4DQOC

Crystal structure of pg16 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
115
structure length
88
Chain Sequence
TTFKLAACVTLACTRVKHCSFNITTDVKDRKQKVNATFYLYRLISCQTTTTEAVDAATAAKVFKQYANDNGIDGEWTYDDATKTFTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PG16 Fab Heavy Chain
publication title Structural basis for diverse N-glycan recognition by HIV-1-neutralizing V1-V2-directed antibody PG16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 88
sequence length 115
ec nomenclature
pdb deposition date 2012-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.790 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dqoC00
3U2SC 4YWGG 3U4EG 4DQOC
chains in the Genus database with same CATH superfamily
4KVGB 2VZKD 4BVUC 2ZZPB 3NVWA 3AEFB 3DBHI 3RNBC 2JXTA 2V4LA 5E6PA 4KGRA 1WX7A 2N7DA 5I4DA 4O1NA 3N32A 3R8BA 3JYUA 4ZOHC 1E5WA 2JX5A 3ZVVA 3H7SA 3MJ5A 3KQ4A 2LI5A 2QC8A 4KDIC 4CO7A 1GPXA 2V9HA 1WJNA 4XGAB 1WY8A 1UH6A 2AQ3B 2ZVOA 1F0ZA 2HJ1A 4ARCA 1OEYJ 2INCC 5CHVC 2QIEB 3QX1A 1PYWD 2JXXA 1GC7A 4M0WB 4IW0A 2FAZA 2Z59B 4M0WA 1ZP0B 3Q8AA 4N9F4 1JW9D 1Q1OA 4K1RB 2VH2A 1UWXA 3AI5A 1OEYA 4M00A 1R4MB 3VXWA 2Y3AA 2BS3B 5D2MB 5FR6A 3PV1A 4E74A 5G55A 1ESFA 1E7UA 4G11A 1HTOA 4W9KA 3PRMB 3RPFC 2GBJA 2OEDA 2PVOD 4R3DA 3UI3A 4BKSD 3J9CA 3RN9C 1KFYB 4F8CB 4JLCA 4WWMA 1V97A 2RDGA 2WGSA 4IDIA 2A4ZA 3I9V1 3PRZA 1YMHE 2ZNVB 4UDUC 2MWSB 1SF0A 1ET6A 1TKEA 1ZKHA 5D94A 2KC1A 1WXQA 2PIAA 3AE4B 2AWTA 1QOAA 3TEWA 1QZEA 5H92C 1V9JA 3B1LX 3ZRFA 4P1CC 4GMVA 2KQSA 2KWCA 2V3PA 1WXMA 2FCSA 4HLEA 5LLIA 2BT6A 1CJEA 2UYZB 4ITKA 4P7IA 2YEPB 1TY2A 4L23A 1AYFA 3RMKC 1TYGB 1T6BX 3B9JA 4HPLB 2K6DB 2L00B 1E7PB 1DOXA 2I1JA 1YQ3B 4HKQA 3KUZA 5MPOA 1UGJA 2N9EB 2W9NA 1XLNA 3B08A 1WIAA 1HZ5A 2LFIA 4K81A 4S17A 1YX6B 4A3OA 2FCNA 4PS3A 1VD2A 3MP9A 3JSVB 2BWES 4GDKB 3WAMA 5EE3A 3B0AA 2AQ2B 2KAJA 3URYA 2KDEB 1BT0A 2I2YA 2FCMA 3RUIB 1YIWA 1EU4A 1I4RA 1R4NI 4CYEA 3FILB 1KJTA 2NBUA 1C1YB 2WU2B 2IYDB 3ML9A 5TR5A 3A9JA 1SXTA 4ZRPA 4GGQA 1ROEA 1KLVA 1V2YA 4ASWC 1KF6B 2DZMA 4MSMB 4GIVA 1FPYA 4HWIB 2D10A 1X1MA 2QDFA 2WXGA 3IHPC 2DZJA 2G45B 3R7RA 1GJZA 3LYYA 3PHWB 3R2TA 1UUPA 1RFKA 3KVFB 4WJPA 2AYOB 2KWUB 2OJWA 1ZUD2 2EMSA 4K7SA 2ON8A 2JPHA 3HVZA 1FNVA 3RNEC 1N5XA 1MJDA 3SD5A 4FBJB 3BY4B 3L4PA 3FKYA 5AZGA 1Q10A 2C60A 2BWFA 2ZNVC 4KGTA 1NYRA 3CF6E 4FA6A 4NQKE 2LZ6A 4WIPA 1JROA 1S1QB 2DAFA 3FC4A 3L54A 2LHEA 1T0QC 3ZQ4A 4PS7A 1WR6E 4MELA 3NVVA 1SJHD 5AZFA 3KLSX 1I4QA 2BPSA 2GOWA 2CU3A 4Q2JA 1SIFA 3EFCA 2MSED 1KOTA 4C4VB 1EF5A 2E6XA 2DYOA 4XWTA 2Y5PA 4ICVA 3AEEB 1WXVA 2WX1A 3KW5B 3EGRA 2G4DB 1I4XA 4EKUA 2WP9B 1CZPA 3AE2B 2BKFA 2K8CA 1KH0A 3H6NA 3V6CB 4PS8A 2OOBB 1FFVA 2JUOA 2JT4B 3MC0B 3OJ4B 3UIPB 1AN8A 4C7ZA 1YNTE 3SFDB 4J3OD 3V61A 2LRWA 2KACA 3B2GA 5C23A 1VZ8A 2J0MA 1ZDVA 3PPAA 4NJ6A 4L2YA 3ZNID 4CQNA 3MFGA 3TIXA 1DOYA 3ETRA 4IUMB 3H7PB 4WWPA 5DPWA 3AM9A 2X8XX 1J19A 2LD9A 3H7PA 2XEWA 4REZA 1F2RI 3W1SA 3RNFC 3ZUNA 2MJEA 1P3QU 2CHZA 2BS4B 2V3SA 1IPGA 4AQ7A 2IY1B 1DYQA 3AE7B 3ZGZA 3VFKA 3N3KB 3CSFA 2N7EA 3SR6A 3BK1A 3B2FA 2FIFA 2WQYB 2K8HA 3ZTDA 1L4DB 2MJ3A 1I4GA 2DX5B 2MBQA 3AB5A 3Q3FA 2WXIA 4YT0B 1TJEA 4LNOA 4KGSA 4GLSC 5TSSA 2L32A 4RNAA 4IKGA 5DPSA 3PGEA 4GDLB 3CSTA 2PPHA 2BW2A 4GDLA 4P6VF 3ECIA 2BTEA 2M19A 2WDRB 4HJKA 2JY6A 1TS5A 3VUWA 2YVCA 3NZ3A 3HHMA 5LNK1 2MA9B 2RR9A 3IFWB 3RD2A 4RGMA 4E71A 4M8NA 2AX5A 2KMAA 4YSYB 2JQRB 2L8JA 2DYMA 2PMVA 1GOZA 4LTUA 1SE3A 3DDCB 3VRAB 4FULA 4WJQA 3I57A 4K3CA 4XDCA 1J7CA 3KH0A 1TY0A 3ZJTA 3GS2A 1XLPA 1JWUD 3EUB2 2E3TA 1JWAD 1TZOA 2K3UA 4RGNA 2WS3B 4XYCA 1CQVA 2K25A 3AU5A 3BIID 1XLOA 4OZCA 2PTLA 4RM8A 4AS1A 3AEDB 2RPQA 1WMHB 4AUQC 2GI9A 4BFRA 1DGJA 2UU7A 1V49A 1WMHA 3QIJA 1JRUA 4S0RA 4W9GA 3BYTB 4YL8A 1C79A 4II3B 1RAXA 2V0GA 1V6EA 3R66C 2O6VB 4J6IA 4BOSC 1I4HA 4HROA 3N1ZC 2O6VA 1V81A 5G5GA 3BK2A 4DDGD 5FKAC 1PGXA 5C3JB 2INPE 3ZXRA 4EOYA 3VQIA 3QC8B 2MHJA 4MGIE 4NNJB 1F52A 4US9A 2FCQA 2M8SA 3T9LA 2HJ8A 5IO9A 2FIDA 1ZGUB 2DLBA 2PE6B 3Q3MC 3Q14C 4WQMA 1AARA 1QKZA 3RFZB 3U8ZA 4NAMA 1SE9A 4JGHB 1T5XD 5D3IB 1K50A 1KTKA 1FD6A 1C76A 3GZNI 4M01A 4KZCA 2GLSA 1VRAB 3N1YC 2D07B 2FBWB 4NJ7A 2KNBA 1UBIA 4W9EA 5D6JB 1TBEA 2LGSA 1P0RA 3CWIA 2RSUA 4ANUA 2N4FA 2KOXA 2PVGC 2G9HD 2KDFB 1Q5WB 4F7ZA 1NBFC 1LO5D 4JX1C 3V3XA 2WXFA 3PT2B 1XCQL 2LHDA 4I6PA 1WI0A 2IO3B 3M95A 2V1YA 3RNCC 1SJED 4WAAA 2AQ1B 2NPTB 5HG2A 1HZ6A 4BBNC 1FCCC 2NPTA 1E8YA 3M63B 1WXSA 2LGIA 4GSWA 3M3JA 2RDBC 3RCZA 2V3NA 4FADA 2ZCBA 3V62A 4IM0A 4DK5A 2N9XA 1XEEA 2NBWB 1GAQB 2Y5CA 4FLHA 4YXDB 3UF8A 4ZRQA 1TKGA 3P4QB 4IWOA 2DBYA 2TSSA 3VRBB 1JWSD 1NDDA 1PDXA 4OZBA 3EFUA 1L5PA 1D4BA 4G50A 2Y5BB 4A3PA 3ZLZA 2LVOA 1C4AA 3QWZB 5BYRA 3RNAC 3P4SB 1R4MI 2FUHB 4TKNA 1OTRB 4YWGG 3EECA 5EE9A 5HKHA 2KO3A 3ZYYX 5J18A 1D3ZA 1PGAA 2VZKB 3CIRB 3VTUA 3NY5A 4KX6B 1Y56A 2QMTA 2OHFA 4GXBA 4IWPA 1ZXHA 4C7YA 5G2NA 2BB6A 2LVQA 1SE2A 4OVZA 1RRBA 2M17A 2PKOA 3BVZA 3DBLB 2GB1A 3ZNGC 3DVNU 2FUG1 5BMIA 4DHZE 3UQAA 1NENB 4KKJA 4KIKB 2L05A 3AEBB 4II2B 4KIKA 2WLBA 3NUHB 1TS2A 2KXJA 1EWYC 5IKCM 1YX5B 3ALBA 1OQRA 1V1PB 