4DQQA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 204
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqqA01
4MFAA 4GXIA 1JL1A 2HVIA 4YQWA 4N56A 3UIQA 3C1ZA 1L3SA 4XRHA 1RT6A 8ICNA 4Z4FA 3NGIA 1KLMA 4KLMA 2VWJA 4FLWA 4KLOA 2XY8A 1U45A 3RJFA 3SNNA 1RBTA 3OS2A 4DF4A 3NF9A 3KD1E 4BXOB 9ICHA 2KTQA 4DOCA 4FJHA 2RN2A 3JYTA 4YFUA 3CQ8A 1S0OA 1L5UA 3LP0A 4C8OA 4KTZA 4B8CA 7ICLA 4KV8A 3HW8A 4PGQA 5FDLA 2W42A 5DG8A 7ICMA 4P4PA 4CEOA 1VSHA 4RQ2A 1HNIA 2LYHA 9ICTA 1CEZA 4M9HA 1XI1A 3H4BA 4Z4GA 4DSEA 2JLEA 3NBPA 3KLIA 4OLBA 1ZQIA 1RT7A 2JGUA 1XSNA 4FO6A 3V1RA 5EOZA 4CFDA 1TK8A 3JPTA 2UVVA 1HQUA 4FS1A 4P2HA 4DL5A 9ICGA 3ZD9A 4KLDA 4UBCA 1X9SA 3PY8A 5DDMA 4YMNA 3LDSA 3LWLA 5J2JA 5DLGA 1J5OA 4B9SA 3TAQA 4O4GA 4E7HA 1S5JA 4PWDA 3NDKA 4RNNA 4FVMA 1JLCA 4FJJA 3NGDA 3ZSRA 5DMRA 3EZ5A 5KFYA 2BE2A 2XO7A 3MR5A 2QK9A 3I8DA 4KHYA 3L2VA 4Z4CA 3K4GA 4ED8A 3VQDA 2PI5A 1NK5A 3QNNA 3QESA 2VG5A 1MSWD 4B9LA 4I2JA 3T3FA 4Q8FA 1RTJA 2C22A 4K8ZA 5CWRA 4MFCA 8ICTA 5C25A 4RW7A 5JS2A 4BWMA 8ICXA 4J9QA 1JN3A 2VG7A 4HVJA 5KG4A 1TV6A 1U9LA 4EYHB 3HPHA 4J2EA 1WAJA 8ICWA 5IINA 3KHRA 2R8HA 1ZQQA 4KN4A 2W9CA 3L2QA 3KKSA 4YR2A 2RKIA 3UPQA 1F21A 4L8RB 3JPQA 1C1AA 1A5WA 5DB6A 4DTPA 4I28A 5CJ7A 9ICKA 4IG0A 3SPYA 2B6AA 2A1JB 4H4OA 3QEWA 2B5JA 3KLEA 4CF8A 2BPFA 3DRPA 2VANA 3PW4A 3ZT1A 4E89A 4W5TA 4LZGA 2RDJA 1VSJA 4Q0BA 4YCXA 4OKJA 4W5OA 3KHGA 4FJ8A 1RDBA 1LW2A 4FZZA 4KKOA 3RMCA 2XY7A 5J0OA 4E3SA 2JEGA 4NYFA 1X1PA 4DL3A 4CEDA 4JWMA 1YVUA 2FBVA 2RDIA 4PH5A 1NK6A 1T3NA 4N47A 3H7IA 8ICOA 2B4JA 4O5CA 3OYBA 1KVCA 3ETLA 1CZBA 8ICSA 3EW9A 2DFLA 4LZDA 1ZJNA 1NK4A 4CHQA 2HMIA 1J9AA 1Y88A 2HB5A 3SI6A 5KFFA 3C6UA 3RJJA 1A76A 2W8LA 4BWJA 2VA2A 1JXLA 4QZCA 1T7PA 4HCCA 2G8WA 5FRNA 3T5KA 4EP5A 3V7JA 4CJKA 1NOZA 1XSPA 9ICJA 2V9WA 4HUEA 1S9FA 3RBEA 1BI4A 5CR0A 2Q0ZX 8ICLA 1BVSA 5DBBA 5L1LA 1ZQJA 3AVBA 2KW4A 4CEQA 4DLEA 3NGYA 4O9MA 1C1BA 4CFCA 1BIZA 1WSGA 4DQQA 2JEFA 5J2MA 3SZ2A 3OYNA 5KFPA 4FZYA 4OLAA 2J6SA 4I29A 3PMNA 1NOMA 3O4QA 4B8AB 4M9GA 1RTIA 1BI4B 4GW6A 2G8FA 3V7KA 4Z4IA 4M9JA 1ZQAA 3HJFA 5BOMA 4DF8A 1FK9A 3EPGA 3Q8RB 3P83D 3RB6A 4I2DA 1L3UA 3JPOA 1ZQTA 5KFXA 4IRDA 1Z26A 3H08A 1R0AA 1QSYA 3QEAZ 1ZQLA 4JWNA 1AROP 2JZBB 4QZEA 3GIKA 4KLEA 4QCLA 5KT4A 2D0BA 