4DQ8A

Crystal structure of acetate kinase acka from mycobacterium marinum
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
380
structure length
373
Chain Sequence
b'NRVVLVLNSGSSSLKFQLVEPDSGMSRATGNIERIPDHDAALRRVFEILAEDDIDLQSCGLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVPHIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLHLGNGASASAVAGGRPVETSMGLTPLEGLVMGTRSGDLDPGVIGYLWRTAKLGVDEIESMLNHRSGMLGLAGERDFRRLRAMIDDGDPAAELAYDVFIHRLRKYVGAYLAVLGHTDVVSFTAGIGEHDAAVRRDTLAGMAELGISLDERRNACPSGGARRISADDSPVTVLVIPTNEELAIARHCCSVLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
molecule tags Transferase
source organism Mycobacterium marinum
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
total genus 124
structure length 373
sequence length 380
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4dq8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4dq8A02
2A6AA 4JNEA 3UKRA 4A61A 3LM9A 5BN8A 1V4SA 2YJFA 4BRIA 5FPEA 3UB5A 2QWQA 4BRNA 1Q18A 1G99A 3D2FA 4BRCA 4PKHA 4RCHA 4A62A 3FFKB 5BPNA 1QQOA 3VF6A 4BC3A 3EKUA 5BPLA 3H46O 3CQYA 3R9PA 5AQKA 4CJ7A 3AAQA 2A5XA 3CQXA 4JAXA 4B1UB 4DQ8A 1IG8A 4H0VB 3WEEB 4FPBA 1RGIA 1BA1A 1BUPA 2P9UA 1CZAN 1NGDA 3C7NB 4ISGA 3QMLA 1YUWA 2P9SB 3FZMA 4BC5A 2E2PA 1ATSA 1NBWA 2BUPA 2ZF5O 3HBTA 5BRHA 3L4IA 1DEJA 4MLEA 1GLFO 4FWNA 4FWSA 3VPZA 1KAXA 3U8XA 3ZETA 2V52B 5TKYA 2ASMA 4FL9A 4CZFA 1T6CA 2E20A 1XUPO 4GY2B 3O8MA 3VOVA 3EKSA 1LCUA 2F9TA 4O5FA 3U4LA 1NGAA 4YDUA 4BG9A 4BRAA 4JHDB 4BQLA 2Q2RA 3CI5A 4BR4A 2HF4A 1ATRA 2V7YA 5AQXA 4BRLA 2OANA 3G25A 4MLHA 4BR7A 5AQTA 3UE5A 5KQ8A 3DAWA 1NGCA 2H3GX 1S3XA 4FWRA 2A40A 2I7NA 2NRHA 1BA0A 3QFPA 3AY9A 3GBTA 3SK3A 2ITMA 3ULEB 3BF1A 1QZ5A 1V4TA 2W40A 1Z05A 2QW9A 1C0GA 4H5WA 1ZXOA 3H45C 4K25A 2F9WA 2QWLA 3U9ZA 4BR0A 1YAGA 4AM7A 3BEXA 3P4IA 2AP1A 2CGJA 3VEYA 1GLLO 3LDNA 1NGIA 3I33A 3B8AX 2FLOA 4H0XB 4CZGA 2P9SA 5AZJB 3FLCO 5AQOA 4B1YB 4BR9A 1JCEA 5EOYA 2D1KA 1T6DA 3DWLA 4M7YA 4XH4A 3CJCA 5AQWA 1T44A 4FO0A 2CH5A 3WQTA 3H3OB 3FZKA 3BP8A 3A8YA 2QXLA 4C23A 2GEMA 4BR2A 3TPQA 5KPRA 2YJEA 4BROA 4B9QA 5ELZA 4CZLA 3VGKA 3KVGA 3SMPA 1HJOA 1BG3A 2V51B 1QQNA 3OHRA 4EHTA 1H1VA 5AQPA 4HWIA 5AQVA 3JS6A 3HM8A 3ENHA 5AQIA 2P9PA 2Q31A 4XEIA 3FGUA 3VEXA 4XH1A 2D4WA 4MO5A 4CZMA 5F1XA 2FSNA 4EFHA 2QWPA 3MK6A 2A41A 3D2EB 2FSKA 3L6QA 4QS9A 1HKBA 5AQRA 3SMSA 2GUPA 4PKGA 3ATUA 3ZETB 4A2AA 1ATNA 3QB0A 3IFRA 3QBWA 1K8KA 1RFQA 5AQFA 3EL2A 1KAYA 5AZJA 2E88A 3O08A 3DJCA 4EAHD 5KPZA 2E1YA 5LJWA 3KHYA 4JHDA 3IUCA 3M1FA 3ENOA 3ULEA 1K8KB 3H1QA 1XC3A 4WQ4A 4BGBA 3WUHA 2IVOA 4I6MB 4Y0WA 2DPNA 3WXKA 1HKCA 3EZWA 4H5RA 3JXUA 3DXKB 2E2NA 5AQNA 1BO5O 1SAZA 4WQ5C 4PL7A 5LJVA 2FF3B 2FF6A 4FWKA 4K42A 4YDUC 4GNIA 2Q97A 4WQ4C 4I6MA 3VEVA 4IWVA 3AARA 3GOIA 5BPMA 1SQKA 2QM1A 3HZ6A 3O1WA 3MN9A 4M63C 3VGLA 4BRKA 1NLVA 5EX5A 2YHYA 3HTVA 1R59O 2P9NB 5AR0A 2WUSA 3EO3A 4CZKA 3O80A 1NGHA 2J4RA 5AZIB 4RWTA 1E4FT 4CZJA 2V7ZA 1IJJA 2P9LB 3A0IX 3ZEUA 5KQDA 2FXUA 4K43A 3LM2A 2D0OA 1NGBA 2VCPA 5AQQA 5ADXA 3CIPA 3RSEA 5F2RA 4WQ5A 4BRDA 4CZEA 3GDQA 4CBUA 5KPTA 3WXIA 3LDLA 5JLHA 3IDHA 1X3MA 2NLXA 3RSEB 4B1WB 1TYQB 3SJHA 4K41A 4JD2A 1GLEG 3VF2A 2P9IA 2YHXA 3ZX2A 5BREA 5AFUH 5F0XA 5E84A 1BWFO 4H0TB 5B8HA 2ZWHA 1GLAG 3QICA 2HF3A 4JD2B 3J8AA 2D0PA 3MN6A 1YVNA 2NZTA 3M6GA 3VEZA 3HSCA 1MDUB 1EQYA 2BTFA 4IO8A 4BRGA 1SZ2A 3H3NO 3A5OC 3ID8A 4PKIA 2Q1NA 4O8KA 1Y64A 5JICA 1X9JA 4BC2A 4H03B 4B1VA 5AQYA 4BRMA 3FE1A 4QS8A 5CE3A 2QWMA 4CBWA 2YI1A 3UKRB 3QDKA 3D7EO 5AZIA 5AQGA 5BRFA 1BOTO 4H5VA 5E26A 2IVPA 3M3ZA 1S22A 4J8FA 1JCFA 4EHUA 5AQUA 1NGJA 4BC4A 3WQUA 4IXCA 2GELA 1NGGA 4M7XA 5EY4A 2P9KB 5AQZA 3ZX0A 3MN7A 4RTFD 3GE1A 1YXQA 2Q36A 4QS7A 3H6EA 4CD3A 1TYQA 2UYTA 4FWPA 3IMXA 5AQJA 3U9DA 3VGMA 3LDQA 2ASPA 2CGKA 4B1ZA 3CERA 4AM6A 3KZBA 1GLBG 3CJBA 3TU5A 2HMPA 1ESVA 4XH5A 1MA9B 2E2OA 4ISFA 3AAPA 2I7PA 5AQHA 3VETA 1WUAA 5AQLA 1QZ6A 5JLFA 1P8ZA 2EWSA 5BR9A 4FWMA 3R8EA 1NGEA 3F9MA 3CETA 3D2EA 3QFUA 4BQZA 2YCHA 1OKJA 2IIRA 2E1ZA 4CBXA 1DGKN 4H0PA 2QWRA 4FOEA 3CJ1A 4E1JA 1GLDG 4DB3A 3DXMA 3H1VX 1BU6O 3MCPA 5JMVA 3MDQA 4BRFA 3GG4A 1C0FA 2GWKA 3BUZB 4FWLA 3DXMB 3O6WA 5AQMA 3O1BA 3I8BA 2E2QA 1U6ZA 2QWOA 4FSVA 3DXKA 4BR5A 3LDPA 2YHWA 2AA4A 3QBXA 2VYPA 3VERA 4PL8A 4L3QA 3A5MC 3O4WA 3LDOA 3SLCA 3R6MA 4EIAA 2ZGZA 3FR0A 4IJAA 2Q0RA 3BF3A 4FPAA 3MMVA 5BRDA 5FPNA 3ZEUB 4IZ9A 1NGFA 1QQMA 3A5NC 5BN9A 3VEOA 3ZX3A 1HKGA 3W0LA 3UKUB 3WEEA 4FWOA 3W3DA 5I9EB 2HOEA 4BRHA 4CZIA 5LY3A 3GL1A 1HX1A 1U2VA 2P9NA 2CH6A 1LOTB 3C0BA 3FZFA 2A3ZA 1DKGD 3FZLA 2P9LA 3HI0A 4A2BA 1GLJO 2PBDA 3CJ7A 3A5LC 1J6ZA 5FPDA 2ASOA 4WYBA 2ZGYA 1HUXA 3ATVA 5FPMA 4B1XB 1TUUA 1ZC6A 1X3NA 4DHYA 1KXPA 4CD1A 1MWMA 2A42A 4FWQA 2GWJA 2KHOA 4H0YB 4BRPA 3CJAA 1NM1A 2P9IB 1Z6RA 1WOQA 2PAVA 4H0OA 5ADXH 1HPMA 4BVPA 5EXWA 4CZHA 5AFUA 1RDWX 4DCHA 3D2FB 3S41A 4BVOA 3UKUA 2W41A 3FZHA 1ZBSA 4LC9B 1KAZA 4MO4A 3LL3A 2QWNA 3EN9A 3WXJA 2GTDA 3O5BA 2CGLA 5AQSA 5EVZA 1JCGA 1MWKA 3MN5A 4IJNA 1XQSC 4NB4A 3CHWA 4FOIA 1NWKA 1GLCG 2P9PB 4Z94A 4HTLA 3VESA 1NMDA 4JN4A 1D4XA 4H5NA 4BRQA 1U2VB 2FSJA 3WT0A 1QHAA 3WXLA 4F9OA 1HLUA 1TUYA 3VEWA 3VF4A 4BG8A 4ISEA 4BGAA 2IVNA 2P9UB 2Q0UA 3C7NA 4BREA 4CI6A 2VWBA 4H5TA 3VENA 1BDGA 1E4GT 3L0QA 3CJ9A 4NO7A 2P9KA 2E8AA 4KBOA
chains in the Genus database with same CATH superfamily
3UKRA 4JNEA 2O8DA 2AJQA 4A61A 4R79A 2YJFA 2OPPA 4FJ8A 4FLVA 4KO0A 4DV1K 1Q18A 2JLEA 3Q7CA 4WF9L 2IC3A 1N5YA 4BC3A 1CZBA 3EKUA 3VQ8A 5BPLA 1JLCA 4JKEA 3SYZA 3CQXA 4KTQA 1EO1A 3PSIA 5JVHL 4FPBA 4YHHK 4ILHA 1NK0A 1BUPA 2NRWA 5LL6Z 5FROA 3OYKA 2Y1IA 3QMLA 2HHXA 3MECA 2E2PA 3CCMN 2BUPA 2ZF5O 3K58A 1N34K 3C65A 5KI6A 4FWSA 4E0DA 3QINA 2G8FA 2HHVA 2E20A 3EKSA 1OVQA 1J9AA 3J7YP 3U4LA 3RVCA 4UY8O 2Q2RA 4W5TA 3KKSA 4Z4EA 3PSFA 5A2QO 5AQXA 1TK8A 2OANA 3G25A 5GAHP 4BR7A 2Z1JA 3SQ4A 1W2BM 3O4QA 2XY8A 4KI6A 5KQ8A 3DAWA 1XHZA 1JL2A 4FWRA 1W97L 1J54A 2NRHA 4AHRA 5GINA 1BA0A 2ATQA 3AVIA 3NE6A 3SAHA 3QFPA 3LPUA 3BF1A 1LWEA 1V4TA 4M41A 3C6UA 5MLCQ 3F73A 3THVA 1X9SA 3P39A 3LWLA 4CJLA 4IFEA 2KZMA 3EZ5A 3LDNA 2KZZA 1X1PA 2A1SA 4M3UA 4DSFA 1VSDA 3I33A 3B8AX 4CZGA 2P9SA 5AZJB 2VWJA 1KQSM 5C10A 2D1KA 4CGDA 1T6DA 2O4GA 3DWLA 4M7YA 1T03A 3CJCA 4DQSA 1I94K 3K5MA 2CH5A 3H3OB 2WOMA 1G15A 4Y1DA 3TPQA 3O3GA 3SMPA 2UUAK 1WSFA 1HR0K 2DFHA 1N36K 3CCLN 3OHRA 1VSFA 4EHTA 3O3FA 1KSPA 5AQIA 3NCIA 2Q31A 3D6RA 3F2KA 1UA0A 1YIJN 3SUPA 4JI2K 2QWPA 1ASWA 1GOAA 4JK7A 4JKFA 1NK5A 4LF8K 4E7KA 2P5GA 1HKBA 3T69A 2IAJA 3THYA 3HOTA 3SQ2A 1KFDA 4DSEA 1HNWK 4DLEA 3IFRA 1NJWA 3QBWA 3CCUN 4OKEA 3SV4A 3THYB 1KVCA 3DJCA 5KPZA 2OCEA 5LJWA 3THWB 4ZTFA 3KHYA 1S1WA 4JHDA 1VHXA 4LFBK 3ZLJA 2DY4A 3ULEA 3H1QA 1XC3A 3SAFA 1IG9A 4WQ4A 4NXNK 1TK0A 3M8SA 1HKCA 3RMAA 5HBMA 5LMUK 3SBGA 2XY5A 3JXUA 3CCQN 4X62K 4WQ5C 1TGOA 5LJVA 2FF6A 1EWRA 4FWKA 4GNIA 1S1VA 4I6MA 2UXDK 1YJNN 2YKMA 3G0ZA 4IWVA 3RWUA 4Q5VA 3GOIA 3TTFA 3C6AA 4V19S 3HZ6A 4BDZA 4M63C 3ZSXA 4KB1A 3HXMA 4BRKA 2HHSA 1NLVA 2YHYA 3O9TA 4M42A 3K5LA 2WUSA 3KKRA 4H4OA 4Z4HA 4CGHA 4OPAA 4B9NA 1BI4B 3ZEUA 4K43A 3ZT3A 3CIPA 1OH7A 3A2FA 3ZT4A 4WQ5A 2A1RA 1L3SA 4BRDA 3CF5L 2HB5A 4CBUA 3HK2A 3CCEN 2JWKA 1QSLA 4OPJA 3IDHA 3DLRA 1ZBIA 3HVTA 4DSKA 4B1WB 2OPSA 3SJHA 3S3OA 1CLQA 4JD2A 3ITHA 4GVEA 2P9IA 3T19A 4JI8K 4JV5K 4H0TB 3L8BA 3D45A 3TAMA 5B8HA 1O13A 4GV9A 1ZBFA 1A5XA 2D0PA 3OY9A 1RTDA 2QEXN 2NZTA 4M3RA 1JLFA 3J7ZO 4FW1A 3AVLA 4CJFA 3MX2A 4IO8A 1C1BA 4DQIA 3Q7BA 3A5OC 4PKIA 3N4PA 3TAEA 4O8KA 1Y64A 1DLOA 4DTUA 2NRVA 4CJRA 4QS8A 5C15A 5CE3A 4CF1A 2NRRA 4CGGA 3UKRB 4DU4A 4M45A 4GKJK 5DM6L 1RBRA 4FJJA 4EHUA 1KLMA 1TKTA 2RHKA 3SUOA 4EZ6A 3WQUA 1ZBUA 4JK8A 3L2WA 3DM2A 4ID1A 3V4IA 2P9KB 5AQZA 4CK2A 4YOVA 3VA0A 3GE1A 1YXQA 2E5LK 4K0KK 1QS4A 1U04A 3I56N 3ZSZA 2WONA 3U9DA 2UYTA 3IMXA 5AQJA 3LDQA 4KAZA 3LP1A 4ILJA 3VQBA 3OYJA 1WBDA 2HMPA 4CJPA 3E66A 3OJSA 4JKGB 1BIZA 4CECA 4DV3K 