4DQQA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 204
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqqA01
5HRSA 3UXOA 5I3UA 8ICHA 2OYQA 5KFNA 2BQ3A 2JGUA 1JMSA 1HPZA 4CJSA 4FJXA 5KFQA 4BWMA 3JSMA 4DFKA 3HM9A 3HPGA 5J1EA 4DTOA 3M9OB 4WE1A 3JPTA 4M42A 1EXNA 4CGDA 4FLXA 1ZQDA 4DFPA 4I29A 1ZETA 4CFAA 3TAGA 2W9CA 3ZDEA 1TFRA 3UXNA 2D0AA 9ICHA 2YKMA 4Q8FA 4CHZA 1C7YA 2VWJA 4DSJA 1HUZA 7ICNA 3KLIA 3HK2A 5T7BA 4M3UA 5DB9A 2YNIA 4PH5A 3V6JA 3Q8SB 2FBTA 3TAEA 9ICKA 3JYTA 2DFFA 4CGFA 5CA7A 1UWBA 4CJRA 3QLHA 4YN4A 2NRVA 3DRPA 2Q3SA 3AVMA 1NK9A 3QNOA 2AJQA 4KI6A 1RTDA 4OPKA 3JPOA 5KT3A 3CFRA 3RJKA 1YTUA 4FLUA 4PHDA 4CCHA 2KFNA 4MF8A 5KFSA 3AO5A 4ELTA 4JUZA 1U48A 2BCQA 3SPZA 4CHNA 3LZIA 1BPBA 2Z1IA 1TV6A 1DOQA 1NJYA 3RR8A 4NM2A 3K75D 4FK0A 3MEDA 4RQ3A 3VQ5A 1XC9A 3WNHA 1X9WA 5KFIA 1T03A 3NF6A 3T5KA 4DL3A 4F3TA 5HBMA 3QEXA 3T3FA 3K5NA 2IHMA 3MXIA 5DDYA 1RBSA 1BPEA 1S9EA 3ZT1A 1SKRA 4JV1A 3KLHA 4PHEA 3GIKA 2BQRA 4E89A 3V81A 4J9QA 2PFQA 1K1QA 3ZT3A 1D8YA 1YT3A 3AVNA 4B9UA 4M9GA 1HUOA 5CB1A 1KDHA 1JIHA 2MUTA 5KG4A 1L3VA 1S77D 1RDBA 4J9PA 4CFBA 4DOCA 4F2RA 9ICQA 5KFOA 4CJFA 2RPIA 3DOKA 3ITHA 3OVNA 2VANA 5J0YA 3KK1A 1JLCA 4DTMA 1JLAA 5KFDA 3C94A 8ICLA 1ZQCA 4CFDA 2X6SA 4FM0A 1ZQPA 2I1QA 3KKSA 3MECA 4CIEA 1JKHA 1ZQGA 3NF7A 2AGPA 4OVLA 4UB4A 4BE2A 4CJPA 4IDKA 1TKTA 4FJIA 1ZBIA 4QZ9A 4FJ8A 1D9DA 2RDJA 3H8WA 3TFSA 4ECQA 3RH6A 3HT3A 3ZT4A 3M8SA 3HL8A 4NYNA 4OLBA 3MGIA 2QXFA 3RJFA 4HHTA 4J2DA 4BDYA 4FW1A 4QW9A 8ICGA 5J0XA 4O5BA 4FJJA 4F92B 5BPCA 8ICVA 3O4NA 3SQ0A 3QETA 3GQCA 3NFAA 3NCIA 1COOA 2BCRA 4DL4A 5JUMA 2AGOA 5L1KA 1TGOA 4KLLA 2F1IA 1IKWA 3ZT0A 1ZBLA 3F9KA 5CR0A 4F3OA 4F4KA 3V7JA 9ICNA 4LD0A 5J2KA 2UVUA 4IFYA 1NK6A 4I2IA 5KFMA 3KLFA 4B08A 3OS1A 1UA0A 4AHUA 4EEYA 1C1BA 2IA6A 2HVIA 7ICTA 3C95A 2E6LA 4KLIA 3KJVA 4KLJA 3LPUA 5J2NA 3THVA 1RT5A 3Q8RB 7ICUA 1C1CA 3L8BA 4RNOA 1HYZA 2HVHA 3AVCA 4UAYA 3OYLA 4YG2A 1EX4A 4DTUA 4IBNA 3D45A 4NM1A 3OYKA 4M45A 3AVLA 1W0HA 2W42A 4DF4A 4KMUA 2R8JA 4KAZA 4QWAA 1BCMA 5DGBA 5KFGA 5J2PA 2FPKA 5J2JA 5L1LA 4FS2A 3K5LA 4FM2A 2F96A 7ICJA 4FBTA 4M0AA 4GLXA 4Q43A 3SUOA 3V1RA 4CEDA 3NH2A 2FPLA 2I5JA 5KT2A 1RT1A 4TQRA 4K4GA 4IQWA 2G8IA 3CFPA 4YXJA 4BXOB 4AHTA 4BXOA 1ZQNA 4YXMA 1WCNA 4RQ4A 2A1JB 3C2LA 4HYKA 1BI4A 5J0UA 4I2HA 2KQ2A 3RJHA 2Z1JA 3DLGA 1ZQIA 4J9NA 3BQ2A 1BIZA 1K6YA 4I2FA 3DLBA 4BGDA 3PMNA 2DPJA 4I2QA 4DU1A 4LSLA 4CEBA 4UQGA 4R65A 3L3VA 4JWNA 4YFUA 2FLNA 2BANA 1I3AA 1KLNA 4BWJA 2HHUA 4DSIA 4KO0A 4F5PA 1HQEA 4YMOA 3QEVA 2ETJA 4NCBA 4IR1A 3BDPA 2ISPA 3RMAA 3PUFA 5IIJA 5KFUA 4RQ8A 4Z6CA 1VSHA 5HRNA 5KG5A 4FJMA 3IAYA 2BDPA 3ZCMA 2PXIA 5JS1A 4B8CA 4PGQA 3O3HA 5DG8A 3O4QA 3PV8A 5CYMA 4JRQA 3H4BA 1KTQA 1TVAA 3NE6A 4DOAA 3DRSA 2AQ4A 3QZ7A 9ICFA 2B4JA 4QZEA 1NK0A 3MEGA 4E7HA 3N4MB 3AO3A 2KZ3A 3RB4A 5KFFA 4ED8A 5D3GA 4Q45A 4FW2A 4KKOA 1GOCA 3TABA 8ICBA 4RQ2A 2W9AA 3OYEA 1W9HA 3AVIA 3GIMA 4I2EA 1C1AA 3K57A 1C6VA 1BQNA 1TL3A 4FO6A 4I2BA 3VA0A 4UB5A 1BQMA 1NJZA 2GV9A 3V9SA 2O4GA 3OHAA 2DFLA 5KFEA 2YNGA 1WSEA 1ZQKA 1MQ3A 2XHBA 3V6DA 4TURA 4R8UB 1JLBA 2IAJA 4HUFA 1RCHA 5FRMA 3TANA 4QCLA 4H4MA 5HMLA 3ZT2A 1QSYA 5L9XA 2ITGA 3OYHA 8ICQA 2QKKA 3DYAA 3A2FA 7ICQA 4O9MA 4LZDA 3AVJA 1ASUA 5KG6A 4CJ4A 3JPPA 5DB8A 5DK5A 3KTQA 4E0DA 3MR3A 2R8IA 1WSJA 3V9ZA 2DY4A 4TQSA 1ZQRA 3B0YA 1ZQFA 3G10A 4KTWA 4CK1A 3QZ8A 3SZ2A 3K58A 1S9FA 3DOLA 3AVGA 4FYDA 4KPYA 5EOZA 1FXXA 3V6KA 2HNYA 4CHYA 3NBPA 4GC7A 5I42A 5J0SA 2VWKA 2BR0A 1A5WA 4QWEA 4RNNA 1QSLA 1TKXA 5DBCA 1X1PA 5C42A 5J2GA 7ICFA 4DTSA 4R66A 3RAQA 4KFBA 3RJGA 4CGJA 3NDKA 4CIFA 4ED3A 4KLSA 5KFWA 4I2GA 3Q8MA 3LP0A 3PO4A 2BE2A 2W9BA 1DLOA 4CESA 1Z00B 3NGYA 1ZQVA 4CFCA 3V9XA 8ICEA 1Q9YA 3WNEA 4M3YA 7ICIA 3IHQB 4YNQA 1L3SA 4F4YA 1VSLA 1KFSA 1JLEA 4CF2A 4PGXA 4DU3A 4RQ1A 5KG2A 4QZCA 1JX4A 3AO2A 1MU2A 2KFZA 3G6VA 4FBUA 2AGQA 4MEXA 5KG0A 3V6HA 1HNVA 4N41A 4EZ6A 1N5YA 2XCAA 5KI6A 5HP1A 2B21A 4I9LA 3ZDAA 3Q8PB 1T4GA 3OYJA 2NRTA 1SZPA 4F4XA 4ECWA 2FBYA 4EBCA 4M9NA 2XO7A 4B3OA 1QSSA 4RQ6A 3AO1A 4ECZA 5CZ1A 5J2DA 4ELUA 2GUIA 5J0RA 1HQUA 3FDSA 4K4HA 3C5FA 1ZBHA 4KLHA 3JPRA 3MAQA 9ICMA 3VQPA 4FJ9A 4RU9A 4ED0A 1ZQZA 1TL1A 3G6XA 1ZQUA 3DLEA 4KLFA 1A5VA 4PHAA 5KG1A 1J54A 4CF1A 3NTUA 3SI6A 4UB2A 2HHVA 5BOLA 1CZBA 4ECTA 1ZQMA 1CZ9A 3OYNA 3P83D 3NHGA 2LYHA 4M2YA 2ATQA 4NY8A 4K8ZA 5KFJA 2R7YA 2XGQA 4I2AA 1HMVA 3C1ZA 4IKFA 3CM5A 4GC6A 4KLEA 4MQ3A 4GXIA 1RT3A 4I28A 7ICEA 1SL1A 4W5OA 5DLFA 4NYFA 3VQ8A 2P1JA 3TWHA 1RT6A 4NXZA 3V9UA 4O4GA 3RJJA 8ICPA 1RDDA 1L5UA 3OS2A 4C8LA 3EPGA 1JLFA 3HPHA 4NLZA 4DL7A 1ZQEA 1QE1A 3LP3A 3VQQA 1TK8A 2PI5A 2VG7A 3L2QA 4JLHA 5DB7A 1Y88A 3HX0A 4E7JA 1JXBA 1VSIA 2DPIA 2BHNA 4EBDA 4AILC 2JLEA 3V4IA 3RR7A 3SQ2A 4OGEA 4CEFA 4LVSA 2P66A 3QEPA 1J5OA 2ZJ8A 2F1JA 3Q8KA 4CEAA 3SQ4A 3KHGA 2J6TA 5C24A 3V1QA 3ZSOA 2I9GA 2B6AA 2YV0X 3JPNA 1VRUA 1J9AA 1NKCA 1S0NA 2BQUA 1NK4A 5DQIA 1UT8A 3L2WA 4ED2A 4W5QA 1D5AA 2VA3A 1GOBA 3QIPA 4B9LA 2V4QA 3MR5A 3JPSA 2PFOA 4B9NA 3IG1A 4Z0UA 2H5XA 4AH9A 4H8KA 4YQWA 3KLEA 4UB3A 1IKXA 4DTJA 3UPQA 