5DBCA 3FFIA 4TURA 2DFFA 2HNZA 4CESA 1GOAA 5C5JA 1DGSA 3DLRA 4QWDA 1SKSA 2BANA 3C2LA 1RT1A 3RR8A 3NH0A 1HJPA 3RH6A 4ZTFA 2AGPA 1U49A 1ZQMA 1JLAA 3OS0A 3TANA 4BACA 4BE0A 2FLLA 3GILA 2ZTCA 3ZDDA 1N56A 2FC0A 3OSPA 4M9NA 4JK1A 5KFOA 4FJMA 5BPCA 1BPXA 5KG3A 5T7BA 3B6PA 1BQNA 5SZTA 1CXUA 5KT5A 1D8LA 4YXMA 2YNFA 2BPGA 4Y1CA 1ZJMA 3U3GA 2HHUA 5DGBA 2P5OA 4B3OA 4AHVA 1WCNA 3SV4A 4Z0UA 4NM2A 3NAEA 1T03A 1UT8A 2OZSA 3IG1A 3O4NA 5I3UA 3B0XA 1NKEA 4CJ3A 4DTSA 3Q8PB 4DEZA 4RUAA 4CHPA 1LB2B 4X5VA 3RJGA 4CECA 1UA0A 8ICQA 5HHHA 2KZMA 4J9PA 1ZBFA 4RQ6A 4CGHA 3P1GA 2HW3A 1RTHA 5CZ2A 4Q44A 1HRHA 3ALYA 1ASVA 1TKTA 1C0TA 5C24A 5J0XA 4FJXA 5FROA 1UAXA 4M45A 1NJYA 3QZ7A 4ELTA 4QZAA 4NCAA 3T5JA 4DOAA 1K1QA 5KG0A 2XY5A 3OGUA 2XGQA 3SV3A 3ISNC 4BDYA 2GBZA 3ISCA 3DLKA 1RBSA 4HYKA 3OVNA 4GVMA 4LVSA 9ICPA 4J9KA 2IOCA 4YMMA 1ZBLA 4F4XA 3LANA 3HT3A 3OYLA 3M8RA 5J2PA 2HNDA 1LWFA 3PX0A 2XGPA 2FPLA 5J0SA 4MFBA 4M3ZA 4IQWA 4DL7A 2XY6A 5HRSA 3MEDA 4B9NA 3EPIA 4IR9A 5IIJA 9ICBA 4E1MA 4DFMA 3WNFA 4CJLA 3KTQA 4ICLA 2ATQA 2J6UA 3Q8SB 3PMLA 2FBXA 2ISOA 4ECZA 3C1YA 1Q9YA 3RB0A 4QZDA 1HMVA 1RT5A 5J29A 4CJTA 1IM4A 1Q8IA 4OGCA 8ICMA 4KITB 3OYIA 5F9NA 4MF2A 8ICFA 3WNGA 5DQIA 1NKCA 4P4MA 2Y1IA 1ZQFA 4R66A 7ICTA 1JLQA 1JKHA 4DTOA 4IQUA 1KDHA 1XSLA 1ZQGA 4J9SA 5J2GA 2XC9A 1T05A 3HVTA 3AUOA 4ED1A 5DB9A 3Q8MA 1SL1A 1QE1A 4RQ7A 3DLBA 4UB2A 4FS2A 4XQ8A 4RPZA 3OYFA 4LH4A 3MGIA 7ICOA 3OYHA 2P1JA 3O3GA 4DSIA 4O0JA 4PY5A 5KRSA 4CJFA 2DPJA 1WLJA 1HPZA 2F96A 5J1EA 3JPNA 3HYFA 4YN4A 4AHCA 3QNOA 4F8RA 4OPKA 5KT2A 7ICGA 3QEBZ 4FLZA 4PA1A 5HBMA 3QIPA 4RNOA 3MAQA 3C2MA 3IM1A 1JXEA 4CK3A 1RBVA 3TFRA 2IHMA 3S3OA 4IDKA 3AVKA 1EP4A 2V4QA 3SYZA 3F73A 3L3UA 2NRTA 1ASWA 3HXMA 2M9NA 1QTMA 3F9KA 4CFAA 4K8XA 3MGHA 2PXIA 5HRPA 4GMJB 3SQ1A 3NH2A 4OJRA 1KVBA 3M8PA 3C21A 3T19A 5KFEA 2C2DA 3AVGA 4Y1DA 4BGDA 5KG7A 3ZSVA 4C8NA 2G8KA 1ZQHA 4NY8A 4KLFA 4RW8A 3H40A 4ED3A 3ZDBA 1UWBA 2P6UA 2I9GA 5EWGA 1Z00B 1KEJA 3G6YA 2OPPA 3KJVA 1T8EA 4CGIA 2ZTEA 5HHIA 4UBBA 5CHGA 2FBTA 3QERA 1S97A 2NRWA 4DL2A 3P5JA 9ICAA 2W9CB 3G0ZA 3Q8LA 4MFFA 4RPXA 4YD1A 4CE9A 8ICZA 1ZQNA 5DG7A 3AU6A 2E4LA 2E6MA 3OSNA 1W9HA 4E7JA 5DLFA 4DL4A 2F8TA 3CG7A 4N76A 2F1HA 4O5KA 4KLLA 5DQGA 4DSFA 3LWMA 1SL0A 1IG9A 4E0DA 1TL1A 