3QETA 1QZ6A 1RT2A 5JLFA 3G4SN 4N41A 4OPKA 3ZT0A 1VRUA 3F9MA 4BQZA 1B9FA 1TKZA 3NMUA 1NG9A 4BDPA 3P38A 4CEZA 3AGRA 4CW7B 2KTQA 1S1XA 2GWKA 4TSXA 1RNHA 2VQEK 2HVIA 1U6ZA 2D0AA 4FSVA 1D5AA 5BR8K 3NF8A 2PFUA 3DXKA 3P83D 4KHNA 4ELUA 2F8TA 3S9HA 2W6KA 1VQON 3RR7A 4Z4IA 4EIAA 3ULDA 4DTOA 3OS0A 4IJAA 3SQ1A 1T8EA 4CHNA 3MMVA 3TI0A 3ZEUB 4OGCA 4KB0A 5SZTA 4FCYA 1VQ8N 2WTUA 3ZX3A 3W0LA 3W3DA 1EXQA 1IBLK 3HRGA 3C0BA 4DU1A 1NMNA 3O3HA 4FJXA 3SAGA 4LF6K 3A5LC 1J6ZA 3DLKA 1KC8O 4FVUA 2FBVA 4AQYK 3I55N 4JI7K 3J81O 4DHYA 4CF2A 2A42A 2YNHA 4RW9A 1JL1A 4FWQA 3WNFA 3VMFB 3CJAA 3V9XA 1Z6RA 1WOQA 2PAVA 1YJ9N 1HPMA 2DFFA 5C24A 3S41A 4BVOA 1I39A 1ILYA 1ZBSA 4LC9B 4JLHA 3RMCA 1NK8A 2QWNA 4KTZA 1E3MA 1FJGK 4OVLA 4C8NA 3QESA 4C8LA 1KFSA 1SL2A 2G8UA 3AVNA 3CHWA 4KHYA 1B92A 4HTLA 3P31A 1VQ9N 5FRMA 4H5NA 3TTCA 4FJHA 3CFPA 1U2VB 3WT0A 4DR3K 3R1XA 2UUBK 2IVNA 2P9UB 3K2PA 2VWBA 1NJIO 2NRTA 2OYQA 2A6AA 3IKMA 4WFBL 3LM9A 3OYAA 1V4SA 3UB5A 1C0MA 4CFDA 4DTNA 3VQCA 3D2FA 1VQLN 4RCHA 1S9EA 4E7HA 3AA4A 1QQOA 3PIOL 2HW3A 1ITGA 3CFOA 4CJ7A 4IOCL 3AAQA 4AH9A 4CCHA 4JAXA 2Z1IA 4FVMA 1IG8A 4JYAK 3WEEB 1RGIA 2OPQA 1EP4A 4C1NK 5HRNA 1YF5L 4JKDA 2P9UA 1CZAN 1NGDA 1NK4A 2HMIA 5JS1A 2ZJRL 1JLEA 4MFBA 2P9SB 2JGUA 2WFBA 4BC5A 4FM0A 1ATSA 3HBTA 5BRHA 3AO4A 3L4IA 1DEJA 1GLFO 4E1MA 1KAXA 3ZETA 5TKYA 2GX9A 2QTDA 1T6CA 4DQRA 3NF7A 3VOVA 1W9HA 4O5FA 4YDUA 4BRAA 3O9SA 4FLTA 1VQ4N 1XWLA 1FKOA 3CI5A 1ATRA 3C95A 4MLHA 2B5JA 4B9UA 3IS9A 4FZXC 3NVKA 1ASUA 4F2SA 4HCCA 3THXA 3HVRA 2I7NA 3HJFA 4F4KA 1EETA 3GBTA 1IKXA 1QZ5A 2W40A 3SPZA 1Z05A 4H5WA 5E41A 1N32K 3HT3A 4K25A 2F9WA 2QWLA 4BR0A 1QVFM 3P4IA 1RDUA 1VK0A 2R7YA 3VEYA 2KW4A 4OLAA 3HL8A 3O9QA 2ZJQL 5EU7A 1ZYQA 5KGXA 1RT3A 1GOBA 3VQ7A 5AQOA 4B1YB 4DFMA 3NH2A 5AQWA 1RBVA 4FO0A 4BWMA 4CF0A 1VQ5N 1J53A 2Z1HA 3H08A 5KRSA 2HNZA 4C23A 2W6LA 4JS4A 5KPRA 3CCRN 3IG1A 5ELZA 4CZLA 2OPRA 5GADP 3THWA 1HJOA 2V51B 1QQNA 1A5VA 3NHGA 1VQKN 4CHZA 3HP6A 1Q82O 3T3FA 2P9PA 4HVJA 1TL3A 3OYLA 1NK9A 4OX9K 4MO5A 4CGIA 4CZMA 3VQAA 4EFHA 5J2PA 1OH8A 1BGXT 5H1SQ 4C1NI 2OZMA 4CFCA 5J1EA 4DV6K 3ATUA 2FBYA 1JLGA 2NNWA 4K8ZA 4YOXA 1Q9YA 3WNEA 1RFQA 2EX3A 3N4QA 3UIQA 3EL2A 3IRXA 4LF7K 3AVGA 2E1YA 2YX6A 3DMJA 4KHSA 4DSLA 4YNQA 4M3ZA 3SV3A 2UU9K 2IVOA 1TL1A 4H4MA 4CHQA 3PV8A 4CESA 2E2NA 1C0TA 5AQNA 4YOUA 1BO5O 4KV8A 3VTHA 2FF3B 2VQFK 2Q97A 4WQ4C 3ZT2A 3SPYA 3AARA 4N47A 4B8CA 2QM1A 3DLLL 1RDAA 3O1WA 4JK9A 4PY5A 1WSJA 4U7BA 4DR7K 4C8MA 3CCJN 1TVRA 1R59O 1VSLA 3OYCA 2P9NB 5AR0A 2OTLN 5C12A 3EO3A 2QKBA 4CZKA 3DLGA 4JI5K 5AZIB 4RWTA 3QNNA 3AO2A 3PO5A 4OKKA 3RMDA 5I3UA 1IJJA 2P9LB 4A5BA 2FXUA 3E9LA 3M8RA 1FXXA 4HTUA 1NGBA 5AQQA 5ADXA 2G8HA 4CEDA 3HP9A 3CMAN 3V9SA 1WSEA 3GDQA 1S9GA 4IO9L 2F7TA 3AVKA 1R0AA 1VRTA 3RSEB 1OH6A 1RT7A 3TTDA 3AVMA 1L3VA 4GW6A 1GLEG 3O4NA 3ZX2A 3FFIA 1LW0A 5E84A 2IDOA 1X9MA 1NKEA 1YTUA 1GLAG 3QICA 1NOZA 4JD2B 3J8AA 3MN6A 4W5QA 3BDPA 4NYFA 1MDUB 2BTFA 4DV0K 2O4IA 2BDPA 2HSTA 1ASVA 3CMEN 3ID8A 2Q1NA 2HHTA 4BRMA 3QEPA 3FE1A 4DMNA 5M1KA 3QDKA 1RTIA 5BRFA 2IVPA 4B08A 3M3ZA 1S22A 3VQ9A 1I3AA 1NGJA 3K9JA 1NGGA 3G10A 4M7XA 5CY4A 1OH5A 1VSEA 3MN7A 2X6SA 4RTFD 3V9UA 2Q36A 3LAMA 3OBYA 3V81A 3E1YA 4QS7A 2WBNA 4CD3A 3AVHA 1TYQA 2O8DB 3VGMA 2ASPA 4YOWA 3SJJA 3CERA 2RN2A 4ILGB 1SS6A 3KZBA 4PUOA 3LDSA 2FBXA 3HPHA 4ISFA 4B9SA 2B6AA 2I7PA 1VQ6N 3K57A 4F3TA 1NKCA 3LP3A 4CVNE 2O8BA 1P8ZA 2EWSA 3NGZA 3RRHA 3CC2N 1C0UA 5JS2A 4CERA 3CETA 3D2EA 4LH4A 1NKBA 1UWBA 3DRRA 3QEWA 4FJMA 3HM9A 4FJGA 4CBXA 3LAKA 4H0PA 1HNVA 4B3SK 3CJ1A 4DB3A 4FLZA 3H1VX 1Y97A 4CK3A 3ZYYX 4JRQA 3MDQA 1N33K 4DV4K 3BUZB 4FWLA 4AHUA 5AQMA 4DTXA 4A5AA 4DQQA 3I8BA 4CHOA 2E2QA 1C6VA 3SUNA 4CJKA 4BR5A 4DTSA 2YHWA 3QBXA 4PL8A 4XIUA 3SLCA 3O4WA 4U67L 4CF8A 3FR0A 4CJVA 3BF3A 1RBUA 3KWIA 4FZZA 4DR6K 5DK5A 1CXUA 1SL1A 1VAZA 4DF8A 1NGFA 3A5NC 4FJ9A 4FWOA 1KLNA 4Z0UA 5I9EB 4CZIA 4FXDA 3GL1A 5D3GA 1U2VA 2P9NA 4W5RA 1B9DA 1VSIA 1NJXA 1DKGD 3FZLA 4WFNL 3ZCMA 4A2BA 2PBDA 5SWMA 4M3XA 4W5NA 1VSKA 4WYBA 2ZGYA 4IBNA 3ATVA 5FPMA 2Y1JA 1TUUA 2QA4N 3V1RA 5J2QA 3C6TA 4CD1A 2BGGA 4CJ3A 2GWJA 4CJWA 1WNSA 4B9MA 4H0OA 4HCBA 2NRXA 1RDWX 3JYTA 4DCHA 4H8KA 5C0YA 4CJEA 4CGJA 4FJLA 3I0RA 3FZHA 3EYZA 1L3TA 4O8UA 3G6EN 3LL3A 2I5JA 3V1QA 3CXCM 2GTDA 1D8YA 4FM2A 3O5BA 2CGLA 4KHPK 3MN5A 4WE1A 1XQSC 5M1OA 2X78A 1NWKA 1SKSA 4Z4GA 1S6PA 3M8QA 1NMDA 4DR1K 1D4XA 1SUQA 4O5BA 3OYBA 2W42A 3RRGA 3TAPA 3U3GA 2RKIA 1MU2A 3WXLA 3QNOA 1TUYA 4JI3K 4PHTX 4CEAA 1VSMA 1LWCA 1BDGA 4O0IA 1NK7A 1E4GT 4NO7A 5GIPA 2E8AA 3DI6A 1XHXA 5BN8A 1L3UA 4BRIA 4J2AA 3TR8A 4EP4A 3F9KA 4BRNA 1U45A 2HNDA 2G8KA 1UA1A 4BRCA 4PKHA 4NCGA 5CHIA 3VF6A 3TWHA 3CQYA 3QLHA 2RPIA 5AQKA 3QO9A 4AHVA 3OA9A 4B1UB 4PWDA 3KJVA 4IDHA 1WB9A 1BA1A 5C42A 3E9PA 1YUWA 3CYMA 4JKAA 5DM7L 3FZMA 3PX6A 1Q81O 3RR8A 4MLEA 1WSGA 3VPZA 1WBBA 3U8XA 3NAEA 4CZFA 4RW8A 3ZT1A 4ICLA 3MEGA 4GY2B 3O8MA 1N6QA 1LCUA 2F9TA 4BG9A 1FW6A 1NGAA 4PQUA 1VQ7N 3HPGA 4MDBA 3KTQA 3RTVA 4BE2A 5GIOA 4N56A 4BR4A 4BRLA 1JKHA 3TANA 2OA8A 5AQTA 3UE5A 1NGCA 4KHWA 1XC9A 3KWGA 1EX4A 2A40A 5CYMA 1XNRK 3SK3A 3ULEB 1RTJA 2ITMA 4O0JA 2F4VK 1GOCA 5C25A 5HLFA 1C0GA 3ENBA 3ISNC 1ZXOA 3NBPA 3H45C 3AVBA 1IKWA 3K9KA 2IGIA 4AM7A 4OO1J 2AP1A 4CEOA 3SQ0A 3BZCA 1Z25A 1GLLO 4RG8A 2FLOA 1Z26A 4IG3A 3NF6A 1HMVA 3K5OA 4XH4A 4KH5A 3V9ZA 1TAQA 1T44A 1LW2A 4I9QA 1EKEA 3AA2A 2XHBA 4Z4FA 3WQTA 3T1HK 3FZKA 2QXLA 2GEMA 3VQDA 4FLWA 2YJEA 2ZM6K 3VGKA 3KVGA 1RT6A 4GMJB 3NGIA 4IEIA 5CZ1A 4FK4A 4DV7K 4MDAA 4OLBA 1H1VA 2BE2A 5AQPA 3HM8A 1TKDA 5FLXO 4CEQA 3FGUA 2O8BB 3VEXA 4XH1A 2D4WA 3OYEA 1HYSA 5F1XA 1FKPA 1QTMA 3D2EB 4KRFA 1ZBLA 5AQRA 3LWMA 1W7AA 4FLUA 4PKGA 5C2DA 3PIPL 1WAJA 2EHGA 4JKHA 3ZETB 3KLEA 3LZJA 1WSHA 4A2AA 4AILC 3QB0A 1HRHA 1K8KA 5CYQA 5AZJA 1NU0A 3P1GA 3IUCA 3ENOA 3LP2A 4FJ7A 1K8KB 4CK1A 5IT9O 4BGBA 3WUHA 4Y0WA 4IG0A 4WCEL 3EZWA 4H5RA 4CIGA 2O8FB 1T05A 3AA5X 3DXKB 1D9FA 2B4JA 4DTMA 5HROA 3ZSYA 4K42A 4YDUC 1X9WA 1HYVA 1OVYA 1RDCA 2ETJA 2QI2A 3B6OA 3ZSQA 3VEVA 1ZBHA 3K5NA 5BPMA 1SQKA 3AVJA 4N5SA 3OYNA 3OJUA 1DTTA 1IKYA 3MN9A 2ITGA 3OW2M 5JVGL 1JXEA 3HTVA 1YTAA 4B3OA 3VQEA 4O55A 3MX5A 3CC4N 4CZJA 2V7ZA 5KQDA 4IOAL 2D0OA 2VCPA 3CPWM 1QVGM 3RSEA 1T7PA 4HHTA 4LF9K 2O8EB 1BQMA 4CZEA 4M3YA 2E4LA 5KPTA 5GAEP 4G1QA 5JLHA 5GAGP 3HPOA 1X3MA 2NLXA 4NLCA 4AHCA 2LSNA 3VF2A 5IWAK 3MXJA 2YHXA 5BREA 4DR2K 5AFUH 1TK5A 2ZJPL 5HRSA 3G71N 2ZWHA 1VQNN 4BY9C 3MWPA 4M3WA 4KPYA 2HF3A 1XMOK 1YVNA 2KKZA 4CIEA 3SNNA 2IOCA 3VEZA 3VQ6A 3HSCA 4JKBA 2WC9A 3EE8A 1EQYA 4FW2A 1SZ2A 3VQQA 1YJWN 4ID5A 4CEEA 1JLQA 5JICA 4AHSA 1X9JA 4H03B 3ZSOA 4B1VA 5AQYA 1XMQK 4KKOA 2QWMA 3I0SA 4JI1K 5AZIA 1CZ9A 4DTPA 5AQGA 4H5VA 5DMRA 2P5OA 2G8IA 4YOYA 1S5JA 3VQ5A 3MXIA 2KQ2A 2VG7A 4J2BA 3OTOK 3ZX0A 5HP1A 4UQGA 3L4QA 3H6EA 4J2DA 2CGKA 4AM6A 1GLBG 3TU5A 4CEFA 3V9WA 2E2OA 2XRIA 3AAPA 3L3VA 4O4GA 4DTRA 5AQHA 1LWFA 1WUAA 5AQLA 2ZE2A 1RT5A 1BISA 3BGRA 4OGEA 5BR9A 2HVHA 4FWMA 3R8EA 1NGEA 4W5OA 5C2FA 1BCOA 3QFUA 4LD0A 2Z1GA 5HRRA 2IIRA 2E1ZA 4CEBA 4BE1A 4OKJA 4E1JA 4JS5A 3CFRA 2NRZA 3DXMA 1BU6O 3OS2A 2XY7A 3QEIA 3SZ2A 4C8KA 5JMVA 1YHQN 4DKWA 4BRFA 2KFNA 2YHBA 3DXMB 3O6WA 1IBKK 3EE9A 3O1BA 1A5WA 1NOYA 2QWOA 4LH5A 2OZSA 1CXQA 1YITN 3TAFA 3LDPA 3VERA 1K8AO 4DQPA 4DS4A 4L3QA 3KK3A 3LDOA 4YFUA 1RT4A 2Q0RA 2O8EA 3F5TA 3KLIA 1BIUA 4Y1CA 4FK0A 5FPNA 4G9ZA 2DTUA 4IZ9A 3PX4A 4JKGA 4A59A 5BN9A 3VEOA 2E6LA 3SI6A 1IO2A 4NLBA 4JI0K 3WEEA 3OYHA 3CD6N 2HOEA 4BRHA 4GKKK 3VTIA 5LY3A 3S3NA 1U4BA 4CF9A 3L3UA 1M90O 1YT3A 2IS3A 1YI2N 3O9UA 2A3ZA 4X64K 1BI4A 3HI0A 1T3VA 1GLJO 1JLAA 4CE9A 3CJ7A 1DTQA 3QIPA 1HNIA 3HOSA 4HUFA 3WNHA 1HUXA 2HHHK 4DLGA 4B1XB 2HHUA 1REVA 1WSIA 1MWMA 2YNFA 2F96A 3HSTB 2JWLA 2KHOA 4H0YB 4I2QA 1NM1A 1QSSA 4CZHA 1JLBA 3T1YK 4I2PA 3UKUA 1RDDA 2W41A 4CGFA 3ID6A 3K0SA 3QEVA 3NVMA 4MO4A 4KH6A 1S1TA 4Z4CA 1NJZA 3TAQA 3DLHA 4IJNA 1YVUA 4FOIA 4CHYA 4E1NA 3NDKA 2X6NA 