4DQ8A

Crystal structure of acetate kinase acka from mycobacterium marinum
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
380
structure length
373
Chain Sequence
NRVVLVLNSGSSSLKFQLVEPDSGMSRATGNIERIPDHDAALRRVFEILAEDDIDLQSCGLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVPHIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLHLGNGASASAVAGGRPVETSMGLTPLEGLVMGTRSGDLDPGVIGYLWRTAKLGVDEIESMLNHRSGMLGLAGERDFRRLRAMIDDGDPAAELAYDVFIHRLRKYVGAYLAVLGHTDVVSFTAGIGEHDAAVRRDTLAGMAELGISLDERRNACPSGGARRISADDSPVTVLVIPTNEELAIARHCCSVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 124
structure length 373
sequence length 380
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4dq8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4dq8A02
1TYQB 2P9PA 4MO4A 1BG3A 1HKBA 3M3ZA 2V7ZA 2HOEA 2ITMA 4B1YB 4BC5A 4AM6A 3R9PA 3TPQA 1YAGA 1XC3A 2Q1NA 2FF3B 3VPZA 1NWKA 3QB0A 2H3GX 4EIAA 3I33A 1D4XA 3CETA 1KXPA 2QXLA 3SLCA 4BVPA 2A42A 4FWRA 3DXMB 5KQ8A 4BRLA 3MCPA 1G99A 4M7XA 5BN9A 4LC9B 2GWJA 3JXUA 2FSKA 2P9NB 3I8BA 3OHRA 5AQSA 2IVOA 1X3MA 2E2OA 1E4FT 3CI5A 4AM7A 4H0OA 1NGCA 2Q36A 2YHXA 3CERA 1BWFO 3EZWA 5AZIA 4H0YB 2KHOA 2Q0UA 3D2FB 5KPRA 2VWBA 4O5FA 4CZJA 3O1BA 5AFUH 1BA1A 4CZGA 2A6AA 3O8MA 3L4IA 2E88A 3A5MC 3AAQA 5EVZA 4BRGA 3JS6A 5F0XA 3ID8A 3FE1A 5AQMA 4E1JA 4BRQA 3F9MA 3DWLA 2CH5A 3LDLA 1BA0A 1NGGA 3EO3A 3QBXA 1JCFA 3AAPA 5FPDA 5AFUA 2QWNA 4K25A 4Z94A 2GELA 3A5NC 3U9DA 1DKGD 4DCHA 5EOYA 4HWIA 4JN4A 3H45C 1T6DA 3U9ZA 1NM1A 1GLFO 3A5OC 3FGUA 4BRNA 3UKUA 2P9SA 3VEWA 5AQYA 4A2BA 4DB3A 1BO5O 2P9IA 4ISGA 1NMDA 1LCUA 4QS7A 2EWSA 4K43A 4EHTA 1MWMA 4FWPA 4PKIA 3QBWA 1QQOA 1BU6O 5AQXA 2ZF5O 1XUPO 1NGJA 2QWQA 2GUPA 3SK3A 1U2VB 3AY9A 4CZMA 4H5RA 1DEJA 1QQMA 1YUWA 3BF1A 4L3QA 4IJAA 5B8HA 1ZXOA 3CJCA 3M1FA 3VEOA 1SZ2A 1ZBSA 1MDUB 3SMSA 1SQKA 4FL9A 4ISFA 4GY2B 3H6EA 4FWOA 1S22A 5E26A 3UB5A 3ZX0A 4BG8A 3ATUA 3DXKA 3WT0A 2Q31A 3HM8A 3BP8A 2OANA 1HUXA 4YDUC 5AQLA 4FOIA 5EX5A 3BF3A 1QZ5A 3CJ9A 2D1KA 1K8KB 4CI6A 1E4GT 5AQOA 3IDHA 4H5WA 5AQVA 3CJAA 4CD1A 4CZEA 4WQ5C 4H0TB 4PL8A 4BC4A 5F1XA 2W40A 1ESVA 5TKYA 1H1VA 4BR5A 2E20A 3GE1A 4PKHA 4BQLA 5CE3A 1NGEA 3P4IA 3ZEUA 4HTLA 3VGLA 3QDKA 4BGBA 3UKRA 4NB4A 4A62A 3HSCA 2E1YA 2FLOA 4BRAA 3H1QA 1NGDA 1C0FA 2P9PB 4K41A 4A2AA 2A3ZA 3ZX3A 2ZGZA 4MO5A 1ZC6A 2QW9A 3MK6A 5BREA 3MN5A 4O8KA 5AZJA 3GG4A 2CH6A 3MMVA 2E1ZA 5BRHA 4A61A 1HPMA 3O6WA 4FPAA 3D2EA 3HBTA 4BR7A 1IJJA 1ATSA 2BUPA 3C7NA 1KAZA 3ATVA 1HLUA 3M6GA 3VEXA 3VETA 1QHAA 3BUZB 3QFPA 2FSNA 2UYTA 3FZFA 1J6ZA 4F9OA 2V51B 4IWVA 5AZIB 2QWLA 3A5LC 4Y0WA 5LJWA 3VEYA 2E2NA 2HMPA 3MN9A 3VOVA 4B1XB 3H1VX 5KPTA 5BPNA 5AQPA 1ATRA 2VCPA 3VESA 3A0IX 5BPMA 2ASMA 5JLHA 3LL3A 4BRPA 2F9WA 3J8AA 2V52B 2IVPA 4JD2A 1Y64A 3QFUA 4CBUA 4MLHA 4BQZA 4H0XB 4CJ7A 4DHYA 4BRCA 4H0VB 3BEXA 3GL1A 2HF3A 2PAVA 3A8YA 3S41A 1ATNA 3EN9A 4FWQA 1TUYA 4PL7A 1T6CA 3U8XA 3WXLA 3IUCA 2P9SB 5EY4A 3UKUB 2A41A 4B1VA 5EXWA 2P9IB 5I9EB 2J4RA 3EKSA 2NRHA 2YHYA 2DPNA 4CZLA 5LJVA 1CZAN 4YDUA 3O1WA 1GLBG 3SJHA 3EL2A 2GWKA 2A5XA 4H5NA 3ZETA 1S3XA 3LDOA 3LDPA 4KBOA 3VERA 3B8AX 4QS8A 1HKCA 3VF2A 1MWKA 2CGJA 4WQ5A 4I6MA 1NGFA 3HTVA 1GLCG 2P9KA 4BVOA 4CBXA 2E8AA 4H0PA 1U6ZA 1NGIA 3QICA 4RWTA 4BRDA 3ZX2A 2P9LA 3ULEA 4JHDA 4FSVA 3ENHA 2D4WA 3KVGA 2ASPA 3DXKB 4FOEA 3FLCO 3MN7A 2ZGYA 4QS9A 2E2PA 3HZ6A 2CGKA 2CGLA 3LM9A 4CZFA 2P9UA 1WOQA 5JMVA 3RSEA 1SAZA 4CZKA 4IO8A 4FWMA 4XH4A 3WEEA 4C23A 2QWOA 4BROA 3G25A 1NGAA 3MDQA 1QZ6A 3CIPA 4IZ9A 1TYQA 1NLVA 2QWPA 4IXCA 3FZHA 2YJFA 4PKGA 3VF6A 1JCGA 1V4TA 3FR0A 5AQJA 4FWNA 4BR9A 3VGKA 3TU5A 3UKRB 2NLXA 5AQIA 5AQZA 2BTFA 4JAXA 3HI0A 1HKGA 2ZWHA 1HX1A 2VYPA 1RGIA 3KHYA 4WQ4C 5FPMA 4B1WB 3DXMA 2W41A 3O5BA 4K42A 3H3OB 3WXJA 2P9NA 3LDQA 4BRMA 1NGBA 5AZJB 4BR4A 2D0PA 4H5VA 2HF4A 2YJEA 3GBTA 5BPLA 4BR0A 4B9QA 3IMXA 3D2EB 1GLJO 3C7NB 2ASOA 2V7YA 1BDGA 4BG9A 1IG8A 2GTDA 3D2FA 4EAHD 1V4SA 1C0GA 2GEMA 2Q97A 4JNEA 4XH5A 1DGKN 1LOTB 1NBWA 3VEZA 1HJOA 1YVNA 5F2RA 3VENA 4CZIA 4IJNA 1GLAG 3L6QA 3VGMA 3R8EA 1Z6RA 2Q2RA 3WQTA 3FZKA 2A40A 2FSJA 4M7YA 1JCEA 3GDQA 5AQRA 2D0OA 3CJ1A 3VF4A 1X9JA 2YCHA 4BRHA 5BRFA 1Q18A 1TUUA 2QWRA 3O08A 4CBWA 3VEVA 4BREA 4RTFD 4BC3A 3WUHA 4J8FA 4JD2B 5AQFA 2WUSA 2IVNA 3L0QA 5ADXH 4BC2A 4BRFA 5ELZA 4EHUA 5AQNA 4BRIA 5AQTA 1GLEG 1KAYA 5BRDA 2AA4A 2F9TA 4B1ZA 3DAWA 5AR0A 2NZTA 5BR9A 3UE5A 1RDWX 1Z05A 4DQ8A 3MN6A 1NGHA 4M63C 5LY3A 3CJ7A 3R6MA 1R59O 4XEIA 1X3NA 1P8ZA 5ADXA 4B1UB 5AQGA 5JLFA 1U2VA 3FZMA 1XQSC 3W3DA 4EFHA 3W0LA 4GNIA 5JICA 3DJCA 1OKJA 3IFRA 3FFKB 3O4WA 5BN8A 1BOTO 4BRKA 1KAXA 4FWSA 3CQYA 4ISEA 2I7PA 3EKUA 3ZETB 3CQXA 4FWKA 2E2QA 4BR2A 5AQUA 3SMPA 5KQDA 4RCHA 3ENOA 2YHWA 3LM2A 4H5TA 3AARA 4I6MB 4CD3A 5AQWA 3WXKA 4FPBA 3KZBA 4CZHA 4WYBA 2P9KB 2PBDA 4H03B 3O80A 2QM1A 4MLEA 1YXQA 2YI1A 3WXIA 2I7NA 2QWMA 4FO0A 1K8KA 2P9LB 2FXUA 3ULEB 4JHDB 1RFQA 3C0BA 3H3NO 2AP1A 2FF6A 3WQUA 3CHWA 3D7EO 1EQYA 5E84A 1GLLO 3H46O 3LDNA 3QMLA 1T44A 4WQ4A 4BGAA 3U4LA 1WUAA 5AQHA 2IIRA 5KPZA 1MA9B 1BUPA 2P9UB 1QQNA 3RSEB 5AQKA 5FPEA 2Q0RA 3WEEB 3ZEUB 3CJBA 4NO7A 4XH1A 5FPNA 5AQQA 3FZLA 4FWLA 1GLDG 3GOIA
chains in the Genus database with same CATH superfamily
4DFJA 1RT4A 1EWQA 2P9PA 4DTRA 2W6LA 4MO4A 2V7ZA 2HOEA 4JKEA 4AM6A 4UY8O 3E01A 4DU1A 4I9LA 4CIEA 5IT9O 3I33A 1KXPA 2QXLA 1B9DA 1HNWK 5M1QA 4IOAL 3MCPA 4CHNA 3TAPA 4LC9B 2P9NB 4A57A 4OKKA 2X78A 4CGHA 2Z1JA 3VQ4A 4B9VA 4KI4A 3CF5L 4HUEA 3KLGA 2ZJRL 4AM7A 4H0OA 2VG6A 5J2NA 3CERA 5AZIA 4ZTFA 3VA3A 4GV3A 4H0YB 3ZSOA 3D2FB 5KPRA 4CZJA 3O1BA 2IS3A 2IC3A 4FJ8A 4F2SA 2UUAK 3KKSA 4BRGA 3D6RA 5F0XA 3DWLA 2FC0A 1NMNA 1NGGA 4DLGA 4K8XA 1JCFA 3OYGA 1VQON 4K25A 3QESA 1RBUA 3OY9A 3U9DA 5EOYA 2F8SA 3WNGA 3MXIA 4HWIA 4Z4HA 3VQAA 3A5OC 3HSTB 3FGUA 2WTUA 4BRNA 4KAZA 4DB3A 3J80O 1ZBIA 4M3RA 2EWSA 3NGIA 1N33K 3THXB 3ITHA 1KSPA 4OPJA 4K43A 1FKPA 1K8AO 4FJ7A 1MWMA 1KFDA 4PKIA 2VQEK 2ZF5O 3ZSQA 4Q5VA 4IKFA 1S6PA 1WNSA 1YUWA 1XMOK 3ZLJA 5B8HA 3RTVA 4ILJA 1SZ2A 4DMNA 4GKJK 4GY2B 3UB5A 4X62K 3P39A 3WT0A 3JYTA 3HM8A 4JKAA 4NXNK 3Q7CA 5HROA 4YDUC 1HUXA 4ID1A 5AQLA 5EX5A 3HL8A 3BF3A 3O3GA 3HM9A 1KFSA 2ZE2A 3C6TA 4DV6K 1N32K 2VQFK 4B3OA 4IEIA 4KHNA 4H5WA 5AQVA 4DTOA 3EE8A 2ZD1A 5F1XA 3C95A 1T05A 1VQPN 3MXJA 2P51A 1YF5L 2G8KA 5FRNA 3QDKA 4BGBA 3UKRA 4CIFA 2O8BA 2FLOA 3H1QA 1NGDA 1KVAA 4A2AA 3ZX3A 2ZGZA 3OBYA 3K9KA 3MK6A 4WE1A 4DR2K 4FJHA 3D45A 3AVKA 3GG4A 1C0MA 4CHQA 2E1ZA 1U04A 1BGXT 1HPMA 3O6WA 1YJWN 4J2EA 5GIOA 4KH4A 3D2EA 2YNIA 3HBTA 3IS9A 4BR7A 4B3RK 4JEPA 4CFBA 1HLUA 4K0KK 1HNXK 3FFIA 3KLFA 2HW3A 3QFPA 1KRPA 1TGOA 3FZFA 1J6ZA 1WSJA 2Y1JA 4CJRA 3VEYA 2E2NA 2HMPA 3DRRA 2QKKA 1J5EK 1OH6A 5KPTA 5BPNA 4FM2A 3PO5A 4JKCA 1BISA 5HL7L 3DRPA 3K5NA 1WLJA 3I0SA 3QFUA 4HCCA 4MLHA 5KRSA 1RDUA 3CMAN 1BCOA 4E7LA 4KKOA 3SAHA 2P1JA 3ALYA 3P1GA 5CZ1A 3R1XA 2HF3A 3K5LA 5HRNA 1MU2A 3S41A 1UA1A 1ATNA 4KHUA 2HHUA 3IKMA 3AA2A 3RRGA 5EY4A 2A41A 5GADP 5I9EB 4FYDA 3AO5A 3DLLL 3T19A 4YDUA 3O1WA 3PIPL 4LH4A 3LDPA 4DSKA 4KBOA 1LAWA 3VF2A 3QNNA 2D0CA 3HTVA 3O9SA 1GLCG 3RMCA 2E8AA 4H0PA 1NGIA 2DTUA 3QICA 1VSFA 4RWTA 3S3NA 5LMUK 1U45A 1W9HA 3MX2A 4CEEA 3FLCO 1K6YA 2ZGYA 1IO2A 2CGLA 4B8CA 4M42A 4RW7A 5JMVA 2HNYA 3RSEA 3NGZA 3HP9A 3WEEA 4JKGA 4QAGA 3MDQA 3CIPA 1TYQA 3DLGA 4JI8K 3CC2N 2BE2A 2JWKA 4BWMA 3TU5A 3P31A 1OH5A 5AQIA 2BTFA 4C8NA 4DV2K 4WQ4C 3TI0A 3DXMA 4DSIA 2W41A 1NK6A 3AA4A 1BL3A 3ZCMA 2P5GA 1TAUA 3HK2A 3ZT2A 5AZJB 4KH6A 4DF4A 1A5VA 3IMXA 1WBDA 2WFBA 2ASOA 5C0YA 1VQKN 1IG8A 2YKMA 4JNEA 5CYQA 4CFCA 1DGKN 4DTNA 5F2RA 4PHTX 4U7BA 4NCBA 3OYDA 3AVBA 1HYVA 1Z6RA 4DTSA 3WQTA 4DSFA 3EYZA 1XC9A 3AVMA 4LF4K 1VSJA 3PO4A 3CJ1A 4BRHA 4B3TK 5J2PA 3VN5A 2KQ2A 1Q18A 1TUUA 4YY3K 3PY8A 3O08A 4CBWA 3VEVA 4BREA 4RTFD 5HRRA 2RF2A 4BC3A 4I9QA 4JD2B 4FLYA 1QVFM 2HHQA 3L2UA 1BHLA 1Q81O 3VQDA 5AQTA 1S5JA 3DRSA 2OPRA 2NNWA 3QLHA 3M8QA 