TYQB 4CEEA 4IKFA 4C1NK 3AY9A 2A1SA 3MN7A 1SL1A 1RBTA 3FFIA 3DOLA 4DTUA 4CGIA 1Q81O 4KH5A 1NGBA 1JLAA 2OANA 1LCUA 1FW6A 3MN6A 3TU5A 4FOIA 4LH4A 1KQSM 4NCGA 4XIUA 3AO5A 1LAVA 1DEJA 1XI1A 5I3UA 3RRHA 4ICLA 4O55A 1RDBA 4PL7A 4LY7A 3MEDA 1HKBA 2GELA 2G8WA 1GLDG 5AQJA 4HUEA 1HKGA 2H3GX 1QQMA 1QQNA 3EN9A 1KTQA 2UUBK 4KO0A 1TL3A 3WNFA 1IKWA 3EZ5A 4DWIA 3N4QA 3VTHA 1WSGA 1JJ2M 1J5EK 1TKTA 3RRGA 4JKGA 4DQPA 3O9RA 3SQ2A 5BPLA 3FZKA 1UA1A 2Q0RA 3VA3A 3AVFA 2G8FA 4NO7A 4WFNL 2IVNA 4NXNK 3EL2A 4OX9K 3K57A 4BC3A 1KFDA 4JLHA 1QQOA 4JI6K 4JI7K 3WNHA 2HVHA 3RMAA 1GOAA 2P9PB 3QB0A 1NWKA 1T6CA 1NJXA 1W9HA 1L3UA 3ID8A 4B9SA 2FSJA 3KLIA 1MWKA 3KJVA 2RPIA 4IBNA 3V9UA 3T19A 3CJAA 5C12A 2B5JA 4JI2K 3QETA 1QE1A 5CZ1A 2E2NA 3SJJA 2P9NB 1C1AA 2ZJRL 1T44A 2F96A 1NBWA 4O8UA 1Q9YA 1ZBLA 2YV0X 3EO3A 4CEQA 3HXMA 4DR3K 3T69A 3C94A 2W40A 2HNDA 5AQIA 3SQ0A 1GLLO 5C10A 2A40A 3SUOA 4DFJA 2ZJQL 4NCAA 3NAEA 1LWCA 5LMUK 5J2MA 2E8AA 1YVUA 3RSEB 3WQUA 4CZLA 4KI4A 4RTFD 4DCHA 2X74A 3J7ZO 3M8PA 3F5TA 1ZXOA 1S6QA 5F2RA 1I3AA 2ASOA 3UE5A 1HYSA 5C2DA 5IT9O 2QKBA 4BR7A 4FJXA 3MWTA 4E7HA 2HHSA 5AQWA 2QWMA 3H45C 4Z4CA 1HJRA 1EXQA 5AQTA 3LP3A 5EVZA 4X66K 1BQNA 2F9TA 2NRRA 1DGKN 2OPRA 4I7FA 2FXUA 1M90O 1TAQA 4DTNA 3K59A 1HRHA 1SS6A 3QNOA 2KFZA 1RTIA 4KKOA 1TUUA 4JHDB 4CJFA 4B8CA 1BISA 3MMVA 4CERA 1EQYA 3SMSA 4FL9A 4DUYK 1JCEA 3CM6A 3NGYA 4CD3A 1VAZA 2CH5A 4M3TA 3VF2A 1KSPA 3M6GA 4CJ4A 4L8RB 4WF9L 4E7JA 4JN4A 3HO1A 3K2PA 4XH4A 4JRQA 4AHTA 4CZKA 3OS1A 1VQNN 1XNRK 1HYVA 3V1RA 4AM7A 4B1ZA 1HX1A 3TAPA 2GUIA 5FROA 5M1QA 3QESA 3RMBA 3DMJA 4H0OA 1NK8A 5JS2A 4FXDA 1JL1A 2YCHA 1NKBA 3SBTA 1Y64A 1M1KO 4WQ4C 1RGIA 2P5GA 3ULDA 4E7IA 3R9PA 1SQKA 4DFPA 4FSVA 4QS9A 3MXJA 5AQXA 1SKSA 3ZLJA 1RBVA 1VQMN 5E26A 4B9MA 4CHYA 1WAFA 2FF6A 3TTCA
chains in the Genus database with same CATH topology
4L3QA 2VGMA 3CJ7A 2ZJPL 4BRAA 3CC7N 1MWMA 3LDNA 3IUCA 5KQDA 4FWSA 3ZX0A 3EE8A 3BF3A 3GBTA 5M1FA 5LJWA 2VGNA 4DB3A 3CPWM 1YVNA 3OBWA 4BRNA 4CI6A 4QS8A 4GY2B 1RDUA 3SBGA 4BR0A 3RVCA 4CZEA 4DHYA 4E1JA 2E88A 4BG8A 3DLLL 4EHUA 3PLAA 1BO5O 3P31A 4U7BA 5F0XA 4KBOA 3O9UA 3C0BA 3E9LA 3MCPA 4IWVA 4B1VA 2EWSA 4H5VA 4PKIA 4K43A 3CMEN 1Q82O 3A5NC 2QWRA 4CZGA 4WYBA 4GV3A 1BOTO 3C65A 4U67L 3HOSA 3JS6A 3QFPA 2QWNA 3CQYA 2E1ZA 4JKDA 5CR4A 4YOVA 3HM8A 4BQLA 1NGIA 3CF5L 1VQ8N 4H5TA 5GAHP 3GOIA 4NLCA 2VYPA 5AQLA 3VEZA 3VEXA 1QZ5A 4PKGA 3HTVA 2GTDA 2Q36A 3O80A 1BG3A 4IOCL 2GX9A 3FFKB 4CBWA 4GV6A 4IJNA 2W41A 3CI5A 3Q7BA 4BRHA 4I6MA 1P90A 4BREA 3O5BA 1SAZA 3HRGA 5BRDA 3DAWA 5GAEP 3GE1A 1S72N 4EFHA 1U2VA 2F9WA 2E2QA 2HSTA 3C7NA 3PIOL 3SMPA 1BA1A 3KWGA 1Q18A 4DKWA 1GLAG 3CCLN 3BUZB 1D4XA 3AAQA 2KKZA 4KH6A 1GLFO 1V4TA 3ID6A 2A42A 2BUPA 3A5OC 1KD1O 3H6EA 2ZWHA 3FZFA 4FWMA 4MDBA 5JMVA 3R1XA 5KPTA 1YJNN 2PFUA 3SK3A 1WOQA 4BC2A 5GINA 1QZ6A 2PAVA 1K9MO 2NZTA 4YDUA 2P9IA 2IVOA 1Q7YO 4IEEA 2NRHA 3VGLA 4H0XB 3WUHA 2HMPA 4K25A 5BREA 4PHTX 3FLCO 4MO4A 4A57A 3ENOA 3S41A 3SJHA 5AQVA 3E9OA 4XH1A 3M5RA 3CCMN 3DXKA 5BPNA 4BC4A 5AQUA 3EZWA 1XUPO 5BN9A 3K9KA 4FWLA 1V4SA 1YAGA 4YDUC 1MA9B 4BR9A 1NGEA 5BRHA 2Q1NA 2QWQA 1EO1A 2A5XA 2V52B 3E66A 3CCVN 4XH5A 5JVHL 1NLVA 1ZBSA 4IOAL 4IZ9A 2BTFA 4JKFA 3ULEA 3CCSN 4CZHA 2PBDA 4YOTA 3KWIA 2KLAA 3MK6A 3QMLA 3UKUA 5KPZA 2NRWA 3D7EO 4ISGA 1VQ5N 3NVKA 3B8AX 2HBMA 5TKWA 4BRLA 2OTJN 3CJ1A 1ESVA 3AGKA 3O9QA 4I6MB 2YHXA 5EXWA 4B1UB 4RWTA 2D0OA 5I9EB 1K73O 3FGUA 4BRCA 5EY4A 4BRGA 3N4PA 2P9UA 4OPHA 1E4GT 1U2VB 3C7NB 3E9PA 4K42A 2JWLA 5AQRA 4BVPA 3CHWA 3TSUA 1BU6O 2P9NA 4H5WA 3O8MA 4AF1A 2IIRA 3HZ6A 4H0PA 3MDQA 5AZIA 4BVOA 1XC3A 2VWBA 5CHIA 3NMUA 2Q97A 4UY8O 1DT9A 3I33A 3TSQA 3DXMB 4IOXA 3IMXA 5DM6L 4JD2A 4BGBA 3DWLA 3E1YA 2FSNA 3HBTA 3MN9A 2P9IB 2YX6A 4EHTA 4BRQA 4ILGB 3VERA 3AAPA 5BPMA 4BC5A 4GNIA 3WQTA 2HBKA 1O13A 2V7YA 3R3LA 3VETA 3P38A 3VOVA 3CXCM 1YJWN 1JCFA 1KAZA 2YI1A 3D2FB 3DXKB 5FPMA 2QM1A 3A0IX 3G25A 3GL1A 2YJEA 2D1KA 1IJJA 3CJBA 3VGKA 3OBYA 4Y0WA 2P9LA 2QWLA 3CJ9A 3O1BA 4CBUA 4BY9C 1HPMA 1Q81O 1BUPA 1K8AO 4H0TB 3A8YA 3P39A 3ULEB 2DPNA 5C15A 3H46O 2CH6A 1HLUA 3C6HA 4A59A 3A5LC 3VENA 3H3NO 3TSPA 4AM6A 2VCPA 2E20A 3C6AA 3UKUB 1W2BM 2ZGZA 4H0YB 3CCUN 1TYQA 2ASPA 3CCQN 3O6WA 4FWRA 2E2OA 2NLXA 3D2EA 3H3OB 2P9UB 3CJCA 3OW2M 1NGFA 1BWFO 3H1QA 3CCEN 4B1WB 3R6MA 2GUPA 2NRVA 3VEYA 4OPAA 3PIPL 4XEIA 1VQON 5BN8A 5FPEA 5AQSA 1CZAN 4C1NI 3P4IA 4ISEA 3U4LA 5AZIB 4MDAA 3O1WA 5AQKA 4IFEA 3LDOA 4HWIA 4EIAA 1Q86O 3CPEA 1X3NA 3EE9A 5AFUH 4JD2B 2FLOA 3I56N 3VEOA 3MCAB 1GLJO 4FWNA 1KAXA 4IDHA 1HUXA 3GDQA 2CGLA 1C0FA 1W97L 1GLEG 3T7ZA 5CE3A 3CMAN 4HTLA 5AQHA 3L0QA 5EOYA 1E4FT 4LC9B 3LDPA 1JCGA 2D4WA 3FZHA 4WFAL 4BR5A 1S22A 1NM1A 3L6QA 4JAXA 4K41A 2P9LB 4CZFA 1KC8O 4PL8A 3CERA 4C23A 3EKUA 3ENHA 2V51B 2CGJA 3QFUA 1X9JA 5BR9A 2P9SA 5LY3A 3ENBA 2ASMA 5AR0A 4BR4A 2GWJA 3WT0A 4BQZA 3SAGA 3KHYA 2QWPA 4JK9A 2AP1A 3CIPA 3WXJA 4ILHA 4JKAA 2YHYA 4MLEA 4PKHA 5AQYA 1TYQB 5AFUA 1OKJA 4KH4A 2Q2RA 4C1NK 3AY9A 1GLBG 3MN7A 3HOTA 3D2EB 1SZ2A 3SAHA 1YUWA 5GAGP 3D6RA 4JKCA 4A62A 2FSKA 4R79A 4KH5A 1NGBA 3O9SA 1T3VA 1R59O 4FWKA 2OANA 1S3XA 3O08A 3W3DA 1LCUA 5MLCQ 3VTIA 5JLHA 3MN6A 4M7XA 4QS7A 2P9PA 3TU5A 3VF4A 3KK7A 4FOIA 3CETA 1KQSM 4WCEL 4YOYA 1YIJN 1ILYA 1YF5L 3VMFB 4ISFA 4FO0A 5C2FA 1DEJA 3R8EA 1K8KA 4A2BA 4FWOA 4YOXA 2HF3A 4PL7A 2I7PA 3ZEUA 1VQKN 1KXPA 1HKBA 2QEXN 2GELA 2AA4A 2E1YA 2NRTA 2WBNA 3LL3A 3M3ZA 5ELZA 1GLDG 3QBXA 4A2AA 5AQJA 5M1KA 3F9MA 2YJFA 1VQ6N 4MLHA 1HKGA 2H3GX 1QQMA 2HBLA 2J4RA 1QQNA 3CCJN 1N8RO 4B1YB 3EN9A 1IG8A 1NGJA 1QHAA 4H03B 4GVEA 4RCHA 3FZLA 3N4QA 3I8BA 3VTHA 4BRPA 3EKSA 1JJ2M 4YORA 5LJVA 2P9SB 3AGRA 1TUYA 5JLFA 4JKGA 5JICA 5GIOA 