1JL1A 1ZQLA 1RTHA 1XS9D 4RPZA 9ICRA 5HRPA 2YKNA 3PVXA 2ZQBA 1LV5A 2KN7A 1EP4A 2VG5A 3HVRA 4FJKA 3LK9A 4DSFA 1XHZA 1NOZA 3PR4A 3UQ2A 4EBEA 1N56A 1AROP 9ICPA 3TQ1A 3MDCA 4OLAA 3WNGA 1WSIA 3OGUA 3CFOA 4F5RA 5KT7A 3DM2A 3RB0A 1LWFA 1MQ2A 4QZDA 3O3GA 3ZSVA 4CJQA 2VA8A 1ZQOA 3RTVA 2G8UA 2HHXA 4MEYA 4Q8EA 3V9WA 5D4BA 4R5PA 3S3MA 4J2EA 1XWLA 4PHPA 5IINA 2FLPA 4QZFA 1RXWA 3LDAA 2HNZA 1S97A 1YTAA 3MR6A 2PFPA 3AVHA 5KTQA 3O3FA 3PW4A 3ISCA 2Y1IA 4YP3A 3EYZA 3NGDA 1X9SA 1GOAA 4CGIA 4CJLA 4L8RB 3UQ0A 5DBBA 1HJRA 5KFTA 1S0VA 5FRNA 4DS4A 4ED1A 4DQSA 4RW9A 1EKEA 4Z4FA 4NCAA 2VA2A 1KVAA 4AHCA 3C21A 4OKKA 5KT4A 1JLGA 4ECVA 2F8TA 4M9LA 3C6UA 4KHUA 1KFDA 4KTZA 4O3OA 3SNNA 1RBTA 2W9MA 1YVUA 4IRKA 1U04A 2ZE2A 3AVAA 4CJ5A 1BL3A 3OYBA 3KK3A 3H40A 4DS5A 2ZD1A 2KW4A 1VSMA 4KHNA 3KHLA 4Q44A 1KSPA 2FLLA 2F8SA 4GXKA 3QEBZ 3OJSA 4E7KA 4TUQA 2KZZA 1TVRA 3GDXA 2HHTA 3ISNC 5KFXA 1Z00A 2ZUCA 4F91B 4ED6A 4PPXA 1JN3A 1RBRA 5DBAA 3KD5E 4FJNA 1BI4B 3TR8A 2O4IA 2P6UA 8ICRA 4RPXA 2Z1HA 4B9VA 3PX6A 3AA4A 3H7IA 4DFMA 3AVKA 4CJKA 4RNMA 3M8RA 5F9NA 1B9DA 1S1TA 3S3OA 4P4PA 2IBKA 4M3ZA 3T5LA 1CXUA 3NF9A 3SYZA 3M9NB 3SUPA 4N47A 4EZ9A 1IKVA 5KFRA 1NKBA 5HRRA 1Y97A 2RDIA 4GVMA 3K5MA 4HUEA 1SL0A 2KTQA 4CJUA 4CGHA 3VQDA 4M6WA 4DSLA 3LWLA 1RDCA 1T05A 3H8JA 4MFBA 4F93B 4ICLA 4E19A 2AU0A 4QWCA 2DFEA 4PY5A 3DMJA 3EWAA 1ZQHA 4DQPA 3B6OA 2R8HA 1KLMA 1R0AA 5CHGA 4O3SA 8ICTA 1Q9XA 1BGXT 3UXPA 3RRGA 2YNHA 3RJIA 5DQGA 4KHSA 4DF8A 3SQ1A 4Z4GA 1RNHA 3MXJA 2FC0A 4E7IA 2GWSA 4HCCA 3OJUA 2YHBA 1XU4A 1DTQA 4XIUA 1WAJA 8ICFA 1NOMA 4IG3A 4F4WA 5DLGA 3TAFA 3ZSWA 3K59A 5IIKA 8ICNA 2DTUA 4G1QA 5CYQA 3KIOA 1ZQXA 4YD2A 3L2UA 2NRWA 4RW7A 3DLKA 2G8HA 5KFLA 1ZJNA 1EXQA 1U47A 4KLOA 4IQUA 2PZSA 1RBVA 3N97B 2XGPA 3KD1E 2B5JA 1Q8IA 1TKDA 3AVBA 4M3RA 1I39A 1HYSA 1ZQJA 4GW6A 1KCFA 4IRDA 4H4OA 1SL2A 4HTUA 1XSLA 2C2EA 4BDZA 1G15A 2R8GA 2MUTB 3NGIA 1X2IA 2UVWA 4I7FA 2UVVA 4TUPA 1WSGA 7ICRA 3I8DA 1SKWA 1CEZA 8ICWA 2BPGA 3OHBA 4CK2A 4JV2A 4F5QA 3QEAZ 1ZQSA 1MSWD 4C8NA 4CEZA 4CEQA 4QW8A 1S10A 4CHPA 3SPYA 1QHTA 4NLGA 4FLZA 2IHNA 3LWMA 2ZTCA 4JS5A 4GXJA 3PX0A 1LAVA 4DQRA 1CUKA 4YMNA 4X5VA 1RYSA 4YD1A 5KFPA 4EYHB 9ICIA 2X74A 2BGGA 4RT2A 4KTQA 1WNSA 4FK2A 1BIUA 1N48A 3HP9A 2HB5A 4DQQA 3RAXA 3RRHA 3LANA 3IS9A 4ED7A 3T5JA 4KN4A 4MF2A 4K4IA 4CJVA 1QQCA 5IIOA 3OYFA 2J6UA 8ICXA 4CJTA 3M8QA 1IXRA 3ZD8A 5J29A 3AO4A 3PW7A 4ELVA 5HP4A 3ZSQA 1LWCA 1NJXA 3CYMA 4HVJA 1KRPA 4UB1A 1ASVA 3BGRA 3SV3A 2PI4A 3GV7B 1U49A 4LH5A 4FS1A 1XI1A 5EWEA 4N76A 4EYIB 4DL6A 5HHIA 5J2EA 4J9SA 3ZDDA 4OKJA 5E41A 9ICCA 7ICSA 4QZIA 3RWUA 1NOYA 5HROA 1XO1A 2PYLA 4O3QA 4OKEA 4O5CA 1NK8A 4IRCA 4BACA 3RB6A 3PMLA 3SJJA 2XC9A 1VRTA 3LP2A 3SUQA 2E4LA 4R64A 4PWDA 2D0BA 2YNFA 4O0IA 4DL5A 4ID1A 4IFVA 2IS3A 1J53A 4CJ3A 3GIJA 4DO9A 2E6MA 3H8SA 3V7LA 2KZMA 4CF0A 1Z25A 4W5TA 2QKBA 1C0TA 3BJYA 3Q8QB 4XA5A 2RN2A 3T19A 3VQCA 2HW3A 1TV9A 4AHSA 1D9FA 3VQBA 1HJPA 1V9PA 5DG9A 4EP5A 1VSDA 4RPYA 5FDLA 1WSHA 3ZSRA 4RUAA 4DL2A 4N56A 1XSPA 3UIQA 4FJHA 4ECRA 2D0CA 2EHGA 3L2RA 3ALYA 3V72A 4XUSA 3PNCA 4KLMA 3OYGA 4KHWA 4CJEA 7ICPA 4PA1A 1ITGA 4MFCA 3RH4A 4F2SA 2ZTEA 4XQ8A 1TAQA 3ASMA 4O3PA 5J2MA 1JL2A 4K8XA 3M8PA 2WTFA 4YCXA 4M9HA 3C5GA 1S5JA 3HVTA 2RF2A 1UA1A 1RYRA 4QAGA 2R8KA 3ZDBA 3ORYA 5CP2A 1IM4A 8ICZA 4C8MA 5DDMA 2P5OA 4ZTJA 2C28A 3HPOA 4UBCA 3E2EA 2W8LA 4OPJA 1BISA 1FK9A 3P1GA 1ZQQA 5J0QA 9ICAA 4KB0A 5J0PA 4OGCA 3MR2A 4F5OA 4PQUA 3SI8A 2JZBA 5F9LA 3PW5A 3P5JA 2HNDA 1S6PA 4EP4A 1S1VA 3AU2A 4F4ZA 3HW8A 4M9JA 5J2QA 4DQIA 3HSTB 5JS2A 5IILA 2EX3A 1IKYA 4KN7A 4KLTA 4Q5VA 4DTXA 4ZTFA 1ZJMA 3RBEA 3NF8A 4O5KA 3K2PA 7ICKA 8ICIA 2NRXA 1SUQA 3NH0A 2PY5A 2XY7A 1VK0A 3ULDA 9ICOA 3TFRA 3OY9A 2OPRA 2ALZA 3GFKB 4FJGA 1VSFA 3IM1A 3PO5A 4I2PA 4Y1DA 3DLHA 3MBYA 1NK7A 4G3IA 1KVBA 2YHAA 4RQ0A 4J9LA 2PYJA 4IQTA 3DRRA 5KFHA 1LW2A 1RXVA 4KREA 2BCUA 3LAMA 3KHHA 4GMJB 4DTRA 4FLYA 3NH1A 1CLQA 1XSNA 4ECUA 4TUSA 7ICVA 1RILA 1CXQA 4O55A 2C2DA 3IRXA 3LP1A 2G8WA 1VSKA 4E1MA 4M3TA 1S9GA 4Z6FA 1ZQAA 2IC3A 1RPLA 4DWIA 4M47A 3SV4A 5CZ2A 1B9FA 4ZH4A 4RZRA 4RW8A 5KT6A 2A1JA 1TKZA 4CJWA 3NAEA 3EPIA 4P4MA 1S76D 4XRHA 3LAKA 2ASJA 8ICCA 4FLWA 2J6SA 3V1OA 9ICBA 4KLGA 3QERA 3S9HA 4FLTA 4Q0BA 2XY6A 4UAZA 4KHQA 2AQ0A 2NRZA 3ZSZA 5K14A 3C6TA 1UAXA 4Z6DA 4UBBA 4MFAA 1T8EA 1LWEA 2G8FA 4PGYA 1X9MA 1S6QA 3MDAA 4DSEA 4AHRA 2ZJ5A 4R63A 1A5XA 1FKPA 2Z1GA 4IQVA 1SV5A 1C0MA 4OJRA 5C25A 3MFIA 4Z4IA 5DB6A 3I0RA 3HXMA 2OA8A 1S1WA 4J9RA 7ICHA 3LDSA 4R8UA 3VA3A 2OPPA 1WN7A 3NGZA 4BE0A 4DTPA 1T3NA 5DMRA 1QLNA 4Z4EA 1U9LA 3TAPA 2RKIA 4ID5A 2HHSA 5J2IA 4Z4HA 4O3NA 4DU4A 1RT4A 2IMWP 9ICUA 1T7PA 5KG7A 2XCPA 1RTIA 4P4OA 4UAWA 3KHRA 1U45A 1S1XA 1WCLA 5DGAA 2QK9A 4Y1CA 3M9MB 1B43A 4PUOA 4O5EA 4NLNA 4DG1A 4B9MA 2V4RA 4M3XA 3DLRA 3AV9A 1KEJA 2JEFA 4QZAA 7ICMA 2X6NA 5J2CA 1Z26A 5J0OA 5KFVA 2BCVA 2ZUBA 2GBZA 4BE1A 3GILA 8ICSA 5J0TA 1HYVA 2ISOA 4Z6EA 3ZSYA 1HNIA 4RG8A 4FZYA 8ICKA 4FJ7A 1RT2A 2A1RA 1WAFA 3L2VA 3MABA 2OZMA 4CEEA 1MC8A 4CE9A 3CM6A 2BPCA 1ZQYA 1B22A 4CF8A 1IH7A 9ICSA 1ASWA 1C0UA 