4DQOC

Crystal structure of pg16 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
115
structure length
88
Chain Sequence
TTFKLAACVTLACTRVKHCSFNITTDVKDRKQKVNATFYLYRLISCQTTTTEAVDAATAAKVFKQYANDNGIDGEWTYDDATKTFTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PG16 Fab Heavy Chain
publication title Structural basis for diverse N-glycan recognition by HIV-1-neutralizing V1-V2-directed antibody PG16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 88
sequence length 115
ec nomenclature
pdb deposition date 2012-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.790 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dqoC00
4YWGG 4DQOC 3U4EG 3U2SC
chains in the Genus database with same CATH superfamily
2BYVE 2HTHA 4WQMA 1OFFA 2WWZA 3B0AA 1ZKHA 4NJ7A 5BMIA 2KWDA 3EHVA 3DPDA 2DNFA 1RFAA 2JXXA 3NHEB 1HZ5A 2G45B 4GLSC 1I35A 3EC8A 3DVGY 2KTRA 1WZ0A 2DZMA 3IVFA 1PGBA 1YN5A 2YLMA 3H8HA 3EECA 2LMCA 3OG5A 1Y8RC 1P7FA 4WWOA 4RGTA 1CZPA 4IWPA 4DWFA 3FKYA 3R8BA 1P1AA 3NS8A 1L0XB 3A9JA 2KWUB 3I63C 4FJVB 3WAPA 2AQ1B 3AECB 4PS3A 4F8CB 2PEAA 5EE9A 2BPSA 5AEKB 2LASA 2JUOA 1D5MC 1ZE3D 3C0RB 4IUMB 2G1EA 3DHHC 1LFDA 1C4CA 1WXVA 1DYQA 2ZPNA 4DHZB 2JZ3B 2VRRB 1N63A 1XCQL 1TGZB 1LQBA 4KKIA 2B76B 4YXDB 3HVDA 4YSZB 1L5PA 1N61A 5G2NA 3AEAB 1NEKB 1WGYA 2UYZB 2C7MB 2L05A 2WQYB 3RT3B 1UD7A 2I38A 5IAAC 3GOEA 3N9YC 5JHAA 2I2YA 1NI2A 2ZZPB 4FBJB 2BS4B 4TUUA 3PLVA 3ZLZA 2LRWA 1RFKA 2DZKA 1WRIA 2QEJC 1UWMA 1OQYA 1XLPA 4K1RB 3W5VB 2D3BA 2E6XA 1CQVA 3QWZB 2LHDA 5G5HA 2WXIA 1QLBB 3N30A 4J3OD 1ESFA 4JQWC 1V9JA 4HKQA 2KTFA 4II3B 2IYDB 3P42A 3ZIMA 1KLGD 2MLBA 3PGEA 3RI7C 2JSVX 2XEWA 2BGFA 2IJ0A 4TMAB 1KM7A 2INDC 3ML8A 1WFYA 2X8XX 1J8CA 4JPSA 1TS5A 3DCGA 1WYGA 4FJYA 3L08A 3KH0A 1WI0A 1K8RB 2KX3A 3ZUNA 2WGSA 3DBRI 4EKUA 2PE6B 2MBBB 1C79A 1EU3A 3RFZB 3ZJUA 3JSVB 3GS2A 1X1MA 1EF1A 3QK0A 3VUYA 3SDLC 4JE3B 1CMXB 1J19A 4W9EA 2KDIA 1G6JA 1JCKB 2AEHA 3TEZA 1YNTE 1SF0A 3HVZA 2K9XA 3Q3OC 2LEKA 3W1YA 3AEGB 3W9CB 1L0YB 3VDZA 2KC1A 3ZNZB 4YTMB 3KUZA 2R61A 3L17A 3Q8BA 3V6CB 1MPEA 1QOAA 4NY0A 5AZFA 2QC8A 4DK5A 4ZOHC 5DPRA 1EM7A 4JLCA 2N9PC 3WALA 2RMMA 1UBQA 4KGSA 1L0VB 2CHWA 2LI5A 4MGYE 1D4BA 3U4EG 3PHXB 1E90A 2DAFA 1PUTA 1KLVA 1RLFA 2MRPA 1GUAB 1PQSA 3R7QA 1JRPA 5AUKA 2G3QB 4AOFA 2L1AA 5KHOA 1FXTB 1WXQA 2L7RA 2XNAC 1TTNA 3C8YA 1I4QA 3H7PB 3RZWC 3PREA 1ZXHA 3L4PA 1WE7A 2Y5CA 3AN1A 1NVID 1I4XA 3LDZE 1R4MI 4P6VF 3DBHB 4AP4C 2PPHA 4HCNB 4NNJB 2LRUA 1N5XA 4HWIB 3DHIC 3I57A 2BWES 2KANA 2D2QA 1ZOYB 2WXFA 2K25A 3MFGA 1HQRD 3V05A 1Z2MA 2R2QA 1E5WA 1S3SG 4WIPA 3B2GA 1SXTA 4P16A 1IGCA 3AEEB 4EZKA 2JQRB 2L83A 1FNVA 1VD2A 4HKZE 3OJ3A 4B6WA 4QAYA 3QAQA 3DBLI 2BYEA 3NVVA 1SJED 3ZNID 2KXJA 4YSYB 4MM3B 4LLGM 3VR9B 4R3DA 3RNFC 3APCA 1E10A 4W9HA 3AI5A 2HDEA 2K8CA 4KSLC 4WQOB 2G4DB 2K6QA 1UNSA 2KO3A 3VUXA 1OQRA 3FC4A 4DHJB 3GZNI 2KMMA 3M63B 2J0MA 2WX1A 4ZHOA 3KW5B 2KAJA 3A1QA 3ZNGC 3RNCC 4W9IA 2KLCA 2WDQB 3EFCA 1YN3A 2N0SB 3A4RA 1SEBD 2V4IB 2J53A 3ABVB 1WSPA 1FXAA 3QA8A 1J7CA 1Q0WB 3AM9A 3SR6A 3Q3NC 2CHZA 4RGOS 3WANA 3RNAC 4ITKA 4NQKE 1E7UA 4DXFA 2K1FA 2LXCA 1V5OA 2WDRB 2PIAA 5I4DA 2UWQA 5HHDG 1QZEA 1V81A 4KX6B 4HROA 5BMGA 1UELA 3CSFA 3NUHB 2MJEA 1UGMA 4I6LB 4CHKA 4YWGG 4ZRIA 4KDIC 4WH4A 3N1ZC 1GB1A 3NZ3A 5EDSA 1QOBA 1YJJA 5C1ZA 2KDBA 2MW5A 4YSXB 2VH1A 3LB8C 3BK1A 3I5JC 5IKCM 1D6EC 1N62A 4MSMB 4FXCA 3APDA 3TSSA 3WCQA 5IP4D 2ICIA 3B08A 3DBSA 4WURA 3P4PB 1XCTL 3BYTB 3PLUA 2K39A 3ZGZA 1R4NB 2K0PA 4W9FA 2K5PA 2V1YA 3NVWA 1FRDA 2M0AA 1YQBA 3IBEA 2AL6A 1N60A 1ET9A 1ACCA 1KJTA 2GI9A 2JRHA 4HVBA 2O2VB 4B0MA 1HE8A 4NZLB 4M0WB 2C60A 3AXCA 3SHQA 1WM3A 1HA5A 4URKA 3ZJTA 4C4VB 2K8HA 4TQ0A 4JIOU 1F77A 2LGYA 3P63A 3H7SA 5BMHA 1TKEA 2V3PA 1OGWA 2WXQA 2GB1A 3QX1A 1C76A 1YQ4B 3ZYYX 4X57B 1M4VA 2M56B 2VZKD 4P1BC 2NBWB 3NOBA 2M17A 3PS6A 2WXRA 4MH8A 1C9FA 4G0NB 1HZ6A 1V1PA 2KVZA 2INCC 1SJHD 1FXIA 3T3NA 1WMHB 1VLBA 2QHOA 2KZRA 2J42A 4NAWA 5BYSA 4M8MA 5HFYA 3DVNU 3UQAA 2KK8A 3DWGC 2V3SA 3WAMA 1H8CA 5IOIA 5LXHA 4PS8A 4RF0A 4KIKA 1HEZE 1FIQA 2WU5B 4GIVA 2KN4A 5C3JB 4M01A 2OOBB 1HTOA 3ONSA 3FILB 4KDLB 4E3CA 1YQ3B 1SE4A 2GOWA 2PMVA 4HJGE 2WDTB 3VVWB 2EMSA 5MPOA 2RDBC 2BS3B 2LGSA 2RDHA 1P0RA 4RF1A 5L83A 2EKEC 3BY4B 4L2YA 2AWTA 2M8SA 1KFYB 3PRZA 2FNJB 2G9HD 2HD5B 3C19A 2JYEA 2WXOA 1SE2A 1HXYD 3RCZA 3JVZX 1GG3A 4IW0A 1YX5B 2FUHB 4ARIA 3M62B 4YT0B 4FULA 2DX5B 3UINB 2Q5WD 1WGKA 5LLIA 2GRIA 3LYYA 4KKJA 2QSDA 3T8MA 3KVFB 4BFRA 3VQIA 4IM0A 1F9JA 1P98A 1XLNA 2JYTA 2O6VA 1L7YA 1B1ZA 2HJ8A 4LDTD 3L54A 2PLPA 1WJ6A 3RN9C 4TQ1A 1WX7A 5DCNA 1WGGA 3HHMA 3IAS1 1ZXIA 4A3OA 4RNAA 2VH2A 2EELA 2KFKA 4E74A 3ZNHB 1B9RA 1EWCA 3BVZA 1L6VA 3N3KB 3UQBA 2N1WA 2IO3B 4K7UA 5JXVA 3PZDA 2J4XA 3Q14C 1TS4A 5JH5C 3IT4B 3V6EB 3AE5B 3LXFA 1C3TA 2GBRA 3E9SA 3ECIA 1ZPSA 3KUDB 1DOYA 1T0QC 4MGIE 1ZW7A 4HPPA 2BW2A 4FADA 5CHVC 3MTNB 3RULA 4RH6A 4P1CC 2LWPA 3ZDTA 2FIFA 3E56A 3U52E 1ROEA 2MQJA 1F2RI 2KC2A 3CMMB 4IDIA 1WR1A 1WJNA 2GMIC 2DYMA 2MCNB 1LXDA 4GDKB 2ONQA 4G50A 1WGRA 4RMAA 4C80A 2LGDA 4RFBA 4LNKA 5CHWA 1T0RC 2NCNA 1JALA 2ZVNA 4P7IA 5CTRC 