3BEXA 3VESA 3O9RA 4WQ4A 4BRDA 3I55N 3MX2A 1U6ZA 3K9JA 3WEEA 5B8HA 5AQGA 5BPLA 5AZJA 4BR2A 3A5MC 3FZKA 1VQ4N 2F7TA 4M7YA 3ZYYX 5BRFA 5HOOA 2Q0RA 5AQPA 4IJAA 4BRIA 4NO7A 4FOEA 2Q0UA 3CD6N 4WFNL 2IVNA 1NGGA 3EL2A 3ATVA 4A5BA 3W0LA 3UB5A 4JK8A 3L4IA 4BC3A 1QVFM 3RSEA 3SLCA 1DKGD 1J6ZA 1QQOA 1ATRA 3LDLA 3ZETA 2A41A 2QXLA 2D0PA 5AQOA 2P9PB 5AQQA 1VQ9N 3QB0A 1NWKA 1T6CA 2UYTA 3G4SN 1H1VA 2P9KA 3WXIA 2KHOA 3ID8A 2FSJA 1K8KB 2ZF5O 2NRXA 4ILJA 4JKEA 1YXQA 5EX5A 4EAHD 1MWKA 4YOUA 3ZEUB 2HBJA 4CD1A 2QI2A 3QICA 5GIPA 3ATUA 3CJAA 3AARA 4IXCA 5C12A 3LM2A 3ZX3A 4JKBA 3VPZA 4FWQA 2E2NA 4DQ8A 2P9NB 5JVGL 2ZJRL 1T44A 1VQPN 4IO9L 3MN5A 4MO5A 1KAYA 3KVGA 1NBWA 1NMDA 3FE1A 4O8UA 3TPQA 3O9TA 3U8XA 5DM7L 3EO3A 3Q7CA 3TTFA 3U9DA 3T69A 4FPAA 2W40A 4Z94A 4JKGB 4JKHA 5AQIA 1GLLO 4IEIA 2A40A 3MWPA 5C10A 3WEEB 5AZJB 2ZJQL 3F2KA 4JHDA 2ZGYA 1MDUB 4CBXA 4G9ZA 2OTLN 1X3MA 4JEPA 4BRKA 1P8ZA 2RE2A 3IKMA 4B9QA 4CZMA 5AQFA 2E8AA 3RSEB 3WQUA 5FPDA 2WFBA 3CQXA 3ZETB 4CZLA 4BG9A 2JWKA 2GEMA 4BROA 4RTFD 3J8AA 4FWPA 4DCHA 1OVYA 3J7ZO 5F1XA 2P9KB 5TKYA 3U9ZA 3F5TA 1ZXOA 2WC9A 3UKRA 3VEVA 2QA4N 5F2RA 1ZC6A 2ASOA 4NLBA 1G99A 3M1FA 3UE5A 4B1XB 5C2DA 3CCRN 3HSCA 3OHRA 4BR7A 3VGMA 3MWTA 3DJCA 5AQWA 3QDKA 2QWMA 3H45C 1T6DA 2NNWA 5KQ8A 1GLCG 1NGCA 4JNEA 3OA9A 3KZBA 5FPNA 4F9OA 5AQTA 5EVZA 2F9TA 2NRRA 4BRMA 1DGKN 3G6EN 3GG4A 2HOEA 3DXMA 3L4QA 1WUAA 2FXUA 1M90O 4IO8A 3TTCA 3CC2N 4JK7A 1LOTB 5M1NA 4WQ5A 3WXKA 2QTDA 3FR0A 4A5AA 1SS6A 5E84A 2GWKA 2QW9A 3WXLA 3LDQA 3BP8A 1NGDA 1TUUA 5C0YA 5HL7L 4JHDB 4FVUA 5M1PA 1YJ9N 3D2FA 3IDHA 3MMVA 1EQYA 1ATNA 4O5FA 3SMSA 4FL9A 1YI2N 2V7ZA 4YOWA 1YHQN 4M63C 1JCEA 1QVGM 1HKCA 4WQ5C 4FPBA 1NJIO 4CD3A 1VAZA 3WXMB 2CH5A 3VF6A 3IFRA 3VF2A 4H0VB 5ADXH 3O4WA 2RHKA 5KPRA 5M1OA 3M6GA 5AQNA 1BA0A 4WF9L 2BH1A 4CJ7A 4JN4A 3JXUA 4XH4A 4OO1J 4WFBL 2CGKA 2E2PA 4CZKA 1VQNN 3UKRB 1RDWX 1BDGA 4J8FA 1VQLN 4AM7A 2FF3B 4B1ZA 1C0GA 1HX1A 1NGHA 3CC4N 2A3ZA 5M1QA 3TTDA 4H0OA 2QWOA 1ATSA 3HI0A 1Z6RA 3QBWA 2I7NA 3NVMA 2WUSA 2YCHA 1RFQA 3G71N 3VEWA 4CZJA 1VQ7N 1YITN 4NB4A 2Q31A 3H1VX 3MX5A 4GV9A 5AQZA 3SBTA 1Y64A 2IVPA 2ITMA 1M1KO 4WQ4C 1RGIA 3BF1A 1HJOA 3FZMA 1NGAA 4BGAA 2YHWA 4BRFA 2NRZA 4H5RA 4CZIA 3LM9A 3R9PA 5H1SQ 5GADP 1SQKA 3ZX2A 4FSVA 4QS9A 5AQMA 5AQXA 2A6AA 5ADXA 4A61A 1Z05A 5E26A 1VQMN 4H5NA 4O8KA 3SAFA 2FF6A 1XQSC 2HF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3Q A;  3CJ7 A;  4BRA A;  1MWM A;  3LDN A;  3IUC A;  5KQD A;  4FWS A;  3ZX0 A;  3BF3 A;  3GBT A;  5LJW A;  4DB3 A;  1YVN A;  4BRN A;  4CI6 A;  4QS8 A;  4GY2 B;  4BR0 A;  4CZE A;  4E1J A;  4DHY A;  2E88 A;  4BG8 A;  4EHU A;  1BO5 O;  5F0X A;  4KBO A;  3C0B A;  3MCP A;  4IWV A;  4B1V A;  2EWS A;  4H5V A;  4PKI A;  4K43 A;  3A5N C;  2QWR A;  4CZG A;  4WYB A;  1BOT O;  3JS6 A;  3QFP A;  2QWN A;  3CQY A;  2E1Z A;  3HM8 A;  4BQL A;  1NGI A;  4H5T A;  3GOI A;  3VEZ A;  2VYP A;  5AQL A;  3VEX A;  1QZ5 A;  4PKG A;  3HTV A;  2GTD A;  2Q36 A;  3O80 A;  1BG3 A;  3FFK B;  4CBW A;  4IJN A;  2W41 A;  3CI5 A;  4BRH A;  4I6M A;  4BRE A;  3O5B A;  1SAZ A;  5BRD A;  3DAW A;  3GE1 A;  4EFH A;  1U2V A;  2F9W A;  2E2Q A;  3C7N A;  3SMP A;  1BA1 A;  1Q18 A;  1GLA G;  3BUZ B;  1D4X A;  3AAQ A;  1GLF O;  1V4T A;  2A42 A;  2BUP A;  3A5O C;  3H6E A;  2ZWH A;  3FZF A;  4FWM A;  5JMV A;  5KPT A;  3SK3 A;  1WOQ A;  4BC2 A;  1QZ6 A;  2PAV A;  2NZT A;  4YDU A;  2P9I A;  2IVO A;  2NRH A;  3VGL A;  4H0X B;  3WUH A;  2HMP A;  4K25 A;  5BRE A;  3FLC O;  4MO4 A;  3ENO A;  3S41 A;  3SJH A;  5AQV A;  4XH1 A;  3DXK A;  5BPN A;  4BC4 A;  5AQU A;  3EZW A;  1XUP O;  5BN9 A;  4FWL A;  1V4S A;  1YAG A;  4YDU C;  1MA9 B;  4BR9 A;  1NGE A;  5BRH A;  2Q1N A;  2QWQ A;  2A5X A;  2V52 B;  4XH5 A;  1NLV A;  1ZBS A;  4IZ9 A;  2BTF A;  3ULE A;  4CZH A;  2PBD A;  3MK6 A;  3QML A;  3UKU A;  5KPZ A;  3D7E O;  4ISG A;  3B8A X;  4BRL A;  3CJ1 A;  1ESV A;  4I6M B;  2YHX A;  5EXW A;  4B1U B;  4RWT A;  2D0O A;  5I9E B;  3FGU A;  4BRC A;  5EY4 A;  4BRG A;  2P9U A;  1E4G T;  1U2V B;  3C7N B;  4K42 A;  5AQR A;  4BVP A;  3CHW A;  1BU6 O;  2P9N A;  4H5W A;  3O8M A;  2IIR A;  3HZ6 A;  4H0P A;  3MDQ A;  5AZI A;  4BVO A;  1XC3 A;  2VWB A;  2Q97 A;  3I33 A;  3DXM B;  3IMX A;  4JD2 A;  4BGB A;  3DWL A;  2FSN A;  3HBT A;  3MN9 A;  2P9I B;  4EHT A;  4BRQ A;  3VER A;  3AAP A;  5BPM A;  4BC5 A;  4GNI A;  3WQT A;  3VET A;  2V7Y A;  3VOV A;  1JCF A;  1KAZ A;  2YI1 A;  3D2F B;  3DXK B;  5FPM A;  2QM1 A;  3A0I X;  3G25 A;  3GL1 A;  2YJE A;  2D1K A;  1IJJ A;  3CJB A;  3VGK A;  4Y0W A;  2P9L A;  2QWL A;  3CJ9 A;  3O1B A;  4CBU A;  1HPM A;  1BUP A;  4H0T B;  3A8Y A;  3ULE B;  2DPN A;  3H46 O;  2CH6 A;  1HLU A;  3A5L C;  3VEN A;  3H3N O;  4AM6 A;  2VCP A;  2E20 A;  3UKU B;  2ZGZ A;  4H0Y B;  1TYQ A;  2ASP A;  3O6W A;  4FWR A;  2E2O A;  2NLX A;  3D2E A;  3H3O B;  2P9U B;  3CJC A;  1NGF A;  1BWF O;  3H1Q A;  4B1W B;  3R6M A;  2GUP A;  3VEY A;  4XEI A;  5BN8 A;  5FPE A;  5AQS A;  1CZA N;  3P4I A;  4ISE A;  3U4L A;  5AZI B;  3O1W A;  5AQK A;  3LDO A;  4HWI A;  4EIA A;  1X3N A;  5AFU H;  4JD2 B;  2FLO A;  3VEO A;  1GLJ O;  4FWN A;  1KAX A;  1HUX A;  3GDQ A;  2CGL A;  1C0F A;  1GLE G;  5CE3 A;  4HTL A;  5AQH A;  3L0Q A;  5EOY A;  1E4F T;  4LC9 B;  3LDP A;  1JCG A;  2D4W A;  3FZH A;  4BR5 A;  1S22 A;  1NM1 A;  3L6Q A;  4JAX A;  4K41 A;  2P9L B;  4CZF A;  4PL8 A;  3CER A;  4C23 A;  3EKU A;  3ENH A;  2V51 B;  2CGJ A;  3QFU A;  1X9J A;  5BR9 A;  2P9S A;  5LY3 A;  5AR0 A;  2ASM A;  4BR4 A;  2GWJ A;  3WT0 A;  4BQZ A;  3KHY A;  2QWP A;  2AP1 A;  3CIP A;  3WXJ A;  4MLE A;  4PKH A;  2YHY A;  