5BR9A 1N36K 1RDWX 2QXFA 1Q9YA 1Z05A 3KWIA 3MN6A 4B3MK 3SBGA 4TSXA 5LY3A 1R59O 4XEIA 3U6FA 4CESA 1EX4A 1P8ZA 1X3NA 2HNZA 3O9TA 4LD0A 4FM0A 1D9FA 5AQGA 4JKDA 4M3YA 3THYB 4EFHA 3K2PA 2JLEA 4H4MA 3IFRA 1REVA 5BN8A 1BOTO 5FROA 4FWSA 3NF9A 4ISEA 2I7PA 5DMRA 4F3OA 3CQXA 3PX4A 4ICLA 5D3GA 4BR2A 3BZCA 3ENOA 2YHWA 3CC7N 5AQWA 4JLHA 4FJJA 1DLOA 2A1SA 4CZHA 4WYBA 2Z1GA 4BE2A 2RN2A 3B6OA 4KTQA 1VQ8N 1RTHA 3WXIA 4N47A 3ULEB 2FXUA 2GV9A 4JHDB 4OGCA 2HB5A 3J7YP 4LFBK 5E84A 3H46O 3QMLA 1NK7A 4WQ4A 1IBMK 3U4LA 4QOZB 5KPZA 5M1KA 1SKWA 5FPEA 3CJBA 4XH1A 5AQQA 3TSUA 2QKBA 2Q3SA 2KW4A 3DM2A 3DYAA 1LW2A 2NRWA 1BG3A 3M3ZA 2R7YA 4IG0A 4C8KA 4JKHA 2UXDK 1W7AA 4PQUA 3TPQA 5JS1A 1XC3A 1KLNA 3OYLA 5GAGP 4FLUA 4EIAA 1EXQA 2A42A 2DY4A 4FWRA 4M7XA 2OPQA 4FJ9A 2FSKA 4CEFA 3L3UA 3OHRA 3WNEA 5AQSA 4BE1A 2IVOA 3SV3A 3OW2M 4B9MA 4YNQA 2YNFA 4LY7A 3VTHA 1BQMA 1N6QA 1YT3A 4G1QA 1NGCA 2HHSA 1BWFO 4CERA 2D0AA 3OYEA 4CIGA 4Z4GA 3DI6A 3NF7A 3AO4A 1BA1A 3SUOA 2A6AA 5HBMA 4DV0K 1IBKK 5LL6Z 3L4IA 1HRHA 2E88A 2O8FB 3FE1A 2ZQBA 2F96A 3D0PA 3CFRA 2B5JA 4BRQA 2CH5A 3LDLA 4CF9A 4FZYA 2XO7A 2HBJA 4DUYK 2QWNA 4Z94A 2GELA 3A5NC 4FJ5A 1DKGD 1WB9A 4JS5A 3H45C 3U9ZA 3T1AA 2Z1HA 3CPWM 3DLBA 3UKUA 5BR8K 2P9IA 1VQ6N 3SPYA 1EWRA 1NMDA 1LCUA 1EO1A 2E6LA 3ISNC 4KHQA 4CECA 1L5UA 3DLHA 4X65K 3L4QA 4IBNA 3AVLA 3AVHA 3DLRA 4FWPA 2IAJA 4YOWA 4CFAA 1NGJA 2QWQA 3TSPA 4B9UA 4JI3K 3ZSVA 1U2VB 3JSMA 4L8RB 3S3OA 1FXXA 1ZXOA 1YJ9N 3M1FA 3VEOA 4DQPA 4NLCA 4FK0A 3IRXA 1NOYA 2NRXA 4AHSA 1KTQA 1OVYA 1SQKA 1VQLN 3ZX0A 3TAFA 1S22A 4ZTJA 4KRFA 4W5NA 3HPHA 4FVMA 4FOIA 1QZ5A 3OTOK 3CJ9A 1S72N 4R79A 2D1KA 1K8KB 4CI6A 1E4GT 3DLEA 2YV0X 1KD1O 2ZJQL 1WSFA 4KB1A 4XIUA 1D8YA 4FJIA 1C6VA 1QE1A 1S1WA 4CJSA 5HRPA 2E20A 4PKHA 2D5RA 2VG7A 1I3AA 4CEBA 1Z26A 3VQ8A 4HTLA 4DTJA 3OYBA 1VQ4N 4CJWA 1Y97A 4A62A 1FK9A 3HSCA 1NK8A 1CZ9A 2A3ZA 4KTWA 1ZC6A 3HYFA 4DLEA 3R3LA 5BRHA 4C8MA 4HHTA 3O4QA 3RMAA 2WC9A 3C7NA 5LMNK 3LALA 2BDPA 5E41A 3M6GA 3VETA 4OPHA 1JXBA 3PUFA 4W5TA 4OJRA 2G8HA 4V19S 2O8CB 3A5LC 4O5BA 4Y0WA 5LJWA 2PY5A 1BIZA 1RT3A 1NKEA 4B1XB 5AQPA 1QSSA 3VESA 2Z1IA 4IEEA 1N8RO 4DS4A 1W2BM 5BPMA 2ASMA 2O8DA 3KK1A 1WBBA 1Y64A 3G10A 3O9RA 1JLGA 4CJ7A 4DHYA 4DQQA 3E9OA 4BRCA 3CXCM 4C8OA 1FKOA 2IDOA 1BI4B 1FW6A 4FZZA 3QEPA 2KFZA 1TUYA 2HSTA 3TARA 2G8WA 5M1FA 2PYJA 1T6CA 4CF1A 3IUCA 2P9SB 2VWKA 5C2DA 3NAEA 5EXWA 3T1YK 2JWLA 4CVNE 5AJ3K 3L8BA 4JI2K 2YHYA 1ASUA 4X66K 4CZLA 4CJ4A 3ZYYX 4AHUA 1ITGA 2GWKA 2A5XA 1J53A 3ZETA 1EKEA 3HT3A 3VERA 4QS8A 5DM7L 2NRVA 1HKCA 3AVFA 4DR7K 4I6MA 1LV5A 4DKWA 1NGFA 3PX0A 2I5JA 2LSNA 2HBLA 3A2FA 3HJFA 5CR4A 1VRTA 2JGUA 2P9LA 3PSIA 3TTCA 4EZ6A 3L2VA 2VG5A 4FSVA 4LF9K 1QSYA 4K8ZA 3DXKB 1A5WA 3MN7A 2E2PA 2CGKA 1TKDA 2F8TA 3QEIA 4FLWA 3CFPA 2NRRA 4WFAL 2P9UA 3MAQA 3OS0A 4CZKA 4IO8A 4FWMA 4XH4A 2WONA 4C23A 5T7BA 2QWOA 3DOKA 4BROA 5M1PA 3G71N 1QZ6A 4DSLA 4IZ9A 1NLVA 3L3VA 2QWPA 3C6HA 3FZHA 2YJFA 4PKGA 3THWB 3VF6A 3ZT4A 5AQJA 4E7HA 4ILGB 2RKIA 1VSDA 4FXDA 5AQZA 1RBRA 1YVUA 3E9LA 1RDAA 3HI0A 4N41A 5FDLA 2OZSA 3AA3A 2VYPA 1RT7A 1RGIA 3KHYA 4B3SK 4KHPK 1OH8A 4K42A 4OX9K 1XHXA 2OYQA 1IKVA 2P9NA 4ILHA 4BRMA 3QERA 2D0PA 3VQ5A 4YOYA 1L3UA 4FJGA 1WAJA 1ZBLA 4BR0A 3O4NA 1HYSA 5KGWA 3MEGA 1HJRA 5GIPA 4IDKA 3PLAA 1VQ9N 1I39A 1VHXA 3D2FA 4EAHD 1VQ5N 2GEMA 2Q97A 1J9AA 3LAMA 4GMJB 2QTDA 1LOTB 1NBWA 1WN7A 3DMJA 3VEZA 3SUNA 1QTMA 4BDZA 1HJOA 3S9HA 1ZYQA 3R8EA 3LWLA 3QETA 3FZKA 1BIUA 4KV8A 2FSJA 2WOMA 3GDQA 5AQRA 4FM1A 1TK5A 3AA5X 2QWRA 1JL2A 4KTZA 3E66A 2RE2A 4J8FA 5AQFA 1UA0A 2FBVA 4DTXA 4HTUA 5ADXH 4BC2A 5ELZA 1NJWA 4BRIA 1KAYA 3QIOA 1VSMA 4JK9A 3J81O 3THXA 4YOXA 1J54A 3EZ5A 1GOAA 3UE5A 3N4PA 3I55N 2ITGA 4GVEA 3NDKA 4FW2A 1TKZA 4M63C 2KZMA 4Z4FA 4B1UB 2G8FA 5JLFA 4FW1A 3NCIA 3WNFA 4U67L 3OYHA 3QEVA 4GNIA 2XY6A 3F5TA 3KD5E 3V9SA 3KWGA 3FFKB 4BRKA 5M1NA 1KAXA 3CQYA 4E1NA 2E2QA 1K9MO 5M1OA 4RCHA 3PIOL 2YKNA 3MXMA 4H5TA 3HVRA 3AARA 4RW6A 3QIPA 3WXKA 3CCSN 2HHHK 3KZBA 3C65A 2P9KB 2PBDA 3O80A 3LP3A 3ENBA 1IBLK 3TAGA 1W0HA 2I7NA 2QWMA 1S9EA 2NRZA 3H3NO 1A5XA 3T7ZA 3HP6A 2FF6A 3HXMA 1EQYA 4LSNA 1XNQK 1GLLO 1RNHA 2KKZA 1WSGA 5CY4A 3L2QA 4Y1DA 2NRTA 4DV5K 4O4GA 4CEAA 5AQKA 3U3GA 4AF1A 5FLXO 2HMIA 1VSHA 3SNNA 3ZEUB 1VK0A 3CQ8A 4BACA 4FWLA 3GOIA 3I56N 4DTPA 1CLQA 1HKBA 3WNHA 1KVCA 2ITMA 4BC5A 2E6MA 1C1AA 3R9PA 3VTIA 4OVLA 2Q1NA 2E4LA 3VPZA 3LWMA 3AVGA 3QB0A 4IO9L 1D4XA 4EP5A 3SLCA 4BVPA 4HUGA 3PSFA 3MX5A 4MDBA 1Q82O 4DTMA 5C15A 4CW7B 1N34K 1OH7A 3MECA 1YTAA 3TAMA 1E4FT 1C1BA 3M5RA 5JVGL 2UUBK 2BANA 3K57A 2Q36A 3NVMA 3EZWA 4W5QA 2KHOA 4O0JA 2Q0UA 5GAHP 4CFDA 2VWBA 2E5LK 1VSIA 4E3SA 5AFUH 1J5OA 1JL1A 4CZGA 4PWDA 3OYFA 4IDHA 4KH5A 3O8MA 1LW0A 3RRHA 3AAQA 1YIJN 2OTJN 3OA9A 4AILC 3ID6A 5AQMA 1NG9A 4E1JA 4CGFA 3F9MA 3SV4A 2FBXA 1U4BA 4B9NA 2W6KA 3NGYA 5J2QA 3AAPA 5FPDA 3KTQA 3O3FA 2PYLA 4DCHA 3MWTA 4Z4EA 4JYAK 1CXQA 4JN4A 3RWUA 1LWCA 3F9KA 1NM1A 3VQ9A 2BH1A 4IFEA 3H08A 1U47A 2OPSA 2HHTA 4N76A 2ETJA 3TR8A 1BO5O 4ISGA 3RMBA 2OTLN 3E9PA 3SCXA 4CJQA 4CHOA 3LP2A 4CHPA 1NJYA 4RW8A 3KLIA 1QQOA 2O8EB 4I7FA 5AQXA 4CJUA 2PFUA 3LPTA 3SK3A 4EP4A 3L2RA 5C42A 5SZTA 3AY9A 4H5RA 3BF1A 4IJAA 5I3UA 2XY7A 4RW4A 3CJCA 1HPZA 4BDYA 3MEDA 1NKCA 1MDUB 5KGXA 4DR5K 3V81A 4ISFA 5E26A 4FWOA 4RG8A 3ATUA 3SPZA 2HVIA 4F3TA 2Q31A 3BP8A 3L2WA 1UAXA 4DR4K 3SUQA 4B9LA 3K9JA 4NYFA 4FK2A 1NK4A 3CJAA 2UUCK 4CZEA 1RT1A 4WQ5C 2OZMA 4H0TB 4PL8A 5CYMA 1ESVA 5TKYA 4BR5A 4CEQA 1TKXA 3GE1A 3KK2A 5CE3A 3BGRA 4JKBA 3ZEUA 2P5OA 3HPOA 5C10A 3VGLA 1NJZA 3NFAA 3N4QA 4NB4A 3TAEA 2YNGA 4JRQA 1S1UA 1JLEA 4FJMA 1TK0A 1VSKA 2P9PB 4K41A 3P5JA 4DUZK 1M1KO 1HYZA 2QW9A 3ZT1A 1S1TA 4CF2A 4O8KA 5AZJA 3G6EN 1YTUA 3NH0A 3O9QA 4YHHK 4FZXC 4CEZA 2HBKA 2W42A 3SQ4A 1JLBA 1O13A 3AGRA 3PX6A 3VEXA 1RT2A 2WBNA 4OPKA 1L3VA 3BUZB 4FJKA 3SQ2A 2UYTA 3T1HK 4CJ3A 1WAFA 2DFEA 4BY9C 3CCJN 4PUOA 3AVJA 4IWVA 5AZIB 4CJPA 1S1XA 1X9WA 3VOVA 1KLMA 3H1VX 3C94A 4CJFA 4NCGA 2VCPA 2QA4N 4FVUA 4B08A 3OYAA 2PZSA 3LL3A 3J8AA 2IVPA 4JD2A 3OS1A 1RBSA 4DTUA 2XHBA 4BQZA 4E0DA 3CG7A 4E19A 4JS4A 4M3TA 4M3XA 3GL1A 4I2QA 3NE6A 3A8YA 1JJ2M 4CGIA 4IG3A 4FWQA 2YHBA 4PL7A 4AHCA 1RBVA 4DG1A 2B4JA 3AVAA 3WXLA 4B1VA 3SBTA 4E7IA 3THYA 2NRHA 2DPNA 4EZ9A 1CZAN 2HHXA 1RDBA 4PY5A 1TKTA 3HVTA 3EL2A 3K5OA 3CCQN 4JK8A 1T03A 4CJ5A 4E1MA 3LDOA 3V4IA 3CC4N 1NKBA 2BGGA 4FJNA 3B8AX 1VQNN 1MWKA 1BQNA 4WQ5A 1TAQA 1SKSA 4OLBA 3UIQA 3CD6N 3SUPA 4M3UA 1TK8A 2ATQA 3C6UA 3TAQA 4CBXA 1SS6A 1U6ZA 4F4KA 2EX3A 4BRDA 1B92A 1IKXA 3ZX2A 3ULEA 4CK1A 4JHDA 3G4SN 4O44A 4CF0A 4DFKA 1CXUA 1GOCA 3ZT0A 1IH7A 1JLQA 4IFYA 2G8IA 4CK3A 3C6AA 4QS9A 1P90A 3V1OA 4DQIA 1WOQA 1NJXA 3M8RA 4W5RA 1SAZA 4LF8K 2D0BA 4JI6K 3G25A 4N56A 3ZSYA 1Z25A 4ZHRA 1X1PA 4G9ZA 4AH9A 4IXCA 3ULDA 3OYNA 1K73O 1JCGA 1V4TA 3FR0A 3NVKA 3U3YA 3UKRB 2NLXA 3VQCA 4KFBA 2O8BB 1HKGA 4UQGA 5C24A 2ZWHA 1BCMA 3NBPA 3WXMB 3H3OB 3LDQA 5KI6A 5KTQA 3MCAB 4H5VA 4KB0A 3GBTA 5BPLA 4FLVA 3S3MA 3D2EB 1YI2N 1BDGA 4BG9A 5C12A 2GTDA 5GINA 1V4SA 3QEWA 3CCUN 3PV8A 4XH5A 1G15A 1VSEA 2GX9A 5DM6L 3VA0A 3HOSA 3VENA 2O4IA 1N5YA 4IJNA 2O8FA 1GLAG 4FLZA 3VGMA 3ASMA 1YITN 4DU4A 2IGIA 4OKEA 2UU9K 1Q8IA 4M7YA 1JCEA 3HO1A 3M8PA 4DF8A 2D0OA 3VF4A 1RBTA 4N5SA 5BRFA 3J7AP 4ELVA 4LFAK 4DS5A 2B6AA 5JVHL 4F2RA 3O9UA 4AHVA 5J2MA 3WUHA 4LF6K 2WUSA 2IVNA 1ASVA 3TSQA 3AO3A 4OKJA 5AQNA 4DFPA 3V1QA 1GLEG 5BRDA 1VRUA 4MDAA 4DSEA 4A5BA 2AA4A 2F9TA 4B1ZA 3CMEN 2HHWA 1KC8O 1Q86O 1KVBA 1RILA 2NZTA 3KIOA 5AR0A 4JKFA 3SAFA 3BDPA 1S6QA 4DQ8A 1XMQK 1U48A 5CHIA 4GVMA 5ADXA 3OYMA 2VWJA 1QS4A 1U2VA 3FZMA 3CCVN 1XQSC 3W3DA 3W0LA 3LZJA 3P38A 1OVQA 3KJVA 1OKJA 3O4WA 4YFUA 1WSIA 4RW9A 4FWKA 3CYMA 4PA1A 5AQUA 4HCBA 5CZ2A 4E7KA 1IV0A 3LAKA 4CD3A 1B9FA 4CGDA 4FLTA 3CCLN 3VQQA 1T3VA 4BDPA 2QM1A 1YXQA 4H8KA 2ZM6K 4B9TA 3OYKA 1JLFA 3SQ1A 1K8KA 1T7PA 1VQ7N 4LFCK 1RFQA 2AP1A 3KK7A 3CHWA 3WQUA 3D7EO 1HNZK 3VQEA 