4GGQA 3IG3A 1GOZA 2LXAA 1PDXA 3TEWA 2J0KA 3RPFC 1SSNA 2L8JA 4MGZE 2KQSA 3UI3A 1JROA 2C5LC 4IOIE 2DZJA 3V62A 2O6VD 2GLSA 3PT2B 2Y5BB 2JZZA 1OQQA 3P4RB 5HG2A 3DBHI 1C1YB 1A5RA 1JMLA 4WWPA 3RZFA 2CHXA 4IM3A 3Q2AC 4GSWA 1IBXA 3AU5A 1YOVB 3GE8C 5TR5A 2IGDA 1AWDA 1WGHA 2EKIA 1H4RA 2BT6A 1BMLC 3ZDMC 3A9KB 2D10A 1FNUA 2MBOA 3NRZA 2OJWA 2XBBC 1T3QA 3EUB2 3MHSD 4MACA 1E7PB 2MWSB 2OEDA 4FLHA 2YEPB 1STEA 2QILA 2KQ4X 3S2AA 4DBGA 3L16A 2V4LA 3W5UB 3Q8AA 2C7NB 1FNWA 3AULA 3VXWA 4ZYSA 3APFA 4LNIA 3QARA 3RNGC 3Q3JA 3CIRB 2KNBA 4EZJA 2FCMA 2MA9B 4GDLB 4ZRJA 2SAKA 1TY0A 4N9F4 5BYRA 3PRMB 4USAA 4CQNA 3WAOA 1VZ7A 4W9CA 1SE3A 1PYWD 1TIFA 4WAAA 1WE6A 2GBJA 3LJ3A 2K3UA 4ZDVA 2PJHA 2D5GA 2B3AA 2MJDA 2WHIA 4LTUA 2I1KA 4LJOB 4BKGA 2J52A 4GOCA 2L0TA 1MG4A 1VZ6A 5E6NA 2MSED 1WRDB 2J0JA 3EGRA 4DDGD 4S17A 1V2YA 1FM0D 1TS3A 1FD6A 2XK5B 3KUCB 2N9EB 4ICVA 2YEPF 3U7ZA 2UU7A 3BVMA 3VUWA 3MC0B 1NYRA 4C7ZA 2LJ5A 1P7EA 1VJKA 3DOWA 3MHZA 4HJKA 4HDQA 1WX9A 4CYEA 1FFUA 5H92C 2NTTA 1LM8B 3BWUD 4MJSB 1OTRB 2D3CA 3D32A 2MP2B 1IPGA 2HTME 1MHXA 1MFWA 4ZRPA 3DHGC 4W9KA 1GNUA 1BUIC 1U4AA 2KKCA 2CU1A 2KYWA 1ISNA 1V80A 5JZEB 3VTVA 5DPTA 1MJDA 1UGJA 4OVVA 1V8CA 2DAJA 1AW7A 4NAMA 4DDID 2WP9B 4YTNB 1T6BX 3Q8CA 3O13A 3VHTC 1QQRA 1DOIA 2MHJA 3AV8A 1VDVA 3VTUA 5DPWA 1EWYC 2MJ3A 3DDCB 2Z0DB 3N32A 1JWAD 1WR6E 4DXGA 2BVCA 4I6NB 2LGIA 4GU2A 2IPKD 1JWBD 4IG7B 2IDYA 5AUIA 4IM2A 1YN4A 1Q1OA 1WF9A 1QF6A 1WX8A 4N6EB 3B2FA 4NAWB 2NMQA 2BB5A 2Y3AA 1PGAA 1E6EB 1M94A 1BXTA 1XD3B 3ZO5B 3R2IA 2LUEA 1PFDA 4C56C 5EE0A 4XGAB 1IGDA 2LGXA 5D7GA 1UBIA 3TCAA 5JHBA 4WAFA 2ASQA 4ICUA 1TYGB 4PYUA 2HE7A 3K9PB 2DWQA 2FCNA 1GPXA 3PVLA 1T0YA 4A9AA 1L2NA 1XXGA 2JVCA 3A4SC 2PW9A 4PYZA 4US8A 4OHJA 1UH6A 2K6DB 2KVRA 4O1NA 3IFWB 2RDGA 3VR8B 1RM6C 4JWSC 2RPQA 4ACFA 3ETRA 2LFIA 4LCDE 3W2DA 2CJNA 1SE9A 2L52A 2KD0A 1FEHA 4B9KA 2SEBD 4MGKE 1WWTA 1KF6B 1NI3A 5FR6A 4TKNA 4E71A 1OEYA 4JGHB 3VFKA 2E3TA 3OWEB 4YTPB 2L0FA 5CHFA 4GB9A 1Y56A 2KTRB 2BYTA 4WJPA 4EUTA 2LZ6A 2JT4B 4II2B 1MG8A 4I6PA 1MI0A 4MT5A 2LJIA 2MBHA 4L1BA 1WXMA 3U7DA 4K7WA 2IGHA 5IA7A 1KTKA 3A9JB 3TEXA 4BAXA 3ZJVA 2C7HA 4UDUC 2K22A 2CU3A 3UIPB 1I4HA 1TZ1A 2JWUA 3ZKJC 2NPTA 3PSEB 2AYOB 2BKFA 1YX6B 4ARCA 1K53A 1AN8A 1C4AA 5HI1A 3H7PA 3SEBA 4IC7B 1JW9D 1YIWA 2Z8LA 3Q6BA 4LNNA 1I7HA 3ALBA 1R7SA 2WXLA 3R66C 1XO3A 4OZCA 2N7JA 3N1YC 4MH0E 2FBWB 1WJUA 3P2BA 4JX1C 2LHEA 1N5WA 3CF6E 4TSSA 4TV3A 2LVOA 1E8YA 1V49A 4BBNF 2HJ1A 2PE9A 4BBNC 1FRRA 1V6EA 3VRAB 1NDDA 4FHJA 2FAZA 2DYBA 3ZQ4A 2WXNA 3H9DA 4WWNA 2MBEA 2ZNVB 2M19A 2AQ2B 1E7VA 4ASWC 4GN1A 1RRBA 2D3GA 2XN9C 3UGBB 2Y5PA 3X0WA 1S1QB 1QKZA 1A70A 2JU6X 4MM3A 4EZLA 1GJZA 1J7AA 4HRSA 1HTQA 2ON8A 4BOSC 1EU4A 3MC9A 4ANXA 4WJNA 4K81A 2KLGA 5AZGA 4DQOC 5D3IB 1SIJA 4KV2A 2OHFA 4W9LA 3TEYA 3EA6A 3IXSA 1D3ZA 1YJIA 2NVUI 3U2SC 2LD9A 2V9HA 1QT9A 2W3RA 1ZGUB 3DWMA 4EFOA 3OJ4B 2V3NA 2WLBA 3RMKC 2BF8B 3MJWA 5J17A 2X38A 2INNE 4PK1A 3L0WB 2KWVB 3TL5A 1E0ZA 1IBXB 4ZHPA 1UF0A 1AARA 1WY8A 4ANWA 3GE3C 4D2KA 3T9LA 1KH0A 2KN5A 3AE8B 4Q2JA 5CX3A 4OVUA 2ZNVC 2KOXA 1TBEA 4BVUC 1P3QU 2QCZA 3CSTA 3SD5A 2MX2A 2BYFA 2DHZA 3NVZA 5D6JB 5C23A 5L95C 1Z5SB 3MC8A 2INPE 4HXDA 1TT5B 3BIID 4LK0M 4A3PA 1L4ZB 1SIFA 2AL3A 2JX5A 3J9CA 4W9GA 4EOYA 3TIXA 2GBMA 3V60A 4XWWA 1JWMD 1RWSA 3NJTA 3KYDD 3AH7A 3RNBC 2AX5A 1J0GA 2BB6A 1DGJA 3N20C 3AE4B 4GMVA 3BK2A 2JWZA 4HEA1 1V97A 4JWUC 1EO6A 4OZAA 2YVCA 2DYOA 3KYCD 4ANVA 4HK2A 3P1MA 3MJ5A 2FCSA 4W9JA 2IO2B 3AEDB 3ENEA 3HIZA 3NY5A 3UIOB 2N1VA 5E6JA 4DHJD 1QILA 1L4DB 3IAM1 2GBNA 4J6IA 2O2VA 1C77A 1RYJA 4W9DA 2Z59B 4M0WA 5FK9C 2ACZB 4C4VA 2KDEB 3VAWA 3ZRCA 1YJ1A 3M3JA 3W1SA 1MHHE 4XE0A 4A8XC 2KWCA 3QQ8B 3TBLD 4CO7A 5TSSA 3KWLA 2ZCBA 2KJRA 1FO4A 2JZPA 3O65B 2NBVB 1CK1A 3TMPB 1RAXA 5J2RA 2W82A 1WXAA 4MSQB 3V3XA 4NQLB 1TJEA 4US9A 4N59A 3QHTA 2L32A 2IO1B 2JF5A 1WMHA 2IY0B 4NPNA 3KWVA 2WNMA 5D2MB 2QIEB 1E8ZA 3NZSA 2PKOA 3URYA 4F7ZA 1TS2A 3PO0A 2KDMA 3ZRFA 1L6UA 4XZ4A 4AWJA 4HCPB 1DOXA 2Z0EB 1IUEA 1FCLA 3QC8B 3Q8EA 1I42A 2N9LA 3DVNV 2MBQA 3U8ZA 4MEMA 2KACA 3RUIB 3FILA 3RYTA 4AJWA 5IN7A 1E8WA 3R7RA 1MVKA 2EMTA 3PHWB 2C9WB 4BKTA 2G4SA 3UF8A 3A1QB 2BBCA 2WYQA 1QOGA 2RD0A 1VZ8A 1F1HA 3AE2B 4GXBA 1V1OA 4RGNA 4LNOA 1JWUD 2W54A 2MH7A 2CS4A 1ZDVA 4WJQA 2DZIA 2N7DA 4N58A 2ZVOA 2KDFB 1FPYA 2J7QB 2VZKB 1C78A 3BYYB 2W9NA 3L13A 3H1UA 1SGHA 4OW0A 2H89B 5GXGB 3SFDB 1I4PA 4PS7A 4FA6A 5GMVA 2NTSA 2W55A 4M00A 3ZTDA 5IO9A 4XDCA 1FMAD 1XEEA 4BKSA 3Q3MC 2L3ZA 2WX0A 5H8YE 2N9KA 5EE1A 1P9DU 2ZW1A 4KZ0A 3SU8X 2DBYA 2LVPA 5G55A 3HRDD 3OLMD 1TY2A 2D11A 3WA0A 2REXA 4DHZE 2I1JA 2ZCCA 4LJPB 3X23A 2KHWB 3KLSX 1WH3A 1F0ZA 5BYQA 4ZRQA 1D5XC 3N1XC 5D3DA 3R2TA 4PT5A 2WXGA 2NPTB 2L00B 4IWOA 4B95A 2JPHA 1KOTA 2M1MA 4HPMB 5G5GA 2KX0A 1XT9B 2BTEA 2ZPYA 5LNK1 4AS1A 4OZBA 2WDVB 3P4QB 3VRBB 4ANUA 4K3BA 3PRPB 1FFVA 3HM3A 1LGRA 3U30A 1SBBB 1V86A 3AU4A 1K50A 5J18A 4AQ7A 2TSSA 5KHQA 1CJEA 4JL9A 5HKHA 2QMTA 4EEWA 3AE6B 4GDKA 4WWMA 2IZVB 1TKYA 3ZVVA 4EE2A 3QJZA 3DBRB 1XQQA 2MEKA 4G3XB 1F2RC 4YL8A 2IGGA 4A20A 1JQ4A 2N9XA 1R4NI 3B9JA 2RPVA 4LDTB 1ENFA 1TKGA 4REZA 