2MQJA 3QJZA 1E0ZA 3ZTCA 1WR1A 2KVZA 3I3TB 3V05A 1E8ZA 1V1PA 2MRPA 5DPRA 1SE4A 1WGGA 5H8YE 1E90A 1KLGD 4LDTD 1V1OA 1XT9B 1QT9A 2K39A 4OVUA 4HXDA 5G5HA 2OJRA 3Q6BA 1WE7A 3L0WB 5HFYA 1YN5A 4MH8A 3ZKJC 3UQBA 2KANA 2M0XA 3P63A 2FE8A 3MJWA 2B3AA 2AEHA 4HCPB 2GBRA 5BO4B 1OQYA 5GMVA 2DNFA 4BKSA 5CHFA 2IGHA 1WGKA 1I4PA 1JCKB 1XD3B 1ZXIA 3WANA 5J17A 2KVRA 4IOIE 3HUIA 1JRPA 1FM0D 1WGYA 4TSSA 3Q8BA 3U4EG 1LQBA 5BYSA 1QF6A 1EO6A 2WYQA 1GUAB 2XBBC 3EC8A 3T3NA 2BKRB 1L0VB 4GU2A 3A9JB 3AN1A 3JVZX 5JZEB 2RGFA 4EEWA 1N63A 1T0YA 1T0RC 3WA0A 4IWQA 1R4NB 3BWUD 2J52A 1JWBD 1PFDA 3PTFC 4FN2A 4NPNA 2RMMA 2W82A 4YTPB 1ENFA 5IA7A 1IBXB 1CMXB 2AL6A 4DHJD 1WYWB 2KDBA 1IBXA 4HK2A 1UGMA 5EDSA 4GOCA 3KWVA 4ZYNA 1WF9A 1H8CA 3W5UB 2UWQA 1DOIA 1MVKA 2BYVE 3PS6A 5T8IA 2K6QA 3U30A 2Z8LA 3NJTA 3AE8B 3V60A 3R7QA 5KHOA 3DBRB 1C4CA 4XE0A 1T3QA 4EZJA 4WURA 5D7GA 2D5GA 4FJYA 2YEPF 1FNWA 1QQRA 2L76A 1GB4A 3X0WA 2JYTA 4MDKE 2NS5A 2BS2B 4LNNA 3L13A 1E6EB 1XXGA 1NI2A 4EE2A 3WALA 4G3XB 4B0MA 2NTSA 2INNE 3VDZA 2D3AA 4WAFA 1M4VA 2V4IB 2JF5A 3TUOA 1IYFA 3N30A 3X23A 3AE3B 3NOBA 1WX8A 4NZLB 4WWOA 2H89B 1WH3A 3PZ8A 4MGZE 3RT3B 1E9MA 1C9FA 2WXNA 2I38A 2MP2B 3PLVA 2BVCA 4X57B 1WM3A 3KUDB 2ZW0A 2MP2A 5HI1A 3TMPB 4IG7B 2K8BA 2EKEC 1MFWA 2LVPA 3H9DA 2LGDA 1MHXA 3NS8A 3VAWA 3Q3OC 1YN4A 1JMLA 4URKA 2B76B 3I63C 3L17A 2HE7A 2KJHB 4ANVA 4AWJA 1LM8B 1UWMA 3AE9B 3ZXVA 2MJDA 3KWLA 3MC8A 4PK1A 4IC7B 4DXAB 2GBKA 2J42A 2LUMA 4YSZB 5DPTA 5AUKA 2CKHB 1JWMD 4RM9A 4AOFA 4XWWA 3U2SC 4XZ4A 1J7BA 5AUIA 2IPKD 1HXYD 3IT6B 1WSPA 1L0YB 3AE6B 4OW0A 4DXFA 2X38A 5LXIB 4H2AA 3HK0A 2KZRA 1UELA 1LGRA 1VLBA 4G0NB 2DZKA 4MM3B 3NZSA 4AJYB 4YTMB 3A33B 4MM3A 3U7ZA 1WYGA 4HPPA 4LCDE 1F9JA 1GC6A 3E56A 2ONQA 1V5OA 3U7DA 2BYEA 4LNIA 1J0GA 4ARIA 2QEJC 1D5XC 2PJHA 2WXJA 2BGFA 4BAXA 2KT7A 3SHQA 4IM2A 4XDDA 3APCA 1MPEA 1P9DU 2KFKB 3GE8C 2NBVB 3P42A 3PZ7A 2KWDA 2KFKA 3C19A 4XX5A 3DWGC 2KKCA 3HIZA 3LXFA 1FFUA 3VUXA 3APDA 2KC2A 4P1BC 5DCNA 3C8YA 1PUTA 4BZAA 2IJ0A 1YJIA 1WZ3A 5JXVA 1RFAA 4TMAB 1I7HA 1V8CA 1FEHA 4K7UA 3WCQA 2KYWA 4RF1A 2LUEA 3AH7A 4A55A 3TSSA 2JWZA 4ZRIA 3W5VB 1K52A 1JALA 2BB5A 2KN4A 1AWDA 1ET9A 2JYEA 4DWFA 3ZNZB 2ZW1A 1QILA 2WWZA 4RGTA 3W1YA 4LK0M 2EELA 3P2BA 2R2QA 2Q5WD 3WIMA 2G1EA 2C7MB 2QCZA 3A4RA 5IAAC 1QOBA 2L3ZA 2LGXA 5EE0A 5BMHA 1MI0A 1TTNA 1WJ4A 4I6NB 3A1QB 1FXIA 2ZPNA 2J4XA 1P7EA 1P98A 1RYJA 3AULA 1MG4A 3A1QA 2C5LC 2ZPYA 1TKYA 3IBEA 4MH0E 2KTFA 2KWVB 2W54A 5IN7A 4DXGA 1VJKA 1V5TA 2NVUI 3VH3B 3HVDA 5GXGB 4M8MA 2L7RA 4BOZB 4XC2A 3QK0A 3QCAA 3Q3JA 3W1SC 4EFOA 2VRRB 2ACZB 2KX0A 3O65B 3BVMA 4KZ0A 2N1VA 2CHWA 1L4ZB 2CJOA 3GP7A 5AEKB 4HDQA 1T0SC 3DQVA 3T8MA 3SDLC 4BBNF 2CR5A 3QAQA 4FHJA 3RNGC 3QQ8B 2WX0A 1QOGA 4RGOS 2HDEA 4OHJA 4PT5A 4B6WA 3QHTA 2WHIA 3DVGX 2KK8A 2SEBD 4K7WA 3OG5A 3PLUA 4ZRJA 2D11A 5FK9C 3Q8FA 1WRIA 4JWUC 3AV8A 3DHHC 3AEAB 4NQLB 4LLGM 4LJOB 2O2VA 1HTQA 2J53A 3OJ3A 2N9KA 3ABVB 2KMMA 3UGBB 3A4SC 3ZDMC 1E8XA 3AEGB 1B9RA 3IT4B 4NY0A 3DBHB 5E6OA 2WXMA 3D32A 1L7YA 4KSKC 3N20C 1JQ4A 1B1ZA 2N9LA 1L2NA 1IP9A 1Z2MA 2D3GA 3NG0A 4JE3B 4HVBA 2WXOA 4HRSA 3AMZA 4N58A 2I1KA 1ACCA 1WGDA 1UF0A 1G6JA 1Z5SB 2JZ3B 2KDMA 1N5WA 3ML8A 4MT5A 2FNJB 3P4PB 5L95C 2WDQB 2MBHA 2K0PA 3L10B 4F1SA 2J7QB 4DBGA 1EF1A 5KHQA 5BYQA 4HEA1 2KLGA 1SB3C 3CMMB 1VZ7A 1WGHA 4P16A 1IGDA 2A5UA 2R2OA 3AXCA 3APFA 1WGRA 2IDYA 2IO2B 3KUCB 1F77A 1A70A 3AE5B 4N6EB 2MEKA 1HE8A 3AECB 2MBBB 3VR9B 2NMQA 2N0SB 4M02A 3W2DA 2LXAA 4TQ1A 3I5JC 2WU5B 1C77A 3Q69A 1E10A 1K51A 1E8WA 2YLMA 2LMCA 3QARA 2SAKA 3ZNHB 1QOFA 2KMCA 5CX3A 2IO1B 5JHAA 3JW0X 1F1HA 3GE3C 1C78A 1V80A 2QILA 1H4RA 3DBLI 4PYUA 3UIOB 3OLMD 4W9FA 1WJUA 2LRUA 1TGZB 1N62A 2WDTB 3MTNB 4YSXB 4LNFA 1TS4A 1SIJA 2WXKA 1RLFA 2KQ7A 1VCBA 2JZZA 3QA8A 3DCGA 1KM7A 2KLCA 2C9WB 3PVLA 2D3BA 3P1MA 2GBMA 1XO3A 2QJLA 3NVZA 3DVGY 3ENEA 4ZRKA 1ZPSA 2DYBA 2XK5B 4E3CA 1YJ1A 3WAPA 2GMIC 4ACFA 2XK5A 2XNAC 4A20A 2KN5A 1FRRA 4FJVB 1WRDB 4OVVA 4JPSA 1WXAA 2CS4A 1Y8RC 3PZDA 2GRIA 2NTTA 1ISNA 1XF5L 2KX3A 1TIFA 1WE6A 4K3BA 3PREA 3PO0A 4EUTA 4ZDVA 1GNUA 2XN9C 2KJRA 2BYFA 2DAJA 4KDLB 3N9YC 4HKZE 3T3OA 4ZHOA 2N1WA 1LXDA 1IGCA 2L1AA 1OFFA 4AJWA 1HEZE 1XCTL 3EHVA 3DPDA 4CHKA 3JSVA 1FRDA 3MHZA 5L83A 2EKIA 4EZKA 4GDKA 3TEXA 3NHEB 5E6JA 2JVCA 1YQ4B 4RFBA 2PLPA 4C56C 3DHGC 2IBIB 3R2IA 2LEKA 4AP4C 2HTHA 3VH4B 1BXTA 4LDTB 3FILA 3O13A 3IG3A 3KYCD 4N59A 2NCNA 2NR2A 2BF8B 3VTVA 1KLUD 1YN3A 1NVID 1EU3A 4GB9A 4EZLA 1A5RA 2G3QB 1ZDXA 3ZJUA 2ZJDA 5E6NA 4WQOB 3SEBA 4I6LB 2LWPA 1WZ0A 1TS3A 2G4SA 1FXAA 4KKIA 3DBRI 2JZPA 4WWNA 3RZWC 4A9AA 5FR3A 1NYQA 3IXSA 2KFJA 5JHBA 2JSVX 4MGYE 1V86A 2IGGA 3EA6A 3Q3NC 2K22A 3FAHA 3HM6X 2R61A 2IGDA 4WH4A 3WAOA 1N61A 1VDVA 1K8RB 1SEBD 4TQ0A 1FIQA 4JQWC 2INDC 3UINB 5AZHA 3BYYB 1NEKB 3TL5A 1WX9A 3SU8X 4IM3A 3V6EB 2RD0A 2LJ5A 2PE9A 2VH1A 1MHHE 4DHJB 1EWCA 3TEZA 3K9PB 5CHWA 2JRHA 1D6EC 3AU4A 3MHSD 2KDIA 1STEA 2JU6X 1ZOYB 1RM6C 4LNKA 1P1AA 1I42A 1Q0WB 2WDVB 1SSNA 3RZFA 5IP4D 1GB1A 4W9JA 2JWUA 4BKTA 2H88B 1UD7A 2PW9A 3HM3A 2WXHA 1D5MC 4C4VA 2LGYA 4NAWB 4ZHPA 4PYZA 4A6QA 2CU1A 2L0FA 1VR9A 1XLQA 3ONSA 