3LDNA 4BGAA 3LPUA 1WUAA 2AJQA 2IIRA 4Q0BA 4JRPA 1BUPA 3NH2A 1ZBHA 3RSEB 1R0AA 4JI1K 3ZSRA 5FRMA 3WEEB 4JKGB 3CFOA 1LAVA 3FZLA 3AO1A 1GLDG 1TYQB 3TANA 4JK7A 3QO9A 4A59A 1HQEA 4B1YB 4QCLA 1QHTA 3SZ2A 3KKRA 3SI6A 1YAGA 2FF3B 1NWKA 3AVNA 4JI5K 2H3GX 1T8EA 1ILYA 3CETA 4NXMK 3CCMN 4BE0A 3DXMB 5KQ8A 2VGNA 4BRLA 1HNIA 4Z4CA 1G99A 3DLKA 5BN9A 4W5OA 1U49A 2GWJA 3JXUA 3I8BA 2RPIA 3MWPA 1QVGM 1X3MA 2E2OA 5HOOA 3LDSA 3HRGA 3CI5A 3V1RA 3TABA 2F7TA 2YHXA 4GW6A 1C1CA 2O8CA 1NK5A 4HVJA 4IOXA 1TVRA 3SJJA 1L3SA 1HMVA 4O5FA 3VMFB 5I42A 2KTQA 4CHYA 3AVCA 3CCEN 3A5MC 5EVZA 4DV1K 4M41A 2YHAA 3JS6A 2X6NA 3B6PA 3ID8A 4FCYA 5JS2A 1O1WA 3OJUA 1BA0A 3AVIA 4NYNA 4KREA 3EO3A 1RTIA 4BWJA 3QBXA 5AFUA 4E89A 1Q9XA 1UOCA 1BI4A 4GV9A 4WF9L 3BY5A 1T6DA 1GLFO 3VEWA 2P9SA 3KD1E 5AQYA 4A2BA 2YX6A 3KLEA 4QS7A 1NNEA 3G0ZA 4OPAA 1FJGK 1NK9A 4EHTA 4GKKK 4DSJA 3QBWA 1BU6O 1RT6A 4JI7K 1XUPO 1JLCA 4AHTA 2GUPA 3SYZA 4CHZA 1C0UA 4CZMA 5HRSA 1DEJA 1QQMA 1XI1A 4L3QA 3F2KA 1ZBSA 3SMSA 4E7JA 3HPGA 4FL9A 4LF7K 3H6EA 4BG8A 3SAGA 3RR8A 3DXKA 3CCRN 4DV3K 2VGMA 2OANA 2A1RA 3EY1A 5AQOA 5HLFA 3IDHA 3OYIA 1DTTA 4CD1A 2O4GA 4FK4A 3NMUA 1ZBUA 3LZIA 1I94K 4BC4A 2W40A 1S1VA 1H1VA 5SWMA 1WSEA 3THWA 3V9XA 4BQLA 5MLCQ 1NGEA 3P4IA 4MFBA 1RTDA 4JI0K 2UXCK 3EE9A 3RVCA 3IG1A 3THVA 1TL1A 3LP1A 4BRAA 2E1YA 4CE9A 4CJTA 1C0FA 2KLAA 4YOUA 4DU3A 4YOTA 2EHGA 4DR1K 4MO5A 4LH5A 1GOBA 3MN5A 5BREA 4ELUA 4KI6A 1IKWA 1SL2A 2XY8A 2CH6A 3MMVA 1C0TA 4A61A 4DR3K 1WSHA 4FPAA 3RMDA 4JI4K 2OA8A 1IJJA 1SL1A 1ATSA 2BUPA 4I2PA 3E1YA 3KLHA 1KAZA 3ATVA 3ZSXA 1QHAA 1NOZA 2FSNA 3OYCA 1L3TA 1SV5A 4LSLA 4F9OA 1W97L 2G8VA 2V51B 2QWLA 3SQ0A 4DQRA 4CEOA 1ASWA 3MN9A 5H1SQ 3ZSZA 1ATRA 3CM5A 1HR0K 4C1NK 4OLAA 3A0IX 5JLHA 2QI2A 4BRPA 3K59A 2F9WA 4DV4K 2V52B 4GV6A 4CBUA 4H0XB 3OS2A 3NF8A 2HVHA 4H0VB 4Z0UA 4O0IA 4IFVA 4ID5A 3BEXA 1KQSM 4B9SA 4FJLA 2PAVA 5C2FA 3NH1A 3EN9A 3LANA 5DK5A 4CCHA 3U8XA 3UKUB 1RDDA 2X74A 4J2DA 1JXEA 1HNVA 2P9IB 2J4RA 3EKSA 5KRTA 2ZJPL 1TV6A 5LJVA 4JV5K 3M8SA 2XRIA 1IKYA 1YJNN 3TTFA 1GLBG 3SJHA 1RDCA 4H5NA 3TTDA 1S3XA 4CJKA 4CGJA 3V9ZA 2CGJA 2IOCA 2P9KA 4CK2A 4BVOA 4NLBA 5K14A 1LWFA 2X6SA 4CF8A 4HUFA 3CPEA 4NCAA 3J7ZO 3ENHA 1EP4A 1EETA 2D4WA 3KVGA 2ASPA 4C8LA 4FOEA 3HZ6A 2GUIA 3BZKA 2GBZA 3LM9A 4CZFA 2KZZA 5C25A 3IAYA 3T69A 2DFHA 2FBTA 1D9DA 1NGAA 1DTQA 5HP1A 2XY5A 1KCFA 1XWLA 1LWEA 4FLXA 3DOLA 1X9SA 4J2AA 3K58A 4FWNA 4BR9A 4CGGA 3VGKA 3MEEA 4JAXA 1HX1A 1UWBA 2KFNA 5FPMA 4B1WB 2F4VK 3O5BA 3VQBA 2NUBA 1VQMN 4B8AB 3VQ7A 3WXJA 4DQSA 1NGBA 5A2QO 3OYJA 4O8UA 4BR4A 4KHSA 1DT9A 4AQYK 2HF4A 3K0SA 3O3HA 2YJEA 1XHZA 4B9QA 4WFBL 3AV9A 3ZSWA 4YOVA 1GLJO 4H4OA 3Q7BA 3CM6A 3JAMO 4WFNL 3C7NB 2V7YA 4YORA 1NK0A 4KHWA 1C0GA 3V9WA 1M90O 4J2BA 2Y1IA 3NF6A 1Q7YO 3QEXA 2HBMA 1IG9A 1E3MA 1CZBA 4KHYA 2UXBK 3VQ6A 4OGEA 1YVNA 4M3ZA 4CZIA 3QINA 3L6QA 1D5AA 4O55A 4R5PA 2Q2RA 3VQPA 4CJEA 1NJIO 5J1EA 4C1NI 2A40A 1RCHA 1TL3A 1X9JA 2DFFA 2YCHA 3K5MA 2O8DB 1NU0A 2RHKA 4MQ3A 1ZBFA 1RTJA 2QK9A 3I8DA 4FJXA 3L0QA 4BRFA 2YNHA 4EHUA 4Z4IA 4DFMA 4Y1CA 4LF5K 1HQUA 3V6DA 3DAWA 3V9UA 1SKRA 2G8UA 1NGHA 3I0RA 4KO0A 1RT5A 3AGKA 3CJ7A 3R6MA 4ELTA 1XNRK 2O8EA 1YHQN 4DR6K 3T3FA 3RR7A 4WCEL 3OVNA 1QSLA 5JICA 4CJLA 3DJCA 4AHRA 5TKWA 3LP0A 4A5AA 1JKHA 3OBWA 2HHVA 3EKUA 3ZETB 4DV7K 4M3WA 3SMPA 5KQDA 3LM2A 1VAZA 1SL0A 4IOCL 4I6MB 4FPBA 3ZT3A 4H03B 4CJVA 2QEXN 4KPYA 4MLEA 3OJSA 2OCEA 2YI1A 3F73A 4OO1J 4X64K 2HNDA 4FO0A 1S9GA 2P9LB 1VSLA 3C0BA 2FBYA 4CEDA 3QNOA 3HOTA 3NHGA 1QQCA 4M45A 1T44A 3KK3A 3AO2A 3TWHA 5AQHA 5IWAK 1MA9B 5EU7A 2P9UB 1QQNA 3EEQA 2OPPA 1JLAA 2Q0RA 4DWIA 4F8RA 1SUQA 1X9MA 5GAEP 4NO7A 5FPNA 3P83D 1F21A
chains in the Genus database with same CATH topology
1TYQB 2P9PA 2NRWA 4JK7A 4MO4A 1BG3A 1HKBA 3M3ZA 2V7ZA 2HOEA 2ITMA 4A59A 4B1YB 4BC5A 4JKEA 4AM6A 4UY8O 3R9PA 3VTIA 4JKHA 3TPQA 1YAGA 1XC3A 2Q1NA 2FF3B 3VPZA 1NWKA 3QB0A 2H3GX 4IO9L 5GAGP 1ILYA 4EIAA 3I33A 1D4XA 3CETA 1KXPA 2QXLA 3SLCA 4BVPA 2A42A 3CCMN 4FWRA 3DXMB 5KQ8A 5M1QA 2VGNA 4BRLA 4IOAL 3MCPA 3MX5A 1G99A 4M7XA 4MDBA 5BN9A 4LC9B 2GWJA 3JXUA 2FSKA 2P9NB 1Q82O 3I8BA 4A57A 3OHRA 5C15A 5AQSA 3MWPA 2IVOA 1QVGM 3OW2M 1X3MA 3VTHA 2E2OA 3CF5L 1E4FT 5HOOA 3M5RA 2ZJRL 5JVGL 3HRGA 3CI5A 2F7TA 4AM7A 4H0OA 1NGCA 2Q36A 2YHXA 3CERA 1BWFO 3NVMA 3EZWA 5AZIA 4GV3A 4H0YB 2KHOA 4IOXA 2Q0UA 5GAHP 3D2FB 5KPRA 2VWBA 4O5FA 3VMFB 4CZJA 3O1BA 5AFUH 1BA1A 4CZGA 2A6AA 4IDHA 4KH5A 3O8MA 3CCEN 3L4IA 2E88A 3A5MC 3AAQA 5EVZA 4BRGA 1YIJN 3OA9A 2OTJN 3JS6A 3D6RA 5F0XA 3ID8A 3FE1A 3ID6A 5AQMA 4E1JA 4BRQA 3F9MA 3DWLA 2CH5A 3LDLA 1BA0A 1NGGA 3EO3A 2HBJA 3QBXA 1JCFA 1VQON 3AAPA 5FPDA 5AFUA 2QWNA 4K25A 4Z94A 2GELA 3A5NC 3U9DA 1DKGD 4GV9A 4DCHA 3MWTA 5EOYA 4HWIA 4JN4A 4WF9L 3H45C 1T6DA 3U9ZA 1NM1A 1GLFO 2BH1A 4IFEA 3CPWM 3A5OC 3FGUA 4BRNA 3UKUA 2P9SA 3VEWA 5AQYA 4A2BA 4DB3A 1BO5O 2P9IA 1VQ6N 4ISGA 2YX6A 1NMDA 1LCUA 4QS7A 2EWSA 2OTLN 3E9PA 1EO1A 4K43A 4OPAA 3L4QA 1K8AO 4EHTA 1MWMA 4FWPA 4PKIA 3QBWA 1QQOA 1BU6O 4YOWA 5AQXA 2ZF5O 1XUPO 1NGJA 2QWQA 3TSPA 2PFUA 2GUPA 3SK3A 1U2VB 3AY9A 4CZMA 4H5RA 1DEJA 1QQMA 1YUWA 3BF1A 4L3QA 4IJAA 5B8HA 1ZXOA 3CJCA 1YJ9N 3M1FA 3VEOA 4ILJA 5C0YA 4NLCA 3F2KA 1SZ2A 1ZBSA 1MDUB 3SMSA 2NRXA 1OVYA 1SQKA 1VQLN 4FL9A 4ISFA 4GY2B 3H6EA 4FWOA 1S22A 5E26A 3P39A 3UB5A 3ZX0A 4BG8A 3ATUA 3SAGA 3DXKA 3WT0A 3CCRN 2Q31A 3HM8A 4JKAA 3BP8A 2VGMA 3Q7CA 2OANA 1HUXA 4YDUC 5AQLA 4FOIA 5EX5A 3BF3A 3PLAA 1QZ5A 3CJ9A 1S72N 4R79A 3K9JA 2D1KA 1K8KB 4CI6A 1E4GT 5AQOA 3IDHA 4IEIA 4H5WA 5AQVA 1KD1O 3CJAA 2ZJQL 4CD1A 4CZEA 3EE8A 4WQ5C 3NMUA 4H0TB 4PL8A 4BC4A 5F1XA 2W40A 1ESVA 5TKYA 1H1VA 4BR5A 2E20A 3GE1A 4PKHA 1VQPN 4BQLA 5CE3A 4JKBA 1YF5L 5MLCQ 1NGEA 3P4IA 3ZEUA 4HTLA 5C10A 1VQ4N 3VGLA 3QDKA 3EE9A 4BGBA 3RVCA 3UKRA 3N4QA 4NB4A 4A62A 3HSCA 2E1YA 2FLOA 4BRAA 3H1QA 1NGDA 1C0FA 2KLAA 4YOUA 2P9PB 4K41A 4YOTA 4A2AA 2A3ZA 3ZX3A 2ZGZA 4MO5A 1M1KO 1ZC6A 3OBYA 2QW9A 3K9KA 3MK6A 3MN5A 5BREA 4O8KA 5AZJA 3G6EN 3GG4A 3O9QA 2CH6A 3MMVA 3R3LA 2E1ZA 5BRHA 4A61A 1YJWN 1HPMA 3O6WA 2HBKA 5GIOA 4KH4A 4FPAA 3D2EA 3HBTA 4BR7A 1IJJA 1ATSA 1O13A 2BUPA 2WC9A 3C7NA 3AGRA 3E1YA 4JEPA 1KAZA 3ATVA 1HLUA 3M6GA 3VEXA 2WBNA 3VETA 4OPHA 1QHAA 3BUZB 3QFPA 2FSNA 2UYTA 3FZFA 1J6ZA 4F9OA 1W97L 4BY9C 3CCJN 2V51B 4IWVA 5AZIB 2QWLA 3A5LC 4Y0WA 5LJWA 3VEYA 2E2NA 2HMPA 3MN9A 3VOVA 4B1XB 5H1SQ 3H1VX 5KPTA 5BPNA 5AQPA 1ATRA 2VCPA 3VESA 2QA4N 4FVUA 4IEEA 4JKCA 1N8RO 4C1NK 1W2BM 3A0IX 5BPMA 2ASMA 5HL7L 5JLHA 2QI2A 3LL3A 4BRPA 2F9WA 3J8AA 2V52B 2IVPA 4JD2A 4GV6A 1Y64A 3QFUA 4CBUA 3O9RA 4MLHA 4BQZA 1RDUA 4H0XB 4CJ7A 4DHYA 3CMAN 3E9OA 4BRCA 4H0VB 3CXCM 3SAHA 3BEXA 1KQSM 3GL1A 3R1XA 2HF3A 2PAVA 5C2FA 3A8YA 3S41A 1JJ2M 1ATNA 3EN9A 3IKMA 4FWQA 1TUYA 2HSTA 4PL7A 5M1FA 1T6CA 3U8XA 3WXLA 3IUCA 2P9SB 5EY4A 3UKUB 5C2DA 2A41A 4B1VA 5EXWA 5GADP 2P9IB 2JWLA 3SBTA 2J4RA 3EKSA 5I9EB 2ZJPL 2NRHA 2YHYA 3DLLL 2DPNA 4CZLA 5LJVA 1CZAN 4YDUA 3ZYYX 3O1WA 3PIPL 1YJNN 3TTFA 3I56N 1GLBG 3SJHA 3EL2A 3CCQN 2GWKA 4JK8A 2A5XA 4H5NA 3TTDA 3ZETA 1S3XA 3LDOA 3LDPA 3CC4N 4KBOA 3VERA 3B8AX 4QS8A 2NRVA 1HKCA 3VF2A 5DM7L 1MWKA 2CGJA 1VQNN 4WQ5A 4I6MA 4DKWA 1NGFA 3HTVA 1GLCG 3O9SA 3CD6N 2P9KA 4BVOA 2HBLA 4CBXA 2E8AA 4H0PA 1SS6A 1U6ZA 4NLBA 1NGIA 3QICA 4RWTA 5CR4A 4BRDA 3ZX2A 2P9LA 3ULEA 3TTCA 4JHDA 3G4SN 3CPEA 4FSVA 3J7ZO 3ENHA 2D4WA 3MX2A 3KVGA 2ASPA 3DXKB 4FOEA 3FLCO 3MN7A 2ZGYA 3C6AA 1P90A 2E2PA 3HZ6A 4QS9A 2CGKA 1VQKN 2CGLA 3LM9A 2NRRA 4WFAL 4CZFA 2P9UA 1WOQA 5JMVA 3RSEA 3T69A 1SAZA 4CZKA 4IO8A 4FWMA 4XH4A 3WEEA 4C23A 4JKGA 2QWOA 4BROA 3G25A 5M1PA 3G71N 1NGAA 3MDQA 1QZ6A 3CIPA 4IZ9A 1TYQA 1NLVA 2QWPA 4G9ZA 3C6HA 3CC2N 2JWKA 3FZHA 4IXCA 2YJFA 4PKGA 1K73O 3VF6A 1JCGA 1V4TA 3FR0A 5AQJA 4FWNA 4BR9A 3NVKA 4ILGB 3VGKA 3TU5A 3P31A 3UKRB 2NLXA 5AQIA 3E9LA 2BTFA 4JAXA 5AQZA 3HI0A 1HKGA 2ZWHA 1HX1A 2VYPA 1RGIA 3KHYA 4WQ4C 5FPMA 4B1WB 3DXMA 2W41A 