1LO5D 2FCQA 2PVOD 3VTWA 1V1PB 5DPSA 1WGDA 3PPAA 2DENB 4KSKC 2FE8A 4H2AA 2H88B 2CKHB 4BKSD 2RSUA 3ML9A 3I9V1 1WM2A 3H6NA 3NZUA 3NS1A 4A90A 4KIKB 1XLQA 1JRUA 4HLEA 1VRAB 4XX5A 2WXMA 4NJ6A 2BS2B 3A9KA 3TUOA 4K7SA 2KFJA 3HUIA 2KJ6A 4G11A 1J7BA 4M02A 3KQ4A 2R2OA 1PGXA 1EF5A 1YD8U 3M95A 3HK0A 3JSVA 2RGFA 5E6OA 1YMHE 4AJYB 2ZEQA 3JYUA 4F1SA 1K52A 1WYWB 4RCOA 1GAQB 2JRIB 3ZW3A 3V61A 1VR9A 4C7YA 3TJPA 4ZRKA 1NYQA 1WIAA 3BZDB 3AEFB 4A55A 3DQVA 1E9MA 4GDLA 5E6PA 5EE3A 1T0SC 2A4ZA 3DVGX 1R4MB 1I4RA 4M8NA 2PVGC 1BT0A 1K51A 2PTLA 3GP7A 1GB4A 1ZDXA 3IT6B 1F52A 3AB5A 4IWQA 4IKGA 2FIDA 4AUQC 3AE9B 4KZCA 2JXTA 4MELA 3FAHA 4K3CA 1I4GA 3NG0A 2NBUA 2O6VB 1IYFA 5LXIB 1GC7A 3PTFC 4LNFA 2NS5A 2V0GA 3EFUA 3Q8FA 4KGRA 2KJHB 3BINA 4S0RA 5C2TB 3ZXVA 1TZOA 4WJOA 4RM8A 4DXAB 4HDOA 5D94A 2KMAA 1UWXA 3AE1B 4RGMA 2RR9A 4FHKA 2KFKB 4HPLB 1OEYJ 3AEBB 3QIJA 4XC2A 1KLUD 2DLBA 2XK5A 3DBLB 2W3SA 3MP9A 4XDDA 1UUPA 2A5UA 1XF5L 3L10B 3HM6X 4C00A 4L23A 1Q10A 2N4FA 1T5XD 4BZAA 5FR3A 4MJSA 2N7EA 1GC6A 3PZ7A 2BWFA 2MP2A 3NVYA 3ZTCA 1WJ4A 3RNEC 5FKAC 2BQQA 3Q69A 1ZUD2 3GZNB 2NR2A 2M4NA 2WXKA 3K9OB 2M0XA 3A33B 1ZP0B 4KVGB 2CR5A 2D07B 1WXSA 4ZYNA 5BO4B 2WS3B 2WXPA 1V5TA 2LUMA 1VCBA 3ZXRA 3IHPC 3BVGA 1WZ3A 2IO0B 2GBKA 3AE7B 2QDFA 3B1LX 4FJZA 2OJRA 3PV1A 3JW0X 1NENB 3I3TB 2WXJA 3AE3B 4KGTA 3RD2A 4RM9A 3P4SB 4XYCA 3VH3B 1SB3C 3GB1A 2ZW0A 3PZ8A 2BKRB 1C4PA 1AYFA 4XWTA 3T3OA 5T8IA 3VH4B 2CJOA 2K8BA 4A6QA 2LVQA 3WIMA 1QOFA 2QJLA 3R3MA 4FN2A 1Q5WB 1EUVB 1UZXB 4B0EA 3QCAA 1KRHA 1JWSD 4BOZB 2AQ3B 2WXHA 2JY6A 2FUG1 2KQ7A 3Q3FA 1XLOA 1ET6A 4OVZA 1D5ZC 2IY1B 3OAWA 1N6ZA 3CWIA 3SFEB 2ZJDA 3W1SC 5AZHA 3AMZA 1IP9A 1FCCC 2KT7A 2WU2B 2KMCA 1NBFC 2IBIB 2D3AA 4MDKE 1E8XA 4NJCA 2L76A
chains in the Genus database with same CATH topology
4FXCA 4WQMA 1DOXA 2HTME 3TSSA 1MHXA 1OFFA 4ZRPA 1IUEA 1FCLA 5BMIA 1BUIC 3Q8EA 2KWDA 2N9LA 3WCQA 2ICIA 4WURA 3P4PB 1XCTL 2KACA 1HZ5A 3FILA 3BYTB 3ZGZA 1UGJA 4GLSC 2K0PA 1V8CA 2K5PA 1AW7A 1MVKA 3NVWA 4NAMA 1PGBA 1YN5A 2WP9B 4YTNB 1T6BX 3Q8CA 1FRDA 2M0AA 3O13A 3H8HA 2BBCA 1QQRA 1DOIA 2LMCA 3AV8A 1QOGA 1VDVA 1N60A 1ET9A 1EWYC 1P7FA 2MJ3A 1VZ8A 4RGTA 1JWAD 1ACCA 2GI9A 4DXGA 1CZPA 3R8BA 2LGIA 3AE2B 4B0MA 2IPKD 1JWBD 4NZLB 1V1OA 2IDYA 1L0XB 5AUIA 4RGNA 1HA5A 1JWUD 2W54A 1YN4A 3ZJTA 2MH7A 1ZDVA 2AQ1B 3AECB 1F77A 1QF6A 3P63A 5BMHA 1TKEA 4N6EB 2V3PA 3B2FA 4NAWB 5EE9A 2WXQA 2NMQA 4N58A 2GB1A 2BB5A 2VZKB 2Y3AA 1PGAA 1C78A 1C76A 1E6EB 3BYYB 1YQ4B 1BXTA 3ZYYX 3R2IA 1PFDA 4C56C 1M4VA 1D5MC 1ZE3D 2H89B 4OW0A 5EE0A 2M56B 5GXGB 3SFDB 1IGDA 2VZKD 2G1EA 5D7GA 1C4CA 1I4PA 4WAFA 1TYGB 2NTSA 1DYQA 2W55A 2DWQA 2WXRA 4MH8A 1C9FA 1GPXA 4XDCA 1HZ6A 1V1PA 1FMAD 4A9AA 1SJHD 1FXIA 1XXGA 3T3NA 1N63A 1XEEA 1XCQL 1VLBA 2PW9A 4KKIA 4US8A 2B76B 4OHJA 2J42A 5BYSA 4YXDB 3HVDA 5HFYA 4YSZB 4O1NA 2RDGA 5H8YE 1L5PA 2N9KA 3VR8B 5EE1A 1N61A 1RM6C 3DWGC 4JWSC 2ZW1A 2DBYA 3ETRA 2LFIA 3W2DA 2CJNA 3HRDD 2L52A 1TY2A 3AEAB 4RF0A 1HEZE 1FEHA 1NEKB 1FIQA 2WU5B 2SEBD 2WQYB 2KN4A 2I38A 5C3JB 1WWTA 3N9YC 1KF6B 1NI3A 3KLSX 2I2YA 1F0ZA 5BYQA 3FILB 4ZRQA 1YQ3B 2BS4B 1D5XC 2E3TA 5D3DA 1SE4A 3OWEB 3R2TA 4YTPB 2PMVA 4HJGE 4PT5A 1Y56A 2WXGA 1RFKA 1WRIA 2QEJC 2BYTA 5MPOA 1UWMA 1XLPA 2BS3B 5G5GA 2RDHA 4RF1A 2BTEA 4L2YA 3W5VB 2E6XA 5LNK1 4AS1A 4OZBA 1CQVA 2WDVB 1KFYB 2LHDA 3P4QB 3VRBB 1MI0A 4MT5A 2G9HD 2LJIA 4L1BA 2JYEA 5G5HA 2WXIA 1FFVA 2WXOA 1QLBB 2IGHA 1KTKA 1HXYD 1ESFA 1SBBB 1SE2A 4J3OD 3TEXA 3ZJVA 4UDUC 1K50A 4AQ7A 2K22A 2TSSA 4HKQA 1CJEA 4ARIA 2CU3A 4YT0B 3P42A 1I4HA 2QMTA 2JWUA 1KLGD 3AE6B 4WWMA 1TKYA 2Q5WD 1WGKA 4EE2A 4ARCA 2JSVX 1K53A 1AN8A 2GRIA 3LYYA 4KKJA 2IJ0A 2MEKA 2QSDA 1C4AA 4TMAB 5HI1A 3VQIA 3SEBA 1F2RC 1JW9D 2IGGA 2Z8LA 1JQ4A 3B9JA 2RPVA 1I7HA 1ENFA 4JPSA 1TS5A 1WYGA 1TKGA 1XLNA 1R7SA 2WXLA 4REZA 1LO5D 2JYTA 1XO3A 2PVOD 1V1PB 4OZCA 1B1ZA 2N7JA 2FBWB 2PLPA 4TQ1A 4JX1C 2FE8A 2LHEA 4H2AA 1N5WA 2H88B 1C79A 4TSSA 1EU3A 3IAS1 1ZXIA 4RNAA 3RFZB 3ZJUA 3I9V1 2EELA 1FRRA 3NS1A 3VRAB 3GS2A 4A90A 4JE3B 1XLQA 1B9RA 1EWCA 3ZQ4A 2WXNA 3BVZA 1JCKB 3TEZA 1YNTE 1L6VA 2M19A 1SF0A 1VRAB 3HVZA 2AQ2B 2K9XA 2WXMA 2XN9C 2LEKA 2BS2B 5JXVA 3AEGB 3TUOA 2J4XA 3W9CB 3HUIA 1L0YB 2Y5PA 1J7BA 1QKZA 1TS4A 4YTMB 1A70A 2R61A 3KQ4A 3IT4B 3Q8BA 2JU6X 3AE5B 3LXFA 1PGXA 1MPEA 1QOAA 3E9SA 1J7AA 1ZPSA 4HRSA 2ON8A 1DOYA 4ZOHC 1EU4A 1EM7A 1YMHE 2BW2A 4DQOC 4RH6A 5D3IB 1K52A 2RMMA 4RCOA 1SIJA 1GAQB 4KGSA 2OHFA 1L0VB 1VR9A 3E56A 4C7YA 3U52E 1D4BA 3TEYA 1ROEA 3U4EG 1NYQA 1F2RI 3EA6A 3BZDB 3IXSA 4IDIA 1YJIA 3AEFB 3U2SC 4A55A 1PUTA 1E9MA 5EE3A 2DYMA 1I4RA 4GDKB 2ONQA 1JRPA 2PVGC 1QT9A 2W3RA 1K51A 2PTLA 3DWMA 5AUKA 4C80A 2L1AA 4RFBA 2V3NA 1JALA 2WLBA 3GP7A 1GB4A 1WXQA 2XNAC 1ZDXA 3C8YA 1I4QA 3AB5A 3IT6B 2X38A 2INNE 4IKGA 1GOZA 1ZXHA 3L4PA 1E0ZA 3AE9B 1IBXB 2Y5CA 1PDXA 2JXTA 3TEWA 3AN1A 4ZHPA 1NVID 3FAHA 1I4XA 1I4GA 3RPFC 1SSNA 4P6VF 4D2KA 1KH0A 3AE8B 4Q2JA 3UI3A 1JROA 2V0GA 4KGRA 3Q8FA 1N5XA 4IOIE 3I57A 5C2TB 1TZOA 1ZOYB 2WXFA 1OQQA 3P4RB 5HG2A 3MFGA 3NVZA 1HQRD 3V05A 1JMLA 1UWXA 3AE1B 4RGMA 2INPE 4WIPA 3BIID 4LK0M 1L4ZB 3AEBB 2JX5A 3B2GA 