2P9PB 5HRPA 2GV9A 3VESA 4BRQA 2FSJA 3I8DA 1K73O 4F9OA 3VA3A 3VEWA 1KVBA 3VF4A 4BG8A 3SCXA 3O9RA 3AVCA 1HNZK 2VWKA 4BREA 3C7NA 1BHLA 4H5TA 3L0QA 3TSQA 3C94A 4KBOA 4MQ3A 4IFVA 5FPEA 3THXB 4NCAA 2QWQA 2UXCK 4LFAK 3E01A 3MAQA 1G99A 1P90A 4A62A 3FFKB 5BPNA 5FDLA 4LSLA 3ZSVA 3H46O 3CG7A 3R9PA 1RCHA 4ZHRA 3AO1A 2A5XA 4CJSA 4DQ8A 4H0VB 4E3SA 2HHWA 3SBTA 3OYDA 3U3YA 4QAGA 1KTQA 4JI4K 3C7NB 4FJIA 4DSJA 4ISGA 1QSYA 3AO5A 5KRTA 1EWQA 5J2MA 2RE2A 4CJUA 3NGYA 4CFAA 3DLBA 1NBWA 2BANA 4LF4K 5M1QA 4FWNA 2V52B 1K6YA 2ASMA 4FL9A 4LSNA 3CCVN 1XUPO 3MXMA 3DRSA 1U49A 4JHDB 4AHTA 4BQLA 4JI6K 4E89A 4CIFA 3ZSWA 2RF2A 2HF4A 2V7YA 2PZSA 4JKCA 1S1UA 4IDKA 1Q86O 3P5JA 4E7LA 1TAUA 1QQCA 2H3GX 1WAFA 1S3XA 3ZSRA 4B3RK 2E6MA 4I7FA 3R3LA 2O8CB 2HBJA 5TKWA 3T1AA 3JAMO 3AY9A 2KFZA 4KHUA 2QW9A 3OBWA 3OVNA 1JJ2M 3S3MA 1VQMN 2QK9A 3EY1A 1KD1O 3U9ZA 3KK2A 1YAGA 3BEXA 1Q7YO 4B8AB 2CGJA 2D0BA 2HHQA 1NGIA 4DG1A 1IKVA 2DFEA 1C1AA 3ASMA 4DSIA 4KREA 3L2VA 3NF9A 4H0XB 1FK9A 3FLCO 4BR9A 1JCEA 2X74A 5EOYA 1XI1A 1UOCA 2PYJA 1F21A 3HO1A 3PY8A 5FRNA 2FC0A 4FZYA 4GV6A 2O8FA 3BP8A 3A8YA 3DLEA 4BR2A 4DF4A 4RW7A 4BROA 1SKRA 4B9QA 4BDYA 2HBKA 1BG3A 4LFCK 3AGKA 2QXFA 5AQVA 4HWIA 4CFBA 3JS6A 4EP5A 3ENHA 4ELVA 4XEIA 3MEDA 3BZKA 1XNQK 3PLAA 4KI4A 3MWTA 4DUZK 3J7AP 2FSNA 3MK6A 4GVMA 2A41A 2YNGA 3PUFA 3KD1E 2FSKA 3BY5A 1O1WA 3TSUA 3L6QA 4QS9A 3TABA 3OYFA 3SMSA 4DUYK 2XO7A 2GUPA 4B9LA 3HYFA 4DR5K 5CZ2A 4IEEA 1ATNA 5I42A 4FLXA 5AQFA 1NJYA 1KAYA 2E88A 3O08A 4EAHD 2FBTA 3M1FA 3AV9A 4KTWA 4BWJA 4AF1A 2VG5A 3CPEA 4QOZB 4LY7A 4HUGA 4NXMK 4CJQA 2YHAA 4I6MB 2DPNA 2VG6A 3WXMB 3WXKA 1K9MO 1SAZA 4FK2A 4PL7A 2YNIA 4E19A 1L5UA 2HNYA 1KVAA 3LP0A 4R5PA 3ALYA 3VGLA 1BL3A 5EX5A 5K14A 2G8WA 3OYGA 4E7IA 3NH0A 2O8CA 3O80A 1NGHA 2J4RA 4FM1A 1NNEA 1E4FT 2P51A 4DV2K 4B3MK 3A0IX 2Q3SA 3SUQA 1VSHA 4PA1A 3LM2A 5F2RA 3WXIA 3KD5E 2ZD1A 3AVAA 3LDLA 5CR4A 3TSPA 1NK6A 4CHPA 2OTJN 1TYQB 4K41A 3KK7A 1WLJA 4N76A 5J2NA 4X65K 5F0XA 3JSMA 3VQ4A 1IBMK 4DFJA 1KRPA 1BWFO 1RTHA 2QKKA 4NCBA 4DFPA 3TAGA 3OYIA 4OPHA 3IAYA 3B6PA 3K59A 3M6GA 3WNGA 3PO4A 4A57A 2NUBA 4BRGA 3DOKA 3H3NO 3CM6A 3AA3A 4DU3A 5M1PA 1J5EK 4JRPA 4BC2A 1SKWA 1U47A 3LANA 4FJKA 3CQ8A 4CBWA 2YI1A 1BQNA 1N8RO 3D7EO 1HJRA 1BOTO 4EZ9A 2UUCK 2PY5A 4O44A 5E26A 4FYDA 5AJ3K 1S6QA 1Q8IA 4J8FA 1JCFA 3EEQA 5AQUA 1DT9A 3MEEA 4CJTA 4YY3K 4BC4A 4IXCA 2GELA 5EY4A 3QERA 1BCMA 4CJ5A 4KH4A 4FWPA 2UXBK 5T7BA 2G8VA 4B1ZA 1W0HA 4J2EA 5LMNK 4X66K 3CJBA 2PYLA 2F8SA 2YKNA 3VN5A 1ESVA 4XH5A 4DV5K 1MA9B 4L8RB 4DTJA 3KK1A 1QHTA 3VETA 4F3OA 4YORA 4Q0BA 4YOTA 1C1CA 1IH7A 3DYAA 3M8PA 2GUIA 1UAXA 2YCHA 1OKJA 4LF5K 3DRPA 5M1FA 3QEXA 4QCLA 1DGKN 4ZTJA 1LV5A 2QWRA 1TV6A 4FOEA 4OJRA 1GLDG 1RT1A 4BE0A 4FJNA 5M1NA 3MCPA 4KHQA 3GG4A 1C0FA 1LAVA 4F8RA 1LAWA 1RILA 3QIOA 4DS5A 3DOLA 2XY6A 4ELTA 4M3TA 1HPZA 2AA4A 1KCFA 3L2QA 4DWIA 2VYPA 1HQEA 3L2UA 3KLFA 3A5MC 3J80O 3R6MA 3AO3A 3KLGA 2D5RA 2ZGZA 1U48A 1RDBA 4I9LA 4E7JA 2GBZA 4CJ4A 4BACA 4FPAA 5BRDA 2YV0X 1RBTA 5KTQA 3T7ZA 1QQMA 1HNXK 1VQPN 3CC7N 1HKGA 2KLAA 3UKUB 3V6DA 2VGMA 3OS1A 4K8XA 3PX0A 1HX1A 2CH6A 1LOTB 3CCSN 3FZFA 3KLHA 4FJ5A 3LZIA 4JEPA 2P9LA 1JXBA 5FPDA 1M1KO 4B9VA 3RMBA 3M5RA 2ASOA 3NH1A 4GV3A 3TARA 3NFAA 3OYMA 1ZC6A 4DR4K 1X3NA 1SL0A 1KXPA 1RBSA 2HBLA 3C6HA 3L2RA 1S72N 4F2RA 4FLYA 4BRPA 2VGNA 2P9IB 1IV0A 3V1OA 5ADXH 4BVPA 5EXWA 3U6FA 2BH1A 5AFUA 3D2FB 5HOOA 4IFYA 1HYZA 2P1JA 5KGWA 1KAZA 5HL7L 3AVFA 3EN9A 3WXJA 4IKFA 1WN7A 3VQPA 5AQSA 5EVZA 1JCGA 1MWKA 3LALA 4NYNA 4NB4A 1QE1A 4IOXA 1GLCG 4Z94A 4HUEA 4JN4A 1VSJA 3D0PA 4DFKA 1SV5A 3CM5A 3LPTA 4C8OA 3MCAB 4RW4A 1QHAA 2ZQBA 1HLUA 1J5OA 4B3TK 4RW6A 4ISEA 1Q9XA 3KIOA 1HQUA 4BGAA 2Q0UA 2D0CA 2HBMA 4CI6A 3VENA 1TKXA 1D9DA 4B9TA 3CJ9A 2P9KA 4WFAL 4KFBA 3E9OA
chains in the Genus database with same CATH topology
2A6AA 4JNEA 3UKRA 3IKMA 4A61A 3LM9A 4WFBL 4R79A 5BN8A 1V4SA 2YJFA 4BRIA 5FPEA 3UB5A 2QWQA 4BRNA 1Q18A 3Q7CA 1G99A 3D2FA 4BRCA 4WF9L 1P90A 4PKHA 1VQLN 4RCHA 4A62A 3FFKB 5CHIA 5BPNA 1QQOA 3VF6A 4BC3A 3PIOL 3EKUA 5BPLA 3H46O 4JKEA 3CQYA 3R9PA 5AQKA 4CJ7A 4IOCL 3AAQA 2A5XA 3CQXA 3OA9A 4JAXA 4B1UB 4DQ8A 1IG8A 4H0VB 1EO1A 5JVHL 3SBTA 4FPBA 3WEEB 1RGIA 4IDHA 4C1NK 1BA1A 4ILHA 1YF5L 4JKDA 1BUPA 2NRWA 1CZAN 1NGDA 2P9UA 3C7NB 3E9PA 2ZJRL 4ISGA 3QMLA 1YUWA 2P9SB 4JKAA 2RE2A 2WFBA 3FZMA 4BC5A 5DM7L 2E2PA 3CCMN 1ATSA 1NBWA 1Q81O 2BUPA 2ZF5O 3HBTA 5BRHA 3L4IA 5M1QA 1DEJA 4MLEA 1GLFO 3C65A 4FWNA 4FWSA 3VPZA 1KAXA 3U8XA 3ZETA 2V52B 5TKYA 2ASMA 2GX9A 2QTDA 4FL9A 1T6CA 4CZFA 2E20A 3CCVN 1XUPO 4GY2B 3O8MA 3VOVA 3EKSA 1LCUA 2F9TA 4O5FA 3RVCA 1NGAA 4YDUA 3O9SA 3U4LA 4BG9A 4JHDB 4MDBA 4BRAA 1VQ4N 1VQ7N 4BQLA 2Q2RA 3CI5A 5GIOA 4BR4A 2HF4A 1ATRA 2V7YA 5AQXA 4BRLA 2OANA 3G25A 4JKCA 5GAHP 4MLHA 4BR7A 5AQTA 1W2BM 3NVKA 3UE5A 5KQ8A 1Q86O 3DAWA 1NGCA 2H3GX 1S3XA 3KWGA 4FWRA 1W97L 2A40A 3R3LA 2HBJA 2I7NA 5GINA 2NRHA 5TKWA 1BA0A 3SAHA 3QFPA 3AY9A 3GBTA 3SK3A 2ITMA 3ULEB 3BF1A 1QZ5A 1V4TA 2W40A 1Z05A 2QW9A 1C0GA 3ENBA 3OBWA 4H5WA 1JJ2M 1VQMN 1ZXOA 5MLCQ 3H45C 4K25A 1KD1O 2F9WA 3P39A 2QWLA 3U9ZA 4BR0A 1QVFM 1YAGA 3K9KA 3BEXA 3P4IA 4AM7A 2AP1A 1Q7YO 1RDUA 4IFEA 2CGJA 4OO1J 3VEYA 1GLLO 3LDNA 1NGIA 3I33A 3O9QA 2ZJQL 3B8AX 2FLOA 4H0XB 4CZGA 2P9SA 5AZJB 3FLCO 5AQOA 4B1YB 1KQSM 4BR9A 1JCEA 5EOYA 5C10A 2D1KA 1T6DA 3DWLA 4M7YA 4XH4A 3CJCA 4KH5A 5AQWA 1T44A 4FO0A 1VQ5N 2CH5A 3WQTA 3H3OB 4GV6A 3FZKA 3BP8A 3A8YA 2QXLA 4C23A 2GEMA 4BR2A 3TPQA 5KPRA 2YJEA 3CCRN 4BROA 4B9QA 5ELZA 4CZLA 3VGKA 3KVGA 2HBKA 5GADP 3SMPA 1HJOA 1BG3A 2V51B 4IEIA 1QQNA 3CCLN 3AGKA 3OHRA 4EHTA 4MDAA 1H1VA 5AQPA 4HWIA 5AQVA 3JS6A 3HM8A 1VQKN 1Q82O 3ENHA 5AQIA 2P9PA 2Q31A 4XEIA 3D6RA 3FGUA 3F2KA 3VEXA 4XH1A 1YIJN 2D4WA 4MO5A 3PLAA 3MWTA 4CZMA 5F1XA 2FSNA 4EFHA 2QWPA 3MK6A 2A41A 3D2EB 4JK7A 4JKFA 2FSKA 3TSUA 3L6QA 4QS9A 1HKBA 5H1SQ 5AQRA 3SMSA 4C1NI 3T69A 2GUPA 3HOTA 4PKGA 3ATUA 5C2DA 3PIPL 4IEEA 4JKHA 3ZETB 2NNWA 4A2AA 1ATNA 3QB0A 3IFRA 4YOXA 3QBWA 1K8KA 1RFQA 3CCUN 3N4QA 5AQFA 3EL2A 1KAYA 5AZJA 2E88A 3O08A 3DJCA 4EAHD 5KPZA 2E1YA 2YX6A 5LJWA 3KHYA 4JHDA 3IUCA 3M1FA 3ENOA 4AF1A 3CPEA 3ULEA 1K8KB 3H1QA 1XC3A 3SAFA 4WQ4A 4BGBA 3WUHA 2IVOA 4I6MB 4Y0WA 4WCEL 2DPNA 3WXKA 1HKCA 3EZWA 3WXMB 4H5RA 3SBGA 3JXUA 3CCQN 3DXKB 1K9MO 2E2NA 5AQNA 4YOUA 1BO5O 1SAZA 4WQ5C 3VTHA 4PL7A 5LJVA 2FF3B 2FF6A 4FWKA 4K42A 4YDUC 4GNIA 1OVYA 2Q97A 2QI2A 4WQ4C 4I6MA 1YJNN 3VEVA 4IWVA 3AARA 3GOIA 3TTFA 5BPMA 3C6AA 1SQKA 2QM1A 3DLLL 3HZ6A 3O1WA 4JK9A 3MN9A 4M63C 3VGLA 4U7BA 3OW2M 4BRKA 5JVGL 1NLVA 5EX5A 2YHYA 3O9TA 3HTVA 3CCJN 1R59O 2P9NB 5AR0A 2OTLN 2WUSA 5C12A 3EO3A 4CZKA 3O80A 1NGHA 2J4RA 5AZIB 4RWTA 3MX5A 3CC4N 1E4FT 4CZJA 2V7ZA 4OPAA 1IJJA 2P9LB 3A0IX 3ZEUA 5KQDA 4A5BA 2FXUA 3E9LA 4K43A 4IOAL 3LM2A 2D0OA 1NGBA 2VCPA 5AQQA 5ADXA 3CIPA 3CPWM 1QVGM 3RSEA 5F2RA 4WQ5A 3CMAN 4BRDA 4CZEA 3CF5L 3GDQA 4CBUA 5KPTA 5GAEP 3WXIA 3CCEN 2JWKA 5CR4A 3LDLA 3TSPA 5JLHA 4IO9L 5GAGP 2F7TA 3IDHA 1X3MA 2NLXA 3RSEB 4NLCA 2OTJN 4B1WB 1TYQB 3SJHA 4K41A 3KK7A 3TTDA 4JD2A 1GLEG 3VF2A 4GVEA 2P9IA 2YHXA 3ZX2A 5BREA 5AFUH 5F0XA 5E84A 1BWFO 4H0TB 2ZJPL 5B8HA 3G71N 2ZWHA 1VQNN 1O13A 4BY9C 1GLAG 3MWPA 4GV9A 3QICA 2HF3A 4JD2B 4OPHA 3J8AA 2D0PA 3MN6A 2QEXN 1YVNA 2KKZA 2NZTA 3M6GA 3VEZA 4A57A 3HSCA 4JKBA 3J7ZO 2WC9A 1MDUB 1EQYA 2BTFA 3EE8A 3MX2A 4IO8A 4BRGA 1SZ2A 3H3NO 2HSTA 3CMEN 3Q7BA 3A5OC 3ID8A 3N4PA 4PKIA 5M1PA 1YJWN 2Q1NA 4O8KA 1Y64A 5JICA 1X9JA 4BC2A 4H03B 4B1VA 2NRVA 5AQYA 4BRMA 3FE1A 4QS8A 5C15A 5CE3A 2NRRA 2QWMA 5M1KA 4CBWA 2YI1A 3UKRB 1N8RO 3QDKA 3D7EO 5AZIA 5AQGA 5BRFA 1BOTO 4H5VA 5E26A 2IVPA 5DM6L 3M3ZA 1S22A 4YOYA 4J8FA 1JCFA 4EHUA 2RHKA 5AQUA 1DT9A 1NGJA 4BC4A 4UY8O 3WQUA 3K9JA 4IXCA 4JK8A 2GELA 1NGGA 4M7XA 5EY4A 2P9KB 5AQZA 4YOVA 3ZX0A 3MN7A 4RTFD 3GE1A 1YXQA 3L4QA 3I56N 2Q36A 3OBYA 3E1YA 4QS7A 2WBNA 4KH4A 3H6EA 4CD3A 1TYQA 2UYTA 4FWPA 3IMXA 5AQJA 3U9DA 3VGMA 