5AQY A;  1TYQ B;  5AFU A;  1OKJ A;  2Q2R A;  3AY9 A;  1GLB G;  3MN7 A;  3D2E B;  1SZ2 A;  1YUW A;  4A62 A;  2FSK A;  1NGB A;  1R59 O;  4FWK A;  2OAN A;  1S3X A;  3O08 A;  3W3D A;  1LCU A;  5JLH A;  3MN6 A;  4M7X A;  4QS7 A;  2P9P A;  3TU5 A;  3VF4 A;  4FOI A;  3CET A;  4ISF A;  4FO0 A;  1DEJ A;  3R8E A;  1K8K A;  4A2B A;  4FWO A;  2HF3 A;  4PL7 A;  2I7P A;  3ZEU A;  1KXP A;  1HKB A;  2GEL A;  2AA4 A;  2E1Y A;  3M3Z A;  3LL3 A;  4A2A A;  5ELZ A;  1GLD G;  3QBX A;  5AQJ A;  3F9M A;  2YJF A;  4MLH A;  1HKG A;  2H3G X;  1QQM A;  2J4R A;  1QQN A;  4B1Y B;  3EN9 A;  1IG8 A;  1NGJ A;  1QHA A;  4H03 B;  4RCH A;  3FZL A;  3I8B A;  4BRP A;  3EKS A;  5LJV A;  2P9S B;  1TUY A;  5JLF A;  5JIC A;  3BEX A;  3VES A;  4BRD A;  4WQ4 A;  1U6Z A;  3WEE A;  5B8H A;  5AQG A;  5BPL A;  5AZJ A;  4BR2 A;  3A5M C;  3FZK A;  4M7Y A;  5BRF A;  2Q0R A;  5AQP A;  4IJA A;  4BRI A;  4NO7 A;  4FOE A;  2Q0U A;  2IVN A;  1NGG A;  3EL2 A;  3ATV A;  3W0L A;  3UB5 A;  3L4I A;  4BC3 A;  3RSE A;  3SLC A;  1DKG D;  1J6Z A;  1QQO A;  1ATR A;  3LDL A;  3ZET A;  2A41 A;  2QXL A;  2D0P A;  5AQO A;  2P9P B;  5AQQ A;  3QB0 A;  1NWK A;  1T6C A;  2UYT A;  1H1V A;  2P9K A;  3WXI A;  2KHO A;  3ID8 A;  2FSJ A;  1K8K B;  2ZF5 O;  1YXQ A;  5EX5 A;  4EAH D;  1MWK A;  3ZEU B;  4CD1 A;  3QIC A;  3ATU A;  3CJA A;  3AAR A;  4IXC A;  3LM2 A;  3ZX3 A;  3VPZ A;  4FWQ A;  2E2N A;  4DQ8 A;  2P9N B;  1T44 A;  3MN5 A;  4MO5 A;  1KAY A;  3KVG A;  1NBW A;  1NMD A;  3FE1 A;  3TPQ A;  3U8X A;  3EO3 A;  3U9D A;  4FPA A;  2W40 A;  4Z94 A;  5AQI A;  1GLL O;  2A40 A;  3WEE B;  5AZJ B;  4JHD A;  2ZGY A;  1MDU B;  4CBX A;  1X3M A;  4BRK A;  1P8Z A;  4B9Q A;  4CZM A;  5AQF A;  2E8A A;  3RSE B;  3WQU A;  5FPD A;  3CQX A;  3ZET B;  4CZL A;  4BG9 A;  2GEM A;  4BRO A;  4RTF D;  3J8A A;  4FWP A;  4DCH A;  5F1X A;  2P9K B;  5TKY A;  3U9Z A;  3UKR A;  1ZXO A;  3VEV A;  5F2R A;  1ZC6 A;  2ASO A;  1G99 A;  3M1F A;  3UE5 A;  4B1X B;  3HSC A;  3OHR A;  4BR7 A;  3VGM A;  3DJC A;  5AQW A;  3QDK A;  2QWM A;  3H45 C;  1T6D A;  5KQ8 A;  1GLC G;  1NGC A;  4JNE A;  5FPN A;  3KZB A;  4F9O A;  5AQT A;  5EVZ A;  2F9T A;  4BRM A;  1DGK N;  3GG4 A;  2HOE A;  3DXM A;  1WUA A;  2FXU A;  4IO8 A;  1LOT B;  4WQ5 A;  3WXK A;  3FR0 A;  5E84 A;  2GWK A;  2QW9 A;  3WXL A;  3LDQ A;  3BP8 A;  1NGD A;  1TUU A;  4JHD B;  3D2F A;  3IDH A;  3MMV A;  1EQY A;  1ATN A;  4O5F A;  3SMS A;  4FL9 A;  2V7Z A;  4M63 C;  1JCE A;  1HKC A;  4WQ5 C;  4FPB A;  4CD3 A;  2CH5 A;  3VF6 A;  3IFR A;  3VF2 A;  4H0V B;  5ADX H;  3O4W A;  5KPR A;  3M6G A;  5AQN A;  1BA0 A;  4CJ7 A;  4JN4 A;  3JXU A;  4XH4 A;  2CGK A;  2E2P A;  4CZK A;  3UKR B;  1RDW X;  1BDG A;  4J8F A;  4AM7 A;  2FF3 B;  4B1Z A;  1C0G A;  1HX1 A;  1NGH A;  2A3Z A;  4H0O A;  2QWO A;  1ATS A;  3HI0 A;  1Z6R A;  3QBW A;  2I7N A;  2WUS A;  2YCH A;  1RFQ A;  3VEW A;  4CZJ A;  4NB4 A;  2Q31 A;  3H1V X;  5AQZ A;  1Y64 A;  2IVP A;  2ITM A;  4WQ4 C;  1RGI A;  3BF1 A;  1HJO A;  3FZM A;  1NGA A;  4BGA A;  2YHW A;  4BRF A;  4H5R A;  4CZI A;  3LM9 A;  3R9P A;  1SQK A;  3ZX2 A;  4FSV A;  4QS9 A;  5AQM A;  5AQX A;  2A6A A;  5ADX A;  4A61 A;  1Z05 A;  5E26 A;  4H5N A;  4O8K A;  2FF6 A;  1XQS C;  2HF4 A; 
#chains in the Genus database with same CATH topology
 2VGM A;  3HYF A;  3NF9 A;  3M8S A;  1MWM A;  3IRX A;  3BF3 A;  5M1F A;  3HP9 A;  4DB3 A;  3MXM A;  4KAZ A;  3OBW A;  3QLH A;  4AHV A;  4QS8 A;  4GY2 B;  3RVC A;  4BG8 A;  3DLL L;  4JI5 K;  3PLA A;  3P31 A;  3ZT0 A;  4MFB A;  3M8Q A;  3TAG A;  4KBO A;  3OYI A;  4CJR A;  3NBP A;  2ZE2 A;  4H4M A;  4IWV A;  4B1V A;  1SKR A;  4H5V A;  3CME N;  1Q82 O;  3PO5 A;  4DFM A;  5E41 A;  2IDO A;  3JS6 A;  1UOC A;  3SV4 A;  4Z4G A;  3CF5 L;  1NOY A;  5HBM A;  5GAH P;  1JLB A;  3D45 A;  3GOI A;  2VYP A;  4NLC A;  4DTM A;  4PKG A;  1ZYQ A;  3O80 A;  4IOC L;  3QEX A;  3OJU A;  3FFK B;  1NK6 A;  4IJN A;  3K5N A;  4NYN A;  4LD0 A;  1P90 A;  4JI8 K;  4FJH A;  5BRD A;  1N34 K;  4PY5 A;  3GE1 A;  3AA3 A;  2F9W A;  2FBX A;  3TAF A;  1TAU A;  3PIO L;  3AA5 X;  4B3M K;  1GLA G;  2KKZ A;  1FJG K;  1V4T A;  5HRN A;  3A5O C;  1KD1 O;  2ZWH A;  4FWM A;  5JMV A;  3MEE A;  1WSF A;  1QZ6 A;  2PAV A;  5GIN A;  4YDU A;  1Q7Y O;  2AJQ A;  3AVA A;  3MEC A;  2UU9 K;  3AVL A;  4HUF A;  4DS4 A;  1WLJ A;  3M5R A;  3THW A;  2R7Y A;  3DXK A;  2HHH K;  5AQU A;  2FBY A;  1V4S A;  4FLU A;  4NYF A;  3ZSO A;  1NGE A;  1EO1 A;  4CGH A;  3CCV N;  3E66 A;  5JVH L;  4JS5 A;  3OYF A;  1NLV A;  1ZBS A;  4JKF A;  1OH8 A;  1J53 A;  4LF8 K;  3CFO A;  3CCS N;  5AJ3 K;  4YOT A;  2KLA A;  5KPZ A;  4CEO A;  3LPT A;  1NKE A;  1VQ5 N;  1DTQ A;  2HBM A;  4BRL A;  1ESV A;  3AGK A;  3O9Q A;  2YHX A;  5EXW A;  2D0O A;  3P1G A;  5EY4 A;  1J54 A;  4B9V A;  2P9N A;  3ZT2 A;  2YNH A;  2D0A A;  5SZT A;  3NMU A;  2Q97 A;  4UY8 O;  4ID5 A;  1DT9 A;  3I33 A;  1ASV A;  3SUP A;  4FJG A;  2LSN A;  3IG1 A;  3PX0 A;  3DWL A;  3E1Y A;  2FSN A;  5FLX O;  3PV8 A;  4B9U A;  3AAP A;  3L2U A;  2VQF K;  2OPP A;  1O13 A;  3CXC M;  3THX A;  1YJW N;  5FPM A;  2YJE A;  3L2V A;  4DSL A;  1TK5 A;  3CJB A;  3LAM A;  4Y0W A;  2P9L A;  1RT7 A;  1RBS A;  2ATQ A;  3PX4 A;  3P39 A;  2DPN A;  5C15 A;  1S1U A;  1OH6 A;  4A59 A;  4Y1D A;  4CJL A;  3UKU B;  2HNY A;  3HM9 A;  3OYN A;  4FK2 A;  4FLZ A;  3CCQ N;  4FYD A;  4DR1 K;  2E2O A;  3H3O B;  3OW2 M;  1BWF O;  4CGD A;  3R6M A;  4PQU A;  2A1R A;  2NRV A;  3O3H A;  3OY9 A;  2P5O A;  5BN8 A;  1CZA N;  1L3T A;  4OGC A;  5AZI B;  3HVT A;  3AO2 A;  4MDA A;  2Y1J A;  3ZT1 A;  4CIG A;  4HWI A;  4DQR A;  3I56 