3J9CA 1KLUD 1SXTA 2DLBA 2W3SA 3MP9A 4P16A 4XDDA 1IGCA 1IBXA 1UUPA 1XF5L 3AEEB 2IGDA 4XWWA 1JWMD 1RWSA 2JQRB 1AWDA 2EKIA 2L83A 1FNVA 2BT6A 3AH7A 1BMLC 4HKZE 4L23A 1Q10A 2AX5A 1T5XD 5FR3A 2BB6A 1DGJA 1FNUA 3NVVA 3AE4B 1SJED 3BK2A 3NRZA 3PZ7A 3NVYA 4YSYB 4HEA1 1T3QA 3EUB2 4MM3B 4MACA 5FKAC 1E7PB 4LLGM 3VR9B 3Q69A 1V97A 1ZUD2 4JWUC 2WXKA 4OZAA 2OEDA 2DYOA 1ZP0B 4R3DA 1E10A 2YEPB 1STEA 2QILA 2WS3B 2WXPA 2HDEA 2KQ4X 2LUMA 3P1MA 3MJ5A 3W5UB 3Q8AA 1UNSA 1FNWA 3BVGA 4ZYSA 3AEDB 1OQRA 3FC4A 2KMMA 3AE7B 3CIRB 1NENB 2WXJA 4ZHOA 4GDLB 2KAJA 3AE3B 5E6JA 4KGTA 1QILA 3P4SB 1L4DB 2SAKA 2WDQB 1SB3C 1TY0A 3GB1A 2ZW0A 3IAM1 1YN3A 2N0SB 1SEBD 3PZ8A 1C4PA 2V4IB 5BYRA 1C77A 2J53A 3ABVB 1RYJA 1AYFA 4USAA 1WSPA 4CQNA 4XWTA 4M0WA 1VZ7A 5FK9C 3T3OA 1SE3A 1FXAA 1PYWD 5T8IA 2ACZB 2CJOA 1J7CA 3AM9A 2K3UA 4A6QA 3W1SA 2D5GA 3SR6A 1MHHE 4XE0A 4RGOS 4A8XC 1QOFA 2MJDA 4ITKA 2QJLA 4DXFA 4LTUA 2WDRB 2J52A 5TSSA 3KWLA 2PIAA 5I4DA 4B0EA 1FO4A 1VZ6A 5HHDG 2JZPA 1KRHA 4HROA 4KX6B 1JWSD 5BMGA 3EGRA 1CK1A 2AQ3B 2WXHA 3NUHB 2MJEA 4YWGG 4WH4A 1FM0D 1TS3A 2W82A 2FUG1 1GB1A 1FD6A 3NZ3A 3V3XA 1TJEA 4US9A 2YEPF 1QOBA 4N59A 1XLOA 3U7ZA 3BVMA 3MC0B 1ET6A 1NYRA 2L32A 4C7ZA 4OVZA 1D5ZC 1YJJA 1P7EA 1VJKA 3KWVA 4YSXB 3CWIA 3MHZA 2WNMA 3SFEB 1FFUA 2QIEB 3AMZA 3LB8C 5H92C 1FCCC 2WU2B 2NTTA 2PKOA 3BK1A 1TS2A 3URYA 3BWUD 3PO0A 2KDMA 1D6EC 1N62A 1L6UA 4NJCA 4TQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWG G;  4DQO C;  3U4E G;  3U2S C; 
#chains in the Genus database with same CATH topology
 2BYV E;  2HTH A;  4WQM A;  1OFF A;  2WWZ A;  3B0A A;  1ZKH A;  4NJ7 A;  5BMI A;  2KWD A;  3EHV A;  3DPD A;  2DNF A;  1RFA A;  2JXX A;  3NHE B;  1HZ5 A;  2G45 B;  4GLS C;  1I35 A;  3EC8 A;  3DVG Y;  2KTR A;  1WZ0 A;  2DZM A;  3IVF A;  1PGB A;  1YN5 A;  2YLM A;  3H8H A;  3EEC A;  2LMC A;  3OG5 A;  1Y8R C;  1P7F A;  4WWO A;  4RGT A;  1CZP A;  4IWP A;  4DWF A;  3FKY A;  3R8B A;  1P1A A;  3NS8 A;  1L0X B;  3A9J A;  2KWU B;  3I63 C;  4FJV B;  3WAP A;  2AQ1 B;  3AEC B;  4PS3 A;  4F8C B;  2PEA A;  5EE9 A;  2BPS A;  5AEK B;  2LAS A;  2JUO A;  1D5M C;  1ZE3 D;  3C0R B;  4IUM B;  2G1E A;  3DHH C;  1LFD A;  1C4C A;  1WXV A;  1DYQ A;  2ZPN A;  4DHZ B;  2JZ3 B;  2VRR B;  1N63 A;  1XCQ L;  1TGZ B;  1LQB A;  4KKI A;  2B76 B;  4YXD B;  3HVD A;  4YSZ B;  1L5P A;  1N61 A;  5G2N A;  3AEA B;  1NEK B;  1WGY A;  2UYZ B;  2C7M B;  2L05 A;  2WQY B;  3RT3 B;  1UD7 A;  2I38 A;  5IAA C;  3GOE A;  3N9Y C;  5JHA A;  2I2Y A;  1NI2 A;  2ZZP B;  4FBJ B;  2BS4 B;  4TUU A;  3PLV A;  3ZLZ A;  2LRW A;  1RFK A;  2DZK A;  1WRI A;  2QEJ C;  1UWM A;  1OQY A;  1XLP A;  4K1R B;  3W5V B;  2D3B A;  2E6X A;  1CQV A;  3QWZ B;  2LHD A;  5G5H A;  2WXI A;  1QLB B;  3N30 A;  4J3O D;  1ESF A;  4JQW C;  1V9J A;  4HKQ A;  2KTF A;  4II3 B;  2IYD B;  3P42 A;  3ZIM A;  1KLG D;  2MLB A;  3PGE A;  3RI7 C;  2JSV X;  2XEW A;  2BGF A;  2IJ0 A;  4TMA B;  1KM7 A;  2IND C;  3ML8 A;  1WFY A;  2X8X X;  1J8C A;  4JPS A;  1TS5 A;  3DCG A;  1WYG A;  4FJY A;  3L08 A;  3KH0 A;  1WI0 A;  1K8R B;  2KX3 A;  3ZUN A;  2WGS A;  3DBR I;  4EKU A;  2PE6 B;  2MBB B;  1C79 A;  1EU3 A;  3RFZ B;  3ZJU A;  3JSV B;  3GS2 A;  1X1M A;  1EF1 A;  3QK0 A;  3VUY A;  3SDL C;  4JE3 B;  1CMX B;  1J19 A;  4W9E A;  2KDI A;  1G6J A;  1JCK B;  2AEH A;  3TEZ A;  1YNT E;  1SF0 A;  3HVZ A;  2K9X A;  3Q3O C;  2LEK A;  3W1Y A;  3AEG B;  3W9C B;  1L0Y B;  3VDZ A;  2KC1 A;  3ZNZ B;  4YTM B;  3KUZ A;  2R61 A;  3L17 A;  3Q8B A;  3V6C B;  1MPE A;  1QOA A;  4NY0 A;  5AZF A;  2QC8 A;  4DK5 A;  4ZOH C;  5DPR A;  1EM7 A;  4JLC A;  2N9P C;  3WAL A;  2RMM A;  1UBQ A;  4KGS A;  1L0V B;  2CHW A;  2LI5 A;  4MGY E;  1D4B A;  3U4E G;  3PHX B;  1E90 A;  2DAF A;  1PUT A;  1KLV A;  1RLF A;  2MRP A;  1GUA B;  1PQS A;  3R7Q A;  1JRP A;  5AUK A;  2G3Q B;  4AOF A;  2L1A A;  5KHO A;  1FXT B;  1WXQ A;  2L7R A;  2XNA C;  1TTN A;  3C8Y A;  1I4Q A;  3H7P B;  3RZW C;  3PRE A;  1ZXH A;  3L4P A;  1WE7 A;  2Y5C A;  3AN1 A;  1NVI D;  1I4X A;  3LDZ E;  1R4M I;  4P6V F;  3DBH B;  4AP4 C;  2PPH A;  4HCN B;  4NNJ B;  2LRU A;  1N5X A;  4HWI B;  3DHI C;  3I57 A;  2BWE S;  2KAN A;  2D2Q A;  1ZOY B;  2WXF A;  2K25 A;  3MFG A;  1HQR D;  3V05 A;  1Z2M A;  2R2Q A;  1E5W A;  1S3S G;  4WIP A;  3B2G A;  1SXT A;  4P16 A;  1IGC A;  3AEE B;  4EZK A;  2JQR B;  2L83 A;  1FNV A;  1VD2 A;  4HKZ E;  3OJ3 A;  4B6W A;  4QAY A;  3QAQ A;  3DBL I;  2BYE A;  3NVV A;  1SJE D;  3ZNI D;  2KXJ A;  4YSY B;  4MM3 B;  4LLG M;  3VR9 B;  4R3D A;  3RNF C;  3APC A;  1E10 A;  4W9H A;  3AI5 A;  2HDE A;  2K8C A;  4KSL C;  4WQO B;  2G4D B;  2K6Q A;  1UNS A;  2KO3 A;  3VUX A;  1OQR A;  3FC4 A;  4DHJ B;  3GZN I;  2KMM A;  3M63 B;  2J0M A;  2WX1 A;  4ZHO A;  3KW5 B;  2KAJ A;  3A1Q A;  3ZNG C;  3RNC C;  4W9I A;  2KLC A;  2WDQ B;  3EFC A;  1YN3 A;  2N0S B;  3A4R A;  1SEB D;  2V4I B;  2J53 A;  3ABV B;  1WSP A;  1FXA A;  3QA8 A;  1J7C A;  1Q0W B;  3AM9 A;  3SR6 A;  3Q3N C;  2CHZ A;  4RGO S;  3WAN A;  3RNA C;  4ITK A;  4NQK E;  1E7U A;  4DXF A;  2K1F A;  2LXC