4IR1A 5J0PA 4KAZA 4QZ8A 3RJKA 3E01A 3L3VA 3QEIA 5DKWA 9ICMA 5J2HA 4RQ0A 5J2DA 1TVRA 4M3UA 4MQ3A 4O3RA 5KGWA 4AH9A 3BQ0A 1HYSA 4FLUA 3HL8A 4LSNA 3VQ7A 1FXXA 4KLJA 3U6FA 3AA5X 4CEEA 1VSEA 2P5GA 3K57A 4M04A 4O3SA 3SUQA 5KFAA 4CJ5A 7ICSA 2YHAA 4FJKA 4YMOA 2HVHA 4LSLA 2PI4A 3V9UA 2HHSA 8ICAA 3AO3A 5L9XA 4QZFA 3PV8A 3HPOA 4ELVA 4FCYA 4DS5A 4E1NA 2R8GA 3DLEA 3RMBA 3TFSA 4M3WA 1RTDA 4AHUA 3C23A 1DLOA 3GV8B 3TWHA 2DTUA 9ICQA 3TAGA 2O4GA 1L3TA 4M42A 5J2QA 3K5MA 3T5HA 4CJWA 3U3YA 1C7YA 4O44A 5TZVA 1S1VA 2ZE2A 3NFAA 2ATLA 4FW2A 4DTJA 3MR3A 2Z1HA 3PR4A 2BCUA 2Z1JA 4E7LA 4OVLA 1B22A 7ICQA 3LZJA 2R8KA 2RPIA 5FRMA 4NXZA 2VWKA 1S1XA 3OJUA 1NJZA 5KT6A 8ICPA 3OHBA 4M3TA 2LSNA 3AVCA 5KFVA 3LAKA 4F93B 1S76D 4Z6FA 3M9NB 3AA4A 1S77D 1A5VA 4KPYA 3ISBA 1C1CA 1LAWA 4IBNA 1DTQA 1WSFA 5J2NA 4ECXA 1HJRA 1K6YA 5J0WA 4EBDA 3VN5A 3H8JA 4J9NA 5J0QA 4I2QA 4OKEA 1TK5A 4FZXC 3AVIA 3L2RA 4BE1A 4YR0A 1ZQBA 1NK7A 4JS4A 5IILA 1J54A 4O3OA 3ZT4A 3PNCA 1ZYQA 4ID1A 4XIUA 2AGOA 3TABA 3LALA 3KK2A 1D8YA 1VSFA 4ED7A 5KFUA 4O3PA 3PR5B 4N41A 3TAFA 2ALZA 4DU4A 4KLHA 2QKKA 4ED0A 5KFNA 3S9HA 4RQ4A 4I9QA 5KFGA 2BHNA 4F5NA 3DI6A 3RH4A 2FLPA 4B9TA 4I7FA 4O0IA 4FYDA 5HMLA 5DDYA 4M6WA 1D9DA 2FPKA 3Q8KA 7ICUA 8ICIA 2KQ2A 5J0TA 3NF7A 4KTQA 3KLFA 3NF8A 4I27A 4DTRA 4B9MA 1BPZA 1MQ2A 1O1WA 3ITHA 3EYZA 4EZ9A 1KVAA 4DMNA 1QSSA 1S6QA 4CGFA 4M41A 1FKOA 1JLEA 3C5GA 1ZQUA 3V9WA 1WSEA 4F5PA 3HWTA 8ICVA 1PZNA 1IKYA 2KZ3A 5E41A 2A1JA 4O5BA 3B0YA 3ASMA 3QINA 1DTTA 1BL3A 9ICOA 2IC3A 4I2HA 1MQ3A 3MXMA 3C5FA 4KLQA 2GUIA 4EYIB 4PQUA 1ZQPA 1B43A 1S1TA 4IRKA 4I9LA 4DQPA 5HLFA 4CEBA 4M3YA 5KT3A 4I2AA 3HP6A 1HUZA 4CK1A 3MXIA 2PFOA 3MECA 2R7YA 4GC7A 8ICEA 4NCBA 4CGJA 2NUBA 1G15A 4DFKA 3QIOA 5KFDA 3ZSXA 4Q43A 1YTUA 4H8KA 4QZGA 3RTVA 4C8LA 1UOCA 5KFWA 3CM6A 1HQEA 1TAUA 3T5LA 4FLYA 5KFKA 5KFZA 4IRCA 2ZUBA 3MDCA 4JV0A 1B92A 1TL3A 4RQ1A 9ICRA 3L2UA 2KFNA 2B21A 4I2PA 3V9SA 1MU2A 4GXKA 4RT2A 9ICUA 3N4MB 1N5YA 3THVA 3PX4A 5D49A 2AJQA 1XS9D 2I1QA 1N6QA 4ECRA 4LH5A 3HO1A 1KRPA 3H8WA 1UA1A 1REVA 5CA7A 3M9OB 1RDCA 4AHRA 2C2RA 3ZDCA 4ECVA 4HCBA 1V9PA 1U47A 5KG5A 4KLGA 1RNHA 3VQ8A 4PPXA 1TGOA 2F1IA 1U04A 4CHZA 1SKWA 5KFBA 4FK0A 1ZQOA 1JL2A 4FJ7A 3TARA 4CF2A 5K14A 2PYJA 4BE2A 3KIOA 9ICXA 4FBUA 4RQ3A 1BPEA 