N;  4FWN A;  1KAX A;  1C0F A;  2GBZ A;  1GLE G;  1E4F T;  4KHQ A;  4HCC A;  4Z4F A;  4WFA L;  5FRN A;  1S22 A;  3EY1 A;  1NKC A;  4CZF A;  5HRS A;  3SCX A;  3AVC A;  2CGJ A;  1X9J A;  5LY3 A;  2ASM A;  3C6T A;  4AHC A;  2GWJ A;  4LF9 K;  3H08 A;  4BE0 A;  4W5N A;  2QWP A;  4JK9 A;  4E89 A;  1J9A A;  3WXJ A;  4AHS A;  3TAE A;  2YNI A;  4KH4 A;  3RR7 A;  1JXB A;  1A5W A;  4ELV A;  4JKC A;  4A62 A;  2FSK A;  1LAW A;  4FWK A;  3OYM A;  3KK1 A;  4QS7 A;  4CFA A;  3CET A;  4YOY A;  3ZSZ A;  3NH0 A;  1BQM A;  1YF5 L;  4DV6 K;  3PUF A;  4FWO A;  2VG6 A;  3PO4 A;  2I7P A;  3OYC A;  4KRF A;  3DLB A;  3QIP A;  2QEX N;  2E1Y A;  2WBN A;  4DSE A;  3QBX A;  2QKK A;  5M1K A;  3F9M A;  3LZJ A;  1UA0 A;  2HBL A;  3DRP A;  3CCJ N;  4KHY A;  4FJ5 A;  4B1Y B;  4DFK A;  4X62 K;  4J2B A;  1QHA A;  1WAJ A;  3SQ4 A;  4E1N A;  4RCH A;  5HP1 A;  4J2A A;  4J2E A;  4CGG A;  4BRP A;  4M45 A;  3EKS A;  1BIU A;  2P9S B;  3AGR A;  1TUY A;  5JIC A;  3BEX A;  4KHW A;  4WQ4 A;  3MX2 A;  5AZJ A;  4M3X A;  4BR2 A;  3A5M C;  1VQ4 N;  4PWD A;  3ZYY X;  2RF2 A;  4BRI A;  1NGG A;  3ATV A;  3W0L A;  4CEB A;  4JV5 K;  1WBB A;  1DKG D;  3ZET A;  3LDL A;  2A41 A;  4DR5 K;  5AQO A;  4OGE A;  3ZSX A;  3G4S N;  2P9K A;  4OLB A;  4OLA A;  1K8K B;  2ZF5 O;  2NRX A;  4EAH D;  3ZEU B;  2HBJ A;  2QI2 A;  5GIP A;  2YKN A;  3ATU A;  4FJ8 A;  1WBD A;  3AAR A;  4B08 A;  2DFE A;  4GMJ B;  4LF7 K;  3LAN A;  1KLM A;  1EX4 A;  5JVG L;  3QNN A;  5HRP A;  4CHN A;  1KAY A;  1RT1 A;  2O8B B;  1BI4 A;  4FK4 A;  4W5R A;  4CCH A;  4Z94 A;  4JKH A;  2DY4 A;  4DV1 K;  4KI6 A;  4IEI A;  4CGF A;  3WEE B;  2ZGY A;  4FZY A;  4BRK A;  1P8Z A;  2RE2 A;  3IKM A;  4B9Q A;  4AHU A;  3KD1 E;  4O4G A;  4BRO A;  2Z1G A;  4F2R A;  1NK9 A;  3A2F A;  5TKY A;  3VEV A;  3UKR A;  2WC9 A;  4N76 A;  1RDD A;  4DR4 K;  3SV3 A;  3M1F A;  4DV0 K;  4B1X B;  3VA0 A;  3V9X A;  3OHR A;  1KCF A;  3QDK A;  2G8I A;  5KQ8 A;  1T6D A;  4CJV A;  3KIO A;  3KZB A;  4F9O A;  1DTT A;  4DV7 K;  2HOE A;  1VRT A;  4LF5 K;  1CXQ A;  1L5U A;  3PY8 A;  3KK2 A;  3THY B;  2GWK A;  3CG7 A;  3K0S A;  3C6U A;  5HL7 L;  1I94 K;  1WSI A;  3SI6 A;  2FBV A;  4CHQ A;  4KHU A;  4YOW A;  5KTQ A;  4M63 C;  1QVG M;  4WQ5 C;  4AH9 A;  3RR8 A;  2E6L A;  2RHK A;  2KQ2 A;  4OKJ A;  4OVL A;  3HT3 A;  4OKE A;  1BA0 A;  4C8N A;  1IBL K;  1VSD A;  4I9L A;  3IAY A;  1BDG A;  3CC4 N;  2A3Z A;  3T1Y K;  1KFS A;  4CEF A;  1ATS A;  3VQ7 A;  2WUS A;  3G71 N;  3VEW A;  4PUO A;  4J2D A;  4GV9 A;  3MX5 A;  3LWM A;  4KB0 A;  2ITM A;  2HHW A;  3QIN A;  3BF1 A;  3TAM A;  4CFB A;  4CZI A;  1B92 A;  1IKX A;  5AQM A;  2A6A A;  3SAF A;  3ISN C;  4HTU A;  1XQS C;  4O5F A;  4L3Q A;  3CJ7 A;  2ZJP L;  4JI4 K;  1QS4 A;  5DMR A;  1HMV A;  1A5V A;  4CJ3 A;  3ZT4 A;  4CEC A;  1L3V A;  1BL3 A;  4X64 K;  4BRN A;  4CES A;  4B8A B;  3SBG A;  4BR0 A;  1CZB A;  4E1J A;  4DSJ A;  1Q9X A;  4U7B A;  5F0X A;  3O9U A;  3VQQ A;  2FBT A;  2O8C B;  5J2Q A;  3MCP A;  2Z1H A;  3TAQ A;  4PKI A;  4YNQ A;  2VWJ A;  3A5N C;  2QWR A;  4CZG A;  1U48 A;  1BOT O;  3OYD A;  4U67 L;  3HOS A;  1KLN A;  3QFP A;  2QWN A;  5CR4 A;  4YOV A;  4BQL A;  2HHV A;  2O8D A;  5AQL A;  1QZ5 A;  3L2Q A;  1WSH A;  2O8F B;  4MQ3 A;  1S6P A;  3BY5 A;  2PZS A;  3CI5 A;  4BRH A;  4I6M A;  5D3G A;  4BRE A;  1ITG A;  1YT3 A;  4YHH K;  3L2R A;  1U2V A;  1VSL A;  2X6N A;  4NCB A;  3KWG A;  3AVK A;  3J7Y P;  1JKH A;  1GLF O;  4KFB A;  2A42 A;  4K8Z A;  2BUP A;  4E7K A;  4MDB A;  3R1X A;  3LP0 A;  2XRI A;  3KKS A;  4M3R A;  2NUB A;  3MXI A;  2NZT A;  3TR8 A;  2OZS A;  2P9I A;  2IVO A;  3LZI A;  1C0U A;  3KLE A;  5BRE A;  5CY4 A;  4OPJ A;  4MO4 A;  1HPZ A;  3S41 A;  3SJH A;  3AVM A;  3L8B A;  3E9O A;  4XH1 A;  3CCM N;  3BZK A;  1VSM A;  3OYH A;  4JI0 K;  1MA9 B;  4BR9 A;  4QAG A;  1QTM A;  2Q1N A;  2QWQ A;  4K0K K;  2V52 B;  3M8R A;  4XH5 A;  1IKV A;  4DR2 K;  3K5M A;  4RW4 A;  4IZ9 A;  2BTF A;  3ULE A;  2XY5 A;  2XY8 A;  4CZH A;  4M3Y A;  5CYM A;  2D0B A;  3QML A;  1HNX K;  3NVK A;  1RDA A;  1F21 A;  4NXM K;  4B1U B;  2P9U A;  1JXE A;  3G0Z A;  3E9P A;  3C7N B;  3K5L A;  2JWL A;  5AQR A;  4BVP A;  1TV6 A;  3TSU A;  2G8K A;  4IG3 A;  3I0S A;  4H0P A;  3MDQ A;  3PSF A;  3PSI A;  2O4I A;  1KVB A;  3TSQ A;  1C1C A;  3DXM B;  4CK1 A;  1OH5 A;  5C42 A;  4FJ7 A;  3IMX A;  1G15 A;  1UWB A;  3MN9 A;  4EHT A;  1S1V A;  1RTH A;  1LV5 A;  3VER A;  1SUQ A;  1C0T A;  1N33 K;  2G8V A;  4CF8 A;  1HNV A;  3P38 A;  4LF6 K;  2YI1 A;  1SV5 A;  2O8E A;  3GL1 A;  1C0M A;  5I42 A;  1Q8I A;  3J7A P;  1B9D A;  4H0T B;  3OTO K;  3C6H A;  1RTD A;  3A5L C;  1FKP A;  3DOK A;  3HVR A;  2E20 A;  3C6A A;  4H0Y B;  4FW2 A;  1OH7 A;  3CCU N;  1TYQ A;  3SUQ A;  4F2S A;  2RKI A;  3O6W A;  2NLX A;  1ZBU A;  3CJC A;  1NGF A;  3H1Q A;  2EX3 A;  3VQC A;  2GUP A;  3SPZ A;  4H8K A;  3PIP L;  4XEI A;  2WON A;  4I2P A;  5FPE A;  4KV8 A;  1HQU A;  3VQB A;  4JYA K;  2W6L A;  3V6D A;  1REV A;  4EIA A;  4JD2 B;  2KW4 A;  3MCA B;  4CJS A;  3QER A;  3GDQ A;  1SL0 A;  5CZ2 A;  2IAJ A;  4RW9 A;  1X9M A;  3CMA N;  3L0Q A;  4GVM A;  4E19 A;  5EOY A;  3HPG A;  1TK8 A;  4JAX A;  4B3R K;  3SUN A;  1KC8 O;  1JLF A;  4FJK A;  3ENH A;  2V51 B;  3QFU A;  2UUA K;  1XHZ A;  3ENB A;  1T8E A;  1A5X A;  3WT0 A;  4HCB A;  3CIP A;  1GOC A;  2YHY A;  3AV9 A;  5AQY A;  1QQC A;  2X6S A;  2XHB A;  2WOM A;  4CVN E;  2Q2R A;  2D0C A;  4DQS A;  3D2E B;  5GAG P;  3SNN A;  3HK2 A;  3O9S A;  1T3V A;  2HB5 A;  4G1Q A;  1TKX A;  4CEZ A;  4DTR A;  3VTI A;  2P9P A;  4FCY A;  1YIJ N;  1ILY A;  1TKZ A;  3VMF B;  4ISF