A;  1V5O A;  2WDR B;  2PIA A;  5I4D A;  2UWQ A;  5HHD G;  1QZE A;  1V81 A;  4KX6 B;  4HRO A;  5BMG A;  1UEL A;  3CSF A;  3NUH B;  2MJE A;  1UGM A;  4I6L B;  4CHK A;  4YWG G;  4ZRI A;  4KDI C;  4WH4 A;  3N1Z C;  1GB1 A;  3NZ3 A;  5EDS A;  1QOB A;  1YJJ A;  5C1Z A;  2KDB A;  2MW5 A;  4YSX B;  2VH1 A;  3LB8 C;  3BK1 A;  3I5J C;  5IKC M;  1D6E C;  1N62 A;  4MSM B;  4FXC A;  3APD A;  3TSS A;  3WCQ A;  5IP4 D;  2ICI A;  3B08 A;  3DBS A;  4WUR A;  3P4P B;  1XCT L;  3BYT B;  3PLU A;  2K39 A;  3ZGZ A;  1R4N B;  2K0P A;  4W9F A;  2K5P A;  2V1Y A;  3NVW A;  1FRD A;  2M0A A;  1YQB A;  3IBE A;  2AL6 A;  1N60 A;  1ET9 A;  1ACC A;  1KJT A;  2GI9 A;  2JRH A;  4HVB A;  2O2V B;  4B0M A;  1HE8 A;  4NZL B;  4M0W B;  2C60 A;  3AXC A;  3SHQ A;  1WM3 A;  1HA5 A;  4URK A;  3ZJT A;  4C4V B;  2K8H A;  4TQ0 A;  4JIO U;  1F77 A;  2LGY A;  3P63 A;  3H7S A;  5BMH A;  1TKE A;  2V3P A;  1OGW A;  2WXQ A;  2GB1 A;  3QX1 A;  1C76 A;  1YQ4 B;  3ZYY X;  4X57 B;  1M4V A;  2M56 B;  2VZK D;  4P1B C;  2NBW B;  3NOB A;  2M17 A;  3PS6 A;  2WXR A;  4MH8 A;  1C9F A;  4G0N B;  1HZ6 A;  1V1P A;  2KVZ A;  2INC C;  1SJH D;  1FXI A;  3T3N A;  1WMH B;  1VLB A;  2QHO A;  2KZR A;  2J42 A;  4NAW A;  5BYS A;  4M8M A;  5HFY A;  3DVN U;  3UQA A;  2KK8 A;  3DWG C;  2V3S A;  3WAM A;  1H8C A;  5IOI A;  5LXH A;  4PS8 A;  4RF0 A;  4KIK A;  1HEZ E;  1FIQ A;  2WU5 B;  4GIV A;  2KN4 A;  5C3J B;  4M01 A;  2OOB B;  1HTO A;  3ONS A;  3FIL B;  4KDL B;  4E3C A;  1YQ3 B;  1SE4 A;  2GOW A;  2PMV A;  4HJG E;  2WDT B;  3VVW B;  2EMS A;  5MPO A;  2RDB C;  2BS3 B;  2LGS A;  2RDH A;  1P0R A;  4RF1 A;  5L83 A;  2EKE C;  3BY4 B;  4L2Y A;  2AWT A;  2M8S A;  1KFY B;  3PRZ A;  2FNJ B;  2G9H D;  2HD5 B;  3C19 A;  2JYE A;  2WXO A;  1SE2 A;  1HXY D;  3RCZ A;  3JVZ X;  1GG3 A;  4IW0 A;  1YX5 B;  2FUH B;  4ARI A;  3M62 B;  4YT0 B;  4FUL A;  2DX5 B;  3UIN B;  2Q5W D;  1WGK A;  5LLI A;  2GRI A;  3LYY A;  4KKJ A;  2QSD A;  3T8M A;  3KVF B;  4BFR A;  3VQI A;  4IM0 A;  1F9J A;  1P98 A;  1XLN A;  2JYT A;  2O6V A;  1L7Y A;  1B1Z A;  2HJ8 A;  4LDT D;  3L54 A;  2PLP A;  1WJ6 A;  3RN9 C;  4TQ1 A;  1WX7 A;  5DCN A;  1WGG A;  3HHM A;  3IAS 1;  1ZXI A;  4A3O A;  4RNA A;  2VH2 A;  2EEL A;  2KFK A;  4E74 A;  3ZNH B;  1B9R A;  1EWC A;  3BVZ A;  1L6V A;  3N3K B;  3UQB A;  2N1W A;  2IO3 B;  4K7U A;  5JXV A;  3PZD A;  2J4X A;  3Q14 C;  1TS4 A;  5JH5 C;  3IT4 B;  3V6E B;  3AE5 B;  3LXF A;  1C3T A;  2GBR A;  3E9S A;  3ECI A;  1ZPS A;  3KUD B;  1DOY A;  1T0Q C;  4MGI E;  1ZW7 A;  4HPP A;  2BW2 A;  4FAD A;  5CHV C;  3MTN B;  3RUL A;  4RH6 A;  4P1C C;  2LWP A;  3ZDT A;  2FIF A;  3E56 A;  3U52 E;  1ROE A;  2MQJ A;  1F2R I;  2KC2 A;  3CMM B;  4IDI A;  1WR1 A;  1WJN A;  2GMI C;  2DYM A;  2MCN B;  1LXD A;  4GDK B;  2ONQ A;  4G50 A;  1WGR A;  4RMA A;  4C80 A;  2LGD A;  4RFB A;  4LNK A;  5CHW A;  1T0R C;  2NCN A;  1JAL A;  2ZVN A;  4P7I A;  5CTR C;  4GGQ A;  3IG3 A;  1GOZ A;  2LXA A;  1PDX A;  3TEW A;  2J0K A;  3RPF C;  1SSN A;  2L8J A;  4MGZ E;  2KQS A;  3UI3 A;  1JRO A;  2C5L C;  4IOI E;  2DZJ A;  3V62 A;  2O6V D;  2GLS A;  3PT2 B;  2Y5B B;  2JZZ A;  1OQQ A;  3P4R B;  5HG2 A;  3DBH I;  1C1Y B;  1A5R A;  1JML A;  4WWP A;  3RZF A;  2CHX A;  4IM3 A;  3Q2A C;  4GSW A;  1IBX A;  3AU5 A;  1YOV B;  3GE8 C;  5TR5 A;  2IGD A;  1AWD A;  1WGH A;  2EKI A;  1H4R A;  2BT6 A;  1BML C;  3ZDM C;  3A9K B;  2D10 A;  1FNU A;  2MBO A;  3NRZ A;  2OJW A;  2XBB C;  1T3Q A;  3EUB 2;  3MHS D;  4MAC A;  1E7P B;  2MWS B;  2OED A;  4FLH A;  2YEP B;  1STE A;  2QIL A;  2KQ4 X;  3S2A A;  4DBG A;  3L16 A;  2V4L A;  3W5U B;  3Q8A A;  2C7N B;  1FNW A;  3AUL A;  3VXW A;  4ZYS A;  3APF A;  4LNI A;  3QAR A;  3RNG C;  3Q3J A;  3CIR B;  2KNB A;  4EZJ A;  2FCM A;  2MA9 B;  4GDL B;  4ZRJ A;  2SAK A;  1TY0 A;  4N9F 4;  5BYR A;  3PRM B;  4USA A;  4CQN A;  3WAO A;  1VZ7 A;  4W9C A;  1SE3 A;  1PYW D;  1TIF A;  4WAA A;  1WE6 A;  2GBJ A;  3LJ3 A;  2K3U A;  4ZDV A;  2PJH A;  2D5G A;  2B3A A;  2MJD A;  2WHI A;  4LTU A;  2I1K A;  4LJO B;  4BKG A;  2J52 A;  4GOC A;  2L0T A;  1MG4 A;  1VZ6 A;  5E6N A;  2MSE D;  1WRD B;  2J0J A;  3EGR A;  4DDG D;  4S17 A;  1V2Y A;  1FM0 D;  1TS3 A;  1FD6 A;  2XK5 B;  3KUC B;  2N9E B;  4ICV A;  2YEP F;  3U7Z A;  2UU7 A;  3BVM A;  3VUW A;  3MC0 B;  1NYR A;  4C7Z A;  2LJ5 A;  1P7E A;  1VJK A;  3DOW A;  3MHZ A;  4HJK A;  4HDQ A;  1WX9 A;  4CYE A;  1FFU A;  5H92 C;  2NTT A;  1LM8 B;  3BWU D;  4MJS B;  1OTR B;  2D3C A;  3D32 A;  2MP2 B;  1IPG A;  2HTM E;  1MHX A;  1MFW A;  4ZRP A;  3DHG C;  4W9K A;  1GNU A;  1BUI C;  1U4A A;  2KKC A;  2CU1 A;  2KYW A;  1ISN A;  1V80 A;  5JZE B;  3VTV A;  5DPT A;  1MJD A;  1UGJ A;  4OVV A;  1V8C A;  2DAJ A;  1AW7 A;  4NAM A;  4DDI D;  2WP9 B;  4YTN B;  1T6B X;  3Q8C A;  3O13 A;  3VHT C;  1QQR A;  1DOI A;  2MHJ A;  3AV8 A;  1VDV A;  3VTU A;  5DPW A;  1EWY C;  2MJ3 A;  3DDC B;  2Z0D B;  3N32 A;  1JWA D;  1WR6 E;  4DXG A;  2BVC A;  4I6N B;  2LGI A;  4GU2 A;  2IPK D;  1JWB D;  4IG7 B;  2IDY A;  5AUI A;  4IM2 A;  1YN4 A;  