2DFEA 3K58A 2YV0X 1CZ9A 9ICIA 3OYKA 7ICPA 3RJHA 5KTQA 4CK2A 3MFHA 3CFOA 3TQ1A 4F2RA 2YKMA 1XHXA 1SZPA 1EX4A 4M3RA 5KFHA 3QZ8A 5HP4A 4RG8A 4FLXA 2GV9A 3BQ2A 1H38A 3QLHA 3SPZA 2NRVA 4NLGA 5KFLA 4Z6EA 4RQ5A 2ASDA 8ICKA 3QEXA 4ECUA 3K75D 4BDPA 2HHTA 4QZHA 2KZZA 1D5AA 5JS1A 5KRTA 3AVMA 1LWCA 1HYVA 1BQMA 3SQ0A 1TKZA 4JV2A 1RXWA 1ZBHA 1D9FA 9ICNA 3VQAA 5EU7A 5J2KA 1XC9A 4BXOA 3K5LA 3UQ2A 1IKWA 1CUKA 3UXPA 1LW0A 2ZJ5A 5KFSA 4QAGA 3RAXA 4DLGA 4M6WB 7ICNA 4JLHA 1NJXA 5KG6A 2W9BA 4CJVA 1NJWA 4J2AA 2HHWA 1VSIA 4KLTA 4PGYA 2IHNA 5J2AA 5KFMA 4I2IA 1EETA 3HP9A 2BCVA 4CIGA 2P66A 2D5RA 3VQ6A 4XA5A 3IS9A 3CFPA 4F4KA 4EBEA 4RUCA 1KCFA 4XUSA 1TKXA 3RBDA 4FW1A 4FLTA 3D45A 1Q9XA 2D0AA 2OYQA 3MDAA 3CFRA 4F5RA 1NK0A 4DTMA 2UVUA 1RXVA 2A1RA 9ICVA 2YNIA 1U4BA 3PW5A 3SUPA 3FDSA 5HROA 3CYMA 3TAEA 3BQ1A 1IH7A 5L1IA 2IAJA 5L1KA 4QWBA 3ZT3A 3Q8QB 2OPQA 3AVAA 2V4RA 1ZETA 3MEGA 3NCIA 3V1OA 8ICUA 3KHHA 5L1JA 5IIKA 4CJQA 4RW9A 2G8IA 9ICCA 4NLZA 4RT3A 4K4GA 4RW6A 1RBRA 4NCGA 4Z4EA 1WNSA 1COOA 9ICEA 2ZUDA 3V72A 4RW4A 4DSJA 1DOQA 4FK4A 2XRIA 4ED6A 2QXFA 4M2YA 2Y1JA 4KHSA 2GWSA 4I2GA 4F50A 7ICKA 3VQ9A 1XWLA 2BDPA 4DOBA 3MXJA 2X74A 1VSKA 3QEVA 4KHQA 4DWIA 5J0RA 4DU1A 2NRXA 2PYLA 4ELUA 4KLUA 2FMPA 4TUPA 3A2FA 1JMSA 1QS4A 3T1AA 2PZSA 4RPYA 5CY4A 3RMAA 3HX0A 2IGIA 5IIOA 4J9OA 4Z6CA 1ZQZA 3PUFA 4Z4HA 1EXNA 2G8UA 2YHBA 3TR8A 4F5OA 4GC6A 1S0MA 2F1JA 3E2EA 4KO0A 3JPPA 3M8QA 3V6JA 2UVRA 3LP2A 4QZIA 3D0PA 4CERA 4QW8A 7ICHA 3RB4A 4I2FA 4FM0A 1HNVA 3ULDA 4JRQA 3M8SA 3OYMA 2ETJA 5DBAA 4ECQA 3RAQA 7ICJA 1SUQA 3PVXA 2YNHA 4I2EA 2E6LA 3V9XA 5KFCA 5KT7A 4J2DA 3VQCA 4LD0A 1Y97A 3KLGA 2HHQA 5CB1A 1WCLA 4CJSA 3QEPA 1JIHA 2G8VA 1NK8A 2X6NA 1B9DA 3LP1A 3MBYA 2VG6A 4PGXA 4KFBA 3ZT0A 4KREA 1EKEA 1C6VA 4CGGA 3KK1A 5HRNA 3O3HA 5CP2A 3SQ4A 1KFTA 4O5EA 4Z6DA 4DTNA 3SUOA 4E19A 1TK0A 2BCQA 3OS1A 4IG3A 4JS5A 4ZTJA 2OPSA 3S3NA 2FMSA 1TFRA 2PFNA 2JEJA 3UXNA 4UB5A 1JLBA 1QHTA 4KN7A 4PHDA 1KLNA 7ICVA 4E7IA 1ZQRA 1ZQEA 3K5OA 1ZBIA 4Q45A 2AQ4A 1TKDA 3HPGA 5IIIA 4DQIA 1BPYA 3EWAA 2IDOA 2NRZA 1ZQCA 4EZ6A 2AQ0A 3FYHA 2BCSA 4YP3A 3SQ2A 4MEXA 1ZQYA 5CZ1A 3K5NA 3V6DA 4B9UA 3RRHA 4DQSA 2FMQA 3UXOA 4FLVA 5J2EA 3MEEA 2Q3SA 3G6VA 3TI0A 4AILC 3LDAA 3DRSA 3GDXA 3ZD8A 3NE6A 2IBKA 7ICFA 4PHAA 