A;  5C2F A;  4B3O A;  3R8E A;  3LDS A;  4O5B A;  1VQK N;  1KXP A;  2NRT A;  3M3Z A;  3JSM A;  4A2A A;  5ELZ A;  1X9W A;  3LAK A;  4MLH A;  2J4R A;  1KRP A;  4F3T A;  4JRP A;  1HNZ K;  1NGJ A;  4GVE A;  5KGX A;  3NH1 A;  3I8B A;  4BE2 A;  4DQQ A;  2OZM A;  3MAQ A;  5JLF A;  1D9D A;  3NGZ A;  3I55 N;  3K9J A;  4DSI A;  5AQG A;  1EP4 A;  2F7T A;  4M7Y A;  4OKK A;  5BRF A;  4IJA A;  1NNE A;  2F8S A;  3CD6 N;  4KHN A;  3F73 A;  3UB5 A;  4JI3 K;  3RSE A;  1N32 K;  3SLC A;  4CF2 A;  4LFA K;  1ATR A;  2OPQ A;  2QXL A;  4CJW A;  1VQ9 N;  2UYT A;  4DV3 K;  4FLY A;  4FLX A;  3WXI A;  3L2W A;  2WTU A;  3EEQ A;  2JLE A;  4CJE A;  3NF6 A;  3BZC A;  1XMO K;  3B6O A;  4JKE A;  4YOU A;  4RW6 A;  3ASM A;  3NCI A;  1JLQ A;  3LM2 A;  1IBK K;  1N36 K;  2JGU A;  2X78 A;  1RNH A;  3VPZ A;  4DUZ K;  4IO9 L;  5KRS A;  1EWR A;  1IKY A;  3KVG A;  3U8X A;  4YY3 K;  4O0J A;  4KRE A;  3TTF A;  3U9D A;  1S5J A;  2ETJ A;  4JKG B;  3PX6 A;  3QO9 A;  4Z4I A;  4CHO A;  1U04 A;  3F2K A;  4JHD A;  1MDU B;  4CBX A;  1X3M A;  2E6M A;  4BWJ A;  4FM1 A;  3KKR A;  2XY6 A;  5AQF A;  4Q0B A;  2WFB A;  1VSJ A;  2O4G A;  4BG9 A;  4V19 S;  5HRO A;  3KLF A;  2HNZ A;  2IOC A;  3J8A A;  3V9S A;  2ITG A;  2G8H A;  3U9Z A;  1BHL A;  1ZBF A;  3DRS A;  2HW3 A;  4B3T K;  2YHB A;  3HSC A;  4LSL A;  2UUC K;  2NNW A;  4KPY A;  1S1W A;  1NGC A;  4AIL C;  4PA1 A;  4ZTJ A;  4BRM A;  5FRM A;  2F4V K;  4CF1 A;  3OVN A;  3DXM A;  3L4Q A;  4FM2 A;  2OA8 A;  4IO8 A;  4O0I A;  3CC2 N;  1IG9 A;  1LOT B;  3WXK A;  3NGI A;  1T03 A;  4M3Z A;  2QTD A;  1D5A A;  3J81 O;  3LDQ A;  1XC9 A;  5C0Y A;  2E5L K;  3IS9 A;  4FVU A;  5M1P A;  1YJ9 N;  3IDH A;  3V9Z A;  3HST B;  1X9S A;  1YI2 N;  4RG8 A;  4GKJ K;  3LP2 A;  3OYA A;  4FPB A;  2ZQB A;  3VQE A;  4F4K A;  4H0V B;  3O4W A;  3BDP A;  5AQN A;  3QEI A;  3OYG A;  1WNS A;  3JXU A;  1NJW A;  4WFB L;  2E2P A;  1RDW X;  4QOZ B;  4J8F A;  4Y1C A;  1NGH A;  3ZCM A;  4KB1 A;  3TTD A;  5EU7 A;  1NJY A;  2QWO A;  3ZT3 A;  3QBW A;  2I7N A;  3NVM A;  4F3O A;  1VQ7 N;  1TVR A;  4B9L A;  1YIT N;  4FJN A;  5AQZ A;  3NH2 A;  3HP6 A;  4BGA A;  4BRF A;  4IFV A;  3KK3 A;  2YHW A;  4H5R A;  3LM9 A;  1WSE A;  5GAD P;  5H1S Q;  3T1H K;  5ADX A;  4CW7 B;  4DTX A;  4H5N A;  4BAC A;  2HF4 A;  1Y97 A;  1IH7 A;  4BRA A;  5FDL A;  4E3S A;  1LWF A;  3LDN A;  3IUC A;  5KQD A;  4FWS A;  3SYZ A;  1W0H A;  4CEA A;  3CPW M;  1B9F A;  5J2N A;  3OYJ A;  4CI6 A;  4CZE A;  4DHY A;  3AVN A;  2ZM6 K;  2E88 A;  2YHA A;  4EHU A;  3UIQ A;  3E9L A;  2BE2 A;  2EWS A;  3DLR A;  1HYZ A;  4BE1 A;  3CQY A;  1VQ8 N;  1XHX A;  2W42 A;  5JS1 A;  2B6A A;  3CFP A;  4Z4E A;  2ZD1 A;  2Q36 A;  4ELU A;  1JLG A;  4DF4 A;  2GX9 A;  4DTP A;  4CBW A;  4LH5 A;  3S3N A;  3VQA A;  2QK9 A;  1RBU A;  3AVI A;  1RT2 A;  3O5B A;  1SAZ A;  3HRG A;  3DAW A;  5GAE P;  2YNF A;  2UXB K;  2D5R A;  1BGX T;  4DG1 A;  4EFH A;  2UXD K;  2E2Q A;  3S3O A;  3CFR A;  1Z26 A;  3AAQ A;  4KH6 A;  3VN5 A;  3H6E A;  2BAN A;  3VQ6 A;  2PFU A;  5KGW A;  1TK0 A;  3OYL A;  2Q3S A;  4IEE A;  3VGL A;  3WUH A;  2HMP A;  1I39 A;  4K25 A;  1RT4 A;  3FLC O;  4PHT X;  3VQ5 A;  4A57 A;  4I2Q A;  5AQV A;  3TAN A;  3DLG A;  3EZW A;  1XUP O;  4WE1 A;  4Z4H A;  3K9K A;  4FWL A;  1U4B A;  1YAG A;  4YDU C;  4KTQ A;  4Z0U A;  5BRH A;  4IOA L;  5CYQ A;  1FK9 A;  2PBD A;  3MK6 A;  3DYA A;  3UKU A;  3D7E O;  2IS3 A;  5TKW A;  4KHS A;  4CJT A;  2OTJ N;  2E4L A;  4BWM A;  4RWT A;  1K73 O;  2I5J A;  5I9E B;  3N4P A;  1NOZ A;  1E4G T;  4K42 A;  4LFC K;  1BCM A;  3CHW A;  1BU6 O;  3HZ6 A;  4BVO A;  5AZI A;  2VWB A;  2B4J A;  1ASW A;  5CHI A;  4AQY K;  4CGJ A;  1K6Y A;  5DM6 L;  3HBT A;  1RT6 A;  1XNQ K;  4CJ5 A;  4ILG B;  1CXU A;  1RCH A;  5C25 A;  1JL2 A;  5BPM A;  4BC5 A;  4GNI A;  4W5Q A;  1XMQ K;  2HHT A;  3WQT A;  2HBK A;  3VET A;  2V7Y A;  4DTO A;  3AO3 A;  1JCF A;  3THW B;  1KAZ A;  3D2F B;  4M41 A;  3DXK B;  4DTS A;  2QM1 A;  3DLH A;  3A0I X;  3NHG A;  1IJJ A;  2QWL A;  4BY9 C;  4CBU A;  3NFA A;  5IWA K;  3TAR A;  3AVB A;  3A8Y A;  4M3W A;  3H46 O;  4JS4 A;  1HLU A;  3DI6 A;  1T7P A;  3H3N O;  3ZSV A;  4QCL A;  2VCP A;  2KZM A;  4CF0 A;  2ZGZ A;  4FJM A;  2ASP A;  3WNE A;  4I9Q A;  3TWH A;  4FWR A;  4FW1 A;  5HLF A;  2Z1J A;  3AO4 A;  4AHR A;  1VQO N;  5AQS A;  4C1N I;  4JI1 K;  4ISE A;  3P83 D;  5AQK A;  3KLH A;  4IFE A;  4E7L A;  4FJ9 A;  1ZBI A;  4O44 A;  4CHZ A;  3S9H A;  4F8R A;  1Q86 O;  3CPE A;  1VK0 A;  5A2Q O;  4FM0 A;  3T3F A;  4IDH A;  1IBM K;  1NK0 A;  1MU2 A;  2KZZ A;  2VG5 A;  4FVM A;  3D0P A;  3VQ8 A;  5CE3 A;  4GW6 A;  5AQH A;  3THX B;  1X1P A;  2Z1I A;  3AVH A;  3L6Q A;  1UAX A;  4K41 A;  3LWL A;  2P9L B;  4PL8 A;  3CER A;  5HRR A;  4CE9 A;  2RN2 A;  5BR9 A;  2P9S A;  5AR0 A;  1FXX A;  4BR4 A;  4YFU A;  1E3M A;  1NK5 A;  3KHY A;  1SL2 A;  1O1W A;  4MLE A;  1BCO A;  4PKH A;  4M42 A;  5AFU A;  1OKJ A;  4M3U A;  1GLB G;  3HOT A;  4N41 A;  2FC0 A;  1SZ2 A;  3SAH A;  4LF4 K;  1YUW A;  3D6R A;  4DTJ A;  1W7A A;  4R79 A;  1R59 O;  1S3X A;  3O08 A;  3W3D A;  5MLC Q;  3QEP A;  4CIE A;  4B9N A;  5JLH A;  4M7X A;  2IGI A;  3V81 A;  3VF4 A;  3KK7 A;  4EP4 A;  3EYZ A;  4WCE L;  3VQP A;  4FO0 A;  1K8K A;  4A2B A;  4YOX A;  2HF3 A;  4CJQ A;  4N5S A;  1TKD A;  2G8U A;  3ZEU A;  1NK7 A;  2AA4 A;  3LL3 A;  2UXC K;  2YJF A;  3SPY A;  1VQ6 N;  2KFN A;  1N8R O;  2HHX A;  1LWE A;  1S1T A;  1IG8 A;  1KVA A;  3QEV A;  2OPS A;  4H03 B;  1CZ9 A;  4CK2 A;  3FZL A;  4CJU A;  2O8B A;  4YOR A;  5LJV A;  4DSK A;  4EP5 A;  5GIO A;  1IV0 A;  3VES A;  4BRD A;  4DLG A;  1NU0 