3QNNA 1ZQWA 3H08A 3LPTA 3FFIA 4CGGA 1PZNA 4CECA 5L1IA 5HHHA 5FROA 1RBUA 3OSNA 3VN5A 4RT3A 3QINA 4YFKA 2BPFA 3QESA 1QTMA 1BPDA 9ICGA 1ZBUA 3LALA 4DOBA 4LH4A 2OZSA 3U3YA 4M6WB 5IIIA 4NLKA 3C2KA 2MAXA 4HUGA 3U3GA 3L3UA 2HMIA 2BGWA 3T1AA 5IIMA 3PY8A 3VQAA 5J2AA 4I27A 4KRFA 4KITB 2HHQA 5SZTA 4IG0A 4ECXA 3RBDA 4I2CA 3CQ8A 4QWDA 3PW0A 1ZYQA 4QZHA 3FYHA 1H38A 2C22A 3JPQA 3VQ6A 4JK1A 9ICWA 7ICOA 3KKRA 4IR9A 2BKEA 8ICJA 3E01A 4QOZB 3C23A 3OYDA 4FJ5A 4CERA 3WNFA 2JEJA 3MFHA 4QWBA 1ZQTA 1UT5A 4F50A 3S3NA 9ICEA 3I0SA 4CK3A 5SWMA 5HMMA 5KRTA 2XRIA 3T5HA 4RW4A 2ASLA 3VQ9A 5J2FA 5KGXA 1TK5A 3K4GA 1BPXA 1RZTA 4M04A 4O44A 1EETA 3RMDA 3MGHA 4W5RA 4KI4A 1RT7A 3KK2A 4RQ5A 4J9KA 2WONA 3LZJA 4FCYA 1WLJA 3G0ZA 4FZZA 5EWGA 2F1HA 4E3SA 3K5OA 2G8VA 4RW6A 3VQ4A 1QS4A 4KB1A 4P2HA 1BPZA 1RDAA 4AHVA 3ZSXA 4QZGA 3V7KA 5KGWA 4B8AB 1BPYA 4M3WA 3PR5B 4CHOA 3AA3A 2VG6A 2LSNA 4DMNA 1DGSA 5CY4A 3TI0A 3RMBA 1NK5A 9ICLA 2ZTDA 3TAQA 2PFNA 3EW9A 3D0PA 4Z4CA 2G8KA 3TAMA 8ICUA 3PX4A 4FJLA 4E7LA 2FBVA 2M9NA 3QEWA 3OYMA 3DI6A 5CWRA 1IG9A 2NUBA 4JWMA 2XY8A 3H4DA 9ICXA 4I2JA 3HP6A 8ICOA 1KFTA 4KLUA 1WSFA 5KFYA 5D46A 1TAUA 4BDPA 4RUCA 1JXEA 4YR2A 4CHQA 1JXLA 2FMQA 1LB2B 4I9QA 3QO9A 3SCXA 1KVCA 2BCSA 3OYIA 2OPQA 4N5SA 5DQHA 1B92A 1SKSA 4KHYA 1REVA 4FXDA 1BVSA 3GV8B 5DKWA 1BCOA 4DLGA 5KRSA 3OS0A 2FMSA 4LZGA 4C8OA 3KLGA 3VQ7A 5J0WA 2P6RA 2W9BB 2ZJAA 2FBXA 2HHWA 3C2MA 2JEIA 7ICLA 4KLDA 5DG7A 3MXMA 2JEGA 3QEIA 4RQ7A 4I2DA 5KG3A 5KFKA 4YR3A 9ICJA 4DEZA 1S0OA 1O1WA 4MFFA 3ETLA 4HCBA 4J9OA 1FKOA 3OYCA 4DFJA 3HWTA 5BOMA 3TARA 2ATLA 4YVZA 1LW0A 4O0JA 4TSXA 4LY7A 5J2HA 3AU6A 2OPSA 3QIOA 1L3UA 4DTNA 4FM1A 3ZDCA 5CJ7A 5L1JA 4C8KA 4ECYA 4J9MA 3VQEA 1A77A 3CG7A 1XHXA 4YMMA 5EWFA 3GV5B 4ZHRA 4DSKA 3B6PA 1N6QA 3BQ0A 2IOCA 3U6FA 3HO1A 1TK0A 2ZUDA 4JRPA 7ICGA 5KFAA 2WOMA 3AA2A 9ICVA 2FMPA 2P51A 4FK4A 3RJEA 1K1SA 2FPMA 2W8KA 1UOCA 8ICYA 3AA5X 5KFBA 4FLVA 3B0XA 2ASDA 1BHLA 5HLFA 2XY5A 3QE9Y 2P5GA 3SUNA 3BQ1A 2JZBB 1S1UA 1RTJA 2C2RA 1IO2A 4FVMA 4FZXC 4B9TA 2OWOA 5D49A 1HRHA 4W5NA 5C5JA 3EZ5A 4F5NA 1ZBFA 1NKEA 3G6YA 3ZD9A 1ZQBA 2X78A 4QZBA 9ICTA 5KFZA 1D8LA 5J2BA 2UVRA 1LAWA 2V9WA 4CIGA 2DFHA 3HYFA 3GIIA 1Z3EB 3RB3A 3OSPA 2W9CB 1S0MA 3PW2A 1DTTA 4J2AA 5TZVA 1VSEA 4DLEA 5KT5A 4LSNA 4F8RA 4JS4A 4KV8A 4QZ8A 3EY1A 4M41A 3RMCA 3C1YA 3ISBA 1VSJA 3AVFA 1L3TA 2Q0ZX 4CEOA 5HNKA 4KLQA 5EU7A 2D5RA 3HJFA 2Y1JA 4JV0A 3MEEA 2A1SA 3Q8LA 2IGIA 3BQTA 1U4BA 4B9SA 3F73A 1JLQA 1NJWA 4NCGA 1A76A 5KFCA 4J2BA 4ECSA 1F21A 4CF9A 8ICMA 3ISDA 4E1NA 4YR0A 3AUOA 2IDOA 3OYAA 8ICAA 4O3RA 3RH5A
chains in the Genus database with same CATH superfamily
2I0XA 3QYYA 1ILYA 3CJKB 2HCFA 2NRRA 5AKKA 1JLBB 4PJ0U 4NLWA 2XSFA 2OYQA 3BO3A 1XMQF 2DNOA 4PG7A 1HPZA 4BHQA 1BWFO 4BWMA 2NLXA 3HPGA 5AQIA 5J1EA 1XR6A 3KMQA 2CGJA 5AZIB 4MLHA 1ZZFA 1N6QB 2W9CA 1V38A 3UXNA 5GIPA 9ICHA 2AA4A 2AYGA 1C7YA 2XLJA 2YTCA 4LIWA 1O51A 1S4EA 3TNVA 2VWJA 1P8ZA 3I5BA 3DLJA 2CZ4A 2A2DA 4WP8A 3J80Y 4JKGA 5DB9A 1KQKA 3VAIA 5F8IA 2R2TA 1WC1A 4CLUA 3R5BA 4CJRA 1X0PA 1VRTB 2OELA 2Q3SA 2PIIA 4CTAA 2F8EX 1CC8A 1NDPA 2VDHA 4EI2A 1NK9A 2DXEA 2AJQA 4KI6A 4WYWA 4OPKA 3JPOA 3RJKA 1URNA 4PHDA 2KFNA 1GQEA 4MF8A 2DR5A 1FDBA 1QQ7A 4B1YB 2CA9A 3SPZA 4IWVA 2MQOA 3WXLA 5ALDA 1DOQA 2WSFC 4FK0A 1XC9A 4OJHA 4DL3A 3T41A 3ILJA 2GMJA 4KB7A 4OLPA 1KL9A 2MPUA 2OJ3A 3DRRB 2B9EA 3ETOA 4YY3J 3I56N 2MGZB 2HVDA 2R7VA 5DDYA 3LDPA 1RBSA 3THPA 2VIXA 3ZT1A 1ZD3A 4JV1A 2NYIA 3GDQA 3BGUA 3KLHB 2ASMA 3I1YA 1EARA 2P9IB 3W9JA 1YT3A 4CZIA 4FYYB 5AQZA 1HUOA 3VCBA 5CB1A 1JIHA 2N7CA 4AXIA 1N5WA 2Y8YA 1ZD2P 1ATNA 5KG4A 1RDBA 4CJFA 3GZFA 4X66K 3CCRN 2GNKA 1OWXA 4JI6F 4B3RK 4OZ1A 5CYMB 1JLCA 4MO4A 1LKYB 3C94A 2E5GA 2LXFA 2JH7A 1ZQCA 1ZQPA 2VQFJ 4NLRA 1RAJA 2LKYA 5JU5A 3AXMA 1V85A 4Y2YA 2IM3A 2EKYA 1JKHA 2HVZA 4CZGA 1NRKA 2CUYA 4LF9F 1A9NB 4UB4A 2WVDA 1RT2B 3TUJC 4IDKA 4RX6A 2UXCJ 3HT0A 1ZBIA 2ZNYA 1U6BA 5HK4A 1DTQB 2E1FA 2RDJA 4EHUA 4ECQA 3IDHA 4ZHRB 4CRJA 1Y7PA 3HSGA 1M5SA 4OLBA 4ACOA 3D2EB 3MGIA 3MPYA 4QU6A 1WC3A 1NHVA 3TA2A 4QW9A 3K2YA 3CC7S 1K8KB 5BPCA 2JLGA 3O4NA 3LGHA 4ZLNA 5GAEP 2F7VA 2Q0RA 3BZCA 4QYRA 5CYJA 1COOA 1X9JA 5JUMA 4ZIWA 3BR9A 2OCEA 1M90T 2CQIA 2EZYA 2E1RA 4DCCA 3WQPA 1HYSB 1JLAB 3VF6A 4V19X 1IKWA 1RTIB 3F9KA 5CH7B 2VC1A 1OYEA 2YMQA 5AHXA 4B08A 3OS1A 3QAEA 1C1BA 1T95A 2ZKTA 2HVIA 3TA1A 2XMVA 4BRKA 1HBOB 3KJVA 3D6RA 5JVHQ 4EENA 2XBPA 3HZGA 1NNDA 3L8BA 2KKHA 3D67A 2MLYA 4I6YA 3OVSA 4DI6A 1EX4A 2NXNA 4NMLA 3K17A 4DTUA 3C14B 3D45A 4QIWD 2ZGZA 5A8RA 4B3TF 4BRMA 4WFAL 1MROB 1WEXA 1JJ2M 1BCMA 1JMTA 5AIAA 3AQEA 2P2CB 4FS2A 2V7ZA 2UXBK 4L3NA 1TL1B 2E5IA 1KD1O 2MTLA 4FM2A 3QUCA 1KQSR 5FLXY 5M1KA 2GH1A 4DR3J 2KJVA 3OTCA 4M0AA 2QL5B 3KDOA 4GLXA 2FZKB 4DCOB 3V1RA 3HZEA 4N8OA 1FDDA 4YB1P 4H5RA 1ZOLA 2YKQA 1VC0A 2J4RA 3CC2N 2H3IA 2AKWB 2OEHA 3KLFB 3V4MA 1FDAA 3CCQS 3ICLA 1HKAA 4X64K 5HL7L 3I5CA 2ZJRL 1Z2LA 2ZITA 3FZ2A 1S72S 3QT8A 3C2LA 1IKXB 2M7SA 3MPDA 3L3FX 3THXB 2NREA 2NSBA 3VWSA 4BRHA 1HBNB 3RJHA 1AT1B 1HBMA 2Z1JA 3QGGA 3MM8B 4FSVA 1NPPA 1E4FT 