3O5BA 4K42A 3WXMB 3H3OB 1VQMN 3WXJA 2P9NA 3LDQA 4ILHA 4BRMA 1NGBA 5AZJB 3MCAB 4O8UA 4BR4A 1DT9A 2D0PA 4H5VA 4KH6A 2HF4A 4YOYA 2YJEA 3GBTA 5BPLA 4BR0A 4B9QA 4WFBL 3IMXA 3D2EB 4YOVA 1GLJO 1YI2N 2WFBA 3Q7BA 4WFNL 5GIPA 3C7NB 2ASOA 2V7YA 1BDGA 4YORA 4BG9A 1IG8A 2GTDA 5C12A 3D2FA 5GINA 1VQ9N 4EAHD 1V4SA 1C0GA 1VQ5N 2GEMA 1M90O 2Q97A 1Q7YO 2HBMA 4JNEA 3CCUN 4XH5A 2QTDA 1DGKN 1LOTB 1NBWA 2GX9A 5DM6L 3VEZA 1HJOA 3HOSA 1YVNA 5F2RA 4PHTX 3VENA 4CZIA 4U7BA 4IJNA 1GLAG 3L6QA 3VGMA 1YITN 3R8EA 1Z6RA 2Q2RA 1NJIO 3WQTA 3FZKA 4C1NI 2A40A 2FSJA 4M7YA 1JCEA 3GDQA 5AQRA 2D0OA 3CJ1A 3VF4A 1X9JA 2YCHA 4BRHA 5BRFA 1Q18A 1TUUA 2QWRA 5JVHL 3O08A 4CBWA 3E66A 3VEVA 3O9UA 4RTFD 4BREA 2RE2A 2RHKA 4BC3A 3WUHA 4J8FA 4JD2B 5AQFA 2WUSA 1QVFM 2IVNA 3L0QA 5ADXH 3TSQA 4BC2A 4BRFA 5ELZA 4EHUA 1Q81O 5AQNA 4BRIA 5AQTA 1GLEG 1KAYA 5BRDA 4MDAA 4A5BA 2AA4A 4JK9A 2F9TA 4B1ZA 2NNWA 4YOXA 3CMEN 1KC8O 3DAWA 1Q86O 5AR0A 2NZTA 5BR9A 3UE5A 1RDWX 3N4PA 4JKFA 3SAFA 3I55N 1Z05A 3KWIA 4GVEA 4DQ8A 3MN6A 1NGHA 4M63C 3SBGA 5LY3A 3AGKA 3CJ7A 1R59O 3R6MA 4XEIA 5CHIA 1YHQN 1X3NA 1P8ZA 5ADXA 3O9TA 4WCEL 4B1UB 5AQGA 4JKDA 5JLFA 1U2VA 3FZMA 3CCVN 1XQSC 3W3DA 4EFHA 4U67L 3W0LA 4GNIA 3P38A 5JICA 3F5TA 3DJCA 5TKWA 1OKJA 3IFRA 4A5AA 3KWGA 3FFKB 3O4WA 5BN8A 1BOTO 4BRKA 3OBWA 1KAXA 5M1NA 4FWSA 3CQYA 4ISEA 2I7PA 3EKUA 3ZETB 3CQXA 4FWKA 2E2QA 4BR2A 1K9MO 5AQUA 3SMPA 5KQDA 5M1OA 4RCHA 3ENOA 2YHWA 3PIOL 3LM2A 4H5TA 1VAZA 3CC7N 3AARA 4IOCL 4I6MB 4CD3A 5AQWA 3WXKA 3CCSN 4FPBA 3CCLN 3KZBA 4CZHA 3C65A 4WYBA 1T3VA 2P9KB 2PBDA 3O80A 4H03B 3ENBA 2QEXN 2QM1A 4MLEA 1YXQA 2YI1A 1VQ8N 4OO1J 3WXIA 2I7NA 2QWMA 4FO0A 2NRZA 1K8KA 2P9LB 2FXUA 3ULEB 1VQ7N 4JHDB 1RFQA 3C0BA 3H3NO 3T7ZA 2AP1A 2FF6A 3KK7A 3CHWA 3WQUA 3D7EO 1EQYA 5E84A 1GLLO 3HOTA 3H46O 3LDNA 2KKZA 3QMLA 1T44A 4WQ4A 4BGAA 3U4LA 1WUAA 5AQHA 2IIRA 5KPZA 2NRTA 1MA9B 1BUPA 2P9UB 5M1KA 1QQNA 3RSEB 5AQKA 5FPEA 4AF1A 2Q0RA 3WEEB 3ZEUB 4JKGB 5GAEP 3CJBA 4NO7A 4XH1A 5FPNA 5AQQA 3TSUA 3FZLA 4FWLA 1GLDG 3GOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYQ B;  2P9P A;  4MO4 A;  1BG3 A;  1HKB A;  3M3Z A;  2V7Z A;  2HOE A;  2ITM A;  4B1Y B;  4BC5 A;  4AM6 A;  3R9P A;  3TPQ A;  1YAG A;  1XC3 A;  2Q1N A;  2FF3 B;  3VPZ A;  1NWK A;  3QB0 A;  2H3G X;  4EIA A;  3I33 A;  1D4X A;  3CET A;  1KXP A;  2QXL A;  3SLC A;  4BVP A;  2A42 A;  4FWR A;  3DXM B;  5KQ8 A;  4BRL A;  3MCP A;  1G99 A;  4M7X A;  5BN9 A;  4LC9 B;  2GWJ A;  3JXU A;  2FSK A;  2P9N B;  3I8B A;  3OHR A;  5AQS A;  2IVO A;  1X3M A;  2E2O A;  1E4F T;  3CI5 A;  4AM7 A;  4H0O A;  1NGC A;  2Q36 A;  2YHX A;  3CER A;  1BWF O;  3EZW A;  5AZI A;  4H0Y B;  2KHO A;  2Q0U A;  3D2F B;  5KPR A;  2VWB A;  4O5F A;  4CZJ A;  3O1B A;  5AFU H;  1BA1 A;  4CZG A;  2A6A A;  3O8M A;  3L4I A;  2E88 A;  3A5M C;  3AAQ A;  5EVZ A;  4BRG A;  3JS6 A;  5F0X A;  3ID8 A;  3FE1 A;  5AQM A;  4E1J A;  4BRQ A;  3F9M A;  3DWL A;  2CH5 A;  3LDL A;  1BA0 A;  1NGG A;  3EO3 A;  3QBX A;  1JCF A;  3AAP A;  5FPD A;  5AFU A;  2QWN A;  4K25 A;  4Z94 A;  2GEL A;  3A5N C;  3U9D A;  1DKG D;  4DCH A;  5EOY A;  4HWI A;  4JN4 A;  3H45 C;  1T6D A;  3U9Z A;  1NM1 A;  1GLF O;  3A5O C;  3FGU A;  4BRN A;  3UKU A;  2P9S A;  3VEW A;  5AQY A;  4A2B A;  4DB3 A;  1BO5 O;  2P9I A;  4ISG A;  1NMD A;  1LCU A;  4QS7 A;  2EWS A;  4K43 A;  4EHT A;  1MWM A;  4FWP A;  4PKI A;  3QBW A;  1QQO A;  1BU6 O;  5AQX A;  2ZF5 O;  1XUP O;  1NGJ A;  2QWQ A;  2GUP A;  3SK3 A;  1U2V B;  3AY9 A;  4CZM A;  4H5R A;  1DEJ A;  1QQM A;  1YUW A;  3BF1 A;  4L3Q A;  4IJA A;  5B8H A;  1ZXO A;  3CJC A;  3M1F A;  3VEO A;  1SZ2 A;  1ZBS A;  1MDU B;  3SMS A;  1SQK A;  4FL9 A;  4ISF A;  4GY2 B;  3H6E A;  4FWO A;  1S22 A;  5E26 A;  3UB5 A;  3ZX0 A;  4BG8 A;  3ATU A;  3DXK A;  3WT0 A;  2Q31 A;  3HM8 A;  3BP8 A;  2OAN A;  1HUX A;  4YDU C;  5AQL A;  4FOI A;  5EX5 A;  3BF3 A;  1QZ5 A;  3CJ9 A;  2D1K A;  1K8K B;  4CI6 A;  1E4G T;  5AQO A;  3IDH A;  4H5W A;  5AQV A;  3CJA A;  4CD1 A;  4CZE A;  4WQ5 C;  4H0T B;  4PL8 A;  4BC4 A;  5F1X A;  2W40 A;  1ESV A;  5TKY A;  1H1V A;  4BR5 A;  2E20 A;  3GE1 A;  4PKH A;  4BQL A;  5CE3 A;  1NGE A;  3P4I A;  3ZEU A;  4HTL A;  3VGL A;  3QDK A;  4BGB A;  3UKR A;  4NB4 A;  4A62 A;  3HSC A;  2E1Y A;  2FLO A;  4BRA A;  3H1Q A;  1NGD A;  1C0F A;  2P9P B;  4K41 A;  4A2A A;  2A3Z A;  3ZX3 A;  2ZGZ A;  4MO5 A;  1ZC6 A;  2QW9 A;  3MK6 A;  5BRE A;  3MN5 A;  4O8K A;  5AZJ A;  3GG4 A;  2CH6 A;  3MMV A;  2E1Z A;  5BRH A;  4A61 A;  1HPM A;  3O6W A;  4FPA A;  3D2E A;  3HBT A;  4BR7 A;  1IJJ A;  1ATS A;  2BUP A;  3C7N A;  1KAZ A;  3ATV A;  1HLU A;  3M6G A;  3VEX A;  3VET A;  1QHA A;  3BUZ B;  3QFP A;  2FSN A;  2UYT A;  3FZF A;  1J6Z A;  4F9O A;  2V51 B;  4IWV A;  5AZI B;  2QWL A;  3A5L C;  4Y0W A;  5LJW A;  3VEY A;  2E2N A;  2HMP A;  3MN9 A;  3VOV A;  4B1X B;  3H1V X;  5KPT A;  5BPN A;  5AQP A;  1ATR A;  2VCP A;  3VES A;  3A0I X;  5BPM A;  2ASM A;  5JLH A;  3LL3 A;  4BRP A;  2F9W A;  3J8A A;  2V52 B;  2IVP A;  4JD2 A;  1Y64 A;  3QFU A;  4CBU A;  4MLH A;  4BQZ A;  4H0X B;  4CJ7 A;  4DHY A;  4BRC A;  4H0V B;  3BEX A;  3GL1 A;  2HF3 A;  2PAV A;  3A8Y A;  3S41 A;  1ATN A;  3EN9 A;  4FWQ A;  1TUY A;  4PL7 A;  1T6C A;  3U8X A;  3WXL A;  3IUC A;  2P9S B;  5EY4 A;  3UKU B;  2A41 A;  4B1V A;  5EXW A;  2P9I B;  5I9E B;  2J4R A;  3EKS A;  2NRH A;  2YHY A;  2DPN A;  4CZL A;  5LJV A;  1CZA N;  4YDU A;  3O1W A;  1GLB G;  3SJH A;  3EL2 A;  2GWK A;  2A5X A;  4H5N A;  3ZET A;  1S3X A;  3LDO A;  3LDP A;  4KBO A;  3VER A;  3B8A X;  4QS8 A;  1HKC A;  3VF2 A;  1MWK A;  2CGJ A;  4WQ5 A;  4I6M A;  1NGF A;  3HTV A;  1GLC G;  2P9K A;  4BVO A;  4CBX A;  2E8A A;  4H0P A;  1U6Z A;  1NGI A;  3QIC A;  4RWT A;  4BRD A;  3ZX2 A;  2P9L A;  3ULE A;  4JHD A;  4FSV A;  3ENH A;  2D4W A;  3KVG A;  2ASP A;  3DXK B;  4FOE A;  3FLC O;  3MN7 A;  2ZGY A;  4QS9 A;  2E2P A;  3HZ6 A;  2CGK A;  2CGL A;  3LM9 A;  4CZF A;  2P9U A;  1WOQ A;  5JMV A;  3RSE A;  1SAZ A;  4CZK A;  4IO8 A;  4FWM A;  4XH4 A;  3WEE A;  4C23 A;  2QWO A;  4BRO A;  3G25 A;  1NGA A;  3MDQ A;  1QZ6 A;  3CIP A;  4IZ9 A;  1TYQ A;  1NLV A;  2QWP A;  4IXC A;  3FZH A;  2YJF A;  4PKG A;  3VF6 A;  1JCG A;  1V4T A;  3FR0 A;  5AQJ A;  4FWN A;  4BR9 A;  3VGK A;  3TU5 A;  3UKR B;  2NLX A;  5AQI A;  5AQZ A;  2BTF A;  4JAX A;  3HI0 A;  1HKG A;  2ZWH A;  1HX1 A;  2VYP A;  1RGI A;  3KHY A;  4WQ4 C;  5FPM A;  4B1W B;  3DXM A;  2W41 A;  3O5B A;  4K42 A;  3H3O B;  3WXJ A;  2P9N A;  3LDQ A;  4BRM A;  1NGB A;  5AZJ B;  4BR4 A;  2D0P A;  4H5V A;  2HF4 A;  2YJE A;  3GBT A;  5BPL A;  4BR0 A;  4B9Q A;  3IMX A;  3D2E B;  1GLJ O;  3C7N B;  2ASO A;  2V7Y A;  1BDG A;  4BG9 A;  1IG8 A;  2GTD A;  3D2F A;  4EAH D;  1V4S A;  1C0G A;  2GEM A;  2Q97 A;  4JNE A;  4XH5 A;  1DGK N;  1LOT B;  1NBW A;  3VEZ A;  1HJO A;  1YVN A;  5F2R A;  3VEN A;  4CZI A;  4IJN A;  1GLA G;  3L6Q A;  3VGM A;  3R8E A;  1Z6R A;  2Q2R A;  3WQT A;  3FZK A;  2A40 A;  2FSJ A;  4M7Y A;  1JCE A;  3GDQ A;  5AQR A;  2D0O A;  3CJ1 A;  3VF4 A;  1X9J A;  2YCH A;  4BRH A;  5BRF A;  1Q18 A;  1TUU A;  2QWR A;  3O08 A;  4CBW A;  3VEV A;  4BRE A;  4RTF D;  4BC3 A;  3WUH A;  4J8F A;  4JD2 B;  5AQF A;  2WUS A;  2IVN A;  3L0Q A;  5ADX H;  4BC2 A;  4BRF A;  5ELZ A;  4EHU A;  5AQN A;  4BRI A;  5AQT A;  1GLE G;  1KAY A;  5BRD A;  2AA4 A;  2F9T A;  4B1Z A;  3DAW A;  5AR0 A;  2NZT A;  5BR9 A;  3UE5 A;  1RDW X;  1Z05 A;  4DQ8 A;  3MN6 A;  1NGH A;  4M63 C;  5LY3 A;  3CJ7 A;  3R6M A;  1R59 O;  4XEI A;  1X3N A;  1P8Z A;  5ADX A;  4B1U B;  5AQG A;  5JLF A;  1U2V A;  3FZM A;  1XQS C;  3W3D A;  4EFH A;  3W0L A;  4GNI A;  5JIC A;  3DJC A;  1OKJ A;  3IFR A;  3FFK B;  3O4W A;  5BN8 A;  1BOT O;  4BRK A;  1KAX A;  4FWS A;  3CQY A;  4ISE A;  2I7P A;  3EKU A;  3ZET B;  3CQX A;  4FWK A;  2E2Q A;  4BR2 A;  5AQU A;  3SMP A;  5KQD A;  4RCH A;  3ENO A;  2YHW A;  3LM2 A;  4H5T A;  3AAR A;  4I6M B;  4CD3 A;  5AQW A;  3WXK A;  4FPB A;  3KZB A;  4CZH A;  4WYB A;  2P9K B;  2PBD A;  4H03 B;  3O80 A;  2QM1 A;  4MLE A;  1YXQ A;  2YI1 A;  3WXI A;  2I7N A;  2QWM A;  4FO0 A;  1K8K A;  2P9L B;  2FXU A;  3ULE B;  4JHD B;  1RFQ A;  3C0B A;  3H3N O;  2AP1 A;  2FF6 A;  3WQU A;  3CHW A;  3D7E O;  1EQY A;  5E84 A;  1GLL O;  3H46 O;  3LDN A;  3QML A;  1T44 A;  4WQ4 A;  4BGA A;  3U4L A;  1WUA A;  5AQH A;  2IIR A;  5KPZ A;  1MA9 B;  1BUP A;  2P9U B;  1QQN A;  3RSE B;  5AQK A;  5FPE A;  2Q0R A;  3WEE B;  3ZEU B;  3CJB A;  4NO7 A;  4XH1 A;  5FPN A;  5AQQ A;  3FZL A;  4FWL A;  1GLD G;  3GOI A; 