3LDQA 2ASPA 2CGKA 4YOWA 4B1ZA 3CERA 4ILJA 4AM6A 4ILGB 1SS6A 3KZBA 1GLBG 3CJBA 3TU5A 2HMPA 3E66A 4JKGB 1ESVA 4XH5A 1MA9B 2E2OA 4ISFA 3AAPA 2I7PA 1VQ6N 5AQHA 3VETA 1WUAA 5AQLA 1QZ6A 5JLFA 3G4SN 4YORA 1P8ZA 2EWSA 5BR9A 4FWMA 3R8EA 3CC2N 1NGEA 4YOTA 5C2FA 3F9MA 3CETA 3D2EA 3QFUA 4BQZA 2YCHA 1OKJA 2IIRA 5M1FA 2E1ZA 3NMUA 4CBXA 1DGKN 4H0PA 3P38A 2QWRA 3AGRA 4FOEA 3CJ1A 4E1JA 1GLDG 4DB3A 2NRZA 3DXMA 3H1VX 1BU6O 5M1NA 3ZYYX 3MCPA 5JMVA 1YHQN 4DKWA 3MDQA 4BRFA 2GWKA 1C0FA 3BUZB 3GG4A 4FWLA 3DXMB 3O6WA 5AQMA 3EE9A 3O1BA 4A5AA 3I8BA 2E2QA 1U6ZA 2QWOA 4FSVA 2PFUA 3DXKA 1YITN 4BR5A 3LDPA 2YHWA 2AA4A 3QBXA 2VYPA 3VERA 1K8AO 4PL8A 4L3QA 1VQON 3A5MC 3O4WA 3LDOA 3SLCA 3R6MA 4U67L 4EIAA 2ZGZA 3FR0A 4IJAA 2Q0RA 3BF3A 3F5TA 3KWIA 4FPAA 3MMVA 5BRDA 5FPNA 3ZEUB 3T7ZA 1VAZA 4G9ZA 4IZ9A 1NGFA 1QQMA 3A5NC 4JKGA 5BN9A 4A59A 1VQPN 1VQ8N 3CC7N 3VEOA 3ZX3A 1HKGA 3W0LA 2KLAA 4NLBA 3UKUB 3WEEA 4FWOA 2VGMA 3W3DA 3CD6N 5I9EB 2HOEA 4BRHA 3VTIA 4CZIA 5LY3A 3GL1A 1HX1A 1U2VA 2P9NA 2CH6A 1LOTB 3CCSN 1M90O 3HRGA 3C0BA 1YI2N 3FZFA 3O9UA 2A3ZA 1DKGD 3FZLA 4WFNL 4JEPA 2P9LA 3HI0A 4A2BA 1T3VA 1GLJO 2PBDA 3SAGA 3CJ7A 3A5LC 1J6ZA 5FPDA 1M1KO 3HOSA 3M5RA 2ASOA 4WYBA 1KC8O 2ZGYA 4FVUA 1HUXA 4GV3A 3ATVA 3I55N 5FPMA 4B1XB 1TUUA 1ZC6A 2QA4N 1X3NA 4DHYA 1KXPA 4CD1A 3C6HA 2HBLA 1MWMA 2A42A 1S72N 4FWQA 2GWJA 2JWLA 2KHOA 4H0YB 4BRPA 2VGNA 3VMFB 3CJAA 1NM1A 2P9IB 1Z6RA 1WOQA 2PAVA 4H0OA 1YJ9N 5ADXH 1HPMA 4BVPA 5EXWA 2BH1A 2NRXA 4CZHA 5AFUA 1RDWX 4DCHA 5C0YA 3D2FB 3S41A 5HOOA 4BVOA 3UKUA 2W41A 3FZHA 1ILYA 3ID6A 1ZBSA 4LC9B 3NVMA 1KAZA 5HL7L 4MO4A 4O8UA 3G6EN 3LL3A 2QWNA 4KH6A 3EN9A 3WXJA 3CXCM 2GTDA 3O5BA 2CGLA 5AQSA 5EVZA 1JCGA 1MWKA 3MN5A 4IJNA 1XQSC 5M1OA 4NB4A 3CHWA 4FOIA 4IOXA 1NWKA 1GLCG 2P9PB 4Z94A 4HTLA 3P31A 3VESA 1NMDA 4JN4A 1VQ9N 1D4XA 4H5NA 3TTCA 4BRQA 1U2VB 2FSJA 3MCAB 1K73O 3WT0A 1QHAA 3WXLA 4F9OA 3R1XA 1HLUA 1TUYA 3VEWA 3VF4A 4BG8A 4ISEA 3O9RA 4BGAA 3C7NA 2IVNA 2P9UB 2Q0UA 4BREA 4PHTX 2HBMA 2VWBA 4CI6A 4H5TA 3VENA 1BDGA 1NJIO 1E4GT 3L0QA 2NRTA 3TSQA 3CJ9A 4NO7A 2P9KA 5GIPA 4WFAL 2E8AA 3E9OA 4KBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6A A;  4JNE A;  3UKR A;  4A61 A;  3LM9 A;  5BN8 A;  1V4S A;  2YJF A;  4BRI A;  5FPE A;  3UB5 A;  2QWQ A;  4BRN A;  1Q18 A;  1G99 A;  3D2F A;  4BRC A;  4PKH A;  4RCH A;  4A62 A;  3FFK B;  5BPN A;  1QQO A;  3VF6 A;  4BC3 A;  3EKU A;  5BPL A;  3H46 O;  3CQY A;  3R9P A;  5AQK A;  4CJ7 A;  3AAQ A;  2A5X A;  3CQX A;  4JAX A;  4B1U B;  4DQ8 A;  1IG8 A;  4H0V B;  3WEE B;  4FPB A;  1RGI A;  1BA1 A;  1BUP A;  2P9U A;  1CZA N;  1NGD A;  3C7N B;  4ISG A;  3QML A;  1YUW A;  2P9S B;  3FZM A;  4BC5 A;  2E2P A;  1ATS A;  1NBW A;  2BUP A;  2ZF5 O;  3HBT A;  5BRH A;  3L4I A;  1DEJ A;  4MLE A;  1GLF O;  4FWN A;  4FWS A;  3VPZ A;  1KAX A;  3U8X A;  3ZET A;  2V52 B;  5TKY A;  2ASM A;  4FL9 A;  4CZF A;  1T6C A;  2E20 A;  1XUP O;  4GY2 B;  3O8M A;  3VOV A;  3EKS A;  1LCU A;  2F9T A;  4O5F A;  3U4L A;  1NGA A;  4YDU A;  4BG9 A;  4BRA A;  4JHD B;  4BQL A;  2Q2R A;  3CI5 A;  4BR4 A;  2HF4 A;  1ATR A;  2V7Y A;  5AQX A;  4BRL A;  2OAN A;  3G25 A;  4MLH A;  4BR7 A;  5AQT A;  3UE5 A;  5KQ8 A;  3DAW A;  1NGC A;  2H3G X;  1S3X A;  4FWR A;  2A40 A;  2I7N A;  2NRH A;  1BA0 A;  3QFP A;  3AY9 A;  3GBT A;  3SK3 A;  2ITM A;  3ULE B;  3BF1 A;  1QZ5 A;  1V4T A;  2W40 A;  1Z05 A;  2QW9 A;  1C0G A;  4H5W A;  1ZXO A;  3H45 C;  4K25 A;  2F9W A;  2QWL A;  3U9Z A;  4BR0 A;  1YAG A;  4AM7 A;  3BEX A;  3P4I A;  2AP1 A;  2CGJ A;  3VEY A;  1GLL O;  3LDN A;  1NGI A;  3I33 A;  3B8A X;  2FLO A;  4H0X B;  4CZG A;  2P9S A;  5AZJ B;  3FLC O;  5AQO A;  4B1Y B;  4BR9 A;  1JCE A;  5EOY A;  2D1K A;  1T6D A;  3DWL A;  4M7Y A;  4XH4 A;  3CJC A;  5AQW A;  1T44 A;  4FO0 A;  2CH5 A;  3WQT A;  3H3O B;  3FZK A;  3BP8 A;  3A8Y A;  2QXL A;  4C23 A;  2GEM A;  4BR2 A;  3TPQ A;  5KPR A;  2YJE A;  4BRO A;  4B9Q A;  5ELZ A;  4CZL A;  3VGK A;  3KVG A;  3SMP A;  1HJO A;  1BG3 A;  2V51 B;  1QQN A;  3OHR A;  4EHT A;  1H1V A;  5AQP A;  4HWI A;  5AQV A;  3JS6 A;  3HM8 A;  3ENH A;  5AQI A;  2P9P A;  2Q31 A;  4XEI A;  3FGU A;  3VEX A;  4XH1 A;  2D4W A;  4MO5 A;  4CZM A;  5F1X A;  2FSN A;  4EFH A;  2QWP A;  3MK6 A;  2A41 A;  3D2E B;  2FSK A;  3L6Q A;  4QS9 A;  1HKB A;  5AQR A;  3SMS A;  2GUP A;  4PKG A;  3ATU A;  3ZET B;  4A2A A;  1ATN A;  3QB0 A;  3IFR A;  3QBW A;  1K8K A;  1RFQ A;  5AQF A;  3EL2 A;  1KAY A;  5AZJ A;  2E88 A;  3O08 A;  3DJC A;  4EAH D;  5KPZ A;  2E1Y A;  5LJW A;  3KHY A;  4JHD A;  3IUC A;  3M1F A;  3ENO A;  3ULE A;  1K8K B;  3H1Q A;  1XC3 A;  4WQ4 A;  4BGB A;  3WUH A;  2IVO A;  4I6M B;  4Y0W A;  2DPN A;  3WXK A;  1HKC A;  3EZW A;  4H5R A;  3JXU A;  3DXK B;  2E2N A;  5AQN A;  1BO5 O;  1SAZ A;  4WQ5 C;  4PL7 A;  5LJV A;  2FF3 B;  2FF6 A;  4FWK A;  4K42 A;  4YDU C;  4GNI A;  2Q97 A;  4WQ4 C;  4I6M A;  3VEV A;  4IWV A;  3AAR A;  3GOI A;  5BPM A;  1SQK A;  2QM1 A;  3HZ6 A;  3O1W A;  3MN9 A;  4M63 C;  3VGL A;  4BRK A;  1NLV A;  5EX5 A;  2YHY A;  3HTV A;  1R59 O;  2P9N B;  5AR0 A;  2WUS A;  3EO3 A;  4CZK A;  3O80 A;  1NGH A;  2J4R A;  5AZI B;  4RWT A;  1E4F T;  4CZJ A;  2V7Z A;  1IJJ A;  2P9L B;  3A0I X;  3ZEU A;  5KQD A;  2FXU A;  4K43 A;  3LM2 A;  2D0O A;  1NGB A;  2VCP A;  5AQQ A;  5ADX A;  3CIP A;  3RSE A;  5F2R A;  4WQ5 A;  4BRD A;  4CZE A;  3GDQ A;  4CBU A;  5KPT A;  3WXI A;  3LDL A;  5JLH A;  3IDH A;  1X3M A;  2NLX A;  3RSE B;  4B1W B;  1TYQ B;  3SJH A;  4K41 A;  4JD2 A;  1GLE G;  3VF2 A;  2P9I A;  2YHX A;  3ZX2 A;  5BRE A;  5AFU H;  5F0X A;  5E84 A;  1BWF O;  4H0T B;  5B8H A;  2ZWH A;  1GLA G;  3QIC A;  2HF3 A;  4JD2 B;  3J8A A;  2D0P A;  3MN6 A;  1YVN A;  2NZT A;  3M6G A;  3VEZ A;  3HSC A;  1MDU B;  1EQY A;  2BTF A;  4IO8 A;  4BRG A;  1SZ2 A;  3H3N O;  3A5O C;  3ID8 A;  4PKI A;  2Q1N A;  4O8K A;  1Y64 A;  5JIC A;  1X9J A;  4BC2 A;  4H03 B;  4B1V A;  5AQY A;  4BRM A;  3FE1 A;  4QS8 A;  5CE3 A;  2QWM A;  4CBW A;  2YI1 A;  3UKR B;  3QDK A;  3D7E O;  5AZI A;  5AQG A;  5BRF A;  1BOT O;  4H5V A;  5E26 A;  2IVP A;  3M3Z A;  1S22 A;  4J8F A;  1JCF A;  4EHU A;  5AQU A;  1NGJ A;  4BC4 A;  3WQU A;  4IXC A;  2GEL A;  1NGG A;  4M7X A;  5EY4 A;  2P9K B;  5AQZ A;  3ZX0 A;  3MN7 A;  4RTF D;  3GE1 A;  1YXQ A;  2Q36 A;  4QS7 A;  3H6E A;  4CD3 A;  1TYQ A;  2UYT A;  4FWP A;  3IMX A;  5AQJ A;  3U9D A;  3VGM A;  3LDQ A;  2ASP A;  2CGK A;  4B1Z A;  3CER A;  4AM6 A;  3KZB A;  1GLB G;  3CJB A;  3TU5 A;  2HMP A;  1ESV A;  4XH5 A;  1MA9 B;  2E2O A;  4ISF A;  3AAP A;  2I7P A;  5AQH A;  3VET A;  1WUA A;  5AQL A;  1QZ6 A;  5JLF A;  1P8Z A;  2EWS A;  5BR9 A;  4FWM A;  3R8E A;  1NGE A;  3F9M A;  3CET A;  3D2E A;  3QFU A;  4BQZ A;  2YCH A;  1OKJ A;  2IIR A;  2E1Z A;  4CBX A;  1DGK N;  4H0P A;  2QWR A;  4FOE A;  3CJ1 A;  4E1J A;  1GLD G;  4DB3 A;  3DXM A;  3H1V X;  1BU6 O;  3MCP A;  5JMV A;  3MDQ A;  4BRF A;  3GG4 A;  1C0F A;  2GWK A;  3BUZ B;  4FWL A;  3DXM B;  3O6W A;  5AQM A;  3O1B A;  3I8B A;  2E2Q A;  1U6Z A;  2QWO A;  4FSV A;  3DXK A;  4BR5 A;  3LDP A;  2YHW A;  2AA4 A;  3QBX A;  2VYP A;  3VER A;  4PL8 A;  4L3Q A;  3A5M C;  3O4W A;  3LDO A;  3SLC A;  3R6M A;  4EIA A;  2ZGZ A;  3FR0 A;  4IJA A;  2Q0R A;  3BF3 A;  4FPA A;  3MMV A;  5BRD A;  5FPN A;  3ZEU B;  4IZ9 A;  1NGF A;  1QQM A;  3A5N C;  5BN9 A;  3VEO A;  3ZX3 A;  1HKG A;  3W0L A;  3UKU B;  3WEE A;  4FWO A;  3W3D A;  5I9E B;  2HOE A;  4BRH A;  4CZI A;  5LY3 A;  3GL1 A;  1HX1 A;  1U2V A;  2P9N A;  2CH6 A;  1LOT B;  3C0B A;  3FZF A;  2A3Z A;  1DKG D;  3FZL A;  2P9L A;  3HI0 A;  4A2B A;  1GLJ O;  2PBD A;  3CJ7 A;  3A5L C;  1J6Z A;  5FPD A;  2ASO A;  4WYB A;  2ZGY A;  1HUX A;  3ATV A;  5FPM A;  4B1X B;  1TUU A;  1ZC6 A;  1X3N A;  4DHY A;  1KXP A;  4CD1 A;  1MWM A;  2A42 A;  4FWQ A;  2GWJ A;  2KHO A;  4H0Y B;  4BRP A;  3CJA A;  1NM1 A;  2P9I B;  1Z6R A;  1WOQ A;  2PAV A;  4H0O A;  5ADX H;  1HPM A;  4BVP A;  5EXW A;  4CZH A;  5AFU A;  1RDW X;  4DCH A;  3D2F B;  3S41 A;  4BVO A;  3UKU A;  2W41 A;  3FZH A;  1ZBS A;  4LC9 B;  1KAZ A;  4MO4 A;  3LL3 A;  2QWN A;  3EN9 A;  3WXJ A;  2GTD A;  3O5B A;  2CGL A;  5AQS A;  5EVZ A;  1JCG A;  1MWK A;  3MN5 A;  4IJN A;  1XQS C;  4NB4 A;  3CHW A;  4FOI A;  1NWK A;  1GLC G;  2P9P B;  4Z94 A;  4HTL A;  3VES A;  1NMD A;  4JN4 A;  1D4X A;  4H5N A;  4BRQ A;  1U2V B;  2FSJ A;  3WT0 A;  1QHA A;  3WXL A;  4F9O A;  1HLU A;  1TUY A;  3VEW A;  3VF4 A;  4BG8 A;  4ISE A;  4BGA A;  2IVN A;  2P9U B;  2Q0U A;  3C7N A;  4BRE A;  4CI6 A;  2VWB A;  4H5T A;  3VEN A;  1BDG A;  1E4G T;  3L0Q A;  3CJ9 A;  4NO7 A;  2P9K A;  2E8A A;  4KBO A; 