1Q1O A;  1WF9 A;  1QF6 A;  1WX8 A;  4N6E B;  3B2F A;  4NAW B;  2NMQ A;  2BB5 A;  2Y3A A;  1PGA A;  1E6E B;  1M94 A;  1BXT A;  1XD3 B;  3ZO5 B;  3R2I A;  2LUE A;  1PFD A;  4C56 C;  5EE0 A;  4XGA B;  1IGD A;  2LGX A;  5D7G A;  1UBI A;  3TCA A;  5JHB A;  4WAF A;  2ASQ A;  4ICU A;  1TYG B;  4PYU A;  2HE7 A;  3K9P B;  2DWQ A;  2FCN A;  1GPX A;  3PVL A;  1T0Y A;  4A9A A;  1L2N A;  1XXG A;  2JVC A;  3A4S C;  2PW9 A;  4PYZ A;  4US8 A;  4OHJ A;  1UH6 A;  2K6D B;  2KVR A;  4O1N A;  3IFW B;  2RDG A;  3VR8 B;  1RM6 C;  4JWS C;  2RPQ A;  4ACF A;  3ETR A;  2LFI A;  4LCD E;  3W2D A;  2CJN A;  1SE9 A;  2L52 A;  2KD0 A;  1FEH A;  4B9K A;  2SEB D;  4MGK E;  1WWT A;  1KF6 B;  1NI3 A;  5FR6 A;  4TKN A;  4E71 A;  1OEY A;  4JGH B;  3VFK A;  2E3T A;  3OWE B;  4YTP B;  2L0F A;  5CHF A;  4GB9 A;  1Y56 A;  2KTR B;  2BYT A;  4WJP A;  4EUT A;  2LZ6 A;  2JT4 B;  4II2 B;  1MG8 A;  4I6P A;  1MI0 A;  4MT5 A;  2LJI A;  2MBH A;  4L1B A;  1WXM A;  3U7D A;  4K7W A;  2IGH A;  5IA7 A;  1KTK A;  3A9J B;  3TEX A;  4BAX A;  3ZJV A;  2C7H A;  4UDU C;  2K22 A;  2CU3 A;  3UIP B;  1I4H A;  1TZ1 A;  2JWU A;  3ZKJ C;  2NPT A;  3PSE B;  2AYO B;  2BKF A;  1YX6 B;  4ARC A;  1K53 A;  1AN8 A;  1C4A A;  5HI1 A;  3H7P A;  3SEB A;  4IC7 B;  1JW9 D;  1YIW A;  2Z8L A;  3Q6B A;  4LNN A;  1I7H A;  3ALB A;  1R7S A;  2WXL A;  3R66 C;  1XO3 A;  4OZC A;  2N7J A;  3N1Y C;  4MH0 E;  2FBW B;  1WJU A;  3P2B A;  4JX1 C;  2LHE A;  1N5W A;  3CF6 E;  4TSS A;  4TV3 A;  2LVO A;  1E8Y A;  1V49 A;  4BBN F;  2HJ1 A;  2PE9 A;  4BBN C;  1FRR A;  1V6E A;  3VRA B;  1NDD A;  4FHJ A;  2FAZ A;  2DYB A;  3ZQ4 A;  2WXN A;  3H9D A;  4WWN A;  2MBE A;  2ZNV B;  2M19 A;  2AQ2 B;  1E7V A;  4ASW C;  4GN1 A;  1RRB A;  2D3G A;  2XN9 C;  3UGB B;  2Y5P A;  3X0W A;  1S1Q B;  1QKZ A;  1A70 A;  2JU6 X;  4MM3 A;  4EZL A;  1GJZ A;  1J7A A;  4HRS A;  1HTQ A;  2ON8 A;  4BOS C;  1EU4 A;  3MC9 A;  4ANX A;  4WJN A;  4K81 A;  2KLG A;  5AZG A;  4DQO C;  5D3I B;  1SIJ A;  4KV2 A;  2OHF A;  4W9L A;  3TEY A;  3EA6 A;  3IXS A;  1D3Z A;  1YJI A;  2NVU I;  3U2S C;  2LD9 A;  2V9H A;  1QT9 A;  2W3R A;  1ZGU B;  3DWM A;  4EFO A;  3OJ4 B;  2V3N A;  2WLB A;  3RMK C;  2BF8 B;  3MJW A;  5J17 A;  2X38 A;  2INN E;  4PK1 A;  3L0W B;  2KWV B;  3TL5 A;  1E0Z A;  1IBX B;  4ZHP A;  1UF0 A;  1AAR A;  1WY8 A;  4ANW A;  3GE3 C;  4D2K A;  3T9L A;  1KH0 A;  2KN5 A;  3AE8 B;  4Q2J A;  5CX3 A;  4OVU A;  2ZNV C;  2KOX A;  1TBE A;  4BVU C;  1P3Q U;  2QCZ A;  3CST A;  3SD5 A;  2MX2 A;  2BYF A;  2DHZ A;  3NVZ A;  5D6J B;  5C23 A;  5L95 C;  1Z5S B;  3MC8 A;  2INP E;  4HXD A;  1TT5 B;  3BII D;  4LK0 M;  4A3P A;  1L4Z B;  1SIF A;  2AL3 A;  2JX5 A;  3J9C A;  4W9G A;  4EOY A;  3TIX A;  2GBM A;  3V60 A;  4XWW A;  1JWM D;  1RWS A;  3NJT A;  3KYD D;  3AH7 A;  3RNB C;  2AX5 A;  1J0G A;  2BB6 A;  1DGJ A;  3N20 C;  3AE4 B;  4GMV A;  3BK2 A;  2JWZ A;  4HEA 1;  1V97 A;  4JWU C;  1EO6 A;  4OZA A;  2YVC A;  2DYO A;  3KYC D;  4ANV A;  4HK2 A;  3P1M A;  3MJ5 A;  2FCS A;  4W9J A;  2IO2 B;  3AED B;  3ENE A;  3HIZ A;  3NY5 A;  3UIO B;  2N1V A;  5E6J A;  4DHJ D;  1QIL A;  1L4D B;  3IAM 1;  2GBN A;  4J6I A;  2O2V A;  1C77 A;  1RYJ A;  4W9D A;  2Z59 B;  4M0W A;  5FK9 C;  2ACZ B;  4C4V A;  2KDE B;  3VAW A;  3ZRC A;  1YJ1 A;  3M3J A;  3W1S A;  1MHH E;  4XE0 A;  4A8X C;  2KWC A;  3QQ8 B;  3TBL D;  4CO7 A;  5TSS A;  3KWL A;  2ZCB A;  2KJR A;  1FO4 A;  2JZP A;  3O65 B;  2NBV B;  1CK1 A;  3TMP B;  1RAX A;  5J2R A;  2W82 A;  1WXA A;  4MSQ B;  3V3X A;  4NQL B;  1TJE A;  4US9 A;  4N59 A;  3QHT A;  2L32 A;  2IO1 B;  2JF5 A;  1WMH A;  2IY0 B;  4NPN A;  3KWV A;  2WNM A;  5D2M B;  2QIE B;  1E8Z A;  3NZS A;  2PKO A;  3URY A;  4F7Z A;  1TS2 A;  3PO0 A;  2KDM A;  3ZRF A;  1L6U A;  4XZ4 A;  4AWJ A;  4HCP B;  1DOX A;  2Z0E B;  1IUE A;  1FCL A;  3QC8 B;  3Q8E A;  1I42 A;  2N9L A;  3DVN V;  2MBQ A;  3U8Z A;  4MEM A;  2KAC A;  3RUI B;  3FIL A;  3RYT A;  4AJW A;  5IN7 A;  1E8W A;  3R7R A;  1MVK A;  2EMT A;  3PHW B;  2C9W B;  4BKT A;  2G4S A;  3UF8 A;  3A1Q B;  2BBC A;  2WYQ A;  1QOG A;  2RD0 A;  1VZ8 A;  1F1H A;  3AE2 B;  4GXB A;  1V1O A;  4RGN A;  4LNO A;  1JWU D;  2W54 A;  2MH7 A;  2CS4 A;  1ZDV A;  4WJQ A;  2DZI A;  2N7D A;  4N58 A;  2ZVO A;  2KDF B;  1FPY A;  2J7Q B;  2VZK B;  1C78 A;  3BYY B;  2W9N A;  3L13 A;  3H1U A;  1SGH A;  4OW0 A;  2H89 B;  5GXG B;  3SFD B;  1I4P A;  4PS7 A;  4FA6 A;  5GMV A;  2NTS A;  2W55 A;  4M00 A;  3ZTD A;  5IO9 A;  4XDC A;  1FMA D;  1XEE A;  4BKS A;  3Q3M C;  2L3Z A;  2WX0 A;  5H8Y E;  2N9K A;  5EE1 A;  1P9D U;  2ZW1 A;  4KZ0 A;  3SU8 X;  2DBY A;  2LVP A;  5G55 A;  3HRD D;  3OLM D;  1TY2 A;  2D11 A;  3WA0 A;  2REX A;  4DHZ E;  2I1J A;  2ZCC A;  4LJP B;  3X23 A;  2KHW B;  3KLS X;  1WH3 A;  1F0Z A;  5BYQ A;  4ZRQ A;  1D5X C;  3N1X C;  5D3D A;  3R2T A;  4PT5 A;  2WXG A;  2NPT B;  2L00 B;  4IWO A;  4B95 A;  2JPH A;  1KOT A;  2M1M A;  4HPM B;  5G5G A;  2KX0 A;  1XT9 B;  2BTE A;  2ZPY A;  5LNK 1;  4AS1 A;  4OZB A;  2WDV B;  3P4Q B;  3VRB B;  4ANU A;  4K3B A;  