#chains in the Genus database with same CATH topology
 4DFJ A;  1RT4 A;  1EWQ A;  2P9P A;  4DTR A;  2W6L A;  4MO4 A;  2V7Z A;  2HOE A;  4JKE A;  4AM6 A;  4UY8 O;  3E01 A;  4DU1 A;  4I9L A;  4CIE A;  5IT9 O;  3I33 A;  1KXP A;  2QXL A;  1B9D A;  1HNW K;  5M1Q A;  4IOA L;  3MCP A;  4CHN A;  3TAP A;  4LC9 B;  2P9N B;  4A57 A;  4OKK A;  2X78 A;  4CGH A;  2Z1J A;  3VQ4 A;  4B9V A;  4KI4 A;  3CF5 L;  4HUE A;  3KLG A;  2ZJR L;  4AM7 A;  4H0O A;  2VG6 A;  5J2N A;  3CER A;  5AZI A;  4ZTF A;  3VA3 A;  4GV3 A;  4H0Y B;  3ZSO A;  3D2F B;  5KPR A;  4CZJ A;  3O1B A;  2IS3 A;  2IC3 A;  4FJ8 A;  4F2S A;  2UUA K;  3KKS A;  4BRG A;  3D6R A;  5F0X A;  3DWL A;  2FC0 A;  1NMN A;  1NGG A;  4DLG A;  4K8X A;  1JCF A;  3OYG A;  1VQO N;  4K25 A;  3QES A;  1RBU A;  3OY9 A;  3U9D A;  5EOY A;  2F8S A;  3WNG A;  3MXI A;  4HWI A;  4Z4H A;  3VQA A;  3A5O C;  3HST B;  3FGU A;  2WTU A;  4BRN A;  4KAZ A;  4DB3 A;  3J80 O;  1ZBI A;  4M3R A;  2EWS A;  3NGI A;  1N33 K;  3THX B;  3ITH A;  1KSP A;  4OPJ A;  4K43 A;  1FKP A;  1K8A O;  4FJ7 A;  1MWM A;  1KFD A;  4PKI A;  2VQE K;  2ZF5 O;  3ZSQ A;  4Q5V A;  4IKF A;  1S6P A;  1WNS A;  1YUW A;  1XMO K;  3ZLJ A;  5B8H A;  3RTV A;  4ILJ A;  1SZ2 A;  4DMN A;  4GKJ K;  4GY2 B;  3UB5 A;  4X62 K;  3P39 A;  3WT0 A;  3JYT A;  3HM8 A;  4JKA A;  4NXN K;  3Q7C A;  5HRO A;  4YDU C;  1HUX A;  4ID1 A;  5AQL A;  5EX5 A;  3HL8 A;  3BF3 A;  3O3G A;  3HM9 A;  1KFS A;  2ZE2 A;  3C6T A;  4DV6 K;  1N32 K;  2VQF K;  4B3O A;  4IEI A;  4KHN A;  4H5W A;  5AQV A;  4DTO A;  3EE8 A;  2ZD1 A;  5F1X A;  3C95 A;  1T05 A;  1VQP N;  3MXJ A;  2P51 A;  1YF5 L;  2G8K A;  5FRN A;  3QDK A;  4BGB A;  3UKR A;  4CIF A;  2O8B A;  2FLO A;  3H1Q A;  1NGD A;  1KVA A;  4A2A A;  3ZX3 A;  2ZGZ A;  3OBY A;  3K9K A;  3MK6 A;  4WE1 A;  4DR2 K;  4FJH A;  3D45 A;  3AVK A;  3GG4 A;  1C0M A;  4CHQ A;  2E1Z A;  1U04 A;  1BGX T;  1HPM A;  3O6W A;  1YJW N;  4J2E A;  5GIO A;  4KH4 A;  3D2E A;  2YNI A;  3HBT A;  3IS9 A;  4BR7 A;  4B3R K;  4JEP A;  4CFB A;  1HLU A;  4K0K K;  1HNX K;  3FFI A;  3KLF A;  2HW3 A;  3QFP A;  1KRP A;  1TGO A;  3FZF A;  1J6Z A;  1WSJ A;  2Y1J A;  4CJR A;  3VEY A;  2E2N A;  2HMP A;  3DRR A;  2QKK A;  1J5E K;  1OH6 A;  5KPT A;  5BPN A;  4FM2 A;  3PO5 A;  4JKC A;  1BIS A;  5HL7 L;  3DRP A;  3K5N A;  1WLJ A;  3I0S A;  3QFU A;  4HCC A;  4MLH A;  5KRS A;  1RDU A;  3CMA N;  1BCO A;  4E7L A;  4KKO A;  3SAH A;  2P1J A;  3ALY A;  3P1G A;  5CZ1 A;  3R1X A;  2HF3 A;  3K5L A;  5HRN A;  1MU2 A;  3S41 A;  1UA1 A;  1ATN A;  4KHU A;  2HHU A;  3IKM A;  3AA2 A;  3RRG A;  5EY4 A;  2A41 A;  5GAD P;  5I9E B;  4FYD A;  3AO5 A;  3DLL L;  3T19 A;  4YDU A;  3O1W A;  3PIP L;  4LH4 A;  3LDP A;  4DSK A;  4KBO A;  1LAW A;  3VF2 A;  3QNN A;  2D0C A;  3HTV A;  3O9S A;  1GLC G;  3RMC A;  2E8A A;  4H0P A;  1NGI A;  2DTU A;  3QIC A;  1VSF A;  4RWT A;  3S3N A;  5LMU K;  1U45 A;  1W9H A;  3MX2 A;  4CEE A;  3FLC O;  1K6Y A;  2ZGY A;  1IO2 A;  2CGL A;  4B8C A;  4M42 A;  4RW7 A;  5JMV A;  2HNY A;  3RSE A;  3NGZ A;  3HP9 A;  3WEE A;  4JKG A;  4QAG A;  3MDQ A;  3CIP A;  1TYQ A;  3DLG A;  4JI8 K;  3CC2 N;  2BE2 A;  2JWK A;  4BWM A;  3TU5 A;  3P31 A;  1OH5 A;  5AQI A;  2BTF A;  4C8N A;  4DV2 K;  4WQ4 C;  3TI0 A;  3DXM A;  4DSI A;  2W41 A;  1NK6 A;  3AA4 A;  1BL3 A;  3ZCM A;  2P5G A;  1TAU A;  3HK2 A;  3ZT2 A;  5AZJ B;  4KH6 A;  4DF4 A;  1A5V A;  3IMX A;  1WBD A;  2WFB A;  2ASO A;  5C0Y A;  1VQK N;  1IG8 A;  2YKM A;  4JNE A;  5CYQ A;  4CFC A;  1DGK N;  4DTN A;  5F2R A;  4PHT X;  4U7B A;  4NCB A;  3OYD A;  3AVB A;  1HYV A;  1Z6R A;  4DTS A;  3WQT A;  4DSF A;  3EYZ A;  1XC9 A;  3AVM A;  4LF4 K;  1VSJ A;  3PO4 A;  3CJ1 A;  4BRH A;  4B3T K;  5J2P A;  3VN5 A;  2KQ2 A;  1Q18 A;  1TUU A;  4YY3 K;  3PY8 A;  3O08 A;  4CBW A;  3VEV A;  4BRE A;  4RTF D;  5HRR A;  2RF2 A;  4BC3 A;  4I9Q A;  4JD2 B;  4FLY A;  1QVF M;  2HHQ A;  3L2U A;  1BHL A;  1Q81 O;  3VQD A;  5AQT A;  1S5J A;  3DRS A;  2OPR A;  2NNW A;  3QLH A;  3M8Q A;  5BR9 A;  1N36 K;  1RDW X;  2QXF A;  1Q9Y A;  1Z05 A;  3KWI A;  3MN6 A;  4B3M K;  3SBG A;  4TSX A;  5LY3 A;  1R59 O;  4XEI A;  3U6F A;  4CES A;  1EX4 A;  1P8Z A;  1X3N A;  2HNZ A;  3O9T A;  4LD0 A;  4FM0 A;  1D9F A;  5AQG A;  4JKD A;  4M3Y A;  3THY B;  4EFH A;  3K2P A;  2JLE A;  4H4M A;  3IFR A;  1REV A;  5BN8 A;  1BOT O;  5FRO A;  4FWS A;  3NF9 A;  4ISE A;  2I7P A;  5DMR A;  4F3O A;  3CQX A;  3PX4 A;  4ICL A;  5D3G A;  4BR2 A;  3BZC A;  3ENO A;  2YHW A;  3CC7 N;  5AQW A;  4JLH A;  4FJJ A;  1DLO A;  2A1S A;  4CZH A;  4WYB A;  2Z1G A;  4BE2 A;  2RN2 A;  3B6O A;  4KTQ A;  1VQ8 N;  1RTH A;  3WXI A;  4N47 A;  3ULE B;  2FXU A;  2GV9 A;  4JHD B;  4OGC A;  2HB5 A;  3J7Y P;  4LFB K;  5E84 A;  3H46 O;  3QML A;  1NK7 A;  4WQ4 A;  1IBM K;  3U4L A;  4QOZ B;  5KPZ A;  5M1K A;  1SKW A;  5FPE A;  3CJB A;  4XH1 A;  5AQQ A;  3TSU A;  2QKB A;  2Q3S A;  2KW4 A;  3DM2 A;  3DYA A;  1LW2 A;  2NRW A;  1BG3 A;  3M3Z A;  2R7Y A;  4IG0 A;  4C8K A;  4JKH A;  2UXD K;  1W7A A;  4PQU A;  3TPQ A;  5JS1 A;  1XC3 A;  1KLN A;  3OYL A;  5GAG P;  4FLU A;  4EIA A;  1EXQ A;  2A42 A;  2DY4 A;  4FWR A;  4M7X A;  2OPQ A;  4FJ9 A;  2FSK A;  4CEF A;  3L3U A;  3OHR A;  3WNE A;  5AQS A;  4BE1 A;  2IVO A;  3SV3 A;  3OW2 M;  4B9M A;  4YNQ A;  2YNF A;  4LY7 A;  3VTH A;  1BQM A;  1N6Q A;  1YT3 A;  4G1Q A;  1NGC A;  2HHS A;  1BWF O;  4CER A;  2D0A A;  3OYE A;  4CIG A;  4Z4G A;  3DI6 A;  3NF7 A;  3AO4 A;  1BA1 A;  3SUO A;  2A6A A;  5HBM A;  4DV0 K;  1IBK K;  5LL6 Z;  3L4I A;  1HRH A;  2E88 A;  2O8F B;  3FE1 A;  2ZQB A;  2F96 A;  3D0P A;  3CFR A;  2B5J A;  4BRQ A;  2CH5 A;  3LDL A;  4CF9 A;  4FZY A;  2XO7 A;  2HBJ A;  4DUY K;  2QWN A;  4Z94 A;  2GEL A;  3A5N C;  4FJ5 A;  1DKG D;  1WB9 A;  4JS5 A;  3H45 C;  3U9Z A;  3T1A A;  2Z1H A;  3CPW M;  3DLB A;  3UKU A;  5BR8 K;  2P9I A;  1VQ6 N;  3SPY A;  1EWR A;  1NMD A;  1LCU A;  1EO1 A;  2E6L A;  3ISN C;  4KHQ A;  4CEC A;  1L5U A;  3DLH A;  4X65 K;  3L4Q A;  4IBN A;  3AVL A;  3AVH A;  3DLR A;  4FWP A;  2IAJ A;  4YOW A;  4CFA A;  1NGJ A;  2QWQ A;  3TSP A;  4B9U A;  4JI3 K;  3ZSV A;  1U2V B;  3JSM A;  4L8R B;  3S3O A;  1FXX A;  1ZXO A;  1YJ9 N;  3M1F A;  3VEO A;  4DQP A;  4NLC A;  4FK0 A;  3IRX A;  1NOY A;  2NRX A;  4AHS A;  1KTQ A;  1OVY A;  1SQK A;  1VQL N;  3ZX0 A;  3TAF A;  1S22 A;  4ZTJ A;  4KRF A;  4W5N A;  3HPH A;  4FVM A;  4FOI A;  1QZ5 A;  3OTO K;  3CJ9 A;  1S72 N;  4R79 A;  2D1K A;  1K8K B;  4CI6 A;  1E4G T;  3DLE A;  2YV0 X;  1KD1 O;  2ZJQ L;  1WSF A;  4KB1 A;  4XIU A;  1D8Y A;  4FJI A;  1C6V A;  1QE1 A;  1S1W A;  4CJS A;  5HRP A;  2E20 A;  4PKH A;  2D5R A;  2VG7 A;  1I3A A;  4CEB A;  1Z26 A;  3VQ8 A;  4HTL A;  4DTJ A;  3OYB A;  1VQ4 N;  4CJW A;  1Y97 A;  4A62 A;  1FK9 A;  3HSC A;  1NK8 A;  1CZ9 A;  2A3Z A;  4KTW A;  1ZC6 A;  3HYF A;  4DLE A;  3R3L A;  5BRH A;  4C8M A;  4HHT A;  3O4Q A;  3RMA A;  2WC9 A;  3C7N A;  5LMN K;  3LAL A;  2BDP A;  5E41 A;  3M6G A;  3VET A;  4OPH A;  1JXB A;  3PUF A;  4W5T A;  4OJR A;  2G8H A;  4V19 S;  2O8C B;  3A5L