3U52E 4KV2A 1EM7A 4NAWA 1OGWA 3PSEB 3VR8B 3NS1A 1UNSA 2LJIA 4KSLC 4RH6A 3HRDD 1ZE3D 1PQSA 2RDHA 2J0JA 1CK1A 4OZAA 4WJOA 4JWSC 2REXA 2DWQA 2HD5B 1KRHA 4MSQB 2LXCA 2Z0DB 1D5ZC 1EUVB 4ANWA 4A8XC 2QSDA 1FNUA 4WJNA 3BVGA 5D3DA 3DOWA 1C3TA 1FXTB 3P4RB 3DWMA 3OAWA 3TCAA 1N60A 1P7FA 1UZXB 2QHOA 3R3MA 2MH7A 3IAM1 1GG3A 2KD0A 3H8HA 4QAYA 3IVFA 3TEYA 2DENB 2Z0EB 2IO0B 2KTRB 3N1XC 4MJSB 2MCNB 2DHZA 3RYTA 1XQQA 2KTRA 4MJSA 1VZ6A 3VTWA 4US8A 3BZDB 1BMLC 3Q8EA 3L16A 4MEMA 4DQOC 1J8CA 2M4NA 3IAS1 2K1FA 1L6UA 4RCOA 4ICUA 4D2KA 2KJ6A 2HTME 1N6ZA 2K9XA 2W3SA 1E7VA 4LJPB 2L0TA 1OQQA 2O6VD 3M62B 4DDID 3AE1B 1YJJA 2MX2A 2ZCCA 2WNMA 2D2QA 3DBSA 2AL3A 2L52A 2GBNA 1WWTA 2EMTA 3Q2AC 4MGKE 4BKGA 4RF0A 1TT5B 2LASA 2RPVA 3ZW3A 2W3RA 1K53A 2WXRA 2C7HA 3ZJVA 4ZYSA 4HCNB 1SGHA 3MC9A 4GN1A 2WXPA 2N7JA 1QLBB 3TJPA 4L1BA 2D3CA 1FMAD 3DVNV 4FHKA 4HPMB 2ASQA 5IOIA 3GB1A 2K5PA 3LDZE 1R7SA 2DZIA 2C7NB 3KYDD 3VUYA 5JH5C 2BQQA 3VHTC 2M1MA 2M56B 2KHWB 4JL9A 5BMGA 3LJ3A 5C1ZA 3RI7C 4USAA 1ZW7A 3S2AA 3DHIC 1C4PA 2IY0B 2M0AA 1FCLA 1L6VA 2CHXA 2WXLA 4FXCA 3RULA 1YQBA 4B95A 1AW7A 4W9CA 4W9LA 3C0RB 4HDOA 3SFEB 2N9PC 4TUUA 3OWEB 5CTRC 1RWSA 2J0KA 3W9CB 1U4AA 3VVWB 3NVYA 1HA5A 1WFYA 2PEAA 3BINA 4RMAA 1M94A 3ZO5B 2ZVNA 4W9DA 4W9HA 1HQRD 5HHDG 2MW5A 4C00A 1UBQA 3L08A 4ANXA 2KQ4X 2CJNA 3ZRCA 2W55A 4B9KA 1IUEA 2MBOA 1NI3A 3GOEA 1FO4A 2ICIA 3NZUA 4C80A 3PHXB 5LXHA 4FJZA 3ZDTA 1SBBB 3LB8C 2IZVB 4HJGE 1BUIC 5C2TB 1TZ1A 1F2RC 3E9SA 2MBEA 1L0XB 1WJ6A 2ZEQA 2JRIB 3Q8CA 2WXQA 4MACA 2BBCA 3PRPB 2BYTA 3A9KB 3ZIMA 2MLBA 4YTNB 4NJCA 4TV3A 3GZNB 3A9KA 1S3SG 4JIOU 4A90A 5EE1A 4DHZB 1PGBA 5J2RA 4W9IA 4B0EA 1MG8A 1I35A 3H1UA 1LFDA 2L83A 2O2VB 1J7AA 1YOVB 1WM2A 3K9OB 1YD8U 3NRZA 3TBLD
chains in the Genus database with same CATH topology
1ZPSA 2AX5A 2VZKD 3PZ8A 4YSYB 2JQRB 3NVWA 2PMVA 2DYMA 1E9MA 3AEFB 1GOZA 2XNAC 2JXTA 1C9FA 4KGRA 4LTUA 1SE3A 1FRRA 3VRAB 2WXNA 5I4DA 3I57A 2I38A 4JPSA 4XDCA 4O1NA 1J7CA 1TY0A 3ZJTA 3GS2A 3R8BA 1XLPA 2ZW0A 1JWUD 4ZOHC 2GRIA 3EUB2 2E3TA 2NTTA 5HI1A 1JWAD 1XF5L 1TZOA 2JX5A 2K3UA 3MJ5A 4RGNA 2WS3B 3KQ4A 1CQVA 3BIID 1MHXA 1XLOA 3PO0A 1GPXA 4OZCA 2PTLA 2XN9C 1YN4A 4AS1A 3N9YC 4HKZE 3T3OA 3AEDB 1JMLA 4ZHOA 2AQ3B 1IGCA 1F0ZA 2L1AA 4ARCA 2B76B 1OFFA 2GI9A 2QIEB 1DGJA 1PYWD 1HEZE 1XCTL 1UWMA 3AE9B 3BYTB 1FRDA 3MHZA 2MJDA 2EKIA 3TEXA 1C79A 3KWLA 4M0WA 5E6JA 2V0GA 1ZP0B 3Q8AA 1YQ4B 4RFBA 1JW9D 2PLPA 4C56C 2J42A 1UWXA 1I4HA 2LUMA 3R2IA 4YSZB 5AUKA 2LEKA 4HROA 1JWMD 1BXTA 4XWWA 3U2SC 2Y3AA 3FILA 2BS3B 1J7BA 3O13A 5AUIA 5G5GA 2IPKD 1HXYD 3IT6B 1ESFA 1WSPA 1L0YB 3BK2A 3AE6B 5FKAC 1PGXA 4N59A 4OW0A 4DXFA 5C3JB 2X38A 2INPE 1KLUD 4H2AA 1YN3A 3VQIA 1NVID 1EU3A 3RPFC 2OEDA 2PVOD 4R3DA 3UI3A 3J9CA 1VLBA 1ZDXA 4US9A 1KFYB 3ZJUA 4MM3B 4WWMA 3SEBA 4YTMB 1V97A 2DLBA 1TS3A 2RDGA 4IDIA 3U7ZA 1FXAA 1WYGA 3I9V1 4WQMA 4KKIA 1QKZA 3E56A 2ONQA 3RFZB 2JZPA 4A9AA 5FR3A 1NYQA 3IXSA 4NAMA 1YMHE 4UDUC 4ARIA 1T5XD 2QEJC 5D3IB 1SF0A 1K50A 1ET6A 1KTKA 1FD6A 1D5XC 1C76A 1TKEA 2JSVX 1WXQA 2WXJA 2IGGA 1VRAB 2PIAA 2FBWB 3EA6A 4XDDA 3AE4B 2K22A 3FAHA 1MPEA 1QOAA 2R61A 3TEWA 2IGDA 3CWIA 4WH4A 5H92C 1N61A 3P42A 3PZ7A 1VDVA 2KWDA 1SEBD 3DWGC 4TQ0A 2PVGC 2G9HD 2V3PA 3LXFA 1FFUA 1FIQA 2BT6A 1CJEA 3C8YA 1LO5D 1PUTA 4ITKA 4JX1C 2IJ0A 1YJIA 2WXFA 3V3XA 5JXVA 2YEPB 4TMAB 1TY2A 1XCQL 1NEKB 2LHDA 1I7HA 1AYFA 3BYYB 4L23A 1V8CA 1TYGB 1T6BX 1FEHA 3WCQA 4RF1A 3B9JA 1SJED 2AQ1B 5HG2A 1HZ6A 1MHHE 3AH7A 1EWCA 3TEZA 4A55A 1FCCC 1E7PB 1DOXA 1D6EC 1YQ3B 3TSSA 4HKQA 5MPOA 1UGJA 3W5VB 1STEA 1K52A 2JU6X 1ZOYB 1XLNA 1JALA 2LGIA 1RM6C 2BB5A 2KN4A 1AWDA 1ET9A 1HZ5A 2JYEA 2LFIA 2V3NA 2WDVB 1SSNA 2ZW1A 1QILA 4RGTA 1GB1A 4LK0M 2EELA 2JWUA 2H88B 2Q5WD 2PW9A 1XEEA 2WXHA 1GAQB 2Y5CA 1D5MC 2G1EA 3MP9A 4ZRQA 4YXDB 1TKGA 3P4QB 4NAWB 2DBYA 2TSSA 4ZHPA 4A6QA 3VRBB 4GDKB 1VR9A 1QOBA 1XLQA 1JWSD 3U52E 1PDXA 5EE3A 4OZBA 5EE0A 5BMHA 1EM7A 1MI0A 2AQ2B 2KAJA 3URYA 3VR8B 1L5PA 3NS1A 1UNSA 1D4BA 2I2YA 2LJIA 4RH6A 1FXIA 3HRDD 1EU4A 1ZE3D 2J4XA 1P7EA 1I4RA 1RYJA 2RDHA 3FILB 1CK1A 4OZAA 1C4AA 4JWSC 1TKYA 5BYRA 2WU2B 2DWQA 1KRHA 3P4SB 4YWGG 2W54A 1D5ZC 5EE9A 4DXGA 4A8XC 1SXTA 1FNUA 1VJKA 2QSDA 3BVGA 5D3DA 4ZRPA 1ROEA 3HVDA 3ZYYX 1KF6B 3P4RB 5GXGB 3DWMA 1N60A 1P7FA 1PGAA 2VZKB 3CIRB 2MH7A 2WXGA 3IAM1 4KX6B 1Y56A 3H8HA 2QMTA 2OHFA 3TEYA 3LYYA 1ZXHA 4C7YA 2ACZB 3R2TA 2BB6A 1UUPA 3BVMA 1RFKA 1SE2A 4OVZA 1VZ6A 1L4ZB 4US8A 2CJOA 1ZUD2 3GP7A 2PKOA 3BVZA 3BZDB 1BMLC 3Q8EA 2ON8A 2GB1A 4DQOC 3HVZA 1FNVA 2FUG1 1N5XA 5BMIA 1NENB 4KKJA 1QOGA 3IAS1 3L4PA 2HDEA 4OHJA 4PT5A 4RGOS 1L6UA 3AEBB 4RCOA 1Q10A 2WLBA 4D2KA 3NUHB 1TS2A 1EWYC 2HTME 4KGTA 2K9XA 1NYRA 2W3SA 2SEBD 1OQRA 1V1PB 1OQQA 4WIPA 1E0ZA 1JROA 3V05A 3AE1B 1YJJA 5FK9C 3Q8FA 1V1PA 3FC4A 2WNMA 1SE4A 5H8YE 1WRIA 1KLGD 4JWUC 3AV8A 1V1OA 3AEAB 2L52A 1WWTA 4LLGM 2LHEA 1QT9A 4RF0A 2RPVA 3ZQ4A 2W3RA 1K53A 2WXRA 5G5HA 2J53A 3ZJVA 3NVVA 4ZYSA 2N9KA 3ABVB 2KMMA 5HFYA 1YN5A 4MH8A 1SJHD 2WXPA 2N7JA 3AEGB 3P63A 1QLBB 1B9RA 2FE8A 3IT4B 3KLSX 4L1BA 2WXMA 1I4QA 1FMAD 2CU3A 1JQ4A 3GB1A 4Q2JA 1B1ZA 2IGHA 1WGKA 1I4PA 