#chains in the Genus database with same CATH topology
 3UKR A;  4JNE A;  2O8D A;  2AJQ A;  4A61 A;  4R79 A;  2YJF A;  2OPP A;  4FJ8 A;  4FLV A;  4KO0 A;  4DV1 K;  1Q18 A;  2JLE A;  3Q7C A;  4WF9 L;  2IC3 A;  1N5Y A;  4BC3 A;  1CZB A;  3EKU A;  3VQ8 A;  5BPL A;  1JLC A;  4JKE A;  3SYZ A;  3CQX A;  4KTQ A;  1EO1 A;  3PSI A;  5JVH L;  4FPB A;  4YHH K;  4ILH A;  1NK0 A;  1BUP A;  2NRW A;  5LL6 Z;  5FRO A;  3OYK A;  2Y1I A;  3QML A;  2HHX A;  3MEC A;  2E2P A;  3CCM N;  2BUP A;  2ZF5 O;  3K58 A;  1N34 K;  3C65 A;  5KI6 A;  4FWS A;  4E0D A;  3QIN A;  2G8F A;  2HHV A;  2E20 A;  3EKS A;  1OVQ A;  1J9A A;  3J7Y P;  3U4L A;  3RVC A;  4UY8 O;  2Q2R A;  4W5T A;  3KKS A;  4Z4E A;  3PSF A;  5A2Q O;  5AQX A;  1TK8 A;  2OAN A;  3G25 A;  5GAH P;  4BR7 A;  2Z1J A;  3SQ4 A;  1W2B M;  3O4Q A;  2XY8 A;  4KI6 A;  5KQ8 A;  3DAW A;  1XHZ A;  1JL2 A;  4FWR A;  1W97 L;  1J54 A;  2NRH A;  4AHR A;  5GIN A;  1BA0 A;  2ATQ A;  3AVI A;  3NE6 A;  3SAH A;  3QFP A;  3LPU A;  3BF1 A;  1LWE A;  1V4T A;  4M41 A;  3C6U A;  5MLC Q;  3F73 A;  3THV A;  1X9S A;  3P39 A;  3LWL A;  4CJL A;  4IFE A;  2KZM A;  3EZ5 A;  3LDN A;  2KZZ A;  1X1P A;  2A1S A;  4M3U A;  4DSF A;  1VSD A;  3I33 A;  3B8A X;  4CZG A;  2P9S A;  5AZJ B;  2VWJ A;  1KQS M;  5C10 A;  2D1K A;  4CGD A;  1T6D A;  2O4G A;  3DWL A;  4M7Y A;  1T03 A;  3CJC A;  4DQS A;  1I94 K;  3K5M A;  2CH5 A;  3H3O B;  2WOM A;  1G15 A;  4Y1D A;  3TPQ A;  3O3G A;  3SMP A;  2UUA K;  1WSF A;  1HR0 K;  2DFH A;  1N36 K;  3CCL N;  3OHR A;  1VSF A;  4EHT A;  3O3F A;  1KSP A;  5AQI A;  3NCI A;  2Q31 A;  3D6R A;  3F2K A;  1UA0 A;  1YIJ N;  3SUP A;  4JI2 K;  2QWP A;  1ASW A;  1GOA A;  4JK7 A;  4JKF A;  1NK5 A;  4LF8 K;  4E7K A;  2P5G A;  1HKB A;  3T69 A;  2IAJ A;  3THY A;  3HOT A;  3SQ2 A;  1KFD A;  4DSE A;  1HNW K;  4DLE A;  3IFR A;  1NJW A;  3QBW A;  3CCU N;  4OKE A;  3SV4 A;  3THY B;  1KVC A;  3DJC A;  5KPZ A;  2OCE A;  5LJW A;  3THW B;  4ZTF A;  3KHY A;  1S1W A;  4JHD A;  1VHX A;  4LFB K;  3ZLJ A;  2DY4 A;  3ULE A;  3H1Q A;  1XC3 A;  3SAF A;  1IG9 A;  4WQ4 A;  4NXN K;  1TK0 A;  3M8S A;  1HKC A;  3RMA A;  5HBM A;  5LMU K;  3SBG A;  2XY5 A;  3JXU A;  3CCQ N;  4X62 K;  4WQ5 C;  1TGO A;  5LJV A;  2FF6 A;  1EWR A;  4FWK A;  4GNI A;  1S1V A;  4I6M A;  2UXD K;  1YJN N;  2YKM A;  3G0Z A;  4IWV A;  3RWU A;  4Q5V A;  3GOI A;  3TTF A;  3C6A A;  4V19 S;  3HZ6 A;  4BDZ A;  4M63 C;  3ZSX A;  4KB1 A;  3HXM A;  4BRK A;  2HHS A;  1NLV A;  2YHY A;  3O9T A;  4M42 A;  3K5L A;  2WUS A;  3KKR A;  4H4O A;  4Z4H A;  4CGH A;  4OPA A;  4B9N A;  1BI4 B;  3ZEU A;  4K43 A;  3ZT3 A;  3CIP A;  1OH7 A;  3A2F A;  3ZT4 A;  4WQ5 A;  2A1R A;  1L3S A;  4BRD A;  3CF5 L;  2HB5 A;  4CBU A;  3HK2 A;  3CCE N;  2JWK A;  1QSL A;  4OPJ A;  3IDH A;  3DLR A;  1ZBI A;  3HVT A;  4DSK A;  4B1W B;  2OPS A;  3SJH A;  3S3O A;  1CLQ A;  4JD2 A;  3ITH A;  4GVE A;  2P9I A;  3T19 A;  4JI8 K;  4JV5 K;  4H0T B;  3L8B A;  3D45 A;  3TAM A;  5B8H A;  1O13 A;  4GV9 A;  1ZBF A;  1A5X A;  2D0P A;  3OY9 A;  1RTD A;  2QEX N;  2NZT A;  4M3R A;  1JLF A;  3J7Z O;  4FW1 A;  3AVL A;  4CJF A;  3MX2 A;  4IO8 A;  1C1B A;  4DQI A;  3Q7B A;  3A5O C;  4PKI A;  3N4P A;  3TAE A;  4O8K A;  1Y64 A;  1DLO A;  4DTU A;  2NRV A;  4CJR A;  4QS8 A;  5C15 A;  5CE3 A;  4CF1 A;  2NRR A;  4CGG A;  3UKR B;  4DU4 A;  4M45 A;  4GKJ K;  5DM6 L;  1RBR A;  4FJJ A;  4EHU A;  1KLM A;  1TKT A;  2RHK A;  3SUO A;  4EZ6 A;  3WQU A;  1ZBU A;  4JK8 A;  3L2W A;  3DM2 A;  4ID1 A;  3V4I A;  2P9K B;  5AQZ A;  4CK2 A;  4YOV A;  3VA0 A;  3GE1 A;  1YXQ A;  2E5L K;  4K0K K;  1QS4 A;  1U04 A;  3I56 N;  3ZSZ A;  2WON A;  3U9D A;  2UYT A;  3IMX A;  5AQJ A;  3LDQ A;  4KAZ A;  3LP1 A;  4ILJ A;  3VQB A;  3OYJ A;  1WBD A;  2HMP A;  4CJP A;  3E66 A;  3OJS A;  4JKG B;  1BIZ A;  4CEC A;  4DV3 K;  3QET A;  1QZ6 A;  1RT2 A;  5JLF A;  3G4S N;  4N41 A;  4OPK A;  3ZT0 A;  1VRU A;  3F9M A;  4BQZ A;  1B9F A;  1TKZ A;  3NMU A;  1NG9 A;  4BDP A;  3P38 A;  4CEZ A;  3AGR A;  4CW7 B;  2KTQ A;  1S1X A;  2GWK A;  4TSX A;  1RNH A;  2VQE K;  2HVI A;  1U6Z A;  2D0A A;  4FSV A;  1D5A A;  5BR8 K;  3NF8 A;  2PFU A;  3DXK A;  3P83 D;  4KHN A;  4ELU A;  2F8T A;  3S9H A;  2W6K A;  1VQO N;  3RR7 A;  4Z4I A;  4EIA A;  3ULD A;  4DTO A;  3OS0 A;  4IJA A;  3SQ1 A;  1T8E A;  4CHN A;  3MMV A;  3TI0 A;  3ZEU B;  4OGC A;  4KB0 A;  5SZT A;  4FCY A;  1VQ8 N;  2WTU A;  3ZX3 A;  3W0L A;  3W3D A;  1EXQ A;  1IBL K;  3HRG A;  3C0B A;  4DU1 A;  1NMN A;  3O3H A;  4FJX A;  3SAG A;  4LF6 K;  3A5L C;  1J6Z A;  3DLK A;  1KC8 O;  4FVU A;  2FBV A;  4AQY K;  3I55 N;  4JI7 K;  3J81 O;  4DHY A;  4CF2 A;  2A42 A;  2YNH A;  4RW9 A;  1JL1 A;  4FWQ A;  3WNF A;  3VMF B;  3CJA A;  3V9X A;  1Z6R A;  1WOQ A;  2PAV A;  1YJ9 N;  1HPM A;  2DFF A;  5C24 A;  3S41 A;  4BVO A;  1I39 A;  1ILY A;  1ZBS A;  4LC9 B;  4JLH A;  3RMC A;  1NK8 A;  2QWN A;  4KTZ A;  1E3M A;  1FJG K;  4OVL A;  4C8N A;  3QES A;  4C8L A;  1KFS A;  1SL2 A;  2G8U A;  3AVN A;  3CHW A;  4KHY A;  1B92 A;  4HTL A;  3P31 A;  1VQ9 N;  5FRM A;  4H5N A;  3TTC A;  4FJH A;  3CFP A;  1U2V B;  3WT0 A;  4DR3 K;  3R1X A;  2UUB K;  2IVN A;  2P9U B;  3K2P A;  2VWB A;  1NJI O;  2NRT A;  2OYQ A;  2A6A A;  3IKM A;  4WFB L;  3LM9 A;  3OYA A;  1V4S A;  3UB5 A;  1C0M A;  4CFD A;  4DTN A;  3VQC A;  3D2F A;  1VQL N;  4RCH A;  1S9E A;  4E7H A;  3AA4 A;  1QQO A;  3PIO L;  2HW3 A;  1ITG A;  3CFO A;  4CJ7 A;  4IOC L;  3AAQ A;  4AH9 A;  4CCH A;  4JAX A;  2Z1I A;  4FVM A;  1IG8 A;  4JYA K;  3WEE B;  1RGI A;  2OPQ A;  1EP4 A;  4C1N K;  5HRN A;  1YF5 L;  4JKD A;  2P9U A;  1CZA N;  1NGD A;  1NK4 A;  2HMI A;  5JS1 A;  2ZJR L;  1JLE A;  4MFB A;  2P9S B;  2JGU A;  2WFB A;  4BC5 A;  4FM0 A;  1ATS A;  3HBT A;  5BRH A;  3AO4 A;  3L4I A;  1DEJ A;  1GLF O;  4E1M A;  1KAX A;  3ZET A;  5TKY A;  2GX9 A;  2QTD A;  1T6C A;  4DQR A;  3NF7 A;  3VOV A;  1W9H A;  4O5F A;  4YDU A;  4BRA A;  3O9S A;  4FLT A;  1VQ4 N;  1XWL A;  1FKO A;  3CI5 A;  1ATR A;  3C95 A;  4MLH A;  2B5J A;  4B9U A;  3IS9 A;  4FZX C;  3NVK A;  1ASU A;  4F2S A;  4HCC A;  3THX A;  3HVR A;  2I7N A;  3HJF A;  4F4K A;  1EET A;  3GBT A;  1IKX A;  1QZ5 A;  2W40 A;  3SPZ A;  1Z05 A;  4H5W A;  5E41 A;  1N32 K;  3HT3 A;  4K25 A;  2F9W A;  2QWL A;  4BR0 A;  1QVF M;  3P4I A;  1RDU A;  1VK0 A;  2R7Y A;  3VEY A;  2KW4 A;  4OLA A;  3HL8 A;  3O9Q A;  2ZJQ L;  5EU7 A;  1ZYQ A;  5KGX A;  1RT3 A;  1GOB A;  3VQ7 A;  5AQO A;  4B1Y B;  4DFM A;  3NH2 A;  5AQW A;  1RBV A;  4FO0 A;  4BWM A;  4CF0 A;  1VQ5 N;  1J53 A;  2Z1H A;  3H08 A;  5KRS A;  2HNZ A;  4C23 A;  2W6L A;  4JS4 A;  5KPR A;  3CCR N;  3IG1 A;  5ELZ A;  4CZL A;  2OPR A;  5GAD P;  3THW A;  1HJO A;  2V51 B;  1QQN A;  1A5V A;  3NHG A;  1VQK N;  4CHZ A;  3HP6 A;  1Q82 O;  3T3F A;  2P9P A;  4HVJ A;  1TL3 A;  3OYL A;  1NK9 A;  4OX9 K;  4MO5 A;  4CGI A;  4CZM A;  3VQA A;  4EFH A;  5J2P A;  1OH8 A;  1BGX T;  5H1S Q;  4C1N I;  2OZM A;  4CFC A;  5J1E A;  4DV6 K;  3ATU A;  2FBY A;  1JLG A;  2NNW A;  