4QOZB 7ICEA 4TQRA 2KN7A 4K4IA 3DLHA 3EY1A 3RJEA 4KB1A 4KTWA 2C2EA 8ICJA 1SKRA 4F4WA 3I0RA 2BQUA 4FXDA 3UQ0A 4FJGA 3ZSZA 3M9MB 2DPIA 1WSHA 2W9AA 4CFBA 4OPJA 4F4ZA 4CHYA 8ICHA 3ISDA 4UAZA 4B9VA 3KLHA 3VQ5A 3SCXA 3V4IA 4UB4A 3C94A 4M9LA 4R64A 1SL2A 1QQCA 2ZJ8A 9ICLA 1BISA 4IKFA 2JEIA 4F2SA 2XCAA 3VA3A 4QZ9A 3ORYA 3OYAA 1U48A 4KB0A 2MAXA 4CEZA 4ZH4A 3AA3A 3ZDAA 2FLNA 1CXQA 3K2PA 3AO2A 5J2CA 4DS4A 3VQEA 4QWCA 1RT4A 4R8UB 2WTFA 2ZUCA 4N5SA 2ZD1A 2FPMA 2IMWP 1ZQVA 1IKVA 4TSXA 4DFPA 1S9GA 1C0UA 4I2CA 2BQ3A 3CM5A 4YFKA 2A1SA 3HM9A 4EP4A 3GQCA 5KFIA 3OYEA 4FBTA 4FJ9A 2BQRA 2BPCA 4E7KA 2VA3A 1S6PA 2KFZA 1MC8A 2R8JA 4F4YA 2PFQA 2YKNA 3ZDEA 5KFTA 3GIMA 3DLGA 4CJRA 4KHWA 1UT5A 1RZTA 4FJ5A 1CLQA 1Z3EB 3GV7B 3DOKA 1IO2A 3QO9A 3LK9A 4Q5VA 8ICYA 4G1QA 2ISPA 1ZQXA 1ASUA 4KRFA 4UAYA 1ZQDA 4IFVA 1S1WA 1YT3A 3QETA 3ZSWA 1HUOA 3NH1A 3GIIA 3IRXA 1VSDA 3OY9A 3DYAA 1BGXT 2HHXA 1Z25A 3ZT2A 1QLNA 4FJLA 1IXRA 4J9LA 2WOMA 5D4BA 3LPTA 2W9MA 3AVJA 1YTAA 2RF2A 3NGZA 1XHZA 3TAPA 4HHTA 2ZTDA 2ASLA 1S10A 3OYGA 4J2BA 1I39A 1JXBA 1A77A 3JSMA 5J2BA 8ICGA 3N97B 1JLGA 2Z1GA 3VQPA 2ZJAA 1RT2A 5F9LA 2ZQBA 3AV9A 3NHGA 3MR2A 4KHNA 4CF9A 3LAMA 2G8HA 3O3FA 2X78A 3S3MA 4M47A 3AVNA 3SUNA 3RMDA 4UB1A 1NKBA 7ICIA 4IQTA 4JUZA 4R63A 5KG2A 3ZSYA 3AO1A 4AHSA 4BDZA 1KSPA 1RDDA 4NM1A 1W0HA 3RJIA 4YVZA 4HUFA 4R8UA 3H4DA 2MUTA 4O3NA 3GFKB 4ID5A 4CJUA 4CHNA 2IS3A 3C6TA 5HP1A 2BGWA 1J53A 1ZBUA 1RPLA 2DY4A 4RU9A 3LP3A 4YD2A 1RILA 3NTUA 3SI8A 1RBUA 4AHTA 4OKKA 3AU2A 3H8SA 3DM2A 1XO1A 1QSLA 4PUOA 4F3OA 4YG2A 3B6OA 2H5XA 4NLKA 3BGRA 3ZSOA 4J9RA 2R8IA 4O55A 3MR6A 3BDPA 8ICCA 4ECYA 4DTUA 1GOCA 4KLSA 3WNHA 3JPSA 3OYCA 5J2IA 4ED2A 1VK0A 4KI4A 4KMUA 4CCHA 1SV5A 3I0SA 4W5NA 3AO4A 4R65A 2JZBA 3TAMA 2MUTB 2WONA 1XU4A 4HTUA 4F5QA 3V9ZA 5KFJA 4Q8EA 1HYZA 2OWOA 1JLFA 5J0YA 1RCHA 3K59A 5DK5A 4CJ4A 2W8KA 3PO4A 4CEFA 3RH5A 4C8MA 4CGDA 4IQVA 1ITGA 1NOYA 4YR3A 1TAQA 3V1QA 3WNEA 4FM2A 1A5XA 2BGGA 1IKXA 1BPDA 4ECSA 3MFIA 4UAWA 1ZQSA 1WAFA 1I3AA 3HSTB 3V81A 4DQRA 4NYNA 7ICRA 2BR0A 3HK2A 1LAVA 2W9BB 2OA8A 3AVLA 5DB7A 1K1SA 4F91B 1RYSA 4DTXA 3G10A 3BQTA 1KTQA 2O4IA 4GXJA 1KFSA 1EXQA 5CYQA 4F3TA 3ZCMA 4M0AA 5IIMA 1S0VA 2UVWA 4KI6A 3GV5B 4R5PA 4P4OA 2P6RA 2J6TA 2VA8A 4DSKA 2P51A 9ICFA 5KGXA 1BHLA 