2VGMA 2QN6B 4RWTA 1K6YA 4BGDA 1FRJA 2DPJA 3A0HU 4CO2A 4H5TA 4Y2SA 3FBCA 4NMXA 1UWAA 4UQGA 4R65A 3DLLQ 1MWQA 4BR4A 4JWNA 2NUHA 3ET6B 1VMBA 1I3AA 1KLNA 2ZWPA 4M63C 5M1PA 3BZQA 4BWJA 2HHUA 3MOJB 1F2HA 3KWGA 3QBXA 1HQEA 2I2YA 4YMOA 2AEJA 2ETJA 4NCBA 4DB3A 4IR1A 2RE1A 4DV6F 4RQ8A 2K4IA 1VSHA 5HRNA 4RL1A 3ZCMA 4CO5A 3B82A 2VH7A 4I56A 3K1RB 2CWKA 1F3FA 4KHPF 1RCOB 4K0KK 1U8WA 3P6YC 3IN5A 4Y2JA 3DRSA 2DL0A 2AQ4A 2B4JA 1TFYA 2KHVA 4JI5F 4JI8J 1JCEA 4DPXA 4NLTA 3KKAC 4LQ3A 3JB9k 1PVPA 3P49B 2K4EA 2LBOA 4BC5A 2KZ3A 3I4PA 2B56A 4WP3A 5D3GA 4FW2A 2F77X 1IBLJ 3TABA 8ICBA 4K4UA 2W9AA 4OHZA 1W9HA 4LFCJ 4OZ0A 2J7KA 1FRLA 3K57A 1C6VA 2OH2A 1NAQA 1GLJO 3FQKA 1G4CA 4GIBA 4UB5A 4EFHA 3WK7A 2KM8B 4JI4F 1WF1A 1NJZA 3CJ8A 3NS1A 3V9SA 2O4GA 2DXFA 2CQ2A 1TKXB 5KFEA 4PWUA 2YNGA 2QV6A 3VZHA 1RWWB 2AYMA 1QM9A 1QQMA 4R8UB 4YB5A 4FWKA 2QA4G 3NVWA 4HUFA 2E2NA 1VQ7S 4WYLA 3D54A 4M1KA 4QCLA 2ZIWB 3MI7X 3O9QA 4ZOHC 1VQPN 2ITGA 4LIRA 1U1OA 3DYAA 2VDIA 3A2FA 3IV6A 2VBZA 2HZVA 3ZETB 5DB8A 1IBLF 2M52A 4E0DA 1IBKK 3V9ZA 2DY4A 3G86A 2E2OA 1ZQRA 2DQNB 1ZQFA 1N5YB 2J9CA 1BMQB 1U1QA 3VEXA 4JI5J 2BMBA 5AKEA 3K58A 2R7WA 3AVGA 4FYDA 4NYZA 1L7NA 2ALYB 2DJWA 2HNYA 1T9VA 1AYEA 3WKDA 5C25B 4OHVA 3LP1B 4ZVFA 2EQYA 2YX4A 4QWEA 4KFBA 3RJGA 3WIUA 3HHLD 3M6XA 3LVVA 5THWA 5AXKA 4JI7F 4CGJA 4CIFA 3CSKA 4ED3A 2BE2A 1QUPA 2G07A 3OR1B 4CESA 2DGWA 4LF5K 3V9XA 2V2ZA 1LFWA 2DGXA 4HACA 3LYSA 2UUBF 2V5HG 3WNEA 2XI9A 4YNQA 2F4VJ 2RD5C 4LRAA 1VQLS 2H51B 2ZIXB 2PAVA 2DGOA 2I8EA 4CF2A 4MIBA 1U09A 4DU3A 4RQ1A 5KG2A 2LFVA 1F9EB 1JX4A 3QU9A 3ZNJ1 2WMMA 4FBUA 4ISFA 1ECWA 2C3MA 2KHCA 5KG0A 3V6HA 3N4WA 4FNIA 4PQUB 3GPAA 4EZ6A 2FDRA 1N5YA 1YJWN 4LRDA 4I9LA 4H4KC 1PCAA 1VBZA 3PM9A 2D0OA 3THWB 3NS7B 2FBYA 1QCKA 4EBCA 3LQVA 2EG2A 4QR1A 1UW4A 4RQ6A 3CEDA 2O6KA 3PRBA 3IFRA 5J2DA 4ELUA 4UY8T 3TRGA 4YOEA 2PBDA 1Y4ZB 4K4HA 3C5FA 4KLHA 1FIQA 9ICMA 3BKTA 3FC4A 4ED0A 1UZHA 2EK6A 1WKLA 1ZQZA 5IV3A 3DLEA 4KLFA 5KG1A 4CF1A 4LBIA 4UB2A 2F65A 2HHVA 4ECTA 1ZQMA 5FJ4A 2HFOA 4KHMA 2ATQA 2VL1A 4NY8A 4K8ZA 2W04A 5KFJA 2R7YA 1Z1ZA 3CCLN 1HMVA 4CM2A 3KUHA 2HQIA 4IKFA 1YRUA 3M30A 2A2CA 2XZTB 2FJDB 2MKCA 4W5OA 4OPHA 1SJRA 4NYFA 2P1JA 1RT6A 4NXZA 4WQ5C 2Y9TA 3HHLA 2KIVA 3GG0A 3OS2A 4WTOB 4C8LA 1HNWJ 2G0AA 3R9LA 4DL7A 4JB8B 3CCSS 1Y3JA 3LP3A 4FWOA 1Q8BA 3H7HB 3RVCA 5KAIU 3BPDA 1PBAA 3HX0A 1RISA 3AJDA 4XDDA 4EBDA 4AILC 4ZN3A 2CQ1A 3RR7A 3N4PA 2VKZG 2P66A 1XK8A 2ZJ8A 3WC2A 3FEYB 3EZUA 3WT0A 3LDNA 1YRTA 3KHGA 2LPEA 1ZC6A 4KHPJ 3CCES 4ANDA 3G71S 2OUGA 2NXJA 1VRUA 2ODGA 1J9AA 3CF5L 1U7LA 4OCZA 3KJFB 2ZG6A 5DQIA 1UT8A 2OPSB 3SXLA 3S8SA 1B7FA 3B8AX 4LJMA 2CIMA 3QIPA 1IVZA 2RDDA 5AQNA 2HK2A 1MN9A 1TKZB 4E2FB 1VQPS 1RT6B 4DTJA 1IKXA 5BR8J 2A42A 3MMAA 3Q86A 3UPQA 1G7CB 3WDOA 2Z2LA 3CPWR 4YOVA 1VI7A 2OSQA 1VBKA 3QT5A 5C2GA 2ZQBA 4DX6A 1EP4A 5HOOA 1Q1KA 2HRTA 1RA6A 4FJKA 1Z4OA 4LF9J 4JYAF 4JI2J 1J5EK 3UO0A 1N56A 4H0XB 4ZLPA 4US9A 9ICPA 3TQ1A 4OLAA 2CJXB 3CFOA 3ET6A 4DV0K 2ZBRA 5F1XA 2QB0B 3NGRA 5AR0A 3RB0A 1IJJA 5MLCQ 4J91A 2F44A 3M8QB 3O3GA 2YY3A 4C11B 2JWNA 2HHXA 1W97L 2WW4A 2LQ8A 1HKCA 2NXCA 4WCEQ 2KL8A 2KG5A 5D4BA 1YIJN 5IINA 1YG0A 2FSJA 3LDAA 4DR7K 3CJ0A 2CPZA 4L3QA 4NXNJ 3MR6A 2M9KA 1YTAA 1N62A 3RW7A 3NGDA 1S0VA 4DS4A 5C12A 4RW9A 4UW9A 1M5VC 4AHCA 4LR9A 2I7NA 4ECVA 1YJUA 5TKWA 2F8TA 2R7RA 4M9LA 2V68A 3C6UA 4KHUA 2O8DB 3VEVA 4WFBL 6AT1B 1URRA 4DV6K 2A41A 4IRKA 2GIQA 1U04A 3AVAA 4CJ5A 1BL3A 3CXCM 3OYBA 1H72C 2YX8A 4H4OB 4M5KA 4H0TB 4KHNA 1K0TA 4Q44A 4X2BA 5ALYA 1GO3F 1N5VA 3HRDD 4MIAA 3VGVA 3P5BP 1KVKA 2QLFB 3J7AP 4U95A 3NMRA 2V9KA 1Q3VA 1NBEB 4QYZK 5KFXA 3NRBA 1Z00A 2J9EA 5GAHU 2ZEJA 4IJNA 4PPXA 5LM7E 1RBRA 4RTFD 5FLXO 4WE1B 1H6KX 3AA4A 1JB0C 3H7IA 4DFMA 4RNMA 3CJBA 1S1TA 4P4PA 3EGNA 4ZP6A 5B0CA 3T5LA 4LFAK 2QX0A 3M9NB 3F44A 4MKAA 1NKBA 4X64F 5HRRA 2RDIA 4HUEA 3DOMA 1PJ7A 2H3QA 4JMUA 3VQDA 2OD6A 2EEYA 1FRKA 1CQNA 2FLOA 4DV1J 3OLBA 4MFBA 2FF3B 5B66U 5HVHA 4OL8A 4PY5A 1H2TZ 3C6HA 2YNGB 3X3UA 8ICTA 1XMQJ 1BGXT 3D0GE 3OTOF 3RRGA 3DU5A 3CP8A 5ALKA 4Z2XA 3M6VA 4HCCA 2YHBA 1FE4A 4XIUA 1WAJA 2DHHA 4IG3A 4AF1A 2WBRA 3K59A 4YHHK 2DTUA 5CYQA 2RQCA 1ZQXA 4Y2QA 2QTDA 5IS2A 3DLKA 2Q3PA 4KGVB 1VS3A 4EK2A 3DAWA 2L9DA 3W5YA 3JQJA 4IQUA 2RHKA 1F5BA 2B5JA 1TKDA 4L6V3 2KHOA 1OH6A 1HBOA 4R25A 1ZQJA 1FCAA 5ETQA 3KK2B 2KKVA 1KCFA 4DCHA 3CC2S 1D09B 2OXOA 1YZ6A 1UCVA 4PG8A 1B0TA 4PL8A 2AEFA 4KGZB 2ZJRQ 2V8PA 3H20A 3N0VA 1G15A 1FESA 1X2IA 2HQ3A 4ZA1A 3CMES 2ZHAA 1SQEA 1CEZA 1R6YA 1FNMA 1VQON 4CEQA 3SPYA 1ZXIA 1VQSA 4YDUA 5AFUA 3ATVA 4G1IA 4NLGA 1S3XA 2IHNA 4RBVA 3LWMA 2G1DA 4GXJA 1V4SA 3VTHA 1LAVA 3JSYA 2UUCF 4YD1A 3A4TA 4EYHB 4K7QA 1RE1B 4OYWA 1M5KC 2X74A 5FPNA 2D6FC 2A3JA 2BGGA 1N48A 1S1WB 4X4TA 5GAHP 4LF6J 2CZVC 2DR9A 1XNQF 5KQ8A 2PEBA 3T5JA 4KN4A 3GR1A 1JJ2R 3ZTRA 3IO1A 4LF5F 3SCIE 2WONB 2J6UA 1OQ3A 5AE1A 4CJTA 1IXRA 5J29A 3AO4A 4G6VB 4KC5A 1T9UA 2UV8G 4ELVA 4OX9J 2MSSA 2YWHA 3OR2A 2DR7A 3ZSQA 3N6LA 4UB1A 3SCKE 5ALWA 1X6JA 3MDFA 1LNQA 4M95A 3GV7B 1GK8A 4ATNA 1XI1A 4N76A 3AMZA 4EYIB 4USAA 4J9SA 