4K8Z A;  4YOX A;  1Q9Y A;  3WNE A;  1RFQ A;  2EX3 A;  3N4Q A;  3UIQ A;  3EL2 A;  3IRX A;  4LF7 K;  3AVG A;  2E1Y A;  2YX6 A;  3DMJ A;  4KHS A;  4DSL A;  4YNQ A;  4M3Z A;  3SV3 A;  2UU9 K;  2IVO A;  1TL1 A;  4H4M A;  4CHQ A;  3PV8 A;  4CES A;  2E2N A;  1C0T A;  5AQN A;  4YOU A;  1BO5 O;  4KV8 A;  3VTH A;  2FF3 B;  2VQF K;  2Q97 A;  4WQ4 C;  3ZT2 A;  3SPY A;  3AAR A;  4N47 A;  4B8C A;  2QM1 A;  3DLL L;  1RDA A;  3O1W A;  4JK9 A;  4PY5 A;  1WSJ A;  4U7B A;  4DR7 K;  4C8M A;  3CCJ N;  1TVR A;  1R59 O;  1VSL A;  3OYC A;  2P9N B;  5AR0 A;  2OTL N;  5C12 A;  3EO3 A;  2QKB A;  4CZK A;  3DLG A;  4JI5 K;  5AZI B;  4RWT A;  3QNN A;  3AO2 A;  3PO5 A;  4OKK A;  3RMD A;  5I3U A;  1IJJ A;  2P9L B;  4A5B A;  2FXU A;  3E9L A;  3M8R A;  1FXX A;  4HTU A;  1NGB A;  5AQQ A;  5ADX A;  2G8H A;  4CED A;  3HP9 A;  3CMA N;  3V9S A;  1WSE A;  3GDQ A;  1S9G A;  4IO9 L;  2F7T A;  3AVK A;  1R0A A;  1VRT A;  3RSE B;  1OH6 A;  1RT7 A;  3TTD A;  3AVM A;  1L3V A;  4GW6 A;  1GLE G;  3O4N A;  3ZX2 A;  3FFI A;  1LW0 A;  5E84 A;  2IDO A;  1X9M A;  1NKE A;  1YTU A;  1GLA G;  3QIC A;  1NOZ A;  4JD2 B;  3J8A A;  3MN6 A;  4W5Q A;  3BDP A;  4NYF A;  1MDU B;  2BTF A;  4DV0 K;  2O4I A;  2BDP A;  2HST A;  1ASV A;  3CME N;  3ID8 A;  2Q1N A;  2HHT A;  4BRM A;  3QEP A;  3FE1 A;  4DMN A;  5M1K A;  3QDK A;  1RTI A;  5BRF A;  2IVP A;  4B08 A;  3M3Z A;  1S22 A;  3VQ9 A;  1I3A A;  1NGJ A;  3K9J A;  1NGG A;  3G10 A;  4M7X A;  5CY4 A;  1OH5 A;  1VSE A;  3MN7 A;  2X6S A;  4RTF D;  3V9U A;  2Q36 A;  3LAM A;  3OBY A;  3V81 A;  3E1Y A;  4QS7 A;  2WBN A;  4CD3 A;  3AVH A;  1TYQ A;  2O8D B;  3VGM A;  2ASP A;  4YOW A;  3SJJ A;  3CER A;  2RN2 A;  4ILG B;  1SS6 A;  3KZB A;  4PUO A;  3LDS A;  2FBX A;  3HPH A;  4ISF A;  4B9S A;  2B6A A;  2I7P A;  1VQ6 N;  3K57 A;  4F3T A;  1NKC A;  3LP3 A;  4CVN E;  2O8B A;  1P8Z A;  2EWS A;  3NGZ A;  3RRH A;  3CC2 N;  1C0U A;  5JS2 A;  4CER A;  3CET A;  3D2E A;  4LH4 A;  1NKB A;  1UWB A;  3DRR A;  3QEW A;  4FJM A;  3HM9 A;  4FJG A;  4CBX A;  3LAK A;  4H0P A;  1HNV A;  4B3S K;  3CJ1 A;  4DB3 A;  4FLZ A;  3H1V X;  1Y97 A;  4CK3 A;  3ZYY X;  4JRQ A;  3MDQ A;  1N33 K;  4DV4 K;  3BUZ B;  4FWL A;  4AHU A;  5AQM A;  4DTX A;  4A5A A;  4DQQ A;  3I8B A;  4CHO A;  2E2Q A;  1C6V A;  3SUN A;  4CJK A;  4BR5 A;  4DTS A;  2YHW A;  3QBX A;  4PL8 A;  4XIU A;  3SLC A;  3O4W A;  4U67 L;  4CF8 A;  3FR0 A;  4CJV A;  3BF3 A;  1RBU A;  3KWI A;  4FZZ A;  4DR6 K;  5DK5 A;  1CXU A;  1SL1 A;  1VAZ A;  4DF8 A;  1NGF A;  3A5N C;  4FJ9 A;  4FWO A;  1KLN A;  4Z0U A;  5I9E B;  4CZI A;  4FXD A;  3GL1 A;  5D3G A;  1U2V A;  2P9N A;  4W5R A;  1B9D A;  1VSI A;  1NJX A;  1DKG D;  3FZL A;  4WFN L;  3ZCM A;  4A2B A;  2PBD A;  5SWM A;  4M3X A;  4W5N A;  1VSK A;  4WYB A;  2ZGY A;  4IBN A;  3ATV A;  5FPM A;  2Y1J A;  1TUU A;  2QA4 N;  3V1R A;  5J2Q A;  3C6T A;  4CD1 A;  2BGG A;  4CJ3 A;  2GWJ A;  4CJW A;  1WNS A;  4B9M A;  4H0O A;  4HCB A;  2NRX A;  1RDW X;  3JYT A;  4DCH A;  4H8K A;  5C0Y A;  4CJE A;  4CGJ A;  4FJL A;  3I0R A;  3FZH A;  3EYZ A;  1L3T A;  4O8U A;  3G6E N;  3LL3 A;  2I5J A;  3V1Q A;  3CXC M;  2GTD A;  1D8Y A;  4FM2 A;  3O5B A;  2CGL A;  4KHP K;  3MN5 A;  4WE1 A;  1XQS C;  5M1O A;  2X78 A;  1NWK A;  1SKS A;  4Z4G A;  1S6P A;  3M8Q A;  1NMD A;  4DR1 K;  1D4X A;  1SUQ A;  4O5B A;  3OYB A;  2W42 A;  3RRG A;  3TAP A;  3U3G A;  2RKI A;  1MU2 A;  3WXL A;  3QNO A;  1TUY A;  4JI3 K;  4PHT X;  4CEA A;  1VSM A;  1LWC A;  1BDG A;  4O0I A;  1NK7 A;  1E4G T;  4NO7 A;  5GIP A;  2E8A A;  3DI6 A;  1XHX A;  5BN8 A;  1L3U A;  4BRI A;  4J2A A;  3TR8 A;  4EP4 A;  3F9K A;  4BRN A;  1U45 A;  2HND A;  2G8K A;  1UA1 A;  4BRC A;  4PKH A;  4NCG A;  5CHI A;  3VF6 A;  3TWH A;  3CQY A;  3QLH A;  2RPI A;  5AQK A;  3QO9 A;  4AHV A;  3OA9 A;  4B1U B;  4PWD A;  3KJV A;  4IDH A;  1WB9 A;  1BA1 A;  5C42 A;  3E9P A;  1YUW A;  3CYM A;  4JKA A;  5DM7 L;  3FZM A;  3PX6 A;  1Q81 O;  3RR8 A;  4MLE A;  1WSG A;  3VPZ A;  1WBB A;  3U8X A;  3NAE A;  4CZF A;  4RW8 A;  3ZT1 A;  4ICL A;  3MEG A;  4GY2 B;  3O8M A;  1N6Q A;  1LCU A;  2F9T A;  4BG9 A;  1FW6 A;  1NGA A;  4PQU A;  1VQ7 N;  3HPG A;  4MDB A;  3KTQ A;  3RTV A;  4BE2 A;  5GIO A;  4N56 A;  4BR4 A;  4BRL A;  1JKH A;  3TAN A;  2OA8 A;  5AQT A;  3UE5 A;  1NGC A;  4KHW A;  1XC9 A;  3KWG A;  1EX4 A;  2A40 A;  5CYM A;  1XNR K;  3SK3 A;  3ULE B;  1RTJ A;  2ITM A;  4O0J A;  2F4V K;  1GOC A;  5C25 A;  5HLF A;  1C0G A;  3ENB A;  3ISN C;  1ZXO A;  3NBP A;  3H45 C;  3AVB A;  1IKW A;  3K9K A;  2IGI A;  4AM7 A;  4OO1 J;  2AP1 A;  4CEO A;  3SQ0 A;  3BZC A;  1Z25 A;  1GLL O;  4RG8 A;  2FLO A;  1Z26 A;  4IG3 A;  3NF6 A;  1HMV A;  3K5O A;  4XH4 A;  4KH5 A;  3V9Z A;  1TAQ A;  1T44 A;  1LW2 A;  4I9Q A;  1EKE A;  3AA2 A;  2XHB A;  4Z4F A;  3WQT A;  3T1H K;  3FZK A;  2QXL A;  2GEM A;  3VQD A;  4FLW A;  2YJE A;  2ZM6 K;  3VGK A;  3KVG A;  1RT6 A;  4GMJ B;  3NGI A;  4IEI A;  5CZ1 A;  4FK4 A;  4DV7 K;  4MDA A;  4OLB A;  1H1V A;  2BE2 A;  5AQP A;  3HM8 A;  1TKD A;  5FLX O;  4CEQ A;  3FGU A;  2O8B B;  3VEX A;  4XH1 A;  2D4W A;  3OYE A;  1HYS A;  5F1X A;  1FKP A;  1QTM A;  3D2E B;  4KRF A;  1ZBL A;  5AQR A;  3LWM A;  1W7A A;  4FLU A;  4PKG A;  5C2D A;  3PIP L;  1WAJ A;  2EHG A;  4JKH A;  3ZET B;  3KLE A;  3LZJ A;  1WSH A;  4A2A A;  4AIL C;  3QB0 A;  1HRH A;  1K8K A;  5CYQ A;  5AZJ A;  1NU0 A;  3P1G A;  3IUC A;  3ENO A;  3LP2 A;  4FJ7 A;  1K8K B;  4CK1 A;  5IT9 O;  4BGB A;  3WUH A;  4Y0W A;  4IG0 A;  4WCE L;  3EZW A;  4H5R A;  4CIG A;  2O8F B;  1T05 A;  3AA5 X;  3DXK B;  1D9F A;  2B4J A;  4DTM A;  5HRO A;  3ZSY A;  4K42 A;  4YDU C;  1X9W A;  1HYV A;  1OVY A;  1RDC A;  2ETJ A;  2QI2 A;  3B6O A;  3ZSQ A;  3VEV A;  1ZBH A;  3K5N A;  5BPM A;  1SQK A;  3AVJ A;  4N5S A;  3OYN A;  3OJU A;  1DTT A;  1IKY A;  3MN9 A;  2ITG A;  3OW2 M;  5JVG L;  1JXE A;  3HTV A;  1YTA A;  4B3O A;  3VQE A;  4O55 A;  3MX5 A;  3CC4 N;  4CZJ A;  2V7Z A;  5KQD A;  4IOA L;  2D0O A;  2VCP A;  3CPW M;  1QVG M;  3RSE A;  1T7P A;  4HHT A;  4LF9 K;  2O8E B;  1BQM A;  4CZE A;  4M3Y A;  2E4L A;  5KPT A;  5GAE P;  4G1Q A;  5JLH A;  5GAG P;  3HPO A;  1X3M A;  2NLX A;  4NLC A;  4AHC A;  2LSN A;  3VF2 A;  5IWA K;  3MXJ A;  2YHX A;  5BRE A;  4DR2 K;  5AFU H;  1TK5 A;  2ZJP L;  5HRS A;  3G71 N;  2ZWH A;  1VQN N;  4BY9 C;  3MWP A;  4M3W A;  4KPY A;  2HF3 A;  1XMO K;  1YVN A;  2KKZ A;  4CIE A;  3SNN A;  2IOC A;  3VEZ A;  3VQ6 A;  3HSC A;  4JKB A;  2WC9 A;  3EE8 A;  1EQY A;  4FW2 A;  1SZ2 A;  3VQQ A;  1YJW N;  4ID5 A;  4CEE A;  1JLQ A;  5JIC A;  4AHS A;  1X9J A;  4H03 B;  3ZSO A;  4B1V A;  5AQY A;  1XMQ K;  4KKO A;  2QWM A;  3I0S A;  4JI1 K;  5AZI A;  1CZ9 A;  4DTP A;  5AQG A;  4H5V A;  5DMR A;  2P5O A;  2G8I A;  4YOY A;  1S5J A;  3VQ5 A;  3MXI A;  2KQ2 A;  2VG7 A;  4J2B A;  3OTO K;  3ZX0 A;  5HP1 A;  4UQG A;  3L4Q A;  3H6E A;  4J2D A;  2CGK A;  4AM6 A;  1GLB G;  3TU5 A;  4CEF A;  3V9W A;  2E2O A;  2XRI A;  3AAP A;  3L3V A;  4O4G A;  4DTR A;  5AQH A;  1LWF A;  1WUA A;  5AQL A;  2ZE2 A;  1RT5 A;  1BIS A;  3BGR A;  4OGE A;  5BR9 A;  2HVH A;  4FWM A;  3R8E A;  1NGE A;  4W5O A;  5C2F A;  1BCO A;  3QFU A;  4LD0 A;  2Z1G A;  5HRR A;  2IIR A;  2E1Z A;  4CEB A;  4BE1 A;  4OKJ A;  4E1J A;  4JS5 A;  3CFR A;  2NRZ A;  3DXM A;  1BU6 O;  3OS2 A;  2XY7 A;  3QEI A;  3SZ2 A;  4C8K A;  5JMV A;  1YHQ N;  4DKW A;  4BRF A;  2KFN A;  2YHB A;  3DXM B;  3O6W A;  1IBK K;  3EE9 A;  3O1B A;  1A5W A;  1NOY A;  2QWO A;  4LH5 A;  2OZS A;  1CXQ A;  1YIT N;  3TAF A;  3LDP A;  3VER A;  1K8A O;  4DQP A;  4DS4 A;  4L3Q A;  3KK3 A;  3LDO A;  4YFU A;  1RT4 A;  2Q0R A;  2O8E A;  3F5T A;  3KLI A;  1BIU A;  4Y1C A;  4FK0 A;  5FPN A;  4G9Z A;  2DTU A;  4IZ9 A;  3PX4 A;  4JKG A;  4A59 A;  5BN9 A;  3VEO A;  2E6L A;  3SI6 A;  1IO2 A;  