1S1UA 5EWEA 2IA6A 3V7LA 4I2BA 1T4GA 2XHBA 1WN7A 1X9MA 3KHLA 2BKEA 1S9EA 1BPBA 4CJPA 1Z00A 5HMMA 4DSLA 4MF8A 4RZRA 1BCMA 9ICSA 3IHQB 2OZMA 4EEYA 4C8KA 4CIFA 4GLXA 4KLIA 2FBYA 3BJYA 4JRPA 4NLNA 1KFDA 4QZBA 3LZIA 1ZQWA 4CIEA 3IAYA 3QE9Y 4EBCA 3SJJA 1B9FA 4LY7A 4CJEA 5J0UA 1VSMA 4MEYA 3V6HA 3DOLA 2PFPA 2YNGA 3G6XA 1VRUA 5KFQA 3PW0A 4CEAA 3PW2A 5DGAA 3PW7A 5DG9A 2OPRA 4K4HA 4W5QA 4RNMA 1LV5A 5D46A 5CYMA 3VQBA 5J2FA 4B08A 4YXJA 4IFYA 4QW9A 3AVHA 4CF0A 2DFHA 4KHUA 2BCRA 4ECWA 4F92B 4TQSA 2C28A 4TUSA 1WSJA 5C42A 4YNQA 1JX4A 1LWEA 1L3VA 3DMJA 4QWAA 1N48A 1RYRA 2AGQA 8ICBA 4OGEA 3RB3A 3LPUA 4UB3A 3OYJA 1X9WA 3GIJA 9ICWA 4DFJA 4FK2A 4CHOA 4O3QA 1NK9A 3HVRA 4JV1A 2PY5A 3V6KA 2QKBA 4WE1A 5HRRA 1RT3A 4CF1A 1RDAA 3RR7A 2EHGA 4FJNA 2ASJA 3KKRA 1BIUA 2ITGA 5SWMA 1TV9A 4TUQA 3OHAA 4HUGA 3KK3A 2AU0A 4H4MA 3OYDA 3MABA 3OJSA 3AA2A 2Z1IA 3L2WA 3VA0A 3C2KA 2HHVA 4QWEA 2D0CA 2HNYA 5DQHA 1VSLA 4RQ8A 4DO9A 3C95A 5D3GA 4ECTA 3DRRA 3JPRA 4FM1A 3ZSQA 4FJIA 3KD5E 5DB8A 3L8BA 1VRTA 3VQ4A 4DU3A 3RRGA 4DL6A 5KG1A 4UQGA 1GOBA 5KI6A 2X6SA 4W5RA 5HNKA 1ZQKA 4PHEA 3AO5A 5BOLA 3RWUA 1C0MA 2XCPA 4M3XA 2I5JA 2EX3A 2F8SA 1X2IA 1S0NA 4J9MA 8ICRA 1FKPA 4DG1A 5I42A 4PHPA 3PX6A 3VQQA 5KFRA 3AVFA 1TVAA 4G3IA 3NF6A 4ZHRA 5EWFA 5JUMA 1BCOA 1WSIA 3PO5A
chains in the Genus database with same CATH superfamily
3EZWA 2CVIA 2P9CA 4CZCA 5HSPA 1UCVA 3P38A 1L3SA 2NYHA 4EWTA 5F0UA 3FK4A 4Z4FA 4KLOA 1YI2N 1A0PA 1RM6C 3OS2A 5IQ6A 2R7WA 3NF9A 4XK8C 1HYSB 2JOQA 5EGYA 3J7AP 4WYBA 3HKWA 2FHMA 2LYBA 2ZH7A 2RN2A 4M5GA 1UP1A 1YJTA 2BDUA 2M52A 2A0FB 1J27A 1F9FA 3HBTA 1L5UA 1VJQA 4C8OA 4USHA 3SEIA 3HW8A 1HW9A 2JWNA 1WC6A 5FDLA 3HSJA 3CVKA 2W42A 2PGCA 5FJ4A 3A0HU 1IVZA 4FXWA 4F04B 2BMBA 3DCAA 2LYHA 1YZ7A 1IXKA 2HBZB 9ICTA 2B8PA 2XSJA 1KKHA 2JLEA 5AQSA 2DEIA 1RWVB 4N8OA 4FF1A 4LF9F 2CJYB 3A8IA 3MCAB 3GJQB 1WOSA 4WKRA 1HQUA 4FS1A 4DB3A 3CGIA 1OY9A 1X5SA 1FJCA 3CNHA 5JMVA 3PY8A 1UEVA 3CDBA 4B9SA 3TAQA 2VCPA 4HEA9 4E7HA 1S5JA 3Q2SC 4KR0B 3A8YA 4RNNA 3GSDA 4F02A 1JLCA 1W25A 3KDOA 4JNEA 3WC0A 3EZ5A 3R6LB 1NK5A 4DR5K 1FFUA 5HMXA 3QESA 4DV2J 4JI8J 6FD1A 3A3PB 1MSWD 2DISA 1U1NA 4DV4F 2O3DA 3T3FA 4DZ6A 2IHR1 4K8ZA 3PSTA 1OXJA 5AM3A 4MFCA 3BR8A 4J8FA 2Z2YB 3PIOQ 4J9QA 2B3TB 2AX1A 3GU0A 