2F8MA 3ZEUB 1XNRF 2D69A 4PYAA 2XS2A 1C20A 4NLQA 3HOTA 7ICSA 2Q79A 3U7JA 5HROA 1MW7A 1L6NA 4O5CA 5D4OA 2K1RB 5I3QA 3KG0A 2XO6A 2HSTA 1EQ0A 1S6OA 3GOIA 2IYGA 3LP2A 3EGVA 1S57A 1L8LA 1ZD4A 1T11A 4DL5A 4DV7J 2CXYA 4CF3A 3EX7B 3GIJA 4MK8A 3V7LA 2KZMA 2VYPA 4CF0A 2KU7A 3QUBA 3Q8QB 1D3WA 2YKAA 3T19A 3VQCA 2QFIA 1KBRA 4AHSA 1RM6C 2C2NA 1KQGB 4ERDA 1EQMA 1F9HA 5DDOC 4EP5A 1X0FA 4RPYA 2X1BA 5FDLA 3NS5A 5CR4A 3ZSRA 4I6MB 3PYDA 4RR5A 2QL9B 4N56A 3UIQA 5CAAA 4CZFA 1IBKJ 2GIRA 3ALYA 3SAFA 7AT1B 1GLEG 2V8VA 4DDFA 2XTJP 4PZNA 2H3GX 3UN2A 4IOCL 3B4DA 2ZH7A 4ZCLA 3N7RC 2ASPA 1HNVB 1WG5A 3H2LA 3C8YA 1PJ6A 4F2SA 4C3LA 4M5NA 5J2MA 1JL2A 1RHRB 1S72N 4KHPK 2VPZB 4LRCA 4B1ZA 3J7ZO 4UZBA 4YCXA 1CULB 4M9HA 1Q86T 2RF2A 3SMVA 3ZDBA 3ORYA 4C1NI 3K8VA 3C14A 2BX6A 1FRHA 2JDJA 4UBCA 3E2EA 3CCWA 2IOFA 3L7PA 2W8LA 2B8QA 4AD6A 1L8OA 3A8EA 2K3IA 3O9RA 4KB0A 3HKZD 4A8OA 1VQYA 3NRWA 2KHQA 2DGUA 3E8OA 4F5OA 2F8KA 3E3XA 4E98A 4EX7A 4FF3A 3OTEA 1M1GA 2JZBA 4DR4F 5C2DA 5F9LA 4DOZA 1LWXA 2WB1F 2XMKA 1HX1A 2HNYB 2HNDA 3LTOA 4EP4A 1QQ6A 2QA4N 3TVYA 4F4ZA 4HEA9 4PUOB 2EFOA 5JLFA 2WK4A 4ZIVA 1BY9A 1GTEA 1IKYA 1T9TA 4Q5VA 4ETXA 2GEMA 1BNOA 2FHJA 7ICKA 1SUQA 2KVCA 1R8AA 2XY7A 3ULDA 2FY8A 3OL7A 3SJHA 2OPRA 3E9PA 2ALZA 3PIOL 2MEWA 5IC6B 4WKYA 4FJGA 4USJC 4RJVA 3ZTQA 2VGNA 2B0CA 1WHYA 3IM1A 1NWKA 3PO5A 2WRMA 4Y3CA 5LMUK 4I2PA 4OHXA 2Y8WA 4QNLA 4BQLA 1VJWA 4S0MA 4J9LA 4JI0F 4IQTA 4DUZK 1WOQA 4KREA 1RXVA 2G5IB 4NXNK 3M2RB 3KHHA 4DTRA 4LFBJ 3UMCA 3GMGA 1XSNA 1YJ9N 2B9WA 1QUVA 2DISA 2RB7A 4OV1A 1UVKA 3LP1A 5AQUA 1VSKA 1U2RA 4E1MA 4MTPA 4YS2A 4ISEA 1QVFM 1H7WA 4OV6A 1MN8A 2XSJA 4IO9L 4LMZA 4FKYA 2QEXS 1L7MA 4ZH4A 3SDEA 3IP0A 2XLIA 5HQ8A 3MM5A 1TKZA 2L3MA 2LEBA 3DOKB 4JHDB 1N63A 4ES2A 3OPXA 3LAKA 2ASJA 1TZ0A 4FLWA 5E0OA 4X66J 2P9UB 1QVGR 3QB0A 2ACYA 3QERA 5ALTA 2D74B 1X5PA 2XY6A 4UAZA 3MEKA 2Q1LA 1UAXA 3HBTA 4MFAA 2LLZA 1LWEA 3J7ZT 2G8FA 3V2UC 3WEEB 2B4VA 5BN9A 1HWIA 1RQLA 3OBWA 3MEEB 4ZLLA 3CETA 3MDAA 2WVCA 4AHRA 4URSA 4K4ZA 3M2VB 3M1VA 1FO1A 3F53A 2FDNA 1FKPA 3GL1A 4IQVA 2VQEK 3WQTA 4DUYF 4B3OB 3I0RA 3UE5A 3QRRA 3UCZP 4PCQA 1S1WA 4J9RA 3CCVN 3FSXA 2HLUA 8AT1B 3CC4N 1GLBG 1T3NA 5DMRA 3K1ZA 1QLNA 3PZPA 2FVQA 1K8AT 4K43A 4CRXA 3TAPA 4JI8F 2HHSA 2V94A 5J2IA 3BO4A 2RU3A 1DXSA 2M8HA 4O3NA 4DU4A 1RT4A 1RHKB 4F0HA 3VV2B 4UAWA 3IUCA 1QJHA 1U45A 2B3TB 2P5VA 4TNOA 4C4WA 1VJQA 1B43A 1UW9A 2WW8A 4PUOA 4JD2B 2R4FA 2V8GA 3R8EA 2H9ZA 4L74A 2Y0SF 3MMJA 4B3MF 2AX1A 2P9NA 2V4RA 2CNOB 1KEJA 2JEFA 2K7JA 2RLTA 1P9QC 4O4GB 2MKIA 4TKTA 3O4WA 5J2CA 1XR7A 5B5EU 1CQMA 2KXFA 4MAKA 2ZUBA 1HYVA 1VQ5S 5GMDA 3Q8VA 2RUGA 5ALGA 3ZSYA 4JV5J 1RBOB 2P9KA 1IN0A 3SSQA 5JVHL 4ILGB 4WJ3B 2D8CA 2M2BA 1WAFA 4OYXA 3MABA 1GT8A 2EXUA 4CVNE 2HHHK 2J0WA 2XMJA 4M5IA 2VQFF 3I9ZA 2PMHA 4U67Q 3TACB 2RP5A 3WK4A 1W2BR 2KKPA 3AEVA 1N5TA 3D2SA 2ZC4A 4DV5F 2HBQB 5FROA 4OJGA 4BRGA 3OSNA 4BVPA 3VN5A 4CIOA 1VLOA 4L73A 3NGKA 3ONQA 1VBYA 1R3NA 1ICEB 1U1LA 4LH4A 3OVAA 2OZSA 2AV5A 3BB5A 1AFJA 4NLKA 3QFUA 4HUGA 5DETA 2YWEA 3UWTA 2L48A 3W8PA 1GLLO 2BGWA 5IIMA 3HX9A 1M1KT 2YQ3A 4GMKA 2ZIUB 5J2AA 1PYOB 1VQ8N 2AJ4A 5SZTA 1SJ3P 4ECXA 2FJAB 4I2CA 4QWDA 3MCOA 2BE2B 3IG8A 4QZHA 3PSPA 3FYHA 2QLWA 5LMUF 1U24A 2C22A 2D0PA 3JPQA 4C4RA 2DXDA 3VQ6A 4K4WA 4Y28C 1KONA 4U6PA 4BBYA 5JMNA 2NCKL 3ZEUA 3E01A 2J0QD 3ULHA 3R6MA 4FXWA 4CERA 4CT8A 2ZZMA 4F50A 2KT2A 3DLKB 4CH0S 5HROB 2W2MP 9ICEA 4CK3A 4LRFA 1NSQA 5KRTA 2XRIA 3T5HA 4NL9A 2E8MA 3CD7A 4JN4A 2ASLA 3FCVA 3VQ9A 3C6AA 3CCMN 1QY7A 1RZTA 5GAGP 2DK2A 5JVGL 1EETA 4MHVA 3GCWP 1RTHB 5JXSA 4MIWA 3FBFA 5A2QY 3RSEA 4DN9A 4UUWA 3CWJA 3KZBA 1DK3A 3PDNA 1Y9OA 1QS4A 4KB1A 5EY4A 5ETSA 4AHVA 2D9OA 1FDNA 2RMLA 1VHFA 4BG9A 5AM1A 3DKDA 3PR5B 1U26A 4BGBA 3VEYA 5CY4A 4DX7A 1NK5A 1UFWA 2BUNA 1PBUA 5H2FU 4Z4CA 3TAMA 8ICUA 1TL3B 2M9NA 2ZM6K 5CWRA 2IBOA 3WXJA 2VODA 4JWMA 5GADU 2DH9A 3SBGA 1KOOA 4PRFA 3SD7A 3H4DA 1KFTA 1PVQA 4KLUA 4CNQA 3J7AN 5F2RA 5KFYA 1TAUA 2ZBQA 4BDPA 1IR2A 3TVZA 2V51B 2KLAA 2CJKA 3GP9A 4F26A 2B0GA 1I5OB 4FN5A 2BM0A 2WVEA 1X6IA 3SCXA 2CJQA 4L75A 1HNZF 1ULRA 3KK3B 2HOEA 3OYIA 3T79A 1UVMA 3VTIA 2CPIA 4N5SA 3O1WA 4OZ2A 1B92A 5AQMA 3KOOA 4KHYA 1REVA 3RJMB 2E7VA 1K73O 3H2UB 4DLGA 4ED4A 1PGZA 5KRSA 4LZGA 4C8OA 3R6LB 1HR0J 3KLGA 4DCJB 2ZJAA 4GVEA 4CZKA 2O8BA 2JEIA 4KLDA 2RQ4A 4ZJOA 2JEGA 5F3XB 4RQ7A 2ASOA 3QEIA 2R7QA 5AM0A 5KG3A 5KFKA 4YR3A 9ICJA 4DEZA 1IR1A 1JXVA 2DITA 2JSXA 1O1WA 2IVFB 2WTUA 2ZH5A 4Y2VA 3MMCA 2NO4A 1KQSM 3HWTA 3AXKA 4OO1J 3D68A 5AQFA 4TXSA 2EFPA 2JL9A 3MD3A 4TSXA 4LVNP 4WP9A 1VQNN 3QIOA 3HSCA 2EFQA 4FM1A 4C8KA 2E5JA 4X4OA 2R7SA 4J9MA 4DV5J 3CG7A 2YQ0A 4USWA 5EWFA 1BNPA 2VFVA 4K5RA 1T05B 4ZHRA 4FF2A 3QNMA 5M1QA 4ISGA 2L9WA 3I0RB 1Z19A 4DV2J 3HO1A 1RTDB 1WF0A 4WFZA 7ICGA 2MA1A 5KFAA 2KJWA 3AA2A 4ZP8A 1B64A 2FMPA 4OQJA 3OTOJ 1K1SA 2FPMA 1MLAA 2UXCK 2E9ZA 4KJIA 3ITHB 4DR5J 2NV3A 4JI7K 2ASDA 5ALIA 3T69A 1KR4A 4P0QA 2C2RA 3KLEB 3AM9A 1IKWB 2W43A 1WKJA 3UI3A 1U1MA 5GAHI 2DNRA 2OWOA 5E3RA 1KEKA 4CO1A 2I38A 4X64J 3D2FA 4QZBA 1D8LA 5B7WA 3MM5B 2UVRA 1LAWA 