A;  1WN7 A;  4DQI A;  1U6Z A;  3WEE A;  5B8H A;  3LPU A;  2YNG A;  1RT5 A;  5HOO A;  5AQP A;  4FOE A;  1EKE A;  2Q0U A;  4FLV A;  4CFD A;  4A5B A;  1QSS A;  4JK8 A;  1BIZ A;  3L4I A;  1QVF M;  3G10 A;  1J6Z A;  2D0P A;  5AQQ A;  5LL6 Z;  4OPK A;  3ZSR A;  1H1V A;  2KHO A;  3E01 A;  3HL8 A;  1S9E A;  1VHX A;  1ASU A;  1LW2 A;  1RIL A;  4W5T A;  4ILJ A;  1YXQ A;  5EX5 A;  3V9W A;  2HHU A;  4Q5V A;  4CD1 A;  3J80 O;  3QIC A;  4IXC A;  1QSY A;  3ZX3 A;  4JKB A;  2QXF A;  3C95 A;  3F9K A;  4FWQ A;  4DQ8 A;  3O4N A;  4RW7 A;  3O3F A;  1VQP N;  3MN5 A;  4MO5 A;  2F8T A;  1NMD A;  3FE1 A;  3TPQ A;  1D9F A;  3O9T A;  5DM7 L;  4DF8 A;  3Q7C A;  4DS5 A;  4FPA A;  3THY A;  3NF7 A;  3MEG A;  4FJL A;  4LFB K;  3MWP A;  5AZJ B;  4ID1 A;  5BR8 K;  2OCE A;  2OTL N;  4JEP A;  4CHP A;  3ZSQ A;  4CZM A;  5FPD A;  3CQX A;  3ZET B;  1U45 A;  2JWK A;  2P51 A;  2GEM A;  4FWP A;  1KVC A;  1OVY A;  5F1X A;  2P9K B;  5SWM A;  2QA4 N;  4EZ6 A;  4DR6 K;  1ZC6 A;  4NLB A;  3HJF A;  1G99 A;  1GOB A;  3QEW A;  3AVG A;  3CCR N;  5LMN K;  3VGM A;  4HVJ A;  1YTU A;  3DJC A;  4DSF A;  5T7B A;  3DM2 A;  1GLC G;  2EHG A;  4JNE A;  3OA9 A;  5FPN A;  1HNI A;  3B6P A;  1NK4 A;  3BGR A;  3G6E N;  3GG4 A;  3VQ4 A;  4CJK A;  1WUA A;  2HMI A;  4JK7 A;  5M1N A;  1BI4 B;  4WQ5 A;  4CIF A;  3FR0 A;  4A5A A;  5E84 A;  2QW9 A;  3WXL A;  3BP8 A;  1NGD A;  4C8L A;  4ELT A;  3AVJ A;  3D2F A;  3HPH A;  3AA2 A;  1ATN A;  4OJR A;  1JLE A;  2V7Z A;  3ZSY A;  1YHQ N;  1NJI O;  1HKC A;  4DV2 K;  3WXM B;  3CYM A;  3VF6 A;  3IFR A;  5KPR A;  5ADX H;  5M1O A;  3JYT A;  2BH1 A;  4CJ7 A;  3JAM O;  2PYL A;  3K5O A;  4OO1 J;  2O8C A;  2CGK A;  1QSL A;  3UKR B;  1VQL N;  2W6K A;  4CJP A;  2FF3 B;  5J2P A;  1C0G A;  3HI0 A;  4DU3 A;  1Z6R A;  1RFQ A;  3NE6 A;  4CZJ A;  4HUG A;  1IO2 A;  4NB4 A;  1FKO A;  2Q31 A;  3H1V X;  2IVP A;  1HJO A;  3FZM A;  1NGA A;  2O8F A;  2NRZ A;  3OJS A;  3ZX2 A;  4A61 A;  1Z05 A;  3AO1 A;  4O8K A;  3QIO A;  4FLT A;  2IC3 A;  3CC7 N;  4DV5 K;  2HHQ A;  3RMC A;  1SKW A;  3ZX0 A;  3EE8 A;  3ITH A;  4TSX A;  1ZBH A;  3GBT A;  5LJW A;  2VGN A;  2PY5 A;  1NMN A;  3DLK A;  4KTW A;  1YVN A;  3TAB A;  3KTQ A;  1RDU A;  4IFY A;  3CQ8 A;  1EWQ A;  2HVI A;  5KI6 A;  1BO5 O;  2P1J A;  3C0B A;  2GV9 A;  2BDP A;  3S3M A;  4C8M A;  1JLC A;  2VQE K;  1RTJ A;  4K43 A;  1VSK A;  4BDP A;  4WYB A;  4GV3 A;  3C65 A;  4B9T A;  3DRR A;  3P5J A;  1L3S A;  1TGO A;  3L3V A;  2E1Z A;  4JKD A;  4FZX C;  2DTU A;  3HM8 A;  1NGI A;  1T05 A;  3THV A;  4H5T A;  4FK0 A;  3OYK A;  3VEZ A;  3VEX A;  4DR7 K;  2VG7 A;  3HTV A;  2GTD A;  4BDY A;  1BG3 A;  4HHT A;  4GV6 A;  4IG0 A;  2W41 A;  3Q7B A;  4DLE A;  4EZ9 A;  1U49 A;  4R5P A;  1S72 N;  1HR0 K;  3C7N A;  2HST A;  4CED A;  4CK3 A;  3SMP A;  1BA1 A;  3CCL N;  1Q18 A;  4DKW A;  3BUZ B;  1D4X A;  3I8D A;  4LSN A;  3RTV A;  3ID6 A;  3SQ1 A;  3FZF A;  4KTZ A;  5KPT A;  1YJN N;  3SK3 A;  1WOQ A;  4BC2 A;  1WSJ A;  3U6F A;  5C24 A;  1K9M O;  4E0D A;  1WB9 A;  3T1A A;  2NRH A;  4H0X B;  1RDC A;  3ENO A;  3OS0 A;  5BPN A;  4BC4 A;  4H4O A;  5BN9 A;  3OS2 A;  3L3U A;  3V1Q A;  2A5X A;  4CF9 A;  2O8D B;  4BDZ A;  2DFH A;  3KWI A;  1EET A;  3U3Y A;  2NRW A;  4ISG A;  3B8A X;  4C8O A;  3CJ1 A;  4I6M B;  1D8Y A;  1RBR A;  1N5Y A;  4G9Z A;  1DLO A;  4UQG A;  3FGU A;  4BRC A;  4BRG A;  4OPH A;  2VWK A;  3O4Q A;  1U2V B;  3O3G A;  3VQD A;  4DU4 A;  4RW8 A;  1TL1 A;  3ALY A;  4H5W A;  3O8M A;  4AF1 A;  2IIR A;  2Y1I A;  1VSF A;  1XC3 A;  2YKM A;  1U47 A;  5KRT A;  4C8K A;  1LW0 A;  4IOX A;  5DK5 A;  3DLE A;  4IDK A;  4JD2 A;  4FJI A;  3ZSW A;  4BGB A;  3U3G A;  4ZHR A;  2P9I B;  2YX6 A;  3V4I A;  4E1M A;  4BRQ A;  3RMD A;  1VRU A;  4DV4 K;  1Z25 A;  4W5O A;  3R3L A;  2PYJ A;  3VOV A;  3RWU A;  3NDK A;  3G25 A;  2D1K A;  2OYQ A;  3VGK A;  3OBY A;  3O1B A;  3CJ9 A;  4GKK K;  1RT3 A;  1HPM A;  1BUP A;  3SZ2 A;  1K8A O;  4FZZ A;  3ULE B;  1C1B A;  1OVQ A;  2CH6 A;  4DMN A;  3VEN A;  3TSP A;  4AM6 A;  4DU1 A;  3LAL A;  1W2B M;  5K14 A;  3NF8 A;  1HNW K;  3AA4 A;  3WNG A;  4KHP K;  2KTQ A;  3D2E A;  1XWL A;  2P9U B;  3CCE N;  4B1W B;  3VEY A;  3VQ9 A;  1CLQ A;  1S9G A;  4B3S K;  3LP1 A;  4OPA A;  3K58 A;  1VSH A;  4CFC A;  4N56 A;  3P4I A;  3U4L A;  1S1X A;  3O1W A;  4X65 K;  3KLG A;  1VSI A;  2XY7 A;  4FJJ A;  3LDO A;  3V1O A;  4K8X A;  1N6Q A;  1NG9 A;  3OYE A;  1NJZ A;  1X3N A;  4N47 A;  3HPO A;  3EE9 A;  5AFU H;  2FLO A;  3VEO A;  1C6V A;  1GLJ O;  1HUX A;  2CGL A;  1J5O A;  1W97 L;  3T7Z A;  2DFF A;  4HTL A;  3OYB A;  3KD5 E;  4LC9 B;  5J1E A;  3LDP A;  1JCG A;  3I0R A;  2D4W A;  1VSE A;  3FZH A;  4BR5 A;  2O8E B;  2XO7 A;  1NM1 A;  1YTA A;  4ZTF A;  1HQE A;  3CM5 A;  4C23 A;  1R0A A;  3EKU A;  2BGG A;  4FLW A;  1QHT A;  4BQZ A;  3SAG A;  2AP1 A;  4ILH A;  4JKA A;  3TI0 A;  1TYQ B;  4CEE A;  4IKF A;  4C1N K;  3AY9 A;  2A1S A;  3MN7 A;  1SL1 A;  1RBT A;  3FFI A;  3DOL A;  4DTU A;  4CGI A;  1Q81 O;  4KH5 A;  1NGB A;  1JLA A;  2OAN A;  1LCU A;  1FW6 A;  3MN6 A;  3TU5 A;  4FOI A;  4LH4 A;  1KQS M;  4NCG A;  4XIU A;  3AO5 A;  1LAV A;  1DEJ A;  1XI1 A;  5I3U A;  3RRH A;  4ICL A;  4O55 A;  1RDB A;  4PL7 A;  4LY7 A;  3MED A;  1HKB A;  2GEL A;  2G8W A;  1GLD G;  5AQJ A;  4HUE A;  1HKG A;  2H3G X;  1QQM A;  1QQN A;  3EN9 A;  1KTQ A;  2UUB K;  4KO0 A;  1TL3 A;  3WNF A;  1IKW A;  3EZ5 A;  4DWI A;  3N4Q A;  3VTH A;  1WSG A;  1JJ2 M;  1J5E K;  1TKT A;  3RRG A;  4JKG A;  4DQP A;  3O9R A;  3SQ2 A;  5BPL A;  3FZK A;  1UA1 A;  2Q0R A;  3VA3 A;  3AVF A;  2G8F A;  4NO7 A;  4WFN L;  