3UKRB 1LNQA 3HPHA 4DR6K 1WAJA 3KHRA 2GELA 2FPHX 2GVDB 1ZQQA 3GDQA 4TN2A 5FPNA 3L2QA 2EZZA 3UPQA 3M7DA 1T3QA 1C1AA 4IYQA 1H0HB 2BM1A 3SPYA 1SIZA 5LSRA 5AI6A 4H4OA 5KPRA 3M8WA 1D09B 1KLMB 1OPIA 3BO3A 2QWNA 3P3DA 3ZT1A 3J80O 1P1TA 3FFIB 2DGZA 2AZ1A 3KHYA 1O0PA 2MQNA 5AXKA 4OKJA 2DR9A 2MKHA 4FJ8A 1LW2A 3G82A 1T02A 2BZFA 3PZPA 2IJFA 4KKOA 2OPQB 4ZPDA 4E3SA 5BN9A 3SQIA 2LP4A 2JEGA 4NYFA 4LF8J 4KX5A 4JWMA 1SV0A 3OXLA 4PH5A 4NZ6A 1AYEA 1T3NA 5HJXA 4N47A 1HHQA 2B4JA 4X4OA 5IT9O 1EWQA 2KKHA 1KVCA 5AZJB 5M1KA 4DPYA 2DFLA 1ZJNA 1WWHA 2HMIA 4CHQA 4PL7A 1BWVA 3IDHA 1Y88A 2HB5A 5KFFA 3DLLQ 4GMKA 1Y3JA 1S4FA 3I87A 4BWJA 3SSSA 2VA2A 4PAAA 4QZCA 1T7PA 3T5KA 3GE9A 3V7JA 4ZP9A 1L7MA 9ICJA 2RQ5A 1S9FA 3WIUA 2JVOA 1BI4A 5F3XB 2DBYA 5A8RA 5DBBA 5L1LA 1RA6A 1ZQJA 4X66F 3OL6A 1UAWA 1C1BA 2KE7A 4KY3A 2EZYA 1PCAA 1U1KA 3T1YF 2ZGYA 3GG1A 3EGZA 4DQQA 3ZTRA 5CHIA 1WKLA 1Y10A 5KFPA 4OLAA 3O4QA 3MR7A 2ZXHA 3CJ9A 2G8FA 2GX9A 3V7KA 2OP5A 2JRSA 2F3NA 4OX9K 3FKBA 3HF5A 1TFWA 1KD1T 2L08A 3EPGA 3Q8RB 4Y0FA 3P83D 4X64K 4I68A 2M4MA 4XDCA 3C6AA 2F9JA 3JPOA 5KFXA 2ZVIA 3FM9A 4IRDA 2QWMA 5MLCV 3CMAS 3IN5A 1QTNB 3PIOL 5H1SQ 2A19A 5D8HB 2ADBA 5DBCA 3FFIA 4CO3A 2DFFA 1PJ7A 2RILA 2BJ7A 3C2LA 3RR8A 3LA0A 4YMEA 1GTHA 2YBVA 4BACA 2W2NP 4BE0A 2FLLA 2CPYA 3QPIA 2ZTCA 2FB0A 3VESA 1CPZA 3ZDDA 3JB9k 3NMAA 4FJMA 4UOFA 1RAGB 5T7BA 1U0HB 5I3UB 2FDNA 4PXCA 4BC4A 4Y1CA 4WIQA 3BO4A 1P9QC 4B3OA 4BRIA 1ELOA 2IJNA 4ZVPB 1VQOS 4OYPA 4C4WA 2OTJS 2DIVA 4NM2A 1WELA 2KYXA 3NAEA 2HBRB 1GLDG 1QQ5A 4BC2A 4CLPA 1Q86O 1Q8KA 1D0EA 3Q8PB 3VGUA 4DEZA 2QKQA 2GCFA 4C0OC 4USUA 2LXIA 4U8VA 3PHTA 4CECA 2CXEA 2WB1C 2KZMA 3ILOA 1QE1B 3HHNB 5GTHU 2YKNB 1VLBA 2HW3A 1RTHA 2HG4A 2V69A 1JB0C 3HHLD 4Q44A 3DWLA 1RAEB 1BNPA 4NEYA 4QIWC 2WONB 4J9UE 1HEKA 1EARA 3PRVA 3OA9A 3V2UC 4I6MB 1NHKL 2BRLA 2G0CA 4CIOA 4ZOSA 3R5BA 4UAVA 2CH6A 3OUYA 2F9TA 4GVLA 4LF5F 5CA5A 4OI3A 3IM8A 2QL5B 5IC4B 1FF2A 4Y2TA 1RBSA 3TSPA 3AB4B 3QBCA 2E1YA 2LQ8A 5A8WA 1XMOK 4KQZA 2W6LA 1S72S 2R2UA 4F4XA 4PEOA 3GR1A 3Q22A 4QS9A 3QWPA 4GO5X 2KSOB 4OQJA 2P9PB 4MFBA 3IAM9 1ZD4A 4DL7A 2XY6A 2GTDA 4ZKAA 3CCSS 3FLCO 2C2KB 3FCVA 4ZPVR 2H3GX 1SBRA 9ICBA 4DFMA 5IQQA 1F9HA 4IS7A 2IDEA 3R27A 2ATQA 3Q8SB 1NUEA 3R8EA 3M5RA 2FBXA 4ANCA 2ISOA 