2UUCK 2LMRA 3MN9A 1UETA 4KX3A 2DFHA 2RIJA 1RGIA 1FFUA 3HYFA 2HLTA 4IQXA 2AEMA 3GIIA 2D1CA 3QGHA 4FKXA 4IKAA 3HHEA 3HTVA 3PW2A 1DTTA 2ERRA 4U8VA 5AK3A 1N33F 5TZVA 2NPFA 4PG5A 2BYCA 4RW7B 1R31A 2MKHA 3CIPA 4DR1K 2BOAA 5D0HA 4M41A 4ZP9A 3RMCA 2E8NA 3K89A 5FP0A 4KLQA 5LMNK 3HJFA 1KW4A 1SCJB 3MEEA 4M5JA 3RF9A 4FPBA 5IXUA 3J81U 1U4BA 3UVJB 2MQNA 5AXLA 3HVAA 1RT5B 1ZBSA 3O6QA 5KFCA 2GTDA 4CTAB 2WF6A 2YVSA 4YR0A 2IDOA 1S59A 1S9GB 4RUBA 2GX8A 3CXCR 2CPHA 4RQNA 4CGZA 8ICHA 2AF6A 1DJ0A 5KFNA 2BQ3A 2JGUA 1JMSA 4OZ5A 4CH1A 4HTIA 1D9AA 3F5AA 1CVJA 2VASA 3LM9A 4WE1A 3JPTA 4BRAA 4CGDA 1ZQDA 1YTYA 2GVZA 2OMLA 1KAYA 4DFPA 4DR5K 2MSTA 1ZETA 4F25A 4CFAA 4G9ZA 4LREA 3OFEA 3BSAA 1TFRA 1RWUA 3WK9A 2YKMA 3ZTSA 5CCLA 3LF0A 5DZ6A 2DRDA 3C2PA 1XERA 3ZO7A 1B3TA 3QU4A 2GQ2A 3UN3A 7ICNA 3HK2A 4WIQA 3I32A 4DV0F 3G2XA 3JYTA 2DGZA 4OI0A 4U7CA 1UWBA 5J2MB 1Q95G 4C4SA 1BC6A 2E1PA 1CJTA 1TTHB 4JYAK 2OIHA 2BKOA 3L4QA 4NL5A 1RTDA 1HBUB 5M1NA 2XSJB 2GWJA 5KT3A 1TL7A 1YTUA 3QIPB 2DNKA 3NGTA 2M88A 1R27B 3RZAA 3CO9A 4USUA 5KFSA 2XI3A 3SQGB 1U48A 2BCQA 3MMAB 3QU2A 4I6WA 4AP9A 4CHNA 4G9BA 3L9ZA 5E3PA 4P0QB 4NCGB 2Z1IA 3L4BC 3CJRA 2O1PA 1SQFA 3JXUA 2P8IA 1SC6A 2M70A 3WNHA 3ENQA 1VRUB 3ENAA 3MN7A 4F3TA 1N5QA 2N82B 3EDQB 1WORA 2K3KA 4ID8A 5KPZA 5F0UA 3PSIA 3KLHA 5AXMA 4PHEA 5DJBA 4DUYK 1XIQA 3QSIA 2A1AA 3ETMA 4HTJA 4E89A 1LVHA 4Z7YA 1NXIA 4PPDA 3ZT3A 2HS4A 3D4JA 4GY2B 3AVNA 2F7TA 1FWPA 1KLMB 1KDHA 3VETA 4NRTA 4CZLA 2MUTA 2OGUA 3O8MA 3MM9B 4J9PA 4NLUA 3PJWA 1CPZA 3OUYB 2RPIA 3DOKA 5J0YA 3P3DA 5AQXA 3B6BA 3CCTA 2RT3A 3TA0A 2GJFA 4OIXA 4EUVA 3KK1A 4DTMA 3EJMA 1A0OB 1JLAA 4DV3K 8ICLA 4X65F 1HIYA 3PJXA 4FM0A 2ROPA 2I1QA 2BJ8A 1U1NA 3KKSA 1S1VB 2GVDB 1ZPWX 3EE8A 4UOFA 3DDIA 3U1MA 2D3OR 1GTHA 5AFUH 2OAUA 2HBJA 1IM6A 3DN9A 3F9MA 3WK6A 1N8RT 3BGOP 2BVZA 3DNCA 3H1QA 8ATCB 3MM6B 2QLJB 4FWMA 2YJFA 1D9DA 3H8WA 5CXTA 3RH6A 1K5OA 3HT3A 2SXLA 2GVZB 2JWLA 3DWLA 5BR8F 1KDNA 3P4UB 3QFWA 5JVGQ 5IT9O 4WBFA 4FWQA 5J0XA 3CGIA 4DUZF 2EH9A 4F92B 8ICVA 1T3OA 1RACB 1YITS 3NFAA 4DG1B 1WHXA 2AGOA 3MM7B 1NGDA 2B7BB 2EAMA 2VPYB 1ZH5A 4WFAQ 1TUVA 3DHXA 2F1IA 3HULA 4BR5A 2WF7A 1LXNA 3ZT0A 5AI4A 3PTWA 4F3OA 1OVQA 4F4KA 3V7JA 3ILOA 4A8QA 1PSDA 4IFYA 2VJ4A 1QHAA 4OJOA 3KLFA 1NJIT 1UA0A 2A6OA 3TADA 5HAOA 4PHTX 4UOHA 4RNFA 1OUQA 2O01C 1FEHA 3C95A 4JB3A 1DEJA 3MXHP 5H9FK 1MWYA 3Q8UA 3GG4A 2WFBA 2GJIA 4LF7F 1L7PA 1HYZA 2HVHA 3AVCA 2UUBJ 1RT4B 4P7TA 1VJ5A 2J8AA 4UZCA 2E66A 1N5SA 3IR6B 2GMLA 5ADZA 4CLKA 2P9PB 3H45C 3P31A 1D4XA 5AQTA 5I3PA 4B3RF 3KOAA 1W0HA 1D8BA 2QI2A 1DQ8A 1N32K 4QWAA 2GO7A 1E6YB 5CQGA 2FPKA 5J2JA 2XHWA 1J2VA 4LT6A 5KQDA 2F96A 7ICJA 4FBTA 4ZVEA 5CZVA 1LKYA 1SV5B 4CEDA 3NH2A 1E6VB 5KT2A 1RT1A 4CZHA 2G8IA 4K4GA 5ETRA 3NWRA 3HD1A 2XEXA 3O5BA 4BXOA 3MM9A 3SCLE 1XMBA 4RQ4A 3HI0A 2DHGA 2YWWA 1X31C 3W62A 5GAEI 5J0UA 3S01A 4I2HA 4J9UE 4NO7A 1VGYA 2AH5A 1OQ6A 2RQ5A 3VVTA 3VEZA 3EICA 2KHDA 1YJ7A 4AXJA 1ZQIA 1BIZA 1SH0A 3FUYA 2B6AB 4NA3A 3S1TA 3DLBA 3PMNA 3CULA 4JI0J 4DU1A 4CEBA 2FQQB 1SC1B 5K8NA 1LOUA 3TSQA 3CPWM 1GEHA 4DJBA 4YFUA 2QMWA 2FLNA 2OLWA 3L7UA 3TUPA 2CGLA 1I94F 1QZ6A 3BSOA 3NOCA 3TUZC 3C3LA 2GV1A 4F5PA 2DCLA 4A8YA 3QEVA 1GXUA 5ALRA 4OX6A 3BDPA 1NM2A 1YI2S 3RMAA 4IQMA 5H1SQ 2ZH8A 4Z6CA 2GHPA 4FJMA 2DHXA 3D6HB 2K06A 2CDRB 4BG8A 3CCMS 2QC3A 1IXKA 3PV8A 3CHWA 1NZ8A 2P9UA 1DTTB 3NE6A 2OHDA 1RKJA 2XYHB 3LH2S 4RCHA 2JZ5A 3AD9C 4QZEA 3MEGA 3B54A 2D3UA 2Q4TA 3AO3A 1R0BG 4MK9A 5A8RB 1QQOA 4KHRA 4BR0A 3CW2C 3EXCX 2Q6CA 3AVIA 3GIMA 1ZPVA 1HNWF 4I2EA 4H54A 5GAEU 1C1AA 5G5HA 2HBMA 2MZQA 4H0YB 1HD0A 3HLUA 2LU2A 1HI0P 1NHKL 1TL3A 4FO6A 4I2BA 1UPPA 2O8FA 3F2KA 4EAHD 1ESVA 2WC9A 4Y2KA 2WVFA 1RAGB 2DFLA 5AQRA 1PUZA 2P9PA 4TURA 4P2MA 3HOSA 5CEHA 1RWVB 1KKHA 1JLBA 3AD7C 2H5EA 1Q81T 3ZTPA 1VQMN 2C42A 4HAIA 1V5VA 3TANA 1C2PA 4R79A 3OYHA 8ICQA 5FIIA 4L76A 3FRZA 3TW0A 3MAAB 2OM6A 5CZXA 3MN5A 7ICQA 3HM8A 2JXJA 2RHFA 4B3SJ 4X4SA 4CJ4A 1RI7A 2KXHA 3RUBL 3KTQA 2ZJQL 3MR3A 2R8IA 1EJ7L 3OVBA 2G2YA 4B9QA 4WPAA 3DXKA 4KTWA 2J9DE 2FHOB 1MWMA 3DLEB 3SZ2A 4OJ3A 2J76E 2GC8A 1N32J 1CJTB 4KPYA 5EOZA 2YHWA 3GG1A 4PYDA 1FXXA 1C1CB 3IRXB 3CD0A 1MMDA 2Q97A 5I42A 5GMEA 2R42A 5ETPA 4X62J 3H0MB 1X1PA 5C42A 3RAQA 5DM6Q 1UJ5A 2ROGA 2ABYA 5KFWA 4I2GA 4IUFA 3N5FA 2EWSA 2FGOA 4ZVHA 3IDWA 4CWBA 3BBCA 8ICEA 3AB2B 3ZLJA 3HHLB 4PKDB 3VEWA 4EO8A 2DPNA 2ZGYA 4M3YA 1V9OA 2A1BA 3KK1B 3C7NA 2HHHF 2MQMA 2E29A 2D3DA 5CYQB 3EZOA 1KFSA 3NY0A 4TYBA 4JI7J 5L38A 1HNVA 3NGSA 2DNZA 1X4GA 1AZSB 4Y6IA 1YK9A 4QR2A 1SZPA 3TSPA 4F4XA 4ECWA 2HNDB 1GMWD 4LR8A 2FD2A 4ECZA 5CZ1A 3DC2A 5ALXA 3CT9A 2EZXA 2QL7B 1G2EA 4BCAA 4F4AA 1NEEA 2PC6A 1JQGA 3VF2A 3SBMA 1PAEX 2HIYA 2DTJA 3VQPA 5BRDA 3EKUA 3JS9A 5DM7Q 3GU0A 2XULA 2CH5A 1A5VA 1J54A 3GFZA 2HBZB 2Z57B 3NHGA 2DHAA 5L9NA 2QWMA 3WZ0A 2PDAA 4AE5A 2XGQA 5KAFU 2HZAA 4BC7A 5F8NA 3FBBA 4B3TJ 2PA3A 4IH6A 3DJCA 4GC6A 4KLEA 2FF6A 1RT3A 1K73T 7ICEA 1SL1A 2J7WA 3TWHA 1D1UA 1Q53A 3IG5A 4JI6K 2NS1B 4AYBC 8ICPA 4FF4A 4BC2A 3PRDA 4OI2A 1L5UA 3GR0A 2HQDA 2NUUG 2OPQB 1H73A 4NLZA 