2IVN A;  4NXN K;  3EL2 A;  4OX9 K;  3K57 A;  4BC3 A;  1KFD A;  4JLH A;  1QQO A;  4JI6 K;  4JI7 K;  3WNH A;  2HVH A;  3RMA A;  1GOA A;  2P9P B;  3QB0 A;  1NWK A;  1T6C A;  1NJX A;  1W9H A;  1L3U A;  3ID8 A;  4B9S A;  2FSJ A;  3KLI A;  1MWK A;  3KJV A;  2RPI A;  4IBN A;  3V9U A;  3T19 A;  3CJA A;  5C12 A;  2B5J A;  4JI2 K;  3QET A;  1QE1 A;  5CZ1 A;  2E2N A;  3SJJ A;  2P9N B;  1C1A A;  2ZJR L;  1T44 A;  2F96 A;  1NBW A;  4O8U A;  1Q9Y A;  1ZBL A;  2YV0 X;  3EO3 A;  4CEQ A;  3HXM A;  4DR3 K;  3T69 A;  3C94 A;  2W40 A;  2HND A;  5AQI A;  3SQ0 A;  1GLL O;  5C10 A;  2A40 A;  3SUO A;  4DFJ A;  2ZJQ L;  4NCA A;  3NAE A;  1LWC A;  5LMU K;  5J2M A;  2E8A A;  1YVU A;  3RSE B;  3WQU A;  4CZL A;  4KI4 A;  4RTF D;  4DCH A;  2X74 A;  3J7Z O;  3M8P A;  3F5T A;  1ZXO A;  1S6Q A;  5F2R A;  1I3A A;  2ASO A;  3UE5 A;  1HYS A;  5C2D A;  5IT9 O;  2QKB A;  4BR7 A;  4FJX A;  3MWT A;  4E7H A;  2HHS A;  5AQW A;  2QWM A;  3H45 C;  4Z4C A;  1HJR A;  1EXQ A;  5AQT A;  3LP3 A;  5EVZ A;  4X66 K;  1BQN A;  2F9T A;  2NRR A;  1DGK N;  2OPR A;  4I7F A;  2FXU A;  1M90 O;  1TAQ A;  4DTN A;  3K59 A;  1HRH A;  1SS6 A;  3QNO A;  2KFZ A;  1RTI A;  4KKO A;  1TUU A;  4JHD B;  4CJF A;  4B8C A;  1BIS A;  3MMV A;  4CER A;  1EQY A;  3SMS A;  4FL9 A;  4DUY K;  1JCE A;  3CM6 A;  3NGY A;  4CD3 A;  1VAZ A;  2CH5 A;  4M3T A;  3VF2 A;  1KSP A;  3M6G A;  4CJ4 A;  4L8R B;  4WF9 L;  4E7J A;  4JN4 A;  3HO1 A;  3K2P A;  4XH4 A;  4JRQ A;  4AHT A;  4CZK A;  3OS1 A;  1VQN N;  1XNR K;  1HYV A;  3V1R A;  4AM7 A;  4B1Z A;  1HX1 A;  3TAP A;  2GUI A;  5FRO A;  5M1Q A;  3QES A;  3RMB A;  3DMJ A;  4H0O A;  1NK8 A;  5JS2 A;  4FXD A;  1JL1 A;  2YCH A;  1NKB A;  3SBT A;  1Y64 A;  1M1K O;  4WQ4 C;  1RGI A;  2P5G A;  3ULD A;  4E7I A;  3R9P A;  1SQK A;  4DFP A;  4FSV A;  4QS9 A;  3MXJ A;  5AQX A;  1SKS A;  3ZLJ A;  1RBV A;  1VQM N;  5E26 A;  4B9M A;  4CHY A;  1WAF A;  2FF6 A;  3TTC A; 
#chains in the Genus database with same CATH homology
 4L3Q A;  2VGM A;  3CJ7 A;  2ZJP L;  4BRA A;  3CC7 N;  1MWM A;  3LDN A;  3IUC A;  5KQD A;  4FWS A;  3ZX0 A;  3EE8 A;  3BF3 A;  3GBT A;  5M1F A;  5LJW A;  2VGN A;  4DB3 A;  3CPW M;  1YVN A;  3OBW A;  4BRN A;  4CI6 A;  4QS8 A;  4GY2 B;  1RDU A;  3SBG A;  4BR0 A;  3RVC A;  4CZE A;  4DHY A;  4E1J A;  2E88 A;  4BG8 A;  3DLL L;  4EHU A;  3PLA A;  1BO5 O;  3P31 A;  4U7B A;  5F0X A;  4KBO A;  3O9U A;  3C0B A;  3E9L A;  3MCP A;  4IWV A;  4B1V A;  2EWS A;  4H5V A;  4PKI A;  4K43 A;  3CME N;  1Q82 O;  3A5N C;  2QWR A;  4CZG A;  4WYB A;  4GV3 A;  1BOT O;  3C65 A;  4U67 L;  3HOS A;  3JS6 A;  3QFP A;  2QWN A;  3CQY A;  2E1Z A;  4JKD A;  5CR4 A;  4YOV A;  3HM8 A;  4BQL A;  1NGI A;  3CF5 L;  1VQ8 N;  4H5T A;  5GAH P;  3GOI A;  4NLC A;  2VYP A;  5AQL A;  3VEZ A;  3VEX A;  1QZ5 A;  4PKG A;  3HTV A;  2GTD A;  2Q36 A;  3O80 A;  1BG3 A;  4IOC L;  2GX9 A;  3FFK B;  4CBW A;  4GV6 A;  4IJN A;  2W41 A;  3CI5 A;  3Q7B A;  4BRH A;  4I6M A;  1P90 A;  4BRE A;  3O5B A;  1SAZ A;  3HRG A;  5BRD A;  3DAW A;  5GAE P;  3GE1 A;  1S72 N;  4EFH A;  1U2V A;  2F9W A;  2E2Q A;  2HST A;  3C7N A;  3PIO L;  3SMP A;  1BA1 A;  3KWG A;  1Q18 A;  4DKW A;  1GLA G;  3CCL N;  3BUZ B;  1D4X A;  3AAQ A;  2KKZ A;  4KH6 A;  1GLF O;  1V4T A;  3ID6 A;  2A42 A;  2BUP A;  3A5O C;  1KD1 O;  3H6E A;  2ZWH A;  3FZF A;  4FWM A;  4MDB A;  5JMV A;  3R1X A;  5KPT A;  1YJN N;  2PFU A;  3SK3 A;  1WOQ A;  4BC2 A;  5GIN A;  1QZ6 A;  2PAV A;  1K9M O;  2NZT A;  4YDU A;  2P9I A;  2IVO A;  1Q7Y O;  4IEE A;  2NRH A;  3VGL A;  4H0X B;  3WUH A;  2HMP A;  4K25 A;  5BRE A;  4PHT X;  3FLC O;  4MO4 A;  4A57 A;  3ENO A;  3S41 A;  3SJH A;  5AQV A;  3E9O A;  4XH1 A;  3M5R A;  3CCM N;  3DXK A;  5BPN A;  4BC4 A;  5AQU A;  3EZW A;  1XUP O;  5BN9 A;  3K9K A;  4FWL A;  1V4S A;  1YAG A;  4YDU C;  1MA9 B;  4BR9 A;  1NGE A;  5BRH A;  2Q1N A;  2QWQ A;  1EO1 A;  2A5X A;  2V52 B;  3E66 A;  3CCV N;  4XH5 A;  5JVH L;  1NLV A;  1ZBS A;  4IOA L;  4IZ9 A;  2BTF A;  4JKF A;  3ULE A;  3CCS N;  4CZH A;  2PBD A;  4YOT A;  3KWI A;  2KLA A;  3MK6 A;  3QML A;  3UKU A;  5KPZ A;  2NRW A;  3D7E O;  4ISG A;  1VQ5 N;  3NVK A;  3B8A X;  2HBM A;  5TKW A;  4BRL A;  2OTJ N;  3CJ1 A;  1ESV A;  3AGK A;  3O9Q A;  4I6M B;  2YHX A;  5EXW A;  4B1U B;  4RWT A;  2D0O A;  5I9E B;  1K73 O;  3FGU A;  4BRC A;  5EY4 A;  4BRG A;  3N4P A;  2P9U A;  4OPH A;  1E4G T;  1U2V B;  3C7N B;  3E9P A;  4K42 A;  2JWL A;  5AQR A;  4BVP A;  3CHW A;  3TSU A;  1BU6 O;  2P9N A;  4H5W A;  3O8M A;  4AF1 A;  2IIR A;  3HZ6 A;  4H0P A;  3MDQ A;  5AZI A;  4BVO A;  1XC3 A;  2VWB A;  5CHI A;  3NMU A;  2Q97 A;  4UY8 O;  1DT9 A;  3I33 A;  3TSQ A;  3DXM B;  4IOX A;  3IMX A;  5DM6 L;  4JD2 A;  4BGB A;  3DWL A;  3E1Y A;  2FSN A;  3HBT A;  3MN9 A;  2P9I B;  2YX6 A;  4EHT A;  4BRQ A;  4ILG B;  3VER A;  3AAP A;  5BPM A;  4BC5 A;  4GNI A;  3WQT A;  2HBK A;  1O13 A;  2V7Y A;  3R3L A;  3VET A;  3P38 A;  3VOV A;  3CXC M;  1YJW N;  1JCF A;  1KAZ A;  2YI1 A;  3D2F B;  3DXK B;  5FPM A;  2QM1 A;  3A0I X;  3G25 A;  3GL1 A;  2YJE A;  2D1K A;  1IJJ A;  3CJB A;  3VGK A;  3OBY A;  4Y0W A;  2P9L A;  2QWL A;  3CJ9 A;  3O1B A;  4CBU A;  4BY9 C;  1HPM A;  1Q81 O;  1BUP A;  1K8A O;  4H0T B;  3A8Y A;  3P39 A;  3ULE B;  2DPN A;  5C15 A;  3H46 O;  2CH6 A;  1HLU A;  3C6H A;  4A59 A;  3A5L C;  3VEN A;  3H3N O;  3TSP A;  4AM6 A;  2VCP A;  2E20 A;  3C6A A;  3UKU B;  1W2B M;  2ZGZ A;  4H0Y B;  3CCU N;  1TYQ A;  2ASP A;  3CCQ N;  3O6W A;  4FWR A;  2E2O A;  2NLX A;  3D2E A;  3H3O B;  2P9U B;  3CJC A;  3OW2 M;  1NGF A;  1BWF O;  3H1Q A;  3CCE N;  4B1W