2N9LA 2K5PA 1JCKB 1R7SA 2E6XA 1ZXIA 2DYOA 4JE3B 4XWTA 2Y5PA 2WXOA 4HRSA 3AMZA 3AEEB 4N58A 1ACCA 2M56B 5BMGA 3EGRA 4IOIE 2KDMA 1N5WA 3HUIA 1JRPA 1I4XA 2WP9B 4MT5A 1CZPA 3AE2B 1FM0D 3P4PB 4USAA 2WDQB 1C4PA 2M0AA 4TSSA 3Q8BA 3U4EG 1L6VA 1KH0A 2WXLA 1FCLA 5BYSA 4FXCA 2K0PA 1QF6A 1FFVA 1AW7A 3MC0B 1AN8A 4C7ZA 1YNTE 3SFEB 3SFDB 5BYQA 4HEA1 4J3OD 3T3NA 1L0VB 2KACA 1SB3C 3B2GA 1VZ7A 4P16A 3OWEB 3AN1A 1IGDA 1VZ8A 1N63A 1ZDVA 2IDYA 4L2YA 1RWSA 3W9CB 4CQNA 1F77A 1A70A 3AE5B 4N6EB 3NVYA 3MFGA 2MEKA 1DOYA 1HA5A 3BWUD 3ETRA 3AECB 2J52A 3VR9B 3AM9A 1JWBD 1PFDA 2NMQA 2N0SB 2RMMA 2W82A 4YTPB 1ENFA 1HQRD 5HHDG 1IBXB 3W2DA 4REZA 4TQ1A 1F2RI 3W1SA 1IBXA 2KQ4X 2WU5B 1C77A 2CJNA 3Q69A 2W55A 2MJEA 1IUEA 1E10A 3KWVA 1K51A 1NI3A 1FO4A 2ICIA 3W5UB 2BS4B 4C80A 1DOIA 1MVKA 2LMCA 2SAKA 4AQ7A 1QOFA 1DYQA 1SBBB 3AE7B 3LB8C 4HJGE 3ZGZA 1BUIC 5T8IA 1C78A 2QILA 3SR6A 3BK1A 5C2TB 3B2FA 2WQYB 1F2RC 2Z8LA 3E9SA 3AE8B 1L0XB 1L4DB 2MJ3A 1I4GA 3AB5A 3Q8CA 2WXIA 1C4CA 2WXQA 1T3QA 2BBCA 4MACA 1TJEA 4XE0A 4WURA 4YT0B 2BYTA 5D7GA 2D5GA 4KGSA 2YEPF 4YTNB 4NJCA 1FNWA 1QQRA 4GLSC 5TSSA 1N62A 1GB4A 4YSXB 4A90A 2L32A 4RNAA 2JYTA 5EE1A 4IKGA 1TS4A 2BS2B 1SIJA 2WXKA 1PGBA 1E6EB 1XXGA 4GDLB 4B0EA 4EE2A 2BW2A 2L83A 4B0MA 2NTSA 2INNE 4P6VF 2BTEA 4WAFA 2M19A 2WDRB 1M4VA 1TS5A 1J7AA 2V4IB 3NZ3A 3TUOA 5LNK1 3P1MA 3NRZA 3AE3B 1XO3A 2QJLA 3NVZA 4RGMA 4NZLB 2H89B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2S C;  4YWG G;  3U4E G;  4DQO C; 
#chains in the Genus database with same CATH topology
 4KVG B;  2VZK D;  4BVU C;  2ZZP B;  3NVW A;  3AEF B;  3DBH I;  3RNB C;  2JXT A;  2V4L A;  5E6P A;  4KGR A;  1WX7 A;  2N7D A;  5I4D A;  4O1N A;  3N32 A;  3R8B A;  3JYU A;  4ZOH C;  1E5W A;  2JX5 A;  3ZVV A;  3H7S A;  3MJ5 A;  3KQ4 A;  2LI5 A;  2QC8 A;  4KDI C;  4CO7 A;  1GPX A;  2V9H A;  1WJN A;  4XGA B;  1WY8 A;  1UH6 A;  2AQ3 B;  2ZVO A;  1F0Z A;  2HJ1 A;  4ARC A;  1OEY J;  2INC C;  5CHV C;  2QIE B;  3QX1 A;  1PYW D;  2JXX A;  1GC7 A;  4M0W B;  4IW0 A;  2FAZ A;  2Z59 B;  4M0W A;  1ZP0 B;  3Q8A A;  4N9F 4;  1JW9 D;  1Q1O A;  4K1R B;  2VH2 A;  1UWX A;  3AI5 A;  1OEY A;  4M00 A;  1R4M B;  3VXW A;  2Y3A A;  2BS3 B;  5D2M B;  5FR6 A;  3PV1 A;  4E74 A;  5G55 A;  1ESF A;  1E7U A;  4G11 A;  1HTO A;  4W9K A;  3PRM B;  3RPF C;  2GBJ A;  2OED A;  2PVO D;  4R3D A;  3UI3 A;  4BKS D;  3J9C A;  3RN9 C;  1KFY B;  4F8C B;  4JLC A;  4WWM A;  1V97 A;  2RDG A;  2WGS A;  4IDI A;  2A4Z A;  3I9V 1;  3PRZ A;  1YMH E;  2ZNV B;  4UDU C;  2MWS B;  1SF0 A;  1ET6 A;  1TKE A;  1ZKH A;  5D94 A;  2KC1 A;  1WXQ A;  2PIA A;  3AE4 B;  2AWT A;  1QOA A;  3TEW A;  1QZE A;  5H92 C;  1V9J A;  3B1L X;  3ZRF A;  4P1C C;  4GMV A;  2KQS A;  2KWC A;  2V3P A;  1WXM A;  2FCS A;  4HLE A;  5LLI A;  2BT6 A;  1CJE A;  2UYZ B;  4ITK A;  4P7I A;  2YEP B;  1TY2 A;  4L23 A;  1AYF A;  3RMK C;  1TYG B;  1T6B X;  3B9J A;  4HPL B;  2K6D B;  2L00 B;  1E7P B;  1DOX A;  2I1J A;  1YQ3 B;  4HKQ A;  3KUZ A;  5MPO A;  1UGJ A;  2N9E B;  2W9N A;  1XLN A;  3B08 A;  1WIA A;  1HZ5 A;  2LFI A;  4K81 A;  4S17 A;  1YX6 B;  4A3O A;  2FCN A;  4PS3 A;  1VD2 A;  3MP9 A;  3JSV B;  2BWE S;  4GDK B;  3WAM A;  5EE3 A;  3B0A A;  2AQ2 B;  2KAJ A;  3URY A;  2KDE B;  1BT0 A;  2I2Y A;  2FCM A;  3RUI B;  1YIW A;  1EU4 A;  1I4R A;  1R4N I;  4CYE A;  3FIL B;  1KJT A;  2NBU A;  1C1Y B;  2WU2 B;  2IYD B;  3ML9 A;  5TR5 A;  3A9J A;  1SXT A;  4ZRP A;  4GGQ A;  1ROE A;  1KLV A;  1V2Y A;  4ASW C;  1KF6 B;  2DZM A;  4MSM B;  4GIV A;  1FPY A;  4HWI B;  2D10 A;  1X1M A;  2QDF A;  2WXG A;  3IHP C;  2DZJ A;  2G45 B;  3R7R A;  1GJZ A;  3LYY A;  3PHW B;  3R2T A;  1UUP A;  1RFK A;  3KVF B;  4WJP A;  2AYO B;  2KWU B;  2OJW A;  1ZUD 2;  2EMS A;  4K7S A;  2ON8 A;  2JPH A;  3HVZ A;  1FNV A;  3RNE C;  1N5X A;  1MJD A;  3SD5 A;  4FBJ B;  3BY4 B;  3L4P A;  3FKY A;  5AZG A;  1Q10 A;  2C60 A;  2BWF A;  2ZNV C;  4KGT A;  1NYR A;  3CF6 E;  4FA6 A;  4NQK E;  2LZ6 A;  4WIP A;  1JRO A;  1S1Q B;  2DAF A;  3FC4 A;  3L54 A;  2LHE A;  1T0Q C;  3ZQ4 A;  4PS7 A;  1WR6 E;  4MEL A;  3NVV A;  1SJH D;  5AZF A;  3KLS X;  1I4Q A;  2BPS A;  2GOW A;  2CU3 A;  4Q2J A;  1SIF A;  3EFC A;  2MSE D;  1KOT A;  4C4V B;  1EF5 A;  2E6X A;  2DYO A;  4XWT A;  2Y5P A;  4ICV A;  3AEE B;  1WXV A;  2WX1 A;  3KW5 B;  3EGR A;  2G4D B;  1I4X A;  4EKU A;  2WP9 B;  1CZP A;  3AE2 B;  2BKF A;  2K8C A;  1KH0 A;  3H6N A;  3V6C B;  4PS8 A;  2OOB B;  1FFV A;  2JUO A;  2JT4 B;  3MC0 B;  3OJ4 B;  3UIP B;  1AN8 A;  4C7Z A;  1YNT E;  3SFD B;  4J3O D;  3V61 A;  2LRW A;  2KAC A;  3B2G A;  5C23 A;  1VZ8 A;  2J0M A;  1ZDV A;  3PPA A;  4NJ6 A;  4L2Y A;  3ZNI D;  4CQN A;  3MFG A;  3TIX A;  1DOY A;  3ETR A;  4IUM B;  3H7P B;  4WWP A;  5DPW A;  3AM9 A;  2X8X X;  1J19 A;  2LD9 A;  3H7P A;  2XEW A;  4REZ A;  1F2R I;  3W1S A;  3RNF C;  3ZUN A;  2MJE A;  1P3Q U;  2CHZ A;  2BS4 B;  2V3S A;  1IPG A;  4AQ7 A;  2IY1 B;  1DYQ A;  3AE7 B;  3ZGZ A;  3VFK A;  3N3K B;  3CSF A;  2N7E A;  3SR6 A;  3BK1 A;  3B2F A;  2FIF A;  2WQY B;  2K8H A;  3ZTD A;  1L4D