4NLB A;  4JI0 K;  3WEE A;  3OYH A;  3CD6 N;  2HOE A;  4BRH A;  4GKK K;  3VTI A;  5LY3 A;  3S3N A;  1U4B A;  4CF9 A;  3L3U A;  1M90 O;  1YT3 A;  2IS3 A;  1YI2 N;  3O9U A;  2A3Z A;  4X64 K;  1BI4 A;  3HI0 A;  1T3V A;  1GLJ O;  1JLA A;  4CE9 A;  3CJ7 A;  1DTQ A;  3QIP A;  1HNI A;  3HOS A;  4HUF A;  3WNH A;  1HUX A;  2HHH K;  4DLG A;  4B1X B;  2HHU A;  1REV A;  1WSI A;  1MWM A;  2YNF A;  2F96 A;  3HST B;  2JWL A;  2KHO A;  4H0Y B;  4I2Q A;  1NM1 A;  1QSS A;  4CZH A;  1JLB A;  3T1Y K;  4I2P A;  3UKU A;  1RDD A;  2W41 A;  4CGF A;  3ID6 A;  3K0S A;  3QEV A;  3NVM A;  4MO4 A;  4KH6 A;  1S1T A;  4Z4C A;  1NJZ A;  3TAQ A;  3DLH A;  4IJN A;  1YVU A;  4FOI A;  4CHY A;  4E1N A;  3NDK A;  2X6N A;  2P9P B;  5HRP A;  2GV9 A;  3VES A;  4BRQ A;  2FSJ A;  3I8D A;  1K73 O;  4F9O A;  3VA3 A;  3VEW A;  1KVB A;  3VF4 A;  4BG8 A;  3SCX A;  3O9R A;  3AVC A;  1HNZ K;  2VWK A;  4BRE A;  3C7N A;  1BHL A;  4H5T A;  3L0Q A;  3TSQ A;  3C94 A;  4KBO A;  4MQ3 A;  4IFV A;  5FPE A;  3THX B;  4NCA A;  2QWQ A;  2UXC K;  4LFA K;  3E01 A;  3MAQ A;  1G99 A;  1P90 A;  4A62 A;  3FFK B;  5BPN A;  5FDL A;  4LSL A;  3ZSV A;  3H46 O;  3CG7 A;  3R9P A;  1RCH A;  4ZHR A;  3AO1 A;  2A5X A;  4CJS A;  4DQ8 A;  4H0V B;  4E3S A;  2HHW A;  3SBT A;  3OYD A;  3U3Y A;  4QAG A;  1KTQ A;  4JI4 K;  3C7N B;  4FJI A;  4DSJ A;  4ISG A;  1QSY A;  3AO5 A;  5KRT A;  1EWQ A;  5J2M A;  2RE2 A;  4CJU A;  3NGY A;  4CFA A;  3DLB A;  1NBW A;  2BAN A;  4LF4 K;  5M1Q A;  4FWN A;  2V52 B;  1K6Y A;  2ASM A;  4FL9 A;  4LSN A;  3CCV N;  1XUP O;  3MXM A;  3DRS A;  1U49 A;  4JHD B;  4AHT A;  4BQL A;  4JI6 K;  4E89 A;  4CIF A;  3ZSW A;  2RF2 A;  2HF4 A;  2V7Y A;  2PZS A;  4JKC A;  1S1U A;  4IDK A;  1Q86 O;  3P5J A;  4E7L A;  1TAU A;  1QQC A;  2H3G X;  1WAF A;  1S3X A;  3ZSR A;  4B3R K;  2E6M A;  4I7F A;  3R3L A;  2O8C B;  2HBJ A;  5TKW A;  3T1A A;  3JAM O;  3AY9 A;  2KFZ A;  4KHU A;  2QW9 A;  3OBW A;  3OVN A;  1JJ2 M;  3S3M A;  1VQM N;  2QK9 A;  3EY1 A;  1KD1 O;  3U9Z A;  3KK2 A;  1YAG A;  3BEX A;  1Q7Y O;  4B8A B;  2CGJ A;  2D0B A;  2HHQ A;  1NGI A;  4DG1 A;  1IKV A;  2DFE A;  1C1A A;  3ASM A;  4DSI A;  4KRE A;  3L2V A;  3NF9 A;  4H0X B;  1FK9 A;  3FLC O;  4BR9 A;  1JCE A;  2X74 A;  5EOY A;  1XI1 A;  1UOC A;  2PYJ A;  1F21 A;  3HO1 A;  3PY8 A;  5FRN A;  2FC0 A;  4FZY A;  4GV6 A;  2O8F A;  3BP8 A;  3A8Y A;  3DLE A;  4BR2 A;  4DF4 A;  4RW7 A;  4BRO A;  1SKR A;  4B9Q A;  4BDY A;  2HBK A;  1BG3 A;  4LFC K;  3AGK A;  2QXF A;  5AQV A;  4HWI A;  4CFB A;  3JS6 A;  4EP5 A;  3ENH A;  4ELV A;  4XEI A;  3MED A;  3BZK A;  1XNQ K;  3PLA A;  4KI4 A;  3MWT A;  4DUZ K;  3J7A P;  2FSN A;  3MK6 A;  4GVM A;  2A41 A;  2YNG A;  3PUF A;  3KD1 E;  2FSK A;  3BY5 A;  1O1W A;  3TSU A;  3L6Q A;  4QS9 A;  3TAB A;  3OYF A;  3SMS A;  4DUY K;  2XO7 A;  2GUP A;  4B9L A;  3HYF A;  4DR5 K;  5CZ2 A;  4IEE A;  1ATN A;  5I42 A;  4FLX A;  5AQF A;  1NJY A;  1KAY A;  2E88 A;  3O08 A;  4EAH D;  2FBT A;  3M1F A;  3AV9 A;  4KTW A;  4BWJ A;  4AF1 A;  2VG5 A;  3CPE A;  4QOZ B;  4LY7 A;  4HUG A;  4NXM K;  4CJQ A;  2YHA A;  4I6M B;  2DPN A;  2VG6 A;  3WXM B;  3WXK A;  1K9M O;  1SAZ A;  4FK2 A;  4PL7 A;  2YNI A;  4E19 A;  1L5U A;  2HNY A;  1KVA A;  3LP0 A;  4R5P A;  3ALY A;  3VGL A;  1BL3 A;  5EX5 A;  5K14 A;  2G8W A;  3OYG A;  4E7I A;  3NH0 A;  2O8C A;  3O80 A;  1NGH A;  2J4R A;  4FM1 A;  1NNE A;  1E4F T;  2P51 A;  4DV2 K;  4B3M K;  3A0I X;  2Q3S A;  3SUQ A;  1VSH A;  4PA1 A;  3LM2 A;  5F2R A;  3WXI A;  3KD5 E;  2ZD1 A;  3AVA A;  3LDL A;  5CR4 A;  3TSP A;  1NK6 A;  4CHP A;  2OTJ N;  1TYQ B;  4K41 A;  3KK7 A;  1WLJ A;  4N76 A;  5J2N A;  4X65 K;  5F0X A;  3JSM A;  3VQ4 A;  1IBM K;  4DFJ A;  1KRP A;  1BWF O;  1RTH A;  2QKK A;  4NCB A;  4DFP A;  3TAG A;  3OYI A;  4OPH A;  3IAY A;  3B6P A;  3K59 A;  3M6G A;  3WNG A;  3PO4 A;  4A57 A;  2NUB A;  4BRG A;  3DOK A;  3H3N O;  3CM6 A;  3AA3 A;  4DU3 A;  5M1P A;  1J5E K;  4JRP A;  4BC2 A;  1SKW A;  1U47 A;  3LAN A;  4FJK A;  3CQ8 A;  4CBW A;  2YI1 A;  1BQN A;  1N8R O;  3D7E O;  1HJR A;  1BOT O;  4EZ9 A;  2UUC K;  2PY5 A;  4O44 A;  5E26 A;  4FYD A;  5AJ3 K;  1S6Q A;  1Q8I A;  4J8F A;  1JCF A;  3EEQ A;  5AQU A;  1DT9 A;  3MEE A;  4CJT A;  4YY3 K;  4BC4 A;  4IXC A;  2GEL A;  5EY4 A;  3QER A;  1BCM A;  4CJ5 A;  4KH4 A;  4FWP A;  2UXB K;  5T7B A;  2G8V A;  4B1Z A;  1W0H A;  4J2E A;  5LMN K;  4X66 K;  3CJB A;  2PYL A;  2F8S A;  2YKN A;  3VN5 A;  1ESV A;  4XH5 A;  4DV5 K;  1MA9 B;  4L8R B;  4DTJ A;  3KK1 A;  1QHT A;  3VET A;  4F3O A;  4YOR A;  4Q0B A;  4YOT A;  1C1C A;  1IH7 A;  3DYA A;  3M8P A;  2GUI A;  1UAX A;  2YCH A;  1OKJ A;  4LF5 K;  3DRP A;  5M1F A;  3QEX A;  4QCL A;  1DGK N;  4ZTJ A;  1LV5 A;  2QWR A;  1TV6 A;  4FOE A;  4OJR A;  1GLD G;  1RT1 A;  4BE0 A;  4FJN A;  5M1N A;  3MCP A;  4KHQ A;  3GG4 A;  1C0F A;  1LAV A;  4F8R A;  1LAW A;  1RIL A;  3QIO A;  4DS5 A;  3DOL A;  2XY6 A;  4ELT A;  4M3T A;  1HPZ A;  2AA4 A;  1KCF A;  3L2Q A;  4DWI A;  2VYP A;  1HQE A;  3L2U A;  3KLF A;  3A5M C;  3J80 O;  3R6M A;  3AO3 A;  3KLG A;  2D5R A;  2ZGZ A;  1U48 A;  1RDB A;  4I9L A;  4E7J A;  2GBZ A;  4CJ4 A;  4BAC A;  4FPA A;  5BRD A;  2YV0 X;  1RBT A;  5KTQ A;  3T7Z A;  1QQM A;  1HNX K;  1VQP N;  3CC7 N;  1HKG A;  2KLA A;  3UKU B;  3V6D A;  2VGM A;  3OS1 A;  4K8X A;  3PX0 A;  1HX1 A;  2CH6 A;  1LOT B;  3CCS N;  3FZF A;  3KLH A;  4FJ5 A;  3LZI A;  4JEP A;  2P9L A;  1JXB A;  5FPD A;  1M1K O;  4B9V A;  3RMB A;  3M5R A;  2ASO A;  3NH1 A;  4GV3 A;  3TAR A;  3NFA A;  3OYM A;  1ZC6 A;  4DR4 K;  1X3N A;  1SL0 A;  1KXP A;  1RBS A;  2HBL A;  3C6H A;  3L2R A;  1S72 N;  4F2R A;  4FLY A;  4BRP A;  2VGN A;  2P9I B;  1IV0 A;  3V1O A;  5ADX H;  4BVP A;  5EXW A;  3U6F A;  2BH1 A;  5AFU A;  3D2F B;  5HOO A;  4IFY A;  1HYZ A;  2P1J A;  5KGW A;  1KAZ A;  5HL7 L;  3AVF A;  3EN9 A;  3WXJ A;  4IKF A;  1WN7 A;  3VQP A;  5AQS A;  5EVZ A;  1JCG A;  1MWK A;  3LAL A;  4NYN A;  4NB4 A;  1QE1 A;  4IOX A;  1GLC G;  4Z94 A;  4HUE A;  4JN4 A;  1VSJ A;  3D0P A;  4DFK A;  1SV5 A;  3CM5 A;  3LPT A;  4C8O A;  3MCA B;  4RW4 A;  1QHA A;  2ZQB A;  1HLU A;  1J5O A;  4B3T K;  4RW6 A;  4ISE A;  1Q9X A;  3KIO A;  1HQU A;  4BGA A;  2Q0U A;  2D0C A;  2HBM A;  4CI6 A;  3VEN A;  1TKX A;  1D9D A;  4B9T A;  3CJ9 A;  2P9K A;  4WFA L;  4KFB A;  3E9O A; 
#chains in the Genus database with same CATH homology
 2A6A A;  4JNE A;  3UKR A;  3IKM A;  4A61 A;  3LM9 A;  4WFB L;  4R79 A;  5BN8 A;  1V4S A;  2YJF A;  4BRI A;  5FPE A;  3UB5 A;  2QWQ A;  4BRN A;  1Q18 A;  3Q7C A;  1G99 A;  3D2F A;  4BRC A;  4WF9 L;  1P90 A;  4PKH A;  1VQL N;  4RCH A;  4A62 A;  3FFK B;  5CHI A;  5BPN A;  1QQO A;  3VF6 A;  4BC3 A;  3PIO L;  3EKU A;  5BPL A;  3H46 O;  4JKE A;  3CQY A;  3R9P A;  5AQK A;  4CJ7 A;  4IOC L;  3AAQ A;  2A5X A;  3CQX A;  3OA9 A;  4JAX A;  4B1U B;  4DQ8 A;  1IG8 A;  4H0V B;  1EO1 A;  5JVH L;  3SBT A;  4FPB A;  3WEE B;  1RGI A;  4IDH A;  4C1N K;  1BA1 A;  4ILH A;  1YF5 L;  4JKD A;  1BUP A;  2NRW A;  1CZA N;  1NGD A;  2P9U A;  3C7N B;  3E9P A;  2ZJR L;  4ISG A;  3QML A;  1YUW A;  2P9S B;  4JKA A;  2RE2 A;  2WFB A;  3FZM A;  4BC5 A;  5DM7 L;  2E2P A;  3CCM N;  1ATS A;  1NBW A;  1Q81 O;  2BUP A;  2ZF5 O;  3HBT A;  5BRH A;  3L4I A;  5M1Q A;  1DEJ A;  4MLE A;  1GLF O;  3C65 A;  4FWN A;  4FWS A;  3VPZ A;  1KAX A;  3U8X A;  3ZET A;  2V52 B;  5TKY A;  2ASM A;  2GX9 A;  2QTD A;  4FL9 A;  1T6C A;  4CZF A;  2E20 A;  3CCV N;  1XUP O;  4GY2 B;  3O8M A;  3VOV A;  3EKS A;  1LCU A;  2F9T A;  4O5F A;  3RVC A;  1NGA A;  4YDU A;  3O9S A;  3U4L A;  4BG9 A;  4JHD B;  4MDB A;  4BRA A;  1VQ4 N;  1VQ7 N;  4BQL A;  2Q2R A;  3CI5 A;  5GIO A;  4BR4 A;  2HF4 A;  1ATR A;  2V7Y A;  5AQX A;  4BRL A;  2OAN A;  3G25 A;  4JKC A;  5GAH P;  4MLH A;  4BR7 A;  5AQT A;  