3PRP B;  1FFV A;  3HM3 A;  1LGR A;  3U30 A;  1SBB B;  1V86 A;  3AU4 A;  1K50 A;  5J18 A;  4AQ7 A;  2TSS A;  5KHQ A;  1CJE A;  4JL9 A;  5HKH A;  2QMT A;  4EEW A;  3AE6 B;  4GDK A;  4WWM A;  2IZV B;  1TKY A;  3ZVV A;  4EE2 A;  3QJZ A;  3DBR B;  1XQQ A;  2MEK A;  4G3X B;  1F2R C;  4YL8 A;  2IGG A;  4A20 A;  1JQ4 A;  2N9X A;  1R4N I;  3B9J A;  2RPV A;  4LDT B;  1ENF A;  1TKG A;  4REZ A;  1LO5 D;  2FCQ A;  2PVO D;  3VTW A;  1V1P B;  5DPS A;  1WGD A;  3PPA A;  2DEN B;  4KSK C;  2FE8 A;  4H2A A;  2H88 B;  2CKH B;  4BKS D;  2RSU A;  3ML9 A;  3I9V 1;  1WM2 A;  3H6N A;  3NZU A;  3NS1 A;  4A90 A;  4KIK B;  1XLQ A;  1JRU A;  4HLE A;  1VRA B;  4XX5 A;  2WXM A;  4NJ6 A;  2BS2 B;  3A9K A;  3TUO A;  4K7S A;  2KFJ A;  3HUI A;  2KJ6 A;  4G11 A;  1J7B A;  4M02 A;  3KQ4 A;  2R2O A;  1PGX A;  1EF5 A;  1YD8 U;  3M95 A;  3HK0 A;  3JSV A;  2RGF A;  5E6O A;  1YMH E;  4AJY B;  2ZEQ A;  3JYU A;  4F1S A;  1K52 A;  1WYW B;  4RCO A;  1GAQ B;  2JRI B;  3ZW3 A;  3V61 A;  1VR9 A;  4C7Y A;  3TJP A;  4ZRK A;  1NYQ A;  1WIA A;  3BZD B;  3AEF B;  4A55 A;  3DQV A;  1E9M A;  4GDL A;  5E6P A;  5EE3 A;  1T0S C;  2A4Z A;  3DVG X;  1R4M B;  1I4R A;  4M8N A;  2PVG C;  1BT0 A;  1K51 A;  2PTL A;  3GP7 A;  1GB4 A;  1ZDX A;  3IT6 B;  1F52 A;  3AB5 A;  4IWQ A;  4IKG A;  2FID A;  4AUQ C;  3AE9 B;  4KZC A;  2JXT A;  4MEL A;  3FAH A;  4K3C A;  1I4G A;  3NG0 A;  2NBU A;  2O6V B;  1IYF A;  5LXI B;  1GC7 A;  3PTF C;  4LNF A;  2NS5 A;  2V0G A;  3EFU A;  3Q8F A;  4KGR A;  2KJH B;  3BIN A;  4S0R A;  5C2T B;  3ZXV A;  1TZO A;  4WJO A;  4RM8 A;  4DXA B;  4HDO A;  5D94 A;  2KMA A;  1UWX A;  3AE1 B;  4RGM A;  2RR9 A;  4FHK A;  2KFK B;  4HPL B;  1OEY J;  3AEB B;  3QIJ A;  4XC2 A;  1KLU D;  2DLB A;  2XK5 A;  3DBL B;  2W3S A;  3MP9 A;  4XDD A;  1UUP A;  2A5U A;  1XF5 L;  3L10 B;  3HM6 X;  4C00 A;  4L23 A;  1Q10 A;  2N4F A;  1T5X D;  4BZA A;  5FR3 A;  4MJS A;  2N7E A;  1GC6 A;  3PZ7 A;  2BWF A;  2MP2 A;  3NVY A;  3ZTC A;  1WJ4 A;  3RNE C;  5FKA C;  2BQQ A;  3Q69 A;  1ZUD 2;  3GZN B;  2NR2 A;  2M4N A;  2WXK A;  3K9O B;  2M0X A;  3A33 B;  1ZP0 B;  4KVG B;  2CR5 A;  2D07 B;  1WXS A;  4ZYN A;  5BO4 B;  2WS3 B;  2WXP A;  1V5T A;  2LUM A;  1VCB A;  3ZXR A;  3IHP C;  3BVG A;  1WZ3 A;  2IO0 B;  2GBK A;  3AE7 B;  2QDF A;  3B1L X;  4FJZ A;  2OJR A;  3PV1 A;  3JW0 X;  1NEN B;  3I3T B;  2WXJ A;  3AE3 B;  4KGT A;  3RD2 A;  4RM9 A;  3P4S B;  4XYC A;  3VH3 B;  1SB3 C;  3GB1 A;  2ZW0 A;  3PZ8 A;  2BKR B;  1C4P A;  1AYF A;  4XWT A;  3T3O A;  5T8I A;  3VH4 B;  2CJO A;  2K8B A;  4A6Q A;  2LVQ A;  3WIM A;  1QOF A;  2QJL A;  3R3M A;  4FN2 A;  1Q5W B;  1EUV B;  1UZX B;  4B0E A;  3QCA A;  1KRH A;  1JWS D;  4BOZ B;  2AQ3 B;  2WXH A;  2JY6 A;  2FUG 1;  2KQ7 A;  3Q3F A;  1XLO A;  1ET6 A;  4OVZ A;  1D5Z C;  2IY1 B;  3OAW A;  1N6Z A;  3CWI A;  3SFE B;  2ZJD A;  3W1S C;  5AZH A;  3AMZ A;  1IP9 A;  1FCC C;  2KT7 A;  2WU2 B;  2KMC A;  1NBF C;  2IBI B;  2D3A A;  4MDK E;  1E8X A;  4NJC A;  2L76 A; 
#chains in the Genus database with same CATH homology
 4FXC A;  4WQM A;  1DOX A;  2HTM E;  3TSS A;  1MHX A;  1OFF A;  4ZRP A;  1IUE A;  1FCL A;  5BMI A;  1BUI C;  3Q8E A;  2KWD A;  2N9L A;  3WCQ A;  2ICI A;  4WUR A;  3P4P B;  1XCT L;  2KAC A;  1HZ5 A;  3FIL A;  3BYT B;  3ZGZ A;  1UGJ A;  4GLS C;  2K0P A;  1V8C A;  2K5P A;  1AW7 A;  1MVK A;  3NVW A;  4NAM A;  1PGB A;  1YN5 A;  2WP9 B;  4YTN B;  1T6B X;  3Q8C A;  1FRD A;  2M0A A;  3O13 A;  3H8H A;  2BBC A;  1QQR A;  1DOI A;  2LMC A;  3AV8 A;  1QOG A;  1VDV A;  1N60 A;  1ET9 A;  1EWY C;  1P7F A;  2MJ3 A;  1VZ8 A;  4RGT A;  1JWA D;  1ACC A;  2GI9 A;  4DXG A;  1CZP A;  3R8B A;  2LGI A;  3AE2 B;  4B0M A;  2IPK D;  1JWB D;  4NZL B;  1V1O A;  2IDY A;  1L0X B;  5AUI A;  4RGN A;  1HA5 A;  1JWU D;  2W54 A;  1YN4 A;  3ZJT A;  2MH7 A;  1ZDV A;  2AQ1 B;  3AEC B;  1F77 A;  1QF6 A;  3P63 A;  5BMH A;  1TKE A;  4N6E B;  2V3P A;  3B2F A;  4NAW B;  5EE9 A;  2WXQ A;  2NMQ A;  4N58 A;  2GB1 A;  2BB5 A;  2VZK B;  2Y3A A;  1PGA A;  1C78 A;  1C76 A;  1E6E B;  3BYY B;  1YQ4 B;  1BXT A;  3ZYY X;  3R2I A;  1PFD A;  4C56 C;  1M4V A;  1D5M C;  1ZE3 D;  2H89 B;  4OW0 A;  5EE0 A;  2M56 B;  5GXG B;  3SFD B;  1IGD A;  2VZK D;  2G1E A;  5D7G A;  1C4C A;  1I4P A;  4WAF A;  1TYG B;  2NTS A;  1DYQ A;  2W55 A;  2DWQ A;  2WXR A;  4MH8 A;  1C9F A;  1GPX A;  4XDC A;  1HZ6 A;  1V1P A;  1FMA D;  4A9A A;  1SJH D;  1FXI A;  1XXG A;  3T3N A;  1N63 A;  1XEE A;  1XCQ L;  1VLB A;  2PW9 A;  4KKI A;  4US8 A;  2B76 B;  4OHJ A;  2J42 A;  5BYS A;  4YXD B;  3HVD A;  5HFY A;  4YSZ B;  4O1N A;  2RDG A;  5H8Y E;  1L5P A;  2N9K A;  3VR8 B;  5EE1 A;  1N61 A;  1RM6 C;  3DWG C;  4JWS C;  2ZW1 A;  2DBY A;  3ETR A;  2LFI A;  3W2D A;  2CJN A;  3HRD D;  2L52 A;  1TY2 A;  3AEA B;  4RF0 A;  1HEZ E;  1FEH A;  1NEK B;  1FIQ A;  2WU5 B;  2SEB D;  2WQY B;  2KN4 A;  2I38 A;  5C3J B;  1WWT A;  3N9Y C;  1KF6 B;  1NI3 A;  3KLS X;  2I2Y A;  1F0Z A;  5BYQ A;  3FIL B;  4ZRQ A;  1YQ3 B;  2BS4 B;  1D5X C;  2E3T A;  5D3D A;  1SE4 A;  3OWE B;  