B;  2MJ3 A;  1I4G A;  2DX5 B;  2MBQ A;  3AB5 A;  3Q3F A;  2WXI A;  4YT0 B;  1TJE A;  4LNO A;  4KGS A;  4GLS C;  5TSS A;  2L32 A;  4RNA A;  4IKG A;  5DPS A;  3PGE A;  4GDL B;  3CST A;  2PPH A;  2BW2 A;  4GDL A;  4P6V F;  3ECI A;  2BTE A;  2M19 A;  2WDR B;  4HJK A;  2JY6 A;  1TS5 A;  3VUW A;  2YVC A;  3NZ3 A;  3HHM A;  5LNK 1;  2MA9 B;  2RR9 A;  3IFW B;  3RD2 A;  4RGM A;  4E71 A;  4M8N A;  2AX5 A;  2KMA A;  4YSY B;  2JQR B;  2L8J A;  2DYM A;  2PMV A;  1GOZ A;  4LTU A;  1SE3 A;  3DDC B;  3VRA B;  4FUL A;  4WJQ A;  3I57 A;  4K3C A;  4XDC A;  1J7C A;  3KH0 A;  1TY0 A;  3ZJT A;  3GS2 A;  1XLP A;  1JWU D;  3EUB 2;  2E3T A;  1JWA D;  1TZO A;  2K3U A;  4RGN A;  2WS3 B;  4XYC A;  1CQV A;  2K25 A;  3AU5 A;  3BII D;  1XLO A;  4OZC A;  2PTL A;  4RM8 A;  4AS1 A;  3AED B;  2RPQ A;  1WMH B;  4AUQ C;  2GI9 A;  4BFR A;  1DGJ A;  2UU7 A;  1V49 A;  1WMH A;  3QIJ A;  1JRU A;  4S0R A;  4W9G A;  3BYT B;  4YL8 A;  1C79 A;  4II3 B;  1RAX A;  2V0G A;  1V6E A;  3R66 C;  2O6V B;  4J6I A;  4BOS C;  1I4H A;  4HRO A;  3N1Z C;  2O6V A;  1V81 A;  5G5G A;  3BK2 A;  4DDG D;  5FKA C;  1PGX A;  5C3J B;  2INP E;  3ZXR A;  4EOY A;  3VQI A;  3QC8 B;  2MHJ A;  4MGI E;  4NNJ B;  1F52 A;  4US9 A;  2FCQ A;  2M8S A;  3T9L A;  2HJ8 A;  5IO9 A;  2FID A;  1ZGU B;  2DLB A;  2PE6 B;  3Q3M C;  3Q14 C;  4WQM A;  1AAR A;  1QKZ A;  3RFZ B;  3U8Z A;  4NAM A;  1SE9 A;  4JGH B;  1T5X D;  5D3I B;  1K50 A;  1KTK A;  1FD6 A;  1C76 A;  3GZN I;  4M01 A;  4KZC A;  2GLS A;  1VRA B;  3N1Y C;  2D07 B;  2FBW B;  4NJ7 A;  2KNB A;  1UBI A;  4W9E A;  5D6J B;  1TBE A;  2LGS A;  1P0R A;  3CWI A;  2RSU A;  4ANU A;  2N4F A;  2KOX A;  2PVG C;  2G9H D;  2KDF B;  1Q5W B;  4F7Z A;  1NBF C;  1LO5 D;  4JX1 C;  3V3X A;  2WXF A;  3PT2 B;  1XCQ L;  2LHD A;  4I6P A;  1WI0 A;  2IO3 B;  3M95 A;  2V1Y A;  3RNC C;  1SJE D;  4WAA A;  2AQ1 B;  2NPT B;  5HG2 A;  1HZ6 A;  4BBN C;  1FCC C;  2NPT A;  1E8Y A;  3M63 B;  1WXS A;  2LGI A;  4GSW A;  3M3J A;  2RDB C;  3RCZ A;  2V3N A;  4FAD A;  2ZCB A;  3V62 A;  4IM0 A;  4DK5 A;  2N9X A;  1XEE A;  2NBW B;  1GAQ B;  2Y5C A;  4FLH A;  4YXD B;  3UF8 A;  4ZRQ A;  1TKG A;  3P4Q B;  4IWO A;  2DBY A;  2TSS A;  3VRB B;  1JWS D;  1NDD A;  1PDX A;  4OZB A;  3EFU A;  1L5P A;  1D4B A;  4G50 A;  2Y5B B;  4A3P A;  3ZLZ A;  2LVO A;  1C4A A;  3QWZ B;  5BYR A;  3RNA C;  3P4S B;  1R4M I;  2FUH B;  4TKN A;  1OTR B;  4YWG G;  3EEC A;  5EE9 A;  5HKH A;  2KO3 A;  3ZYY X;  5J18 A;  1D3Z A;  1PGA A;  2VZK B;  3CIR B;  3VTU A;  3NY5 A;  4KX6 B;  1Y56 A;  2QMT A;  2OHF A;  4GXB A;  4IWP A;  1ZXH A;  4C7Y A;  5G2N A;  2BB6 A;  2LVQ A;  1SE2 A;  4OVZ A;  1RRB A;  2M17 A;  2PKO A;  3BVZ A;  3DBL B;  2GB1 A;  3ZNG C;  3DVN U;  2FUG 1;  5BMI A;  4DHZ E;  3UQA A;  1NEN B;  4KKJ A;  4KIK B;  2L05 A;  3AEB B;  4II2 B;  4KIK A;  2WLB A;  3NUH B;  1TS2 A;  2KXJ A;  1EWY C;  5IKC M;  1YX5 B;  3ALB A;  1OQR A;  1V1P B;  2MQJ A;  3QJZ A;  1E0Z A;  3ZTC A;  1WR1 A;  2KVZ A;  3I3T B;  3V05 A;  1E8Z A;  1V1P A;  2MRP A;  5DPR A;  1SE4 A;  1WGG A;  5H8Y E;  1E90 A;  1KLG D;  4LDT D;  1V1O A;  1XT9 B;  1QT9 A;  2K39 A;  4OVU A;  4HXD A;  5G5H A;  2OJR A;  3Q6B A;  1WE7 A;  3L0W B;  5HFY A;  1YN5 A;  4MH8 A;  3ZKJ C;  3UQB A;  2KAN A;  2M0X A;  3P63 A;  2FE8 A;  3MJW A;  2B3A A;  2AEH A;  4HCP B;  2GBR A;  5BO4 B;  1OQY A;  5GMV A;  2DNF A;  4BKS A;  5CHF A;  2IGH A;  1WGK A;  1I4P A;  1JCK B;  1XD3 B;  1ZXI A;  3WAN A;  5J17 A;  2KVR A;  4IOI E;  3HUI A;  1JRP A;  1FM0 D;  1WGY A;  4TSS A;  3Q8B A;  3U4E G;  1LQB A;  5BYS A;  1QF6 A;  1EO6 A;  2WYQ A;  1GUA B;  2XBB C;  3EC8 A;  3T3N A;  2BKR B;  1L0V B;  4GU2 A;  3A9J B;  3AN1 A;  3JVZ X;  5JZE B;  2RGF A;  4EEW A;  1N63 A;  1T0Y A;  1T0R C;  3WA0 A;  4IWQ A;  1R4N B;  3BWU D;  2J52 A;  1JWB D;  1PFD A;  3PTF C;  4FN2 A;  4NPN A;  2RMM A;  2W82 A;  4YTP B;  1ENF A;  5IA7 A;  1IBX B;  1CMX B;  2AL6 A;  4DHJ D;  1WYW B;  2KDB A;  1IBX A;  4HK2 A;  1UGM A;  5EDS A;  4GOC A;  3KWV A;  4ZYN A;  1WF9 A;  1H8C A;  3W5U B;  2UWQ A;  1DOI A;  1MVK A;  2BYV E;  3PS6 A;  5T8I A;  2K6Q A;  3U30 A;  2Z8L A;  3NJT A;  3AE8 B;  3V60 A;  3R7Q A;  5KHO A;  3DBR B;  1C4C A;  4XE0 A;  1T3Q A;  4EZJ A;  4WUR A;  5D7G A;  2D5G A;  4FJY A;  2YEP F;  1FNW A;  1QQR A;  2L76 A;  1GB4 A;  3X0W A;  2JYT A;  4MDK E;  2NS5 A;  2BS2 B;  4LNN A;  3L13 A;  1E6E B;  1XXG A;  1NI2 A;  4EE2 A;  3WAL A;  4G3X B;  4B0M A;  2NTS A;  2INN E;  3VDZ A;  2D3A A;  4WAF A;  1M4V A;  2V4I B;  2JF5 A;  3TUO A;  1IYF A;  3N30 A;  3X23 A;  3AE3 B;  3NOB A;  1WX8 A;  4NZL B;  4WWO A;  2H89 B;  1WH3 A;  3PZ8 A;  4MGZ E;  3RT3 B;  1E9M A;  1C9F A;  2WXN A;  2I38 A;  2MP2 B;  3PLV A;  2BVC A;  4X57 B;  1WM3 A;  3KUD B;  2ZW0 A;  2MP2 A;  5HI1 A;  3TMP B;  4IG7 B;  2K8B A;  2EKE C;  1MFW A;  2LVP A;  3H9D A;  2LGD A;  1MHX A;  3NS8 A;  3VAW A;  3Q3O C;  1YN4 A;  1JML A;  4URK A;  2B76 B;  3I63 C;  3L17 A;  2HE7 A;  2KJH B;  4ANV A;  4AWJ A;  1LM8 B;  1UWM A;  3AE9 B;  3ZXV A;  2MJD A;  3KWL A;  3MC8 A;  