B;  3R6M A;  2GUP A;  2NRV A;  3VEY A;  4OPA A;  3PIP L;  4XEI A;  1VQO N;  5BN8 A;  5FPE A;  5AQS A;  1CZA N;  4C1N I;  3P4I A;  4ISE A;  3U4L A;  5AZI B;  4MDA A;  3O1W A;  5AQK A;  4IFE A;  3LDO A;  4HWI A;  4EIA A;  1Q86 O;  3CPE A;  1X3N A;  3EE9 A;  5AFU H;  4JD2 B;  2FLO A;  3I56 N;  3VEO A;  3MCA B;  1GLJ O;  4FWN A;  1KAX A;  4IDH A;  1HUX A;  3GDQ A;  2CGL A;  1C0F A;  1W97 L;  1GLE G;  3T7Z A;  5CE3 A;  3CMA N;  4HTL A;  5AQH A;  3L0Q A;  5EOY A;  1E4F T;  4LC9 B;  3LDP A;  1JCG A;  2D4W A;  3FZH A;  4WFA L;  4BR5 A;  1S22 A;  1NM1 A;  3L6Q A;  4JAX A;  4K41 A;  2P9L B;  4CZF A;  1KC8 O;  4PL8 A;  3CER A;  4C23 A;  3EKU A;  3ENH A;  2V51 B;  2CGJ A;  3QFU A;  1X9J A;  5BR9 A;  2P9S A;  5LY3 A;  3ENB A;  2ASM A;  5AR0 A;  4BR4 A;  2GWJ A;  3WT0 A;  4BQZ A;  3SAG A;  3KHY A;  2QWP A;  4JK9 A;  2AP1 A;  3CIP A;  3WXJ A;  4ILH A;  4JKA A;  2YHY A;  4MLE A;  4PKH A;  5AQY A;  1TYQ B;  5AFU A;  1OKJ A;  4KH4 A;  2Q2R A;  4C1N K;  3AY9 A;  1GLB G;  3MN7 A;  3HOT A;  3D2E B;  1SZ2 A;  3SAH A;  1YUW A;  5GAG P;  3D6R A;  4JKC A;  4A62 A;  2FSK A;  4R79 A;  4KH5 A;  1NGB A;  3O9S A;  1T3V A;  1R59 O;  4FWK A;  2OAN A;  1S3X A;  3O08 A;  3W3D A;  1LCU A;  5MLC Q;  3VTI A;  5JLH A;  3MN6 A;  4M7X A;  4QS7 A;  2P9P A;  3TU5 A;  3VF4 A;  3KK7 A;  4FOI A;  3CET A;  1KQS M;  4WCE L;  4YOY A;  1YIJ N;  1ILY A;  1YF5 L;  3VMF B;  4ISF A;  4FO0 A;  5C2F A;  1DEJ A;  3R8E A;  1K8K A;  4A2B A;  4FWO A;  4YOX A;  2HF3 A;  4PL7 A;  2I7P A;  3ZEU A;  1VQK N;  1KXP A;  1HKB A;  2QEX N;  2GEL A;  2AA4 A;  2E1Y A;  2NRT A;  2WBN A;  3LL3 A;  3M3Z A;  5ELZ A;  1GLD G;  3QBX A;  4A2A A;  5AQJ A;  5M1K A;  3F9M A;  2YJF A;  1VQ6 N;  4MLH A;  1HKG A;  2H3G X;  1QQM A;  2HBL A;  2J4R A;  1QQN A;  3CCJ N;  1N8R O;  4B1Y B;  3EN9 A;  1IG8 A;  1NGJ A;  1QHA A;  4H03 B;  4GVE A;  4RCH A;  3FZL A;  3N4Q A;  3I8B A;  3VTH A;  4BRP A;  3EKS A;  1JJ2 M;  4YOR A;  5LJV A;  2P9S B;  3AGR A;  1TUY A;  5JLF A;  4JKG A;  5JIC A;  5GIO A;  3BEX A;  3VES A;  3O9R A;  4WQ4 A;  4BRD A;  3I55 N;  3MX2 A;  1U6Z A;  3K9J A;  3WEE A;  5B8H A;  5AQG A;  5BPL A;  5AZJ A;  4BR2 A;  3A5M C;  3FZK A;  1VQ4 N;  2F7T A;  4M7Y A;  3ZYY X;  5BRF A;  5HOO A;  2Q0R A;  5AQP A;  4IJA A;  4BRI A;  4NO7 A;  4FOE A;  2Q0U A;  3CD6 N;  4WFN L;  2IVN A;  1NGG A;  3EL2 A;  3ATV A;  4A5B A;  3W0L A;  3UB5 A;  4JK8 A;  3L4I A;  4BC3 A;  1QVF M;  3RSE A;  3SLC A;  1DKG D;  1J6Z A;  1QQO A;  1ATR A;  3LDL A;  3ZET A;  2A41 A;  2QXL A;  2D0P A;  5AQO A;  2P9P B;  5AQQ A;  1VQ9 N;  3QB0 A;  1NWK A;  1T6C A;  2UYT A;  3G4S N;  1H1V A;  2P9K A;  3WXI A;  2KHO A;  3ID8 A;  2FSJ A;  1K8K B;  2ZF5 O;  2NRX A;  4ILJ A;  4JKE A;  1YXQ A;  5EX5 A;  4EAH D;  1MWK A;  4YOU A;  3ZEU B;  2HBJ A;  4CD1 A;  2QI2 A;  3QIC A;  5GIP A;  3ATU A;  3CJA A;  3AAR A;  4IXC A;  5C12 A;  3LM2 A;  3ZX3 A;  4JKB A;  3VPZ A;  4FWQ A;  2E2N A;  4DQ8 A;  2P9N B;  5JVG L;  2ZJR L;  1T44 A;  1VQP N;  4IO9 L;  3MN5 A;  4MO5 A;  1KAY A;  3KVG A;  1NBW A;  1NMD A;  3FE1 A;  4O8U A;  3TPQ A;  3O9T A;  3U8X A;  5DM7 L;  3EO3 A;  3Q7C A;  3TTF A;  3U9D A;  3T69 A;  4FPA A;  2W40 A;  4Z94 A;  4JKG B;  4JKH A;  5AQI A;  1GLL O;  4IEI A;  2A40 A;  3MWP A;  5C10 A;  3WEE B;  5AZJ B;  2ZJQ L;  3F2K A;  4JHD A;  2ZGY A;  1MDU B;  4CBX A;  4G9Z A;  2OTL N;  1X3M A;  4JEP A;  4BRK A;  1P8Z A;  2RE2 A;  3IKM A;  4B9Q A;  4CZM A;  5AQF A;  2E8A A;  3RSE B;  3WQU A;  5FPD A;  2WFB A;  3CQX A;  3ZET B;  4CZL A;  4BG9 A;  2JWK A;  2GEM A;  4BRO A;  4RTF D;  3J8A A;  4FWP A;  4DCH A;  1OVY A;  3J7Z O;  5F1X A;  2P9K B;  5TKY A;  3U9Z A;  3F5T A;  1ZXO A;  2WC9 A;  3UKR A;  3VEV A;  2QA4 N;  5F2R A;  1ZC6 A;  2ASO A;  4NLB A;  1G99 A;  3M1F A;  3UE5 A;  4B1X B;  5C2D A;  3CCR N;  3HSC A;  3OHR A;  4BR7 A;  3VGM A;  3MWT A;  3DJC A;  5AQW A;  3QDK A;  2QWM A;  3H45 C;  1T6D A;  2NNW A;  5KQ8 A;  1GLC G;  1NGC A;  4JNE A;  3OA9 A;  3KZB A;  5FPN A;  4F9O A;  5AQT A;  5EVZ A;  2F9T A;  2NRR A;  4BRM A;  1DGK N;  3G6E N;  3GG4 A;  2HOE A;  3DXM A;  3L4Q A;  1WUA A;  2FXU A;  1M90 O;  4IO8 A;  3TTC A;  3CC2 N;  4JK7 A;  1LOT B;  5M1N A;  4WQ5 A;  3WXK A;  2QTD A;  3FR0 A;  4A5A A;  1SS6 A;  5E84 A;  2GWK A;  2QW9 A;  3WXL A;  3LDQ A;  3BP8 A;  1NGD A;  1TUU A;  5C0Y A;  5HL7 L;  4JHD B;  4FVU A;  5M1P A;  1YJ9 N;  3D2F A;  3IDH A;  3MMV A;  1EQY A;  1ATN A;  4O5F A;  3SMS A;  4FL9 A;  1YI2 N;  2V7Z A;  4YOW A;  1YHQ N;  4M63 C;  1JCE A;  1QVG M;  1HKC A;  4WQ5 C;  4FPB A;  1NJI O;  4CD3 A;  1VAZ A;  3WXM B;  2CH5 A;  3VF6 A;  3IFR A;  3VF2 A;  4H0V B;  5ADX H;  3O4W A;  2RHK A;  5KPR A;  5M1O A;  3M6G A;  5AQN A;  1BA0 A;  4WF9 L;  2BH1 A;  4CJ7 A;  4JN4 A;  3JXU A;  4XH4 A;  4OO1 J;  4WFB L;  2CGK A;  2E2P A;  4CZK A;  1VQN N;  3UKR B;  1RDW X;  1BDG A;  4J8F A;  1VQL N;  4AM7 A;  2FF3 B;  4B1Z A;  1C0G A;  1HX1 A;  1NGH A;  3CC4 N;  2A3Z A;  5M1Q A;  3TTD A;  4H0O A;  2QWO A;  1ATS A;  3HI0 A;  1Z6R A;  3QBW A;  2I7N A;  3NVM A;  2WUS A;  2YCH A;  1RFQ A;  3G71 N;  3VEW A;  4CZJ A;  1VQ7 N;  1YIT N;  4NB4 A;  2Q31 A;  3H1V X;  3MX5 A;  4GV9 A;  5AQZ A;  3SBT A;  1Y64 A;  2IVP A;  2ITM A;  1M1K O;  4WQ4 C;  1RGI A;  3BF1 A;  1HJO A;  3FZM A;  1NGA A;  4BGA A;  2YHW A;  4BRF A;  2NRZ A;  4H5R A;  4CZI A;  3LM9 A;  3R9P A;  5H1S Q;  5GAD P;  1SQK A;  3ZX2 A;  4FSV A;  4QS9 A;  5AQM A;  5AQX A;  2A6A A;  5ADX A;  4A61 A;  1Z05 A;  5E26 A;  1VQM N;  4H5N A;  4O8K A;  3SAF A;  2FF6 A;  1XQS C;  2HF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...