1QE1A 1Q8LA 5KL8B 2AX0A 5ALFA 1HA1A 4C0OC 3A5MC 3BS7A 2NO5A 2CNLB 4ZKAA 2VG7A 3BZKA 3L2QA 5DB7A 3R7SB 2FJXA 1K8KA 1Y88A 5CCMA 1T03B 1AUDA 4J7CA 2DPIA 1H74A 2BHNA 1WDDA 3V4IA 5M1OA 1WUDA 2F4FA 4OGEA 4CEFA 3MM7A 4FOEA 1J5OA 2F1JA 3R9KA 2GS8A 4KAIA 3C16B 5IC4B 1T02A 1U02A 2PFDA 2CQHA 2FB0A 4BRQA 1DHMA 1FFVA 3U1LA 3V1QA 3ZSOA 3O2IA 1WG4A 2W7AA 1X5SA 3N4QA 3UKRB 2RHSB 2B6AA 3QBWA 2HAIA 4K42A 1HIWA 1NKCA 1NDLA 2G0JA 1H2UX 1D5AA 4CO0A 3CMAN 1GOBA 1BLUA 3DHWC 3QPIA 1J2MA 2U1AA 4NXMF 3N7SC 2KN4A 3HKZC 1AZSA 4BVOA 2K4HA 4UB3A 4H4MB 3OTBA 1ZQLA 1JL1A 4RPZA 9ICRA 4GKKJ 1JJ4A 1VOMA 2DY9A 1QE1B 4BUGA 2ZH4A 3CDBA 2YKNB 3D3BJ 4DN0A 1HHTP 1KD1T 1NCLA 4DR7J 3CJ9A 1NOZA 3OL9A 3UQ2A 1IKVB 1AROP 1NGJA 3VPZA 4C80A 5EE1A 3WNGA 4OX8A 3UVJA 2OTLS 2BJ9A 2RRNA 3OGUA 3PHTA 4F5RA 5AKLA 2PKEA 5KT7A 1DURA 3H0RB 4A48A 3CPEA 3KKAA 1E6VA 2IDLA 4HR2A 4C11A 2VA8A 4YOTA 3GJSB 3D1OA 3RTVA 2ZUAA 3AQOA 4Q8EA 3QWUA 5GADP 2JOQA 3V9WA 1LWCB 3IS9B 4R5PA 1CZAN 3S3MA 4WK1A 1KQFB 1XWLA 1UCNA 3Q7BA 5KNIA 2FLPA 3DGVA 3H42A 3NVMA 4GKKF 2HNZA 1SGGA 2PT0A 5KTQA 3PW4A 3EYZA 1X9SA 5F8HA 4TVAB 3AB4B 3PYGA 3JSBA 3UQ0A 1HJRA 2IVMA 5KFTA 5FRNA 1RUSA 4ED1A 3MEGB 2VA2A 2FSKA 4UAUA 2X51A 4PXEA 3O9UA 4OKKA 3G25A 5KT4A 1VYAA 4A8EA 2XNQA 3X1LB 1HJOA 2HWHA 3CDEA 2VC0A 1KFDA 3P8BB 1O8BA 4C0BA 1RDRA 1OSDA 3PXGa 3A5NC 3T1YJ 3SNNA 1DK2A 4O44B 1ZTWA 2B4OA 4LF7J 2ZD1A 3FSIA 3VGLA 1VSMA 1ROFA 4W90B 2F8SA 5AZJA 5BXIA 4GXKA 3QEBZ 1O5JA 3OJSA 4WU2A 4CO4A 1TVRA 2HHTA 3ISNC 4F02A 3OA9A 1DLOB 4F91B 2NXEA 2KIWA 1VIOA 3RG6A 3KD5E 4FJNA 2O4IA 2P6UA 3HJEA 2Z1HA 1YI2N 3M1FA 1RDUA 1T6CA 4A5AA 4FWLA 5KL1B 4K4SA 1HUXA 4CJKA 4AFFA 3GFHA 1QH9A 2M5YA 2IBKA 2EWHA 3QX7A 3K9JA 1HNXK 3SUPA 1IIPA 4QS7A 1IKVA 2IRUA 1AFIA 4GVMA 1YJ9S 1SL0A 2KTQA 4CJUA 3G6ES 5FPEA 4CGHA 2A6MA 5EHHA 2GAGC 3IA0A 1RQ0A 2WSCC 3DRPB 2C1EB 1RDCA 3OL8A 3AT1B 2CJAA 4A62A 1RP5A 1Y5NB 3PKMA 2DNGA 3PHEA 4PG6A 2YKPA 3EWAA 5EXWA 4FYVB 3B6OA 4LFCF 5CHGA 1Q9XA 3R9PA 2YNHA 4KHSA 2DNLA 1F0MA 4Z4GA 3MXJA 5AKIA 2FC0A 1R7IA 1XQIA 3I33A 1S9EB 2HGMA 1DTQA 4X65J 3ZX3A 3WK8A 1ATSA 5DLGA 3TAFA 3DRXA 3ZSWA 5IIKA 8ICNA 1PK3A 2YH0A 4G1QA 2CPJA 4HT5A 4YD2A 2KV2A 5AM4A 5HJYA 3QJLA 1B4FA 2WOMB 3QXGA 2Z0GA 5E7OB 2OHFA 2V63A 2G8HA 3U1NA 4IFYB 1FKAF 4NPOA 3SFUA 1LWEB 3OHRA 2JNJA 3N97B 3KD1E 1AQ6A 5HP1B 3AVBA 4M3RA 1HYSA 5J8YA 2Y0BB 3M2VA 3KDNA 4H4OA 3D7EO 2QARA 2I5HA 5SUHA 1XNSA 1FNOA 1GNKA 1DZ5A 3R1LA 2ZIUA 3NRZA 4BDZA 2FI1A 2E5LF 3NGIA 2UVWA 4I7FA 1PC5A 4HHHA 4TUPA 7ICRA 1ATRA 4BR2A 2B4PA 8ICWA 2BPGA 2E20A 3OHBA 1U2VA 1R8HA 3QEAZ 1ZQSA 3QFHA 3W7BA 2JRSA 4CEZA 4EGLA 1SVDA 4Y2XA 1S10A 5D4PA 4CHPA 1IBLK 1TYQA 3F2BA 3CRXA 2OTLN 3MDQA 2HBRB 3CMEN 2PO4A 4IH7A 3BSCA 3FLCO 4C8ZA 1ZXOA 2VONA 2ZWHA 5KFPA 9ICIA 2DNPA 2MY7A 5A2QU 4F7VA 4RT2A 1IQZA 1WNSA 2CQPA 3HP9A 5B0AA 2HB5A 4DQQA 3RAXA 1Q16B 3AARA 3CERA 1NG9A 5F3ZA 4CYUA 5GVQA 2F9JA 1TKTB 4CJVA 4U9RA 5BR8K 2UXDK 1UP1A 4P10A 3FFKB 2CWXA 1JI7A 2G9OA 5D78A 2IVNA 1Z6RA 3JAMO 4EU0A 4NA2A 2HYIB 3QBCA 2QE5A 5ITHA 2XWYA 4JI2F 4B3MJ 2X1AA 3GBTA 3R1XA 5E79U 1RWNB 3UD3P 4QJFB 5EN1A 1D0EA 2QIFA 4KKOB 3PSTA 4LH5A 4FS1A 1RB0A 2DRAA 2E2PA 3MCPA 2IYIA 4KY3A 3ZDDA 4IH5A 4I6MA 3ATUA 1YLXA 5E41A 2E1CA 3MMVA 3NCRA 4IXCA 5KAKA 4NXMJ 4K50A 4O3QA 2IY5B 4OKEA 1FF2A 3PEJA 2CJ9A 4IRCA 4BACA 4OYOA 1VRTA 2C3PA 1KN5A 2Z56B 3SUQA 1WG1A 2E4LA 4YMEA 2P9LA 5F8JA 4K2JA 2J0XA 3FGVA 4PWDA 1U25A 3MCSA 2LHTA 2W40A 4IFVA 2IS3A 3H2VE 1HQEB 2WF5A 4ILJA 1QAIA 2E6MA 2GX9A 2GIFA 3GONA 1Z25A 5LMUJ 1AW0A 4W5TA 3UM9A 3EGZA 4LFAF 2RN2A 4AT1B 4J5OA 3V4IB 3E9LA 5AK6A 3IBWA 1N33J 3D66A 1N54B 2BE7D 4MDAA 1ZBTA 3HZ6A 4DL2A 2O3DA 1XSPA 4FJHA 4ECRA 3L2RA 2ZJQQ 4RO0A 3FCWA 3PNCA 4LF1A 2XZWA 1NNEA 4PA1A 3WBZA 2I6XA 1Z4UA 1KVIA 2C3UA 3M30B 4CYUB 2W3RA 4MFCA 3R8YA 2I9SA 4XAKA 3B9JA 5HLFB 2ZTEA 3PLAA 1TAQA 4O3PA 3MN6A 4DPTA 4K8XA 1RJJA 3LVWA 4PABA 3C15A 3VERA 1HKBA 3H90A 5ALNA 4USMA 4NLBA 4EIAA 1RYRA 3UDVA 5A8WB 4QAGA 2R8KA 2A19A 1IM4A 3F0NA 4HDGA 4GVBB 4OYMA 3IGNA 4C8MA 1B70B 2FC8A 3UE2A 2P5OA 1TVRB 1BISA 1C0GA 3D2WA 2OD4A 3P1GA 1ZQQA 9ICAA 4UASA 4UB6U 3D7SB 4B3TK 2QWPA 4OGCA 3MR2A 3BGLA 2AXTU 3SI8A 1UFLA 2RJZA 4CO3A 5ALPA 5HR7A 1M5PC 4DV5K 1WWHA 3H6EA 3T1YK 1JLFB 5AKGA 1Q82O 1RCXB 2EKNA 4NJ8A 2KSOB 4K4TA 4M9JA 4DQIA 2MB0B 1EO1A 2E9RX 4RBUA 2LECA 3R97A 4H4KA 5IILA 2EX3A 2OEMA 4KN7A 3ENHA 1N5XA 1RT3B 3NF8A 2YKOA 1GLFO 1S48A 1YF5L 1VIXA 2NRXA 1HI1A 5FPMA 3NH0A 4LF6K 5AI5A 1ZM9A 3BN4A 3OY9A 5A8WA 2H65B 3VMFB 3GFKB 4DZDA 3AHPA 3D3CJ 5AQGA 2EFVA 1X4EA 1VSFA 4TU7A 3VF4A 3BN7A 1E3MA 3MBYA 4C2MA 1KVBA 2GELA 2AZ1A 1PG5B 1RFQA 2W03A 5KFHA 4DU7A 2DKZA 2Y0SD 4GKJF 4M5LA 2KNJA 4PWDB 3E9OA 2Q6BA 4Y2IA 1CXQA 3T1HF 2DGQA 2QA4S 1S9GA 4Z6FA 1KHWA 2ZUGA 3CJ3A 1HBUA 2KM8C 4M47A 5AQYA 1GFWB 2CAJA 2GJ2A 1PO6A 1B9FA 2M0GB 4JV5F 5IFMA 5KT6A 2CQCA 2W6LA 2L9NA 3CCUN 5C2FA 4P4MA 1ELOA 1S76D 2QTWA 2HZCA 2KVIA 1N0VC 2NRHA 1BG3A 8ICCA 3GLJA 2F9DA 4ZVOB 1FWKA 3TTCA 1SH3A 4U7BA 4KLGA 1I6JA 3QFPA 3IRWP 2DO0A 2H54B 3C46A 4BC3A 2G2OA 4A8XA 2NRZA 3ZSZA 5K14A 