C;  4O5B A;  4Y0W A;  5LJW A;  2PY5 A;  1BIZ A;  1RT3 A;  1NKE A;  4B1X B;  5AQP A;  1QSS A;  3VES A;  2Z1I A;  4IEE A;  1N8R O;  4DS4 A;  1W2B M;  5BPM A;  2ASM A;  2O8D A;  3KK1 A;  1WBB A;  1Y64 A;  3G10 A;  3O9R A;  1JLG A;  4CJ7 A;  4DHY A;  4DQQ A;  3E9O A;  4BRC A;  3CXC M;  4C8O A;  1FKO A;  2IDO A;  1BI4 B;  1FW6 A;  4FZZ A;  3QEP A;  2KFZ A;  1TUY A;  2HST A;  3TAR A;  2G8W A;  5M1F A;  2PYJ A;  1T6C A;  4CF1 A;  3IUC A;  2P9S B;  2VWK A;  5C2D A;  3NAE A;  5EXW A;  3T1Y K;  2JWL A;  4CVN E;  5AJ3 K;  3L8B A;  4JI2 K;  2YHY A;  1ASU A;  4X66 K;  4CZL A;  4CJ4 A;  3ZYY X;  4AHU A;  1ITG A;  2GWK A;  2A5X A;  1J53 A;  3ZET A;  1EKE A;  3HT3 A;  3VER A;  4QS8 A;  5DM7 L;  2NRV A;  1HKC A;  3AVF A;  4DR7 K;  4I6M A;  1LV5 A;  4DKW A;  1NGF A;  3PX0 A;  2I5J A;  2LSN A;  2HBL A;  3A2F A;  3HJF A;  5CR4 A;  1VRT A;  2JGU A;  2P9L A;  3PSI A;  3TTC A;  4EZ6 A;  3L2V A;  2VG5 A;  4FSV A;  4LF9 K;  1QSY A;  4K8Z A;  3DXK B;  1A5W A;  3MN7 A;  2E2P A;  2CGK A;  1TKD A;  2F8T A;  3QEI A;  4FLW A;  3CFP A;  2NRR A;  4WFA L;  2P9U A;  3MAQ A;  3OS0 A;  4CZK A;  4IO8 A;  4FWM A;  4XH4 A;  2WON A;  4C23 A;  5T7B A;  2QWO A;  3DOK A;  4BRO A;  5M1P A;  3G71 N;  1QZ6 A;  4DSL A;  4IZ9 A;  1NLV A;  3L3V A;  2QWP A;  3C6H A;  3FZH A;  2YJF A;  4PKG A;  3THW B;  3VF6 A;  3ZT4 A;  5AQJ A;  4E7H A;  4ILG B;  2RKI A;  1VSD A;  4FXD A;  5AQZ A;  1RBR A;  1YVU A;  3E9L A;  1RDA A;  3HI0 A;  4N41 A;  5FDL A;  2OZS A;  3AA3 A;  2VYP A;  1RT7 A;  1RGI A;  3KHY A;  4B3S K;  4KHP K;  1OH8 A;  4K42 A;  4OX9 K;  1XHX A;  2OYQ A;  1IKV A;  2P9N A;  4ILH A;  4BRM A;  3QER A;  2D0P A;  3VQ5 A;  4YOY A;  1L3U A;  4FJG A;  1WAJ A;  1ZBL A;  4BR0 A;  3O4N A;  1HYS A;  5KGW A;  3MEG A;  1HJR A;  5GIP A;  4IDK A;  3PLA A;  1VQ9 N;  1I39 A;  1VHX A;  3D2F A;  4EAH D;  1VQ5 N;  2GEM A;  2Q97 A;  1J9A A;  3LAM A;  4GMJ B;  2QTD A;  1LOT B;  1NBW A;  1WN7 A;  3DMJ A;  3VEZ A;  3SUN A;  1QTM A;  4BDZ A;  1HJO A;  3S9H A;  1ZYQ A;  3R8E A;  3LWL A;  3QET A;  3FZK A;  1BIU A;  4KV8 A;  2FSJ A;  2WOM A;  3GDQ A;  5AQR A;  4FM1 A;  1TK5 A;  3AA5 X;  2QWR A;  1JL2 A;  4KTZ A;  3E66 A;  2RE2 A;  4J8F A;  5AQF A;  1UA0 A;  2FBV A;  4DTX A;  4HTU A;  5ADX H;  4BC2 A;  5ELZ A;  1NJW A;  4BRI A;  1KAY A;  3QIO A;  1VSM A;  4JK9 A;  3J81 O;  3THX A;  4YOX A;  1J54 A;  3EZ5 A;  1GOA A;  3UE5 A;  3N4P A;  3I55 N;  2ITG A;  4GVE A;  3NDK A;  4FW2 A;  1TKZ A;  4M63 C;  2KZM A;  4Z4F A;  4B1U B;  2G8F A;  5JLF A;  4FW1 A;  3NCI A;  3WNF A;  4U67 L;  3OYH A;  3QEV A;  4GNI A;  2XY6 A;  3F5T A;  3KD5 E;  3V9S A;  3KWG A;  3FFK B;  4BRK A;  5M1N A;  1KAX A;  3CQY A;  4E1N A;  2E2Q A;  1K9M O;  5M1O A;  4RCH A;  3PIO L;  2YKN A;  3MXM A;  4H5T A;  3HVR A;  3AAR A;  4RW6 A;  3QIP A;  3WXK A;  3CCS N;  2HHH K;  3KZB A;  3C65 A;  2P9K B;  2PBD A;  3O80 A;  3LP3 A;  3ENB A;  1IBL K;  3TAG A;  1W0H A;  2I7N A;  2QWM A;  1S9E A;  2NRZ A;  3H3N O;  1A5X A;  3T7Z A;  3HP6 A;  2FF6 A;  3HXM A;  1EQY A;  4LSN A;  1XNQ K;  1GLL O;  1RNH A;  2KKZ A;  1WSG A;  5CY4 A;  3L2Q A;  4Y1D A;  2NRT A;  4DV5 K;  4O4G A;  4CEA A;  5AQK A;  3U3G A;  4AF1 A;  5FLX O;  2HMI A;  1VSH A;  3SNN A;  3ZEU B;  1VK0 A;  3CQ8 A;  4BAC A;  4FWL A;  3GOI A;  3I56 N;  4DTP A;  1CLQ A;  1HKB A;  3WNH A;  1KVC A;  2ITM A;  4BC5 A;  2E6M A;  1C1A A;  3R9P A;  3VTI A;  4OVL A;  2Q1N A;  2E4L A;  3VPZ A;  3LWM A;  3AVG A;  3QB0 A;  4IO9 L;  1D4X A;  4EP5 A;  3SLC A;  4BVP A;  4HUG A;  3PSF A;  3MX5 A;  4MDB A;  1Q82 O;  4DTM A;  5C15 A;  4CW7 B;  1N34 K;  1OH7 A;  3MEC A;  1YTA A;  3TAM A;  1E4F T;  1C1B A;  3M5R A;  5JVG L;  2UUB K;  2BAN A;  3K57 A;  2Q36 A;  3NVM A;  3EZW A;  4W5Q A;  2KHO A;  4O0J A;  2Q0U A;  5GAH P;  4CFD A;  2VWB A;  2E5L K;  1VSI A;  4E3S A;  5AFU H;  1J5O A;  1JL1 A;  4CZG A;  4PWD A;  3OYF A;  4IDH A;  4KH5 A;  3O8M A;  1LW0 A;  3RRH A;  3AAQ A;  1YIJ N;  2OTJ N;  3OA9 A;  4AIL C;  3ID6 A;  5AQM A;  1NG9 A;  4E1J A;  4CGF A;  3F9M A;  3SV4 A;  2FBX A;  1U4B A;  4B9N A;  2W6K A;  3NGY A;  5J2Q A;  3AAP A;  5FPD A;  3KTQ A;  3O3F A;  2PYL A;  4DCH A;  3MWT A;  4Z4E A;  4JYA K;  1CXQ A;  4JN4 A;  3RWU A;  1LWC A;  3F9K A;  1NM1 A;  3VQ9 A;  2BH1 A;  4IFE A;  3H08 A;  1U47 A;  2OPS A;  2HHT A;  4N76 A;  2ETJ A;  3TR8 A;  1BO5 O;  4ISG A;  3RMB A;  2OTL N;  3E9P A;  3SCX A;  4CJQ A;  4CHO A;  3LP2 A;  4CHP A;  1NJY A;  4RW8 A;  3KLI A;  1QQO A;  2O8E B;  4I7F A;  5AQX A;  4CJU A;  2PFU A;  3LPT A;  3SK3 A;  4EP4 A;  3L2R A;  5C42 A;  5SZT A;  3AY9 A;  4H5R A;  3BF1 A;  4IJA A;  5I3U A;  2XY7 A;  4RW4 A;  3CJC A;  1HPZ A;  4BDY A;  3MED A;  1NKC A;  1MDU B;  5KGX A;  4DR5 K;  3V81 A;  4ISF A;  5E26 A;  4FWO A;  4RG8 A;  3ATU A;  3SPZ A;  2HVI A;  4F3T A;  2Q31 A;  3BP8 A;  3L2W A;  1UAX A;  4DR4 K;  3SUQ A;  4B9L A;  3K9J A;  4NYF A;  4FK2 A;  1NK4 A;  3CJA A;  2UUC K;  4CZE A;  1RT1 A;  4WQ5 C;  2OZM A;  4H0T B;  4PL8 A;  5CYM A;  1ESV A;  5TKY A;  4BR5 A;  4CEQ A;  1TKX A;  3GE1 A;  3KK2 A;  5CE3 A;  3BGR A;  4JKB A;  3ZEU A;  2P5O A;  3HPO A;  5C10 A;  3VGL A;  1NJZ A;  3NFA A;  3N4Q A;  4NB4 A;  3TAE A;  2YNG A;  4JRQ A;  1S1U A;  1JLE A;  4FJM A;  1TK0 A;  1VSK A;  2P9P B;  4K41 A;  3P5J A;  4DUZ K;  1M1K O;  1HYZ A;  2QW9 A;  3ZT1 A;  1S1T A;  4CF2 A;  4O8K A;  5AZJ A;  3G6E N;  1YTU A;  3NH0 A;  3O9Q A;  4YHH K;  4FZX C;  4CEZ A;  2HBK A;  2W42 A;  3SQ4 A;  1JLB A;  1O13 A;  3AGR A;  3PX6 A;  3VEX A;  1RT2 A;  2WBN A;  4OPK A;  1L3V A;  3BUZ B;  4FJK A;  3SQ2 A;  2UYT A;  3T1H K;  4CJ3 A;  1WAF A;  2DFE A;  4BY9 C;  3CCJ N;  4PUO A;  3AVJ A;  4IWV A;  5AZI B;  4CJP A;  1S1X A;  1X9W A;  3VOV A;  1KLM A;  3H1V X;  3C94 A;  4CJF A;  4NCG A;  2VCP A;  2QA4 N;  4FVU A;  4B08 A;  3OYA A;  2PZS A;  3LL3 A;  3J8A A;  2IVP A;  4JD2 A;  3OS1 A;  1RBS A;  4DTU A;  2XHB A;  4BQZ A;  4E0D A;  3CG7 A;  4E19 A;  4JS4 A;  4M3T A;  4M3X A;  3GL1 A;  4I2Q A;  3NE6 A;  3A8Y A;  1JJ2 M;  4CGI A;  4IG3 A;  4FWQ A;  2YHB A;  4PL7 A;  4AHC A;  1RBV A;  4DG1 A;  2B4J A;  3AVA A;  3WXL A;  4B1V A;  3SBT A;  4E7I A;  3THY A;  2NRH A;  2DPN A;  4EZ9 A;  1CZA N;  2HHX A;  1RDB A;  4PY5 A;  1TKT A;  3HVT A;  3EL2 A;  3K5O A;  3CCQ N;  4JK8 A;  1T03 A;  4CJ5 A;  4E1M A;  3LDO A;  3V4I A;  3CC4 N;  1NKB A;  2BGG A;  4FJN A;  3B8A X;  1VQN N;  1MWK A;  1BQN A;  4WQ5 A;  1TAQ A;  1SKS A;  4OLB A;  3UIQ A;  3CD6 N;  3SUP A;  4M3U A;  1TK8 A;  2ATQ A;  3C6U A;  3TAQ A;  4CBX A;  1SS6 A;  1U6Z A;  4F4K A;  2EX3 A;  4BRD A;  1B92 A;  1IKX A;  3ZX2 A;  3ULE A;  4CK1 A;  4JHD A;  3G4S N;  4O44 A;  4CF0 A;  4DFK A;  1CXU A;  1GOC A;  3ZT0 A;  1IH7 A;  1JLQ A;  4IFY A;  2G8I A;  4CK3 A;  3C6A A;  4QS9 A;  1P90 A;  3V1O A;  4DQI A;  1WOQ A;  1NJX A;  3M8R A;  4W5R A;  1SAZ A;  4LF8 K;  2D0B A;  4JI6 K;  3G25 A;  4N56 A;  3ZSY A;  1Z25 A;  4ZHR A;  1X1P A;  4G9Z A;  4AH9 A;  4IXC A;  3ULD A;  3OYN A;  1K73 O;  1JCG A;  1V4T A;  3FR0 A;  3NVK A;  3U3Y A;  3UKR B;  2NLX A;  3VQC A;  4KFB A;  2O8B B;  1HKG A;  4UQG A;  5C24 A;  2ZWH A;  1BCM A;  3NBP A;  3WXM B;  3H3O B;  3LDQ A;  5KI6 A;  5KTQ A;  3MCA B;  4H5V A;  4KB0 A;  3GBT A;  5BPL A;  4FLV A;  3S3M A;  3D2E B;  1YI2 N;  1BDG A;  4BG9 A;  5C12 A;  2GTD A;  5GIN A;  1V4S A;  3QEW A;  3CCU N;  3PV8 A;  4XH5 A;  1G15 A;  1VSE A;  2GX9 A;  5DM6 L;  3VA0 A;  3HOS A;  3VEN A;  2O4I A;  1N5Y A;  4IJN A;  2O8F A;  1GLA G;  4FLZ A;  3VGM A;  3ASM A;  1YIT N;  4DU4 A;  2IGI A;  4OKE A;  2UU9 K;  1Q8I A;  4M7Y A;  1JCE A;  3HO1 A;  3M8P A;  4DF8 A;  2D0O A;  3VF4 A;  1RBT A;  4N5S A;  5BRF A;  3J7A P;  4ELV A;  4LFA K;  4DS5 A;  2B6A A;  5JVH L;  4F2R A;  3O9U A;  4AHV A;  5J2M A;  3WUH A;  4LF6 K;  2WUS A;  2IVN A;  