1W2B M;  3NVK A;  3UE5 A;  5KQ8 A;  1Q86 O;  3DAW A;  1NGC A;  2H3G X;  1S3X A;  3KWG A;  4FWR A;  1W97 L;  2A40 A;  3R3L A;  2HBJ A;  2I7N A;  5GIN A;  2NRH A;  5TKW A;  1BA0 A;  3SAH A;  3QFP A;  3AY9 A;  3GBT A;  3SK3 A;  2ITM A;  3ULE B;  3BF1 A;  1QZ5 A;  1V4T A;  2W40 A;  1Z05 A;  2QW9 A;  1C0G A;  3ENB A;  3OBW A;  4H5W A;  1JJ2 M;  1VQM N;  1ZXO A;  5MLC Q;  3H45 C;  4K25 A;  1KD1 O;  2F9W A;  3P39 A;  2QWL A;  3U9Z A;  4BR0 A;  1QVF M;  1YAG A;  3K9K A;  3BEX A;  3P4I A;  4AM7 A;  2AP1 A;  1Q7Y O;  1RDU A;  4IFE A;  2CGJ A;  4OO1 J;  3VEY A;  1GLL O;  3LDN A;  1NGI A;  3I33 A;  3O9Q A;  2ZJQ L;  3B8A X;  2FLO A;  4H0X B;  4CZG A;  2P9S A;  5AZJ B;  3FLC O;  5AQO A;  4B1Y B;  1KQS M;  4BR9 A;  1JCE A;  5EOY A;  5C10 A;  2D1K A;  1T6D A;  3DWL A;  4M7Y A;  4XH4 A;  3CJC A;  4KH5 A;  5AQW A;  1T44 A;  4FO0 A;  1VQ5 N;  2CH5 A;  3WQT A;  3H3O B;  4GV6 A;  3FZK A;  3BP8 A;  3A8Y A;  2QXL A;  4C23 A;  2GEM A;  4BR2 A;  3TPQ A;  5KPR A;  2YJE A;  3CCR N;  4BRO A;  4B9Q A;  5ELZ A;  4CZL A;  3VGK A;  3KVG A;  2HBK A;  5GAD P;  3SMP A;  1HJO A;  1BG3 A;  2V51 B;  4IEI A;  1QQN A;  3CCL N;  3AGK A;  3OHR A;  4EHT A;  4MDA A;  1H1V A;  5AQP A;  4HWI A;  5AQV A;  3JS6 A;  3HM8 A;  1VQK N;  1Q82 O;  3ENH A;  5AQI A;  2P9P A;  2Q31 A;  4XEI A;  3D6R A;  3FGU A;  3F2K A;  3VEX A;  4XH1 A;  1YIJ N;  2D4W A;  4MO5 A;  3PLA A;  3MWT A;  4CZM A;  5F1X A;  2FSN A;  4EFH A;  2QWP A;  3MK6 A;  2A41 A;  3D2E B;  4JK7 A;  4JKF A;  2FSK A;  3TSU A;  3L6Q A;  4QS9 A;  1HKB A;  5H1S Q;  5AQR A;  3SMS A;  4C1N I;  3T69 A;  2GUP A;  3HOT A;  4PKG A;  3ATU A;  5C2D A;  3PIP L;  4IEE A;  4JKH A;  3ZET B;  2NNW A;  4A2A A;  1ATN A;  3QB0 A;  3IFR A;  4YOX A;  3QBW A;  1K8K A;  1RFQ A;  3CCU N;  3N4Q A;  5AQF A;  3EL2 A;  1KAY A;  5AZJ A;  2E88 A;  3O08 A;  3DJC A;  4EAH D;  5KPZ A;  2E1Y A;  2YX6 A;  5LJW A;  3KHY A;  4JHD A;  3IUC A;  3M1F A;  3ENO A;  4AF1 A;  3CPE A;  3ULE A;  1K8K B;  3H1Q A;  1XC3 A;  3SAF A;  4WQ4 A;  4BGB A;  3WUH A;  2IVO A;  4I6M B;  4Y0W A;  4WCE L;  2DPN A;  3WXK A;  1HKC A;  3EZW A;  3WXM B;  4H5R A;  3SBG A;  3JXU A;  3CCQ N;  3DXK B;  1K9M O;  2E2N A;  5AQN A;  4YOU A;  1BO5 O;  1SAZ A;  4WQ5 C;  3VTH A;  4PL7 A;  5LJV A;  2FF3 B;  2FF6 A;  4FWK A;  4K42 A;  4YDU C;  4GNI A;  1OVY A;  2Q97 A;  2QI2 A;  4WQ4 C;  4I6M A;  1YJN N;  3VEV A;  4IWV A;  3AAR A;  3GOI A;  3TTF A;  5BPM A;  3C6A A;  1SQK A;  2QM1 A;  3DLL L;  3HZ6 A;  3O1W A;  4JK9 A;  3MN9 A;  4M63 C;  3VGL A;  4U7B A;  3OW2 M;  4BRK A;  5JVG L;  1NLV A;  5EX5 A;  2YHY A;  3O9T A;  3HTV A;  3CCJ N;  1R59 O;  2P9N B;  5AR0 A;  2OTL N;  2WUS A;  5C12 A;  3EO3 A;  4CZK A;  3O80 A;  1NGH A;  2J4R A;  5AZI B;  4RWT A;  3MX5 A;  3CC4 N;  1E4F T;  4CZJ A;  2V7Z A;  4OPA A;  1IJJ A;  2P9L B;  3A0I X;  3ZEU A;  5KQD A;  4A5B A;  2FXU A;  3E9L A;  4K43 A;  4IOA L;  3LM2 A;  2D0O A;  1NGB A;  2VCP A;  5AQQ A;  5ADX A;  3CIP A;  3CPW M;  1QVG M;  3RSE A;  5F2R A;  4WQ5 A;  3CMA N;  4BRD A;  4CZE A;  3CF5 L;  3GDQ A;  4CBU A;  5KPT A;  5GAE P;  3WXI A;  3CCE N;  2JWK A;  5CR4 A;  3LDL A;  3TSP A;  5JLH A;  4IO9 L;  5GAG P;  2F7T A;  3IDH A;  1X3M A;  2NLX A;  3RSE B;  4NLC A;  2OTJ N;  4B1W B;  1TYQ B;  3SJH A;  4K41 A;  3KK7 A;  3TTD A;  4JD2 A;  1GLE G;  3VF2 A;  4GVE A;  2P9I A;  2YHX A;  3ZX2 A;  5BRE A;  5AFU H;  5F0X A;  5E84 A;  1BWF O;  4H0T B;  2ZJP L;  5B8H A;  3G71 N;  2ZWH A;  1VQN N;  1O13 A;  4BY9 C;  1GLA G;  3MWP A;  4GV9 A;  3QIC A;  2HF3 A;  4JD2 B;  4OPH A;  3J8A A;  2D0P A;  3MN6 A;  2QEX N;  1YVN A;  2KKZ A;  2NZT A;  3M6G A;  3VEZ A;  4A57 A;  3HSC A;  4JKB A;  3J7Z O;  2WC9 A;  1MDU B;  1EQY A;  2BTF A;  3EE8 A;  3MX2 A;  4IO8 A;  4BRG A;  1SZ2 A;  3H3N O;  2HST A;  3CME N;  3Q7B A;  3A5O C;  3ID8 A;  3N4P A;  4PKI A;  5M1P A;  1YJW N;  2Q1N A;  4O8K A;  1Y64 A;  5JIC A;  1X9J A;  4BC2 A;  4H03 B;  4B1V A;  2NRV A;  5AQY A;  4BRM A;  3FE1 A;  4QS8 A;  5C15 A;  5CE3 A;  2NRR A;  2QWM A;  5M1K A;  4CBW A;  2YI1 A;  3UKR B;  1N8R O;  3QDK A;  3D7E O;  5AZI A;  5AQG A;  5BRF A;  1BOT O;  4H5V A;  5E26 A;  2IVP A;  5DM6 L;  3M3Z A;  1S22 A;  4YOY A;  4J8F A;  1JCF A;  4EHU A;  2RHK A;  5AQU A;  1DT9 A;  1NGJ A;  4BC4 A;  4UY8 O;  3WQU A;  3K9J A;  4IXC A;  4JK8 A;  2GEL A;  1NGG A;  4M7X A;  5EY4 A;  2P9K B;  5AQZ A;  4YOV A;  3ZX0 A;  3MN7 A;  4RTF D;  3GE1 A;  1YXQ A;  3L4Q A;  3I56 N;  2Q36 A;  3OBY A;  3E1Y A;  4QS7 A;  2WBN A;  4KH4 A;  3H6E A;  4CD3 A;  1TYQ A;  2UYT A;  4FWP A;  3IMX A;  5AQJ A;  3U9D A;  3VGM A;  3LDQ A;  2ASP A;  2CGK A;  4YOW A;  4B1Z A;  3CER A;  4ILJ A;  4AM6 A;  4ILG B;  1SS6 A;  3KZB A;  1GLB G;  3CJB A;  3TU5 A;  2HMP A;  3E66 A;  4JKG B;  1ESV A;  4XH5 A;  1MA9 B;  2E2O A;  4ISF A;  3AAP A;  2I7P A;  1VQ6 N;  5AQH A;  3VET A;  1WUA A;  5AQL A;  1QZ6 A;  5JLF A;  3G4S N;  4YOR A;  1P8Z A;  2EWS A;  5BR9 A;  4FWM A;  3R8E A;  3CC2 N;  1NGE A;  4YOT A;  5C2F A;  3F9M A;  3CET A;  3D2E A;  3QFU A;  4BQZ A;  2YCH A;  1OKJ A;  2IIR A;  5M1F A;  2E1Z A;  3NMU A;  4CBX A;  1DGK N;  4H0P A;  3P38 A;  2QWR A;  3AGR A;  4FOE A;  3CJ1 A;  4E1J A;  1GLD G;  4DB3 A;  2NRZ A;  3DXM A;  3H1V X;  1BU6 O;  5M1N A;  3ZYY X;  3MCP A;  5JMV A;  1YHQ N;  4DKW A;  3MDQ A;  4BRF A;  2GWK A;  1C0F A;  3BUZ B;  3GG4 A;  4FWL A;  3DXM B;  3O6W A;  5AQM A;  3EE9 A;  3O1B A;  4A5A A;  3I8B A;  2E2Q A;  1U6Z A;  2QWO A;  4FSV A;  2PFU A;  3DXK A;  1YIT N;  4BR5 A;  3LDP A;  2YHW A;  2AA4 A;  3QBX A;  2VYP A;  3VER A;  1K8A O;  4PL8 A;  4L3Q A;  1VQO N;  3A5M C;  3O4W A;  3LDO A;  3SLC A;  3R6M A;  4U67 L;  4EIA A;  2ZGZ A;  3FR0 A;  4IJA A;  2Q0R A;  3BF3 A;  3F5T A;  3KWI A;  4FPA A;  3MMV A;  5BRD A;  5FPN A;  3ZEU B;  3T7Z A;  1VAZ A;  4G9Z A;  4IZ9 A;  1NGF A;  1QQM A;  3A5N C;  4JKG A;  5BN9 A;  4A59 A;  1VQP N;  1VQ8 N;  3CC7 N;  3VEO A;  3ZX3 A;  1HKG A;  3W0L A;  2KLA A;  4NLB A;  3UKU B;  3WEE A;  4FWO A;  2VGM A;  3W3D A;  3CD6 N;  5I9E B;  2HOE A;  4BRH A;  3VTI A;  4CZI A;  5LY3 A;  3GL1 A;  1HX1 A;  1U2V A;  2P9N A;  2CH6 A;  1LOT B;  3CCS N;  1M90 O;  3HRG A;  3C0B A;  1YI2 N;  3FZF A;  3O9U A;  2A3Z A;  1DKG D;  3FZL A;  4WFN L;  4JEP A;  2P9L A;  3HI0 A;  4A2B A;  1T3V A;  1GLJ O;  2PBD A;  3SAG A;  3CJ7 A;  3A5L C;  1J6Z A;  5FPD A;  1M1K O;  3HOS A;  3M5R A;  2ASO A;  4WYB A;  1KC8 O;  2ZGY A;  4FVU A;  1HUX A;  4GV3 A;  3ATV A;  3I55 N;  5FPM A;  4B1X B;  1TUU A;  1ZC6 A;  2QA4 N;  1X3N A;  4DHY A;  1KXP A;  4CD1 A;  3C6H A;  2HBL A;  1MWM A;  2A42 A;  1S72 N;  4FWQ A;  2GWJ A;  2JWL A;  2KHO A;  4H0Y B;  4BRP A;  2VGN A;  3VMF B;  3CJA A;  1NM1 A;  2P9I B;  1Z6R A;  1WOQ A;  2PAV A;  4H0O A;  1YJ9 N;  5ADX H;  1HPM A;  4BVP A;  5EXW A;  2BH1 A;  2NRX A;  4CZH A;  5AFU A;  1RDW X;  4DCH A;  5C0Y A;  3D2F B;  3S41 A;  5HOO A;  4BVO A;  3UKU A;  2W41 A;  3FZH A;  1ILY A;  3ID6 A;  1ZBS A;  4LC9 B;  3NVM A;  1KAZ A;  5HL7 L;  4MO4 A;  4O8U A;  3G6E N;  3LL3 A;  2QWN A;  4KH6 A;  3EN9 A;  3WXJ A;  3CXC M;  2GTD A;  3O5B A;  2CGL A;  5AQS A;  5EVZ A;  1JCG A;  1MWK A;  3MN5 A;  4IJN A;  1XQS C;  5M1O A;  4NB4 A;  3CHW A;  4FOI A;  4IOX A;  1NWK A;  1GLC G;  2P9P B;  4Z94 A;  4HTL A;  3P31 A;  3VES A;  1NMD A;  4JN4 A;  1VQ9 N;  1D4X A;  4H5N A;  3TTC A;  4BRQ A;  1U2V B;  2FSJ A;  3MCA B;  1K73 O;  3WT0 A;  1QHA A;  3WXL A;  4F9O A;  3R1X A;  1HLU A;  1TUY A;  3VEW A;  3VF4 A;  4BG8 A;  4ISE A;  3O9R A;  4BGA A;  3C7N A;  2IVN A;  2P9U B;  2Q0U A;  4BRE A;  4PHT X;  2HBM A;  2VWB A;  4CI6 A;  4H5T A;  3VEN A;  1BDG A;  1NJI O;  1E4G T;  3L0Q A;  2NRT A;  3TSQ A;  3CJ9 A;  4NO7 A;  2P9K A;  5GIP A;  4WFA L;  2E8A A;  3E9O A;  4KBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...