2DKXA 3NG8A 4Y2AA 4CDGA 4EX6A 1G99A 5IQ6A 4KH6A 2VU5A 1X3MA 4DSEA 1RWKB 2ZOFA 2YX7A 1BHNA 3T1HJ 3C28A 3SSRA 1YBUA 1A5XA 2YX1A 2ACMA 2ZHBA 1C0MA 1RAAB 3HF5A 4F72A 4Z4IA 3CC4S 1LQ9A 3HXMA 1FX2A 4I68A 3I8BA 4P9SA 2OA8A 1SS6A 1TU0B 3Q8YA 4HI2A 1BA1A 5E84A 3IKMA 4BE0A 4CP5A 3Q2SC 2HOFA 3ULEB 1IR0A 4ID5A 5ALQA 3UR0A 1N2XA 2DBYA 4Z4HA 2PN6A 2ZE2B 2IMWP 3CVKA 3HHLC 9ICUA 5MAOA 5EE0A 5KG7A 2YTUA 3KHRA 4ILMA 1S1XA 1N8RO 5DGAA 1K0VA 2FJBB 2M0NA 2Z2MA 4CH7A 2V69A 5CD4H 4OYBA 1TUWA 3QUQA 1PK1A 4DG1A 1WEYA 4B9MA 5BYRA 1X4AA 2GMHA 3MM6A 5A0LA 2F5GA 4TU9A 3OW2M 2O8FB 1RBAA 4EHTA 1TAMA 4BE1A 3E58A 1L7OA 4WIIA 3D2FB 4RG8A 5AQWA 4B6JA 8ICKA 1RT2A 2OEKA 1GH8A 3DCAA 2ZM6F 3FM9A 4H0VB 2R7UA 4CNZA 1P90A 3K5PA 2UXBJ 4QIEA 2YI1A 1MC8A 3D1QA 3WC0A 3QGPA 3R7NB 1NZBA 1WUUA 3DRSB 4ZS6A 3CMQA 5LOQA 1MWKA 3CM6A 3AQPA 1C0UA 3FGUA 1N4LA 3MD1A 3H08A 3FFIA 3IBPA 5AI6A 4WXWA 1PZNA 1RHJB 5L1IA 3S6EA 4CECA 4A47A 4JEPA 3L5KA 4A2AA 3VAFA 4CQ1A 3CCEN 3QINA 2YPZA 1QTMA 1ZBUA 2MZJA 3LALA 2ADCA 4DOBA 2EI5A 3C2KA 3U3GA 3N6NA 2GGPA 1SWVA 1BQMB 3T1AA 5AM3A 2WBNA 4A2BA 4CLYA 4KRFA 4I27A 1CLFA 3VZIA 3M7VA 4FVCA 4IG0A 3ZZZA 3U26A 3GB0A 2CNNB 2D1KA 2N3OA 2ZHOA 4NYOA 1DGJA 3LPYA 4CDIA 4NX9A 1F9FA 5DM6L 3BM7A 4DV3J 5AK5A 3SAGA 2M4MA 2VWBA 4AL5A 2EC2A 3GJRB 2HS0A 1P9YA 4FJ5A 4ZPBA 3BS9A 2QWRA 2JEJA 2MSNA 4QWBA 4WWSA 4DU8A 6FDRA 1HD1A 3S3NA 2KD1A 4Z7CA 3FFIB 4KR0B 4JK8A 3AJ1A 5J2FA 3M1YA 1SIWB 3MMBB 5L46A 3H3OB 3AN1A 2P9LB 5I4MA 2V2VA 2G06A 3K4GA 2BM1A 4A8KA 4M04A 4FO0A 2JMGA 3L3CA 4NRUA 5D0EA 3RMDA 1SJ1A 4RQ5A 3LZJA 3ADAC 4FCYA 4DV2K 4OZ3A 1YUWA 3S7RA 5BRFA 4EELA 3ZZ0A 4AL6A 4M8LA 3ED5A 4NXMK 1NB7A 4Y65A 5ETLA 1XEZA 4P2HA 1RDAA 3ZSXA 1EIYB 2HHPA 3NGUA 3EMTA 1VQKS 4ZP7A 3AA3A 2LSNA 4DMNA 4ENOA 1DGSA 3UW1A 1WI8A 3TI0A 2ZTDA 3TAQA 2PFNA 2VQFK 3EW9A 5C24B 3D0PA 2G8KA 1BQNB 3S41A 3MHYA 1Z4NA 1LW0B 4MLEA 4IEIA 4X4NA 2NUBA 5EE9A 8ICOA 1LK7A 4DPWA 1SZHA 5D46A 4RUCA 5F3TA 4YR2A 4CHQA 2QA1A 2FMQA 4I9QA 3CJCA 4YOYA 1KVCA 2HMPA 2CVEA 2OPQA 3QT7A 1YHQS 5T41A 4QIWC 4DR6F 1CSJA 2V6AA 3A8YA 5HMWA 5DKWA 2DEIA 3GYGA 1BCOA 1G6BA 3OS0A 1VK3A 4URQU 1CJUA 2MZRA 4GO7X 3ILLA 3K7RA 3A3PB 5J0WA 2HHWA 3BBBA 7ICLA 3MXMA 4I2DA 2GHVC 2W2OP 1TYQB 4DHYA 5C10A 1XNQK 1S0OA 3NP5A 3IAS9 3ETLA 2R3VA 5HN0A 2ZFHA 1BOTO 2CN1A 1FKOA 5LL6Z 3OYCA 2BZ2A 1JLCB 4YDDB 1VQ5N 3TARA 2HFZA 4F36A 2RE2A 5E33A 2ATLA 4YVZA 3D28A 1LW0A 4I69A 3U02A 1SQGA 4LY7A 3OLAA 2QKQA 4LUBA 2OPSA 2M3DA 4JOUA 5F0WA 2YNHB 2R9LA 3ZI4A 2IIHA 3HHKA 5H9EJ 4H03B 3AOCA 4ECYA 4I1TA 4PG4A 4PKGA 3OQ2A 3VQEA 4ZCKA 4BC4A 3GV5B 2VQEF 2LKZA 1P7DA 3W5ZA 1Q78A 3B6PA 2G09A 2Q2RA 2IOCA 4LF5J 3U6FA 1KWMA 1TK0A 3RSEB 2ZUDA 4Q0BB 1XR5A 1GX5A 1X66A 9ICVA 4FK4A 2K60A 5T14A 5TISU 1FFGB 4LF6F 3OPKA 2OFHX 1X4BA 1NGIA 3L09A 1APSA 1MMNA 3QE9Y 2UU9J 2P5GA 1W25A 3B8HA 2XYGB 1Q7LB 4YDUC 2IMOA 3UNYA 2PFFB 1TR0A 3DYAB 2QT7A 1J5EJ 3PIPL 1WSRA 1OH8A 2KE7A 2CPDA 3ONNA 3Q83A 4LBHA 1ZBFA 1NKEA 2MDAA 1DQAA 3WK5A 4X65K 2B8PA 4DX5A 2X78A 2DNMA 4PKHA 3D5MA 4WU3A 4JNEA 2FY1A 3SDEB 3JSMB 4CIGA 2P9GA 3MWTA 3TSUA 4WZMA 3WU2U 3WUHA 3RB3A 4OI6A 3OSPA 2YWKA 2E1YA 4OD0A 4ZMMA 2X1FA 3GTYX 4DLEA 3T6BA 4I0WA 4LSNA 2CKWA 5GAGI 4F8RA 4J90A 4E1JA 1HFEL 4I2QB 1YXQA 2JH3A 3M32A 3DDKA 3ISBA 1VSJA 5HNKA 4JI1J 2U2FA 3CJAA 3OD2A 3DDNA 4JV0A 3RRKA 1JK9B 4F0KA 5D0GA 3BQTA 4B9SA 5IWAJ 2Y9UA 2DBBA 4NCGA 1J97A 2Q36A 5HANA 1A76A 4J2BA 4ECSA 1ACMB 1F21A 3C29A 3EE9A 8ICMA 3R5JB 1K8AO 3Q7CA 4LF8K 1UPHA 1SC4B 2FZCB 3NVVA 2JC1A 5HRSA 5DZ7A 2G13A 5C7PA 4OZJA 2HBYB 4CJSA 4FJXA 5KFQA 2HQGA 4IDHA 3JSMA 1X5OA 3SIPB 2W4CA 3M9OB 2A18A 3EN9A 4M42A 1EXNA 4FLXA 2DF4B 3DM2B 1VQ8S 3M8ZA 5AI8A 4JK9A 1S6PB 4Q8FA 4CHZA 2ZIVB 5E3AA 2GQQA 3ZTOA 1PC4A 1YDLA 4U96A 4DSJA 1HUZA 3EGWB 3KLIA 2FJWA 5IT9Y 3CJTA 1XMOF 4PH5A 3V6JA 1BDGA 2FBTA 2W11A 3LA0A 3VGMA 5CA7A 4YN4A 3C16A 3WX4A 3N5BA 4NV0A 1IBCB 4OX9K 1IJEB 3DRPA 1YJWS 3FBEA 3U9ZA 2E9TA 1EX8A 3AVMA 4PL7A 3QNWB 2CXEA 3FR0A 1R43A 4A8FA 5FD1A 3I55N 4DR5F 3CFRA 2EFGA 2DCUB 1YKWA 2AZ3A 5I3UB 4DR7F 1NNLA 2RRBA 2XVTA 2GO8A 4UY85 3M6UA 2HGLA 4FWPA 4GO5X 2ZVSA 1Q79A 2H3FA 3AO5A 2PEHA 3ZX2A 2RRDA 2LDYA 4JUZA 2W25A 3LZIA 4WK3A 4R0JA 2ATCB 1TV6A 2A5XA 3TZZA 1NJYA 3G8SA 4NM2A 2RAQA 4C9DA 3K75D 1S1TB 3MEDA 2EDUA 1I51B 2W4PA 4RQ3A 3O80A 5A6WA 1N34J 3MUTP 1X9WA 2LEAA 4IS7A 5AICA 3N7PD 5HBMA 3QEXA 5C15A 1OXJA 3K5NA 2RVJA 2RUSA 3ENOA 2IHMA 2B5JB 2IM0A 1QVGM 1BPEA 2XMMA 2DUYA 4Y2CA 2WAQC 2BJEA 3GIKA 2XICA 4X62K 2BQRA 4M94A 4DR1F 4J9QA 3HCXA 4HHUA 4Q7AA 1NM1A 1D8YA 4GVBA 4B9UA 5EVZA 4M9GA 1HQ2A 5K20B 4I7FB 2WF8A 1R0AB 4EWTA 2X3GA 5IZHA 1L3VA 1S77D 2D7SA 5AKYA 4CFBA 4DOCA 4F2RA 2IM1A 9ICQA 5KFOA 5B0FA 2Z2YB 2V8DA 3OVNA 2VANA 3J7YI 5G4DA 4FNHA 4DMZA 3WQUA 2XS7A 5AE2A 3NASA 8RUCA 5D77A 1YIJS 5KFDA 3CCVS 4CFDA 2X6SA 3AH6A 2Q31A 2QLXA 4C4TA 4P2SA 1WI6A 2FHKA 5HBMB 4OVLA 1FHTA 1Y10A 4BE2A 4CJPA 2GZOA 4IJAA 4FJIA 4QZ9A 4FJ8A 3QSYB 3TFSA 4Z94A 1GLAG 1NGFA 4BROA 2KJ9A 3BKUA 3ZT4A 1NZPA 3HL8A 4NB4A 2F8HA 2QFJA 4CJ7A 3RJFA 1S79A 4CLTA 4BDYA 4FW1A 3QRPA 1QVFR 4KFBB