1ASV A;  3TSQ A;  3AO3 A;  4OKJ A;  5AQN A;  4DFP A;  3V1Q A;  1GLE G;  5BRD A;  1VRU A;  4MDA A;  4DSE A;  4A5B A;  2AA4 A;  2F9T A;  4B1Z A;  3CME N;  2HHW A;  1KC8 O;  1Q86 O;  1KVB A;  1RIL A;  2NZT A;  3KIO A;  5AR0 A;  4JKF A;  3SAF A;  3BDP A;  1S6Q A;  4DQ8 A;  1XMQ K;  1U48 A;  5CHI A;  4GVM A;  5ADX A;  3OYM A;  2VWJ A;  1QS4 A;  1U2V A;  3FZM A;  3CCV N;  1XQS C;  3W3D A;  3W0L A;  3LZJ A;  3P38 A;  1OVQ A;  3KJV A;  1OKJ A;  3O4W A;  4YFU A;  1WSI A;  4RW9 A;  4FWK A;  3CYM A;  4PA1 A;  5AQU A;  4HCB A;  5CZ2 A;  4E7K A;  1IV0 A;  3LAK A;  4CD3 A;  1B9F A;  4CGD A;  4FLT A;  3CCL N;  3VQQ A;  1T3V A;  4BDP A;  2QM1 A;  1YXQ A;  4H8K A;  2ZM6 K;  4B9T A;  3OYK A;  1JLF A;  3SQ1 A;  1K8K A;  1T7P A;  1VQ7 N;  4LFC K;  1RFQ A;  2AP1 A;  3KK7 A;  3CHW A;  3WQU A;  3D7E O;  1HNZ K;  3VQE A;  3LDN A;  4BGA A;  3LPU A;  1WUA A;  2AJQ A;  2IIR A;  4Q0B A;  4JRP A;  1BUP A;  3NH2 A;  1ZBH A;  3RSE B;  1R0A A;  4JI1 K;  3ZSR A;  5FRM A;  3WEE B;  4JKG B;  3CFO A;  1LAV A;  3FZL A;  3AO1 A;  1GLD G;  1TYQ B;  3TAN A;  4JK7 A;  3QO9 A;  4A59 A;  1HQE A;  4B1Y B;  4QCL A;  1QHT A;  3SZ2 A;  3KKR A;  3SI6 A;  1YAG A;  2FF3 B;  1NWK A;  3AVN A;  4JI5 K;  2H3G X;  1T8E A;  1ILY A;  3CET A;  4NXM K;  3CCM N;  4BE0 A;  3DXM B;  5KQ8 A;  2VGN A;  4BRL A;  1HNI A;  4Z4C A;  1G99 A;  3DLK A;  5BN9 A;  4W5O A;  1U49 A;  2GWJ A;  3JXU A;  3I8B A;  2RPI A;  3MWP A;  1QVG M;  1X3M A;  2E2O A;  5HOO A;  3LDS A;  3HRG A;  3CI5 A;  3V1R A;  3TAB A;  2F7T A;  2YHX A;  4GW6 A;  1C1C A;  2O8C A;  1NK5 A;  4HVJ A;  4IOX A;  1TVR A;  3SJJ A;  1L3S A;  1HMV A;  4O5F A;  3VMF B;  5I42 A;  2KTQ A;  4CHY A;  3AVC A;  3CCE N;  3A5M C;  5EVZ A;  4DV1 K;  4M41 A;  2YHA A;  3JS6 A;  2X6N A;  3B6P A;  3ID8 A;  4FCY A;  5JS2 A;  1O1W A;  3OJU A;  1BA0 A;  3AVI A;  4NYN A;  4KRE A;  3EO3 A;  1RTI A;  4BWJ A;  3QBX A;  5AFU A;  4E89 A;  1Q9X A;  1UOC A;  1BI4 A;  4GV9 A;  4WF9 L;  3BY5 A;  1T6D A;  1GLF O;  3VEW A;  2P9S A;  3KD1 E;  5AQY A;  4A2B A;  2YX6 A;  3KLE A;  4QS7 A;  1NNE A;  3G0Z A;  4OPA A;  1FJG K;  1NK9 A;  4EHT A;  4GKK K;  4DSJ A;  3QBW A;  1BU6 O;  1RT6 A;  4JI7 K;  1XUP O;  1JLC A;  4AHT A;  2GUP A;  3SYZ A;  4CHZ A;  1C0U A;  4CZM A;  5HRS A;  1DEJ A;  1QQM A;  1XI1 A;  4L3Q A;  3F2K A;  1ZBS A;  3SMS A;  4E7J A;  3HPG A;  4FL9 A;  4LF7 K;  3H6E A;  4BG8 A;  3SAG A;  3RR8 A;  3DXK A;  3CCR N;  4DV3 K;  2VGM A;  2OAN A;  2A1R A;  3EY1 A;  5AQO A;  5HLF A;  3IDH A;  3OYI A;  1DTT A;  4CD1 A;  2O4G A;  4FK4 A;  3NMU A;  1ZBU A;  3LZI A;  1I94 K;  4BC4 A;  2W40 A;  1S1V A;  1H1V A;  5SWM A;  1WSE A;  3THW A;  3V9X A;  4BQL A;  5MLC Q;  1NGE A;  3P4I A;  4MFB A;  1RTD A;  4JI0 K;  2UXC K;  3EE9 A;  3RVC A;  3IG1 A;  3THV A;  1TL1 A;  3LP1 A;  4BRA A;  2E1Y A;  4CE9 A;  4CJT A;  1C0F A;  2KLA A;  4YOU A;  4DU3 A;  4YOT A;  2EHG A;  4DR1 K;  4MO5 A;  4LH5 A;  1GOB A;  3MN5 A;  5BRE A;  4ELU A;  4KI6 A;  1IKW A;  1SL2 A;  2XY8 A;  2CH6 A;  3MMV A;  1C0T A;  4A61 A;  4DR3 K;  1WSH A;  4FPA A;  3RMD A;  4JI4 K;  2OA8 A;  1IJJ A;  1SL1 A;  1ATS A;  2BUP A;  4I2P A;  3E1Y A;  3KLH A;  1KAZ A;  3ATV A;  3ZSX A;  1QHA A;  1NOZ A;  2FSN A;  3OYC A;  1L3T A;  1SV5 A;  4LSL A;  4F9O A;  1W97 L;  2G8V A;  2V51 B;  2QWL A;  3SQ0 A;  4DQR A;  4CEO A;  1ASW A;  3MN9 A;  5H1S Q;  3ZSZ A;  1ATR A;  3CM5 A;  1HR0 K;  4C1N K;  4OLA A;  3A0I X;  5JLH A;  2QI2 A;  4BRP A;  3K59 A;  2F9W A;  4DV4 K;  2V52 B;  4GV6 A;  4CBU A;  4H0X B;  3OS2 A;  3NF8 A;  2HVH A;  4H0V B;  4Z0U A;  4O0I A;  4IFV A;  4ID5 A;  3BEX A;  1KQS M;  4B9S A;  4FJL A;  2PAV A;  5C2F A;  3NH1 A;  3EN9 A;  3LAN A;  5DK5 A;  4CCH A;  3U8X A;  3UKU B;  1RDD A;  2X74 A;  4J2D A;  1JXE A;  1HNV A;  2P9I B;  2J4R A;  3EKS A;  5KRT A;  2ZJP L;  1TV6 A;  5LJV A;  4JV5 K;  3M8S A;  2XRI A;  1IKY A;  1YJN N;  3TTF A;  1GLB G;  3SJH A;  1RDC A;  4H5N A;  3TTD A;  1S3X A;  4CJK A;  4CGJ A;  3V9Z A;  2CGJ A;  2IOC A;  2P9K A;  4CK2 A;  4BVO A;  4NLB A;  5K14 A;  1LWF A;  2X6S A;  4CF8 A;  4HUF A;  3CPE A;  4NCA A;  3J7Z O;  3ENH A;  1EP4 A;  1EET A;  2D4W A;  3KVG A;  2ASP A;  4C8L A;  4FOE A;  3HZ6 A;  2GUI A;  3BZK A;  2GBZ A;  3LM9 A;  4CZF A;  2KZZ A;  5C25 A;  3IAY A;  3T69 A;  2DFH A;  2FBT A;  1D9D A;  1NGA A;  1DTQ A;  5HP1 A;  2XY5 A;  1KCF A;  1XWL A;  1LWE A;  4FLX A;  3DOL A;  1X9S A;  4J2A A;  3K58 A;  4FWN A;  4BR9 A;  4CGG A;  3VGK A;  3MEE A;  4JAX A;  1HX1 A;  1UWB A;  2KFN A;  5FPM A;  4B1W B;  2F4V K;  3O5B A;  3VQB A;  2NUB A;  1VQM N;  4B8A B;  3VQ7 A;  3WXJ A;  4DQS A;  1NGB A;  5A2Q O;  3OYJ A;  4O8U A;  4BR4 A;  4KHS A;  1DT9 A;  4AQY K;  2HF4 A;  3K0S A;  3O3H A;  2YJE A;  1XHZ A;  4B9Q A;  4WFB L;  3AV9 A;  3ZSW A;  4YOV A;  1GLJ O;  4H4O A;  3Q7B A;  3CM6 A;  3JAM O;  4WFN L;  3C7N B;  2V7Y A;  4YOR A;  1NK0 A;  4KHW A;  1C0G A;  3V9W A;  1M90 O;  4J2B A;  2Y1I A;  3NF6 A;  1Q7Y O;  3QEX A;  2HBM A;  1IG9 A;  1E3M A;  1CZB A;  4KHY A;  2UXB K;  3VQ6 A;  4OGE A;  1YVN A;  4M3Z A;  4CZI A;  3QIN A;  3L6Q A;  1D5A A;  4O55 A;  4R5P A;  2Q2R A;  3VQP A;  4CJE A;  1NJI O;  5J1E A;  4C1N I;  2A40 A;  1RCH A;  1TL3 A;  1X9J A;  2DFF A;  2YCH A;  3K5M A;  2O8D B;  1NU0 A;  2RHK A;  4MQ3 A;  1ZBF A;  1RTJ A;  2QK9 A;  3I8D A;  4FJX A;  3L0Q A;  4BRF A;  2YNH A;  4EHU A;  4Z4I A;  4DFM A;  4Y1C A;  4LF5 K;  1HQU A;  3V6D A;  3DAW A;  3V9U A;  1SKR A;  2G8U A;  1NGH A;  3I0R A;  4KO0 A;  1RT5 A;  3AGK A;  3CJ7 A;  3R6M A;  4ELT A;  1XNR K;  2O8E A;  1YHQ N;  4DR6 K;  3T3F A;  3RR7 A;  4WCE L;  3OVN A;  1QSL A;  5JIC A;  4CJL A;  3DJC A;  4AHR A;  5TKW A;  3LP0 A;  4A5A A;  1JKH A;  3OBW A;  2HHV A;  3EKU A;  3ZET B;  4DV7 K;  4M3W A;  3SMP A;  5KQD A;  3LM2 A;  1VAZ A;  1SL0 A;  4IOC L;  4I6M B;  4FPB A;  3ZT3 A;  4H03 B;  4CJV A;  2QEX N;  4KPY A;  4MLE A;  3OJS A;  2OCE A;  2YI1 A;  3F73 A;  4OO1 J;  4X64 K;  2HND A;  4FO0 A;  1S9G A;  2P9L B;  1VSL A;  3C0B A;  2FBY A;  4CED A;  3QNO A;  3HOT A;  3NHG A;  1QQC A;  4M45 A;  1T44 A;  3KK3 A;  3AO2 A;  3TWH A;  5AQH A;  5IWA K;  1MA9 B;  5EU7 A;  2P9U B;  1QQN A;  3EEQ A;  2OPP A;  1JLA A;  2Q0R A;  4DWI A;  4F8R A;  1SUQ A;  1X9M A;  5GAE P;  4NO7 A;  5FPN A;  3P83 D;  1F21 A; 
#chains in the Genus database with same CATH homology
 1TYQ B;  2P9P A;  2NRW A;  4JK7 A;  4MO4 A;  1BG3 A;  1HKB A;  3M3Z A;  2V7Z A;  2HOE A;  2ITM A;  4A59 A;  4B1Y B;  4BC5 A;  4JKE A;  4AM6 A;  4UY8 O;  3R9P A;  3VTI A;  4JKH A;  3TPQ A;  1YAG A;  1XC3 A;  2Q1N A;  2FF3 B;  3VPZ A;  1NWK A;  3QB0 A;  2H3G X;  4IO9 L;  5GAG P;  1ILY A;  4EIA A;  3I33 A;  1D4X A;  3CET A;  1KXP A;  2QXL A;  3SLC A;  4BVP A;  2A42 A;  3CCM N;  4FWR A;  3DXM B;  5KQ8 A;  5M1Q A;  2VGN A;  4BRL A;  4IOA L;  3MCP A;  3MX5 A;  1G99 A;  4M7X A;  4MDB A;  5BN9 A;  4LC9 B;  2GWJ A;  3JXU A;  2FSK A;  2P9N B;  1Q82 O;  3I8B A;  4A57 A;  3OHR A;  5C15 A;  5AQS A;  3MWP A;  2IVO A;  1QVG M;  3OW2 M;  1X3M A;  3VTH A;  2E2O A;  3CF5 L;  1E4F T;  5HOO A;  3M5R A;  2ZJR L;  5JVG L;  3HRG A;  3CI5 A;  2F7T A;  4AM7 A;  4H0O A;  1NGC A;  2Q36 A;  2YHX A;  3CER A;  1BWF O;  3NVM A;  3EZW A;  5AZI A;  4GV3 A;  4H0Y B;  2KHO A;  4IOX A;  2Q0U A;  5GAH P;  3D2F B;  5KPR A;  2VWB A;  4O5F A;  3VMF B;  4CZJ A;  3O1B A;  5AFU H;  1BA1 A;  4CZG A;  2A6A A;  4IDH A;  4KH5 A;  3O8M A;  3CCE N;  3L4I A;  2E88 A;  3A5M C;  3AAQ A;  5EVZ A;  4BRG A;  1YIJ N;  3OA9 A;  2OTJ N;  3JS6 A;  3D6R A;  5F0X A;  3ID8 A;  3FE1 A;  3ID6 A;  5AQM A;  4E1J A;  4BRQ A;  3F9M A;  3DWL A;  2CH5 A;  3LDL A;  1BA0 A;  1NGG A;  3EO3 A;  2HBJ A;  3QBX A;  1JCF A;  1VQO N;  3AAP A;  5FPD A;  5AFU A;  2QWN A;  4K25 A;  4Z94 A;  2GEL A;  3A5N C;  3U9D A;  