4PK1 A;  4IC7 B;  4DXA B;  2GBK A;  2J42 A;  2LUM A;  4YSZ B;  5DPT A;  5AUK A;  2CKH B;  1JWM D;  4RM9 A;  4AOF A;  4XWW A;  3U2S C;  4XZ4 A;  1J7B A;  5AUI A;  2IPK D;  1HXY D;  3IT6 B;  1WSP A;  1L0Y B;  3AE6 B;  4OW0 A;  4DXF A;  2X38 A;  5LXI B;  4H2A A;  3HK0 A;  2KZR A;  1UEL A;  1LGR A;  1VLB A;  4G0N B;  2DZK A;  4MM3 B;  3NZS A;  4AJY B;  4YTM B;  3A33 B;  4MM3 A;  3U7Z A;  1WYG A;  4HPP A;  4LCD E;  1F9J A;  1GC6 A;  3E56 A;  2ONQ A;  1V5O A;  3U7D A;  2BYE A;  4LNI A;  1J0G A;  4ARI A;  2QEJ C;  1D5X C;  2PJH A;  2WXJ A;  2BGF A;  4BAX A;  2KT7 A;  3SHQ A;  4IM2 A;  4XDD A;  3APC A;  1MPE A;  1P9D U;  2KFK B;  3GE8 C;  2NBV B;  3P42 A;  3PZ7 A;  2KWD A;  2KFK A;  3C19 A;  4XX5 A;  3DWG C;  2KKC A;  3HIZ A;  3LXF A;  1FFU A;  3VUX A;  3APD A;  2KC2 A;  4P1B C;  5DCN A;  3C8Y A;  1PUT A;  4BZA A;  2IJ0 A;  1YJI A;  1WZ3 A;  5JXV A;  1RFA A;  4TMA B;  1I7H A;  1V8C A;  1FEH A;  4K7U A;  3WCQ A;  2KYW A;  4RF1 A;  2LUE A;  3AH7 A;  4A55 A;  3TSS A;  2JWZ A;  4ZRI A;  3W5V B;  1K52 A;  1JAL A;  2BB5 A;  2KN4 A;  1AWD A;  1ET9 A;  2JYE A;  4DWF A;  3ZNZ B;  2ZW1 A;  1QIL A;  2WWZ A;  4RGT A;  3W1Y A;  4LK0 M;  2EEL A;  3P2B A;  2R2Q A;  2Q5W D;  3WIM A;  2G1E A;  2C7M B;  2QCZ A;  3A4R A;  5IAA C;  1QOB A;  2L3Z A;  2LGX A;  5EE0 A;  5BMH A;  1MI0 A;  1TTN A;  1WJ4 A;  4I6N B;  3A1Q B;  1FXI A;  2ZPN A;  2J4X A;  1P7E A;  1P98 A;  1RYJ A;  3AUL A;  1MG4 A;  3A1Q A;  2C5L C;  2ZPY A;  1TKY A;  3IBE A;  4MH0 E;  2KTF A;  2KWV B;  2W54 A;  5IN7 A;  4DXG A;  1VJK A;  1V5T A;  2NVU I;  3VH3 B;  3HVD A;  5GXG B;  4M8M A;  2L7R A;  4BOZ B;  4XC2 A;  3QK0 A;  3QCA A;  3Q3J A;  3W1S C;  4EFO A;  2VRR B;  2ACZ B;  2KX0 A;  3O65 B;  3BVM A;  4KZ0 A;  2N1V A;  2CHW A;  1L4Z B;  2CJO A;  3GP7 A;  5AEK B;  4HDQ A;  1T0S C;  3DQV A;  3T8M A;  3SDL C;  4BBN F;  2CR5 A;  3QAQ A;  4FHJ A;  3RNG C;  3QQ8 B;  2WX0 A;  1QOG A;  4RGO S;  2HDE A;  4OHJ A;  4PT5 A;  4B6W A;  3QHT A;  2WHI A;  3DVG X;  2KK8 A;  2SEB D;  4K7W A;  3OG5 A;  3PLU A;  4ZRJ A;  2D11 A;  5FK9 C;  3Q8F A;  1WRI A;  4JWU C;  3AV8 A;  3DHH C;  3AEA B;  4NQL B;  4LLG M;  4LJO B;  2O2V A;  1HTQ A;  2J53 A;  3OJ3 A;  2N9K A;  3ABV B;  2KMM A;  3UGB B;  3A4S C;  3ZDM C;  1E8X A;  3AEG B;  1B9R A;  3IT4 B;  4NY0 A;  3DBH B;  5E6O A;  2WXM A;  3D32 A;  1L7Y A;  4KSK C;  3N20 C;  1JQ4 A;  1B1Z A;  2N9L A;  1L2N A;  1IP9 A;  1Z2M A;  2D3G A;  3NG0 A;  4JE3 B;  4HVB A;  2WXO A;  4HRS A;  3AMZ A;  4N58 A;  2I1K A;  1ACC A;  1WGD A;  1UF0 A;  1G6J A;  1Z5S B;  2JZ3 B;  2KDM A;  1N5W A;  3ML8 A;  4MT5 A;  2FNJ B;  3P4P B;  5L95 C;  2WDQ B;  2MBH A;  2K0P A;  3L10 B;  4F1S A;  2J7Q B;  4DBG A;  1EF1 A;  5KHQ A;  5BYQ A;  4HEA 1;  2KLG A;  1SB3 C;  3CMM B;  1VZ7 A;  1WGH A;  4P16 A;  1IGD A;  2A5U A;  2R2O A;  3AXC A;  3APF A;  1WGR A;  2IDY A;  2IO2 B;  3KUC B;  1F77 A;  1A70 A;  3AE5 B;  4N6E B;  2MEK A;  1HE8 A;  3AEC B;  2MBB B;  3VR9 B;  2NMQ A;  2N0S B;  4M02 A;  3W2D A;  2LXA A;  4TQ1 A;  3I5J C;  2WU5 B;  1C77 A;  3Q69 A;  1E10 A;  1K51 A;  1E8W A;  2YLM A;  2LMC A;  3QAR A;  2SAK A;  3ZNH B;  1QOF A;  2KMC A;  5CX3 A;  2IO1 B;  5JHA A;  3JW0 X;  1F1H A;  3GE3 C;  1C78 A;  1V80 A;  2QIL A;  1H4R A;  3DBL I;  4PYU A;  3UIO B;  3OLM D;  4W9F A;  1WJU A;  2LRU A;  1TGZ B;  1N62 A;  2WDT B;  3MTN B;  4YSX B;  4LNF A;  1TS4 A;  1SIJ A;  2WXK A;  1RLF A;  2KQ7 A;  1VCB A;  2JZZ A;  3QA8 A;  3DCG A;  1KM7 A;  2KLC A;  2C9W B;  3PVL A;  2D3B A;  3P1M A;  2GBM A;  1XO3 A;  2QJL A;  3NVZ A;  3DVG Y;  3ENE A;  4ZRK A;  1ZPS A;  2DYB A;  2XK5 B;  4E3C A;  1YJ1 A;  3WAP A;  2GMI C;  4ACF A;  2XK5 A;  2XNA C;  4A20 A;  2KN5 A;  1FRR A;  4FJV B;  1WRD B;  4OVV A;  4JPS A;  1WXA A;  2CS4 A;  1Y8R C;  3PZD A;  2GRI A;  2NTT A;  1ISN A;  1XF5 L;  2KX3 A;  1TIF A;  1WE6 A;  4K3B A;  3PRE A;  3PO0 A;  4EUT A;  4ZDV A;  1GNU A;  2XN9 C;  2KJR A;  2BYF A;  2DAJ A;  4KDL B;  3N9Y C;  4HKZ E;  3T3O A;  4ZHO A;  2N1W A;  1LXD A;  1IGC A;  2L1A A;  1OFF A;  4AJW A;  1HEZ E;  1XCT L;  3EHV A;  3DPD A;  4CHK A;  3JSV A;  1FRD A;  3MHZ A;  5L83 A;  2EKI A;  4EZK A;  4GDK A;  3TEX A;  3NHE B;  5E6J A;  2JVC A;  1YQ4 B;  4RFB A;  2PLP A;  4C56 C;  3DHG C;  2IBI B;  3R2I A;  2LEK A;  4AP4 C;  2HTH A;  3VH4 B;  1BXT A;  4LDT B;  3FIL A;  3O13 A;  3IG3 A;  3KYC D;  4N59 A;  2NCN A;  2NR2 A;  2BF8 B;  3VTV A;  1KLU D;  1YN3 A;  1NVI D;  1EU3 A;  4GB9 A;  4EZL A;  1A5R A;  2G3Q B;  1ZDX A;  3ZJU A;  2ZJD A;  5E6N A;  4WQO B;  3SEB A;  4I6L B;  2LWP A;  1WZ0 A;  1TS3 A;  2G4S A;  1FXA A;  4KKI A;  3DBR I;  2JZP A;  4WWN A;  3RZW C;  4A9A A;  5FR3 A;  1NYQ A;  3IXS A;  2KFJ A;  5JHB A;  2JSV X;  4MGY E;  1V86 A;  2IGG A;  3EA6 A;  3Q3N C;  2K22 A;  3FAH A;  3HM6 X;  2R61 A;  2IGD A;  4WH4 A;  3WAO A;  1N61 A;  1VDV A;  1K8R B;  1SEB D;  4TQ0 A;  1FIQ A;  4JQW C;  2IND C;  3UIN B;  5AZH A;  3BYY B;  1NEK B;  3TL5 A;  1WX9 A;  3SU8 X;  4IM3 A;  3V6E B;  2RD0 A;  2LJ5 A;  2PE9 A;  2VH1 A;  1MHH E;  