3R2T A;  4YTP B;  2PMV A;  4HJG E;  4PT5 A;  1Y56 A;  2WXG A;  1RFK A;  1WRI A;  2QEJ C;  2BYT A;  5MPO A;  1UWM A;  1XLP A;  2BS3 B;  5G5G A;  2RDH A;  4RF1 A;  2BTE A;  4L2Y A;  3W5V B;  2E6X A;  5LNK 1;  4AS1 A;  4OZB A;  1CQV A;  2WDV B;  1KFY B;  2LHD A;  3P4Q B;  3VRB B;  1MI0 A;  4MT5 A;  2G9H D;  2LJI A;  4L1B A;  2JYE A;  5G5H A;  2WXI A;  1FFV A;  2WXO A;  1QLB B;  2IGH A;  1KTK A;  1HXY D;  1ESF A;  1SBB B;  1SE2 A;  4J3O D;  3TEX A;  3ZJV A;  4UDU C;  1K50 A;  4AQ7 A;  2K22 A;  2TSS A;  4HKQ A;  1CJE A;  4ARI A;  2CU3 A;  4YT0 B;  3P42 A;  1I4H A;  2QMT A;  2JWU A;  1KLG D;  3AE6 B;  4WWM A;  1TKY A;  2Q5W D;  1WGK A;  4EE2 A;  4ARC A;  2JSV X;  1K53 A;  1AN8 A;  2GRI A;  3LYY A;  4KKJ A;  2IJ0 A;  2MEK A;  2QSD A;  1C4A A;  4TMA B;  5HI1 A;  3VQI A;  3SEB A;  1F2R C;  1JW9 D;  2IGG A;  2Z8L A;  1JQ4 A;  3B9J A;  2RPV A;  1I7H A;  1ENF A;  4JPS A;  1TS5 A;  1WYG A;  1TKG A;  1XLN A;  1R7S A;  2WXL A;  4REZ A;  1LO5 D;  2JYT A;  1XO3 A;  2PVO D;  1V1P B;  4OZC A;  1B1Z A;  2N7J A;  2FBW B;  2PLP A;  4TQ1 A;  4JX1 C;  2FE8 A;  2LHE A;  4H2A A;  1N5W A;  2H88 B;  1C79 A;  4TSS A;  1EU3 A;  3IAS 1;  1ZXI A;  4RNA A;  3RFZ B;  3ZJU A;  3I9V 1;  2EEL A;  1FRR A;  3NS1 A;  3VRA B;  3GS2 A;  4A90 A;  4JE3 B;  1XLQ A;  1B9R A;  1EWC A;  3ZQ4 A;  2WXN A;  3BVZ A;  1JCK B;  3TEZ A;  1YNT E;  1L6V A;  2M19 A;  1SF0 A;  1VRA B;  3HVZ A;  2AQ2 B;  2K9X A;  2WXM A;  2XN9 C;  2LEK A;  2BS2 B;  5JXV A;  3AEG B;  3TUO A;  2J4X A;  3W9C B;  3HUI A;  1L0Y B;  2Y5P A;  1J7B A;  1QKZ A;  1TS4 A;  4YTM B;  1A70 A;  2R61 A;  3KQ4 A;  3IT4 B;  3Q8B A;  2JU6 X;  3AE5 B;  3LXF A;  1PGX A;  1MPE A;  1QOA A;  3E9S A;  1J7A A;  1ZPS A;  4HRS A;  2ON8 A;  1DOY A;  4ZOH C;  1EU4 A;  1EM7 A;  1YMH E;  2BW2 A;  4DQO C;  4RH6 A;  5D3I B;  1K52 A;  2RMM A;  4RCO A;  1SIJ A;  1GAQ B;  4KGS A;  2OHF A;  1L0V B;  1VR9 A;  3E56 A;  4C7Y A;  3U52 E;  1D4B A;  3TEY A;  1ROE A;  3U4E G;  1NYQ A;  1F2R I;  3EA6 A;  3BZD B;  3IXS A;  4IDI A;  1YJI A;  3AEF B;  3U2S C;  4A55 A;  1PUT A;  1E9M A;  5EE3 A;  2DYM A;  1I4R A;  4GDK B;  2ONQ A;  1JRP A;  2PVG C;  1QT9 A;  2W3R A;  1K51 A;  2PTL A;  3DWM A;  5AUK A;  4C80 A;  2L1A A;  4RFB A;  2V3N A;  1JAL A;  2WLB A;  3GP7 A;  1GB4 A;  1WXQ A;  2XNA C;  1ZDX A;  3C8Y A;  1I4Q A;  3AB5 A;  3IT6 B;  2X38 A;  2INN E;  4IKG A;  1GOZ A;  1ZXH A;  3L4P A;  1E0Z A;  3AE9 B;  1IBX B;  2Y5C A;  1PDX A;  2JXT A;  3TEW A;  3AN1 A;  4ZHP A;  1NVI D;  3FAH A;  1I4X A;  1I4G A;  3RPF C;  1SSN A;  4P6V F;  4D2K A;  1KH0 A;  3AE8 B;  4Q2J A;  3UI3 A;  1JRO A;  2V0G A;  4KGR A;  3Q8F A;  1N5X A;  4IOI E;  3I57 A;  5C2T B;  1TZO A;  1ZOY B;  2WXF A;  1OQQ A;  3P4R B;  5HG2 A;  3MFG A;  3NVZ A;  1HQR D;  3V05 A;  1JML A;  1UWX A;  3AE1 B;  4RGM A;  2INP E;  4WIP A;  3BII D;  4LK0 M;  1L4Z B;  3AEB B;  2JX5 A;  3B2G A;  3J9C A;  1KLU D;  1SXT A;  2DLB A;  2W3S A;  3MP9 A;  4P16 A;  4XDD A;  1IGC A;  1IBX A;  1UUP A;  1XF5 L;  3AEE B;  2IGD A;  4XWW A;  1JWM D;  1RWS A;  2JQR B;  1AWD A;  2EKI A;  2L83 A;  1FNV A;  2BT6 A;  3AH7 A;  1BML C;  4HKZ E;  4L23 A;  1Q10 A;  2AX5 A;  1T5X D;  5FR3 A;  2BB6 A;  1DGJ A;  1FNU A;  3NVV A;  3AE4 B;  1SJE D;  3BK2 A;  3NRZ A;  3PZ7 A;  3NVY A;  4YSY B;  4HEA 1;  1T3Q A;  3EUB 2;  4MM3 B;  4MAC A;  5FKA C;  1E7P B;  4LLG M;  3VR9 B;  3Q69 A;  1V97 A;  1ZUD 2;  4JWU C;  2WXK A;  4OZA A;  2OED A;  2DYO A;  1ZP0 B;  4R3D A;  1E10 A;  2YEP B;  1STE A;  2QIL A;  2WS3 B;  2WXP A;  2HDE A;  2KQ4 X;  2LUM A;  3P1M A;  3MJ5 A;  3W5U B;  3Q8A A;  1UNS A;  1FNW A;  3BVG A;  4ZYS A;  3AED B;  1OQR A;  3FC4 A;  2KMM A;  3AE7 B;  3CIR B;  1NEN B;  2WXJ A;  4ZHO A;  4GDL B;  2KAJ A;  3AE3 B;  5E6J A;  4KGT A;  1QIL A;  3P4S B;  1L4D B;  2SAK A;  2WDQ B;  1SB3 C;  1TY0 A;  3GB1 A;  2ZW0 A;  3IAM 1;  1YN3 A;  2N0S B;  1SEB D;  3PZ8 A;  1C4P A;  2V4I B;  5BYR A;  1C77 A;  2J53 A;  3ABV B;  1RYJ A;  1AYF A;  4USA A;  1WSP A;  4CQN A;  4XWT A;  4M0W A;  1VZ7 A;  5FK9 C;  3T3O A;  1SE3 A;  1FXA A;  1PYW D;  5T8I A;  2ACZ B;  2CJO A;  1J7C A;  3AM9 A;  2K3U A;  4A6Q A;  3W1S A;  2D5G A;  3SR6 A;  1MHH E;  4XE0 A;  4RGO S;  4A8X C;  1QOF A;  2MJD A;  4ITK A;  2QJL A;  4DXF A;  4LTU A;  2WDR B;  2J52 A;  5TSS A;  3KWL A;  2PIA A;  5I4D A;  4B0E A;  1FO4 A;  1VZ6 A;  5HHD G;  2JZP A;  1KRH A;  4HRO A;  4KX6 B;  1JWS D;  5BMG A;  3EGR A;  1CK1 A;  2AQ3 B;  2WXH A;  3NUH B;  2MJE A;  4YWG G;  4WH4 A;  1FM0 D;  1TS3 A;  2W82 A;  2FUG 1;  1GB1 A;  1FD6 A;  3NZ3 A;  3V3X A;  1TJE A;  4US9 A;  2YEP F;  1QOB A;  4N59 A;  1XLO A;  3U7Z A;  3BVM A;  3MC0 B;  1ET6 A;  1NYR A;  2L32 A;  4C7Z A;  4OVZ A;  1D5Z C;  1YJJ A;  1P7E A;  1VJK A;  3KWV A;  4YSX B;  3CWI A;  3MHZ A;  2WNM A;  3SFE B;  1FFU A;  2QIE B;  3AMZ A;  3LB8 C;  5H92 C;  1FCC C;  2WU2 B;  2NTT A;  2PKO A;  3BK1 A;  1TS2 A;  3URY A;  3BWU D;  3PO0 A;  2KDM A;  1D6E C;  1N62 A;  1L6U A;  4NJC A;  4TQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...