1DKG D;  4GV9 A;  4DCH A;  3MWT A;  5EOY A;  4HWI A;  4JN4 A;  4WF9 L;  3H45 C;  1T6D A;  3U9Z A;  1NM1 A;  1GLF O;  2BH1 A;  4IFE A;  3CPW M;  3A5O C;  3FGU A;  4BRN A;  3UKU A;  2P9S A;  3VEW A;  5AQY A;  4A2B A;  4DB3 A;  1BO5 O;  2P9I A;  1VQ6 N;  4ISG A;  2YX6 A;  1NMD A;  1LCU A;  4QS7 A;  2EWS A;  2OTL N;  3E9P A;  1EO1 A;  4K43 A;  4OPA A;  3L4Q A;  1K8A O;  4EHT A;  1MWM A;  4FWP A;  4PKI A;  3QBW A;  1QQO A;  1BU6 O;  4YOW A;  5AQX A;  2ZF5 O;  1XUP O;  1NGJ A;  2QWQ A;  3TSP A;  2PFU A;  2GUP A;  3SK3 A;  1U2V B;  3AY9 A;  4CZM A;  4H5R A;  1DEJ A;  1QQM A;  1YUW A;  3BF1 A;  4L3Q A;  4IJA A;  5B8H A;  1ZXO A;  3CJC A;  1YJ9 N;  3M1F A;  3VEO A;  4ILJ A;  5C0Y A;  4NLC A;  3F2K A;  1SZ2 A;  1ZBS A;  1MDU B;  3SMS A;  2NRX A;  1OVY A;  1SQK A;  1VQL N;  4FL9 A;  4ISF A;  4GY2 B;  3H6E A;  4FWO A;  1S22 A;  5E26 A;  3P39 A;  3UB5 A;  3ZX0 A;  4BG8 A;  3ATU A;  3SAG A;  3DXK A;  3WT0 A;  3CCR N;  2Q31 A;  3HM8 A;  4JKA A;  3BP8 A;  2VGM A;  3Q7C A;  2OAN A;  1HUX A;  4YDU C;  5AQL A;  4FOI A;  5EX5 A;  3BF3 A;  3PLA A;  1QZ5 A;  3CJ9 A;  1S72 N;  4R79 A;  3K9J A;  2D1K A;  1K8K B;  4CI6 A;  1E4G T;  5AQO A;  3IDH A;  4IEI A;  4H5W A;  5AQV A;  1KD1 O;  3CJA A;  2ZJQ L;  4CD1 A;  4CZE A;  3EE8 A;  4WQ5 C;  3NMU A;  4H0T B;  4PL8 A;  4BC4 A;  5F1X A;  2W40 A;  1ESV A;  5TKY A;  1H1V A;  4BR5 A;  2E20 A;  3GE1 A;  4PKH A;  1VQP N;  4BQL A;  5CE3 A;  4JKB A;  1YF5 L;  5MLC Q;  1NGE A;  3P4I A;  3ZEU A;  4HTL A;  5C10 A;  1VQ4 N;  3VGL A;  3QDK A;  3EE9 A;  4BGB A;  3RVC A;  3UKR A;  3N4Q A;  4NB4 A;  4A62 A;  3HSC A;  2E1Y A;  2FLO A;  4BRA A;  3H1Q A;  1NGD A;  1C0F A;  2KLA A;  4YOU A;  2P9P B;  4K41 A;  4YOT A;  4A2A A;  2A3Z A;  3ZX3 A;  2ZGZ A;  4MO5 A;  1M1K O;  1ZC6 A;  3OBY A;  2QW9 A;  3K9K A;  3MK6 A;  3MN5 A;  5BRE A;  4O8K A;  5AZJ A;  3G6E N;  3GG4 A;  3O9Q A;  2CH6 A;  3MMV A;  3R3L A;  2E1Z A;  5BRH A;  4A61 A;  1YJW N;  1HPM A;  3O6W A;  2HBK A;  5GIO A;  4KH4 A;  4FPA A;  3D2E A;  3HBT A;  4BR7 A;  1IJJ A;  1ATS A;  1O13 A;  2BUP A;  2WC9 A;  3C7N A;  3AGR A;  3E1Y A;  4JEP A;  1KAZ A;  3ATV A;  1HLU A;  3M6G A;  3VEX A;  2WBN A;  3VET A;  4OPH A;  1QHA A;  3BUZ B;  3QFP A;  2FSN A;  2UYT A;  3FZF A;  1J6Z A;  4F9O A;  1W97 L;  4BY9 C;  3CCJ N;  2V51 B;  4IWV A;  5AZI B;  2QWL A;  3A5L C;  4Y0W A;  5LJW A;  3VEY A;  2E2N A;  2HMP A;  3MN9 A;  3VOV A;  4B1X B;  5H1S Q;  3H1V X;  5KPT A;  5BPN A;  5AQP A;  1ATR A;  2VCP A;  3VES A;  2QA4 N;  4FVU A;  4IEE A;  4JKC A;  1N8R O;  4C1N K;  1W2B M;  3A0I X;  5BPM A;  2ASM A;  5HL7 L;  5JLH A;  2QI2 A;  3LL3 A;  4BRP A;  2F9W A;  3J8A A;  2V52 B;  2IVP A;  4JD2 A;  4GV6 A;  1Y64 A;  3QFU A;  4CBU A;  3O9R A;  4MLH A;  4BQZ A;  1RDU A;  4H0X B;  4CJ7 A;  4DHY A;  3CMA N;  3E9O A;  4BRC A;  4H0V B;  3CXC M;  3SAH A;  3BEX A;  1KQS M;  3GL1 A;  3R1X A;  2HF3 A;  2PAV A;  5C2F A;  3A8Y A;  3S41 A;  1JJ2 M;  1ATN A;  3EN9 A;  3IKM A;  4FWQ A;  1TUY A;  2HST A;  4PL7 A;  5M1F A;  1T6C A;  3U8X A;  3WXL A;  3IUC A;  2P9S B;  5EY4 A;  3UKU B;  5C2D A;  2A41 A;  4B1V A;  5EXW A;  5GAD P;  2P9I B;  2JWL A;  3SBT A;  2J4R A;  3EKS A;  5I9E B;  2ZJP L;  2NRH A;  2YHY A;  3DLL L;  2DPN A;  4CZL A;  5LJV A;  1CZA N;  4YDU A;  3ZYY X;  3O1W A;  3PIP L;  1YJN N;  3TTF A;  3I56 N;  1GLB G;  3SJH A;  3EL2 A;  3CCQ N;  2GWK A;  4JK8 A;  2A5X A;  4H5N A;  3TTD A;  3ZET A;  1S3X A;  3LDO A;  3LDP A;  3CC4 N;  4KBO A;  3VER A;  3B8A X;  4QS8 A;  2NRV A;  1HKC A;  3VF2 A;  5DM7 L;  1MWK A;  2CGJ A;  1VQN N;  4WQ5 A;  4I6M A;  4DKW A;  1NGF A;  3HTV A;  1GLC G;  3O9S A;  3CD6 N;  2P9K A;  4BVO A;  2HBL A;  4CBX A;  2E8A A;  4H0P A;  1SS6 A;  1U6Z A;  4NLB A;  1NGI A;  3QIC A;  4RWT A;  5CR4 A;  4BRD A;  3ZX2 A;  2P9L A;  3ULE A;  3TTC A;  4JHD A;  3G4S N;  3CPE A;  4FSV A;  3J7Z O;  3ENH A;  2D4W A;  3MX2 A;  3KVG A;  2ASP A;  3DXK B;  4FOE A;  3FLC O;  3MN7 A;  2ZGY A;  3C6A A;  1P90 A;  2E2P A;  3HZ6 A;  4QS9 A;  2CGK A;  1VQK N;  2CGL A;  3LM9 A;  2NRR A;  4WFA L;  4CZF A;  2P9U A;  1WOQ A;  5JMV A;  3RSE A;  3T69 A;  1SAZ A;  4CZK A;  4IO8 A;  4FWM A;  4XH4 A;  3WEE A;  4C23 A;  4JKG A;  2QWO A;  4BRO A;  3G25 A;  5M1P A;  3G71 N;  1NGA A;  3MDQ A;  1QZ6 A;  3CIP A;  4IZ9 A;  1TYQ A;  1NLV A;  2QWP A;  4G9Z A;  3C6H A;  3CC2 N;  2JWK A;  3FZH A;  4IXC A;  2YJF A;  4PKG A;  1K73 O;  3VF6 A;  1JCG A;  1V4T A;  3FR0 A;  5AQJ A;  4FWN A;  4BR9 A;  3NVK A;  4ILG B;  3VGK A;  3TU5 A;  3P31 A;  3UKR B;  2NLX A;  5AQI A;  3E9L A;  2BTF A;  4JAX A;  5AQZ A;  3HI0 A;  1HKG A;  2ZWH A;  1HX1 A;  2VYP A;  1RGI A;  3KHY A;  4WQ4 C;  5FPM A;  4B1W B;  3DXM A;  2W41 A;  3O5B A;  4K42 A;  3WXM B;  3H3O B;  1VQM N;  3WXJ A;  2P9N A;  3LDQ A;  4ILH A;  4BRM A;  1NGB A;  5AZJ B;  3MCA B;  4O8U A;  4BR4 A;  1DT9 A;  2D0P A;  4H5V A;  4KH6 A;  2HF4 A;  4YOY A;  2YJE A;  3GBT A;  5BPL A;  4BR0 A;  4B9Q A;  4WFB L;  3IMX A;  3D2E B;  4YOV A;  1GLJ O;  1YI2 N;  2WFB A;  3Q7B A;  4WFN L;  5GIP A;  3C7N B;  2ASO A;  2V7Y A;  1BDG A;  4YOR A;  4BG9 A;  1IG8 A;  2GTD A;  5C12 A;  3D2F A;  5GIN A;  1VQ9 N;  4EAH D;  1V4S A;  1C0G A;  1VQ5 N;  2GEM A;  1M90 O;  2Q97 A;  1Q7Y O;  2HBM A;  4JNE A;  3CCU N;  4XH5 A;  2QTD A;  1DGK N;  1LOT B;  1NBW A;  2GX9 A;  5DM6 L;  3VEZ A;  1HJO A;  3HOS A;  1YVN A;  5F2R A;  4PHT X;  3VEN A;  4CZI A;  4U7B A;  4IJN A;  1GLA G;  3L6Q A;  3VGM A;  1YIT N;  3R8E A;  1Z6R A;  2Q2R A;  1NJI O;  3WQT A;  3FZK A;  4C1N I;  2A40 A;  2FSJ A;  4M7Y A;  1JCE A;  3GDQ A;  5AQR A;  2D0O A;  3CJ1 A;  3VF4 A;  1X9J A;  2YCH A;  4BRH A;  5BRF A;  1Q18 A;  1TUU A;  2QWR A;  5JVH L;  3O08 A;  4CBW A;  3E66 A;  3VEV A;  3O9U A;  4RTF D;  4BRE A;  2RE2 A;  2RHK A;  4BC3 A;  3WUH A;  4J8F A;  4JD2 B;  5AQF A;  2WUS A;  1QVF M;  2IVN A;  3L0Q A;  5ADX H;  3TSQ A;  4BC2 A;  4BRF A;  5ELZ A;  4EHU A;  1Q81 O;  5AQN A;  4BRI A;  5AQT A;  1GLE G;  1KAY A;  5BRD A;  4MDA A;  4A5B A;  2AA4 A;  4JK9 A;  2F9T A;  4B1Z A;  2NNW A;  4YOX A;  3CME N;  1KC8 O;  3DAW A;  1Q86 O;  5AR0 A;  2NZT A;  5BR9 A;  3UE5 A;  1RDW X;  3N4P A;  4JKF A;  3SAF A;  3I55 N;  1Z05 A;  3KWI A;  4GVE A;  4DQ8 A;  3MN6 A;  1NGH A;  4M63 C;  3SBG A;  5LY3 A;  3AGK A;  3CJ7 A;  1R59 O;  3R6M A;  4XEI A;  5CHI A;  1YHQ N;  1X3N A;  1P8Z A;  5ADX A;  3O9T A;  4WCE L;  4B1U B;  5AQG A;  4JKD A;  5JLF A;  1U2V A;  3FZM A;  3CCV N;  1XQS C;  3W3D A;  4EFH A;  4U67 L;  3W0L A;  4GNI A;  3P38 A;  5JIC A;  3F5T A;  3DJC A;  5TKW A;  1OKJ A;  3IFR A;  4A5A A;  3KWG A;  3FFK B;  3O4W A;  5BN8 A;  1BOT O;  4BRK A;  3OBW A;  1KAX A;  5M1N A;  4FWS A;  3CQY A;  4ISE A;  2I7P A;  3EKU A;  3ZET B;  3CQX A;  4FWK A;  2E2Q A;  4BR2 A;  1K9M O;  5AQU A;  3SMP A;  5KQD A;  5M1O A;  4RCH A;  3ENO A;  2YHW A;  3PIO L;  3LM2 A;  4H5T A;  1VAZ A;  3CC7 N;  3AAR A;  4IOC L;  4I6M B;  4CD3 A;  5AQW A;  3WXK A;  3CCS N;  4FPB A;  3CCL N;  3KZB A;  4CZH A;  3C65 A;  4WYB A;  1T3V A;  2P9K B;  2PBD A;  3O80 A;  4H03 B;  3ENB A;  2QEX N;  2QM1 A;  4MLE A;  1YXQ A;  2YI1 A;  1VQ8 N;  4OO1 J;  3WXI A;  2I7N A;  2QWM A;  4FO0 A;  2NRZ A;  1K8K A;  2P9L B;  2FXU A;  3ULE B;  1VQ7 N;  4JHD B;  1RFQ A;  3C0B A;  3H3N O;  3T7Z A;  2AP1 A;  2FF6 A;  3KK7 A;  3CHW A;  3WQU A;  3D7E O;  1EQY A;  5E84 A;  1GLL O;  3HOT A;  3H46 O;  3LDN A;  2KKZ A;  3QML A;  1T44 A;  4WQ4 A;  4BGA A;  3U4L A;  1WUA A;  5AQH A;  2IIR A;  5KPZ A;  2NRT A;  1MA9 B;  1BUP A;  2P9U B;  5M1K A;  1QQN A;  3RSE B;  5AQK A;  5FPE A;  4AF1 A;  2Q0R A;  3WEE B;  3ZEU B;  4JKG B;  5GAE P;  3CJB A;  4NO7 A;  4XH1 A;  5FPN A;  5AQQ A;  3TSU A;  3FZL A;  4FWL A;  1GLD G;  3GOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...