4DHJ B;  1EWC A;  3TEZ A;  3K9P B;  5CHW A;  2JRH A;  1D6E C;  3AU4 A;  3MHS D;  2KDI A;  1STE A;  2JU6 X;  1ZOY B;  1RM6 C;  4LNK A;  1P1A A;  1I42 A;  1Q0W B;  2WDV B;  1SSN A;  3RZF A;  5IP4 D;  1GB1 A;  4W9J A;  2JWU A;  4BKT A;  2H88 B;  1UD7 A;  2PW9 A;  3HM3 A;  2WXH A;  1D5M C;  4C4V A;  2LGY A;  4NAW B;  4ZHP A;  4PYZ A;  4A6Q A;  2CU1 A;  2L0F A;  1VR9 A;  1XLQ A;  3ONS A;  3U52 E;  4KV2 A;  1EM7 A;  4NAW A;  1OGW A;  3PSE B;  3VR8 B;  3NS1 A;  1UNS A;  2LJI A;  4KSL C;  4RH6 A;  3HRD D;  1ZE3 D;  1PQS A;  2RDH A;  2J0J A;  1CK1 A;  4OZA A;  4WJO A;  4JWS C;  2REX A;  2DWQ A;  2HD5 B;  1KRH A;  4MSQ B;  2LXC A;  2Z0D B;  1D5Z C;  1EUV B;  4ANW A;  4A8X C;  2QSD A;  1FNU A;  4WJN A;  3BVG A;  5D3D A;  3DOW A;  1C3T A;  1FXT B;  3P4R B;  3DWM A;  3OAW A;  3TCA A;  1N60 A;  1P7F A;  1UZX B;  2QHO A;  3R3M A;  2MH7 A;  3IAM 1;  1GG3 A;  2KD0 A;  3H8H A;  4QAY A;  3IVF A;  3TEY A;  2DEN B;  2Z0E B;  2IO0 B;  2KTR B;  3N1X C;  4MJS B;  2MCN B;  2DHZ A;  3RYT A;  1XQQ A;  2KTR A;  4MJS A;  1VZ6 A;  3VTW A;  4US8 A;  3BZD B;  1BML C;  3Q8E A;  3L16 A;  4MEM A;  4DQO C;  1J8C A;  2M4N A;  3IAS 1;  2K1F A;  1L6U A;  4RCO A;  4ICU A;  4D2K A;  2KJ6 A;  2HTM E;  1N6Z A;  2K9X A;  2W3S A;  1E7V A;  4LJP B;  2L0T A;  1OQQ A;  2O6V D;  3M62 B;  4DDI D;  3AE1 B;  1YJJ A;  2MX2 A;  2ZCC A;  2WNM A;  2D2Q A;  3DBS A;  2AL3 A;  2L52 A;  2GBN A;  1WWT A;  2EMT A;  3Q2A C;  4MGK E;  4BKG A;  4RF0 A;  1TT5 B;  2LAS A;  2RPV A;  3ZW3 A;  2W3R A;  1K53 A;  2WXR A;  2C7H A;  3ZJV A;  4ZYS A;  4HCN B;  1SGH A;  3MC9 A;  4GN1 A;  2WXP A;  2N7J A;  1QLB B;  3TJP A;  4L1B A;  2D3C A;  1FMA D;  3DVN V;  4FHK A;  4HPM B;  2ASQ A;  5IOI A;  3GB1 A;  2K5P A;  3LDZ E;  1R7S A;  2DZI A;  2C7N B;  3KYD D;  3VUY A;  5JH5 C;  2BQQ A;  3VHT C;  2M1M A;  2M56 B;  2KHW B;  4JL9 A;  5BMG A;  3LJ3 A;  5C1Z A;  3RI7 C;  4USA A;  1ZW7 A;  3S2A A;  3DHI C;  1C4P A;  2IY0 B;  2M0A A;  1FCL A;  1L6V A;  2CHX A;  2WXL A;  4FXC A;  3RUL A;  1YQB A;  4B95 A;  1AW7 A;  4W9C A;  4W9L A;  3C0R B;  4HDO A;  3SFE B;  2N9P C;  4TUU A;  3OWE B;  5CTR C;  1RWS A;  2J0K A;  3W9C B;  1U4A A;  3VVW B;  3NVY A;  1HA5 A;  1WFY A;  2PEA A;  3BIN A;  4RMA A;  1M94 A;  3ZO5 B;  2ZVN A;  4W9D A;  4W9H A;  1HQR D;  5HHD G;  2MW5 A;  4C00 A;  1UBQ A;  3L08 A;  4ANX A;  2KQ4 X;  2CJN A;  3ZRC A;  2W55 A;  4B9K A;  1IUE A;  2MBO A;  1NI3 A;  3GOE A;  1FO4 A;  2ICI A;  3NZU A;  4C80 A;  3PHX B;  5LXH A;  4FJZ A;  3ZDT A;  1SBB B;  3LB8 C;  2IZV B;  4HJG E;  1BUI C;  5C2T B;  1TZ1 A;  1F2R C;  3E9S A;  2MBE A;  1L0X B;  1WJ6 A;  2ZEQ A;  2JRI B;  3Q8C A;  2WXQ A;  4MAC A;  2BBC A;  3PRP B;  2BYT A;  3A9K B;  3ZIM A;  2MLB A;  4YTN B;  4NJC A;  4TV3 A;  3GZN B;  3A9K A;  1S3S G;  4JIO U;  4A90 A;  5EE1 A;  4DHZ B;  1PGB A;  5J2R A;  4W9I A;  4B0E A;  1MG8 A;  1I35 A;  3H1U A;  1LFD A;  2L83 A;  2O2V B;  1J7A A;  1YOV B;  1WM2 A;  3K9O B;  1YD8 U;  3NRZ A;  3TBL D; 
#chains in the Genus database with same CATH homology
 1ZPS A;  2AX5 A;  2VZK D;  3PZ8 A;  4YSY B;  2JQR B;  3NVW A;  2PMV A;  2DYM A;  1E9M A;  3AEF B;  1GOZ A;  2XNA C;  2JXT A;  1C9F A;  4KGR A;  4LTU A;  1SE3 A;  1FRR A;  3VRA B;  2WXN A;  5I4D A;  3I57 A;  2I38 A;  4JPS A;  4XDC A;  4O1N A;  1J7C A;  1TY0 A;  3ZJT A;  3GS2 A;  3R8B A;  1XLP A;  2ZW0 A;  1JWU D;  4ZOH C;  2GRI A;  3EUB 2;  2E3T A;  2NTT A;  5HI1 A;  1JWA D;  1XF5 L;  1TZO A;  2JX5 A;  2K3U A;  3MJ5 A;  4RGN A;  2WS3 B;  3KQ4 A;  1CQV A;  3BII D;  1MHX A;  1XLO A;  3PO0 A;  1GPX A;  4OZC A;  2PTL A;  2XN9 C;  1YN4 A;  4AS1 A;  3N9Y C;  4HKZ E;  3T3O A;  3AED B;  1JML A;  4ZHO A;  2AQ3 B;  1IGC A;  1F0Z A;  2L1A A;  4ARC A;  2B76 B;  1OFF A;  2GI9 A;  2QIE B;  1DGJ A;  1PYW D;  1HEZ E;  1XCT L;  1UWM A;  3AE9 B;  3BYT B;  1FRD A;  3MHZ A;  2MJD A;  2EKI A;  3TEX A;  1C79 A;  3KWL A;  4M0W A;  5E6J A;  2V0G A;  1ZP0 B;  3Q8A A;  1YQ4 B;  4RFB A;  1JW9 D;  2PLP A;  4C56 C;  2J42 A;  1UWX A;  1I4H A;  2LUM A;  3R2I A;  4YSZ B;  5AUK A;  2LEK A;  4HRO A;  1JWM D;  1BXT A;  4XWW A;  3U2S C;  2Y3A A;  3FIL A;  2BS3 B;  1J7B A;  3O13 A;  5AUI A;  5G5G A;  2IPK D;  1HXY D;  3IT6 B;  1ESF A;  1WSP A;  1L0Y B;  3BK2 A;  3AE6 B;  5FKA C;  1PGX A;  4N59 A;  4OW0 A;  4DXF A;  5C3J B;  2X38 A;  2INP E;  1KLU D;  4H2A A;  1YN3 A;  3VQI A;  1NVI D;  1EU3 A;  3RPF C;  2OED A;  2PVO D;  4R3D A;  3UI3 A;  3J9C A;  1VLB A;  1ZDX A;  4US9 A;  1KFY B;  3ZJU A;  4MM3 B;  4WWM A;  3SEB A;  4YTM B;  1V97 A;  2DLB A;  1TS3 A;  2RDG A;  4IDI A;  3U7Z A;  1FXA A;  1WYG A;  3I9V 1;  4WQM A;  4KKI A;  1QKZ A;  3E56 A;  2ONQ A;  3RFZ B;  2JZP A;  4A9A A;  5FR3 A;  1NYQ A;  3IXS A;  4NAM A;  1YMH E;  4UDU C;  4ARI A;  1T5X D;  2QEJ C;  5D3I B;  1SF0 A;  1K50 A;  1ET6 A;  1KTK A;  1FD6 A;  1D5X C;  1C76 A;  1TKE A;  2JSV X;  1WXQ A;  2WXJ A;  2IGG A;  1VRA B;  2PIA A;  2FBW B;  3EA6 A;  4XDD A;  3AE4 B;  2K22 A;  3FAH A;  1MPE A;  1QOA A;  2R61 A;  3TEW A;  2IGD A;  3CWI A;  4WH4 A;  5H92 C;  1N61 A;  3P42 A;  3PZ7 A;  1VDV A;  2KWD A;  1SEB D;  3DWG C;  4TQ0 A;  2PVG C;  2G9H D;  2V3P A;  3LXF A;  1FFU A;  1FIQ A;  2BT6 A;  1CJE A;  3C8Y A;  1LO5 D;  1PUT A;  4ITK A;  4JX1 C;  2IJ0 A;  1YJI A;  2WXF A;  3V3X A;  5JXV A;  2YEP B;  4TMA B;  1TY2 A;  1XCQ L;  1NEK B;  2LHD A;  1I7H A;  1AYF A;  3BYY B;  4L23 A;  1V8C A;  1TYG B;  1T6B X;  1FEH A;  3WCQ A;  4RF1 A;  3B9J A;  1SJE D;  2AQ1 B;  5HG2 A;  1HZ6 A;  1MHH E;  3AH7 A;  1EWC A;  3TEZ A;  4A55 A;  1FCC C;  1E7P B;  1DOX A;  1D6E C;  1YQ3 B;  3TSS A;  4HKQ A;  5MPO A;  1UGJ A;  3W5V B;  1STE A;  1K52 A;  2JU6 X;  1ZOY B;  1XLN A;  1JAL A;  2LGI A;  1RM6 C;  2BB5 A;  2KN4 A;  1AWD A;  1ET9 A;  1HZ5 A;  2JYE A;  2LFI A;  2V3N A;  2WDV B;  1SSN A;  2ZW1 A;  1QIL A;  4RGT A;  1GB1 A;  4LK0 M;  2EEL A;  2JWU A;  2H88 B;  2Q5W D;  2PW9 A;  1XEE A;  2WXH A;  1GAQ B;  2Y5C A;  1D5M C;  2G1E A;  3MP9 A;  4ZRQ A;  4YXD B;  1TKG A;  3P4Q B;  4NAW B;  2DBY A;  2TSS A;  4ZHP A;  4A6Q A;  3VRB B;  4GDK B;  1VR9 A;  1QOB A;  1XLQ A;  1JWS D;  3U52 E;  1PDX A;  5EE3 A;  4OZB A;  5EE0 A;  5BMH A;  1EM7 A;  1MI0 A;  2AQ2 B;  2KAJ A;  3URY A;  3VR8 B;  1L5P A;  3NS1 A;  1UNS A;  1D4B A;  2I2Y A;  2LJI A;  4RH6 A;  1FXI A;  3HRD D;  1EU4 A;  1ZE3 D;  2J4X A;  1P7E A;  1I4R A;  1RYJ A;  2RDH A;  3FIL B;  1CK1 A;  4OZA A;  1C4A A;  4JWS C;  1TKY A;  5BYR A;  2WU2 B;  2DWQ A;  1KRH A;  3P4S B;  4YWG G;  2W54 A;  1D5Z C;  5EE9 A;  4DXG A;  4A8X C;  1SXT A;  1FNU A;  1VJK A;  2QSD A;  3BVG A;  5D3D A;  4ZRP A;  1ROE A;  3HVD A;  3ZYY X;  1KF6 B;  3P4R B;  5GXG B;  3DWM A;  1N60 A;  1P7F A;  1PGA A;  2VZK B;  3CIR B;  2MH7 A;  2WXG A;  3IAM 1;  4KX6 B;  1Y56 A;  3H8H A;  2QMT A;  2OHF A;  3TEY A;  3LYY A;  1ZXH A;  4C7Y A;  2ACZ B;  3R2T A;  2BB6 A;  1UUP A;  3BVM A;  1RFK A;  1SE2 A;  4OVZ A;  1VZ6 A;  1L4Z B;  4US8 A;  2CJO A;  1ZUD 2;  3GP7 A;  2PKO A;  3BVZ A;  3BZD B;  1BML C;  3Q8E A;  2ON8 A;  2GB1 A;  4DQO C;  3HVZ A;  1FNV A;  2FUG 1;  1N5X A;  5BMI A;  1NEN B;  4KKJ A;  1QOG A;  3IAS 1;  3L4P A;  2HDE A;  4OHJ A;  4PT5 A;  4RGO S;  1L6U A;  3AEB B;  4RCO A;  1Q10 A;  2WLB A;  4D2K A;  3NUH B;  1TS2 A;  1EWY C;  2HTM E;  4KGT A;  2K9X A;  1NYR A;  2W3S A;  2SEB D;  1OQR A;  1V1P B;  1OQQ A;  4WIP A;  1E0Z A;  1JRO A;  3V05 A;  3AE1 B;  1YJJ A;  5FK9 C;  3Q8F A;  1V1P A;  3FC4 A;  2WNM A;  1SE4 A;  5H8Y E;  1WRI A;  1KLG D;  4JWU C;  3AV8 A;  1V1O A;  3AEA B;  2L52 A;  1WWT A;  4LLG M;  2LHE A;  1QT9 A;  4RF0 A;  2RPV A;  3ZQ4 A;  2W3R A;  1K53 A;  2WXR A;  5G5H A;  2J53 A;  3ZJV A;  3NVV A;  4ZYS A;  2N9K A;  3ABV B;  2KMM A;  5HFY A;  1YN5 A;  4MH8 A;  1SJH D;  2WXP A;  2N7J A;  3AEG B;  3P63 A;  1QLB B;  1B9R A;  2FE8 A;  3IT4 B;  3KLS X;  4L1B A;  2WXM A;  1I4Q A;  1FMA D;  2CU3 A;  1JQ4 A;  3GB1 A;  4Q2J A;  1B1Z A;  2IGH A;  1WGK A;  1I4P A;  2N9L A;  2K5P A;  1JCK B;  1R7S A;  2E6X A;  1ZXI A;  2DYO A;  4JE3 B;  4XWT A;  2Y5P A;  2WXO A;  4HRS A;  3AMZ A;  3AEE B;  4N58 A;  1ACC A;  2M56 B;  5BMG A;  3EGR A;  4IOI E;  2KDM A;  1N5W A;  3HUI A;  1JRP A;  1I4X A;  2WP9 B;  4MT5 A;  1CZP A;  3AE2 B;  1FM0 D;  3P4P B;  4USA A;  2WDQ B;  1C4P A;  2M0A A;  4TSS A;  3Q8B A;  3U4E G;  1L6V A;  1KH0 A;  2WXL A;  1FCL A;  5BYS A;  4FXC A;  2K0P A;  1QF6 A;  1FFV A;  1AW7 A;  3MC0 B;  1AN8 A;  4C7Z A;  1YNT E;  3SFE B;  3SFD B;  5BYQ A;  4HEA 1;  4J3O D;  3T3N A;  1L0V B;  2KAC A;  1SB3 C;  3B2G A;  1VZ7 A;  4P16 A;  3OWE B;  3AN1 A;  1IGD A;  1VZ8 A;  1N63 A;  1ZDV A;  2IDY A;  4L2Y A;  1RWS A;  3W9C B;  4CQN A;  1F77 A;  1A70 A;  3AE5 B;  4N6E B;  3NVY A;  3MFG A;  2MEK A;  1DOY A;  1HA5 A;  3BWU D;  3ETR A;  3AEC B;  2J52 A;  3VR9 B;  3AM9 A;  1JWB D;  1PFD A;  2NMQ A;  2N0S B;  2RMM A;  2W82 A;  4YTP B;  1ENF A;  1HQR D;  5HHD G;  1IBX B;  3W2D A;  4REZ A;  4TQ1 A;  1F2R I;  3W1S A;  1IBX A;  2KQ4 X;  2WU5 B;  1C77 A;  2CJN A;  3Q69 A;  2W55 A;  2MJE A;  1IUE A;  1E10 A;  3KWV A;  1K51 A;  1NI3 A;  1FO4 A;  2ICI A;  3W5U B;  2BS4 B;  4C80 A;  1DOI A;  1MVK A;  2LMC A;  2SAK A;  4AQ7 A;  1QOF A;  1DYQ A;  1SBB B;  3AE7 B;  3LB8 C;  4HJG E;  3ZGZ A;  1BUI C;  5T8I A;  1C78 A;  2QIL A;  3SR6 A;  3BK1 A;  5C2T B;  3B2F A;  2WQY B;  1F2R C;  2Z8L A;  3E9S A;  3AE8 B;  1L0X B;  1L4D B;  2MJ3 A;  1I4G A;  3AB5 A;  3Q8C A;  2WXI A;  1C4C A;  2WXQ A;  1T3Q A;  2BBC A;  4MAC A;  1TJE A;  4XE0 A;  4WUR A;  4YT0 B;  2BYT A;  5D7G A;  2D5G A;  4KGS A;  2YEP F;  4YTN B;  4NJC A;  1FNW A;  1QQR A;  4GLS C;  5TSS A;  1N62 A;  1GB4 A;  4YSX B;  4A90 A;  2L32 A;  4RNA A;  2JYT A;  5EE1 A;  4IKG A;  1TS4 A;  2BS2 B;  1SIJ A;  2WXK A;  1PGB A;  1E6E B;  1XXG A;  4GDL B;  4B0E A;  4EE2 A;  2BW2 A;  2L83 A;  4B0M A;  2NTS A;  2INN E;  4P6V F;  2BTE A;  4WAF A;  2M19 A;  2WDR B;  1M4V A;  1TS5 A;  1J7A A;  2V4I B;  3NZ3 A;  3TUO A;  5LNK 1;  3P1M A;  3NRZ A;  3AE3 B;  1XO3 A;  2QJL A;  3NVZ A;  4RGM A;  4NZL B;  2H89 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...