4DR2J 4GNIA 2BV3A 2DL0A 4JN4A 2CZ4A 4FF4A 1ATNA 2UP1A 1KN5A 3RB0A 3WK5A 1HMVA 2QKKA 1GK8A 3OFEA 1RT5A 4X2BA 1HWJA 1K0TA 2N82B 4B9QA 2BJ9A 4KITB 4MK9A 3OYIA 4JI2K 3WNGA 4Y0WA 4P2SA 1NKCA 4P4MA 2Y1IA 1NGHA 1ZQFA 1VQSA 1FI4A 5HO4A 1Z2LA 2LHTA 4H5TA 2QMWA 1ZQGA 2XC9A 4M63C 3SMVA 1H74A 5B7WA 4DV1F 1FK9B 1B0VA 1FDBA 4RQ7A 2ACMA 1DK2A 2RHSB 4F26A 3KFWX 5ALVA 4UB2A 2DGXA 1SGGA 4FE3A 4LH4A 3MGIA 3M6GA 3SLCA 2DF4B 4Y2CA 3ZTSA 4DSIA 4O0JA 4PY5A 3SIPB 2IIRA 4R79A 5DO2A 4Z94A 5EUHA 1MN7A 2F96A 2IDLA 2LKYA 4OX8A 3L3FX 1YJNN 1RAIB 4EEKA 3MM5A 3JPNA 3BS5A 3F56A 4ZOHC 4YN4A 3LP1B 2KN4A 4F8RA 4OPKA 3HI0A 1F5AA 4NYPA 3C2MA 3IM1A 1JXEA 4LFBJ 1MMDA 1NBEB 1CJKA 3D6MB 3S3OA 2HBKA 3EXCX 1GT8A 3AVKA 3HDSA 3SYZA 3F73A 1HL6A 3CCLS 1ZBTA 3HXMA 1QTMA 2VQFF 2PE8A 4S0MA 5AQHA 4OO1J 1TMMA 2PXIA 1TL5A 2E88A 3M8ZA 3SQ1A 3NH2A 1HWIA 3T19A 3BKTA 1NPRA 2O67A 3RW7A 4NLXA 5KG7A 2RQMA 1ZQHA 3OW2M 4KLFA 4PYAA 3ATVA 5B0DA 3H40A 2I9GA 2VQEK 4RO0A 4C11A 1Z00B 3G6YA 3C28A 3ZTPA 1RT5B 3MDFA 4JV5J 5CHGA 4ZDNA 2KJ9A 2NRWA 1Q46A 3R5JB 3PNIA 4OI1A 3CJKB 3KMSA 2XSJB 3JAMU 1KOOA 4RPXA 1LKYA 4F25A 3HHKA 3RBXA 4K0KK 3FZBA 5DG7A 2HMPA 2ZDPA 2JV3A 2ZBPA 2RF2B 5K5MA 3KG0A 2DNKA 3CJ5A 3QGIA 2QSFA 4E7JA 4FO0A 5A8KA 3G9CA 2DGUA 2CQBA 3DRRB 3VMFB 4IO8A 4N76A 4O5KA 3N6NA 4DUZK 4DR7J 3LWMA 1SL0A 1XR6A 1GX5A 1HKBA 2E3TA 1UZHA 3D2SA 2VPYB 2OAUA 4FDFA 4DV6F 3RJKA 4KAZA 5D0HA 3E01A 1FTCA 8AT1B 3L3VA 4BRHA 4Y34A 5DKWA 3DU6A 3VAGA 5J2DA 4ZPAA 4M3UA 3J81j 4MQ3A 4O3RA 2PA3A 1HYSA 1UFWA 2ZC3A 4Y3CA 3AA5X 2EC2A 2G1DA 3K57A 2OFGX 2KO1A 1EQYA 5KFAA 7ICSA 3N01A 2YHAA 2EK6A 4EHTA 4YMOA 1VJWA 1V9OA 3V9UA 5D4OA 2VONA 2W55A 4ELVA 2NRHA 4FCYA 4DS5A 2MMYA 2FJDB 3NUQA 4E1NA 4WFZA 4LFCK 4RQNA 4M3WA 4DUZF 1IR2A 5E84A 2NCKL 2QYCA 2W11A 1KL9A 1RHMB 3GV8B 5IFMA 1J2MA 3W3DA 9ICQA 4H0XB 1Y4ZB 2Z0GA 4MYUA 4M42A 3CUNA 1KD1O 3U3YA 4O44A 4Y2KA 1N4LA 5AZIB 1O5JA 1REVB 3PFOA 4A8WA 3NKYA 3WX8A 3UN3A 4OX9F 3KUEA 3NFAA 3FUYA 4V19S 3I0SB 3IWLA 4DTJA 3Q89A 4NXMF 3PR4A 1RHUB 4E7LA 2N3OA 3BZQA 2QYGA 4UF4A 5DZ7A 2R8KA 3IC1A 5EOYA 1KKXA 4L6V3 2LSNA 3AVCA 1F6TA 4F93B 2DGOA 4HH0A 4URQU 5F0WA 1CULB 3G82B 3AA4A 1S77D 4CH0S 4ANEA 3DDIA 3ISBA 3OVAA 2MKCA 1TL3B 4DJBA 2Y0BB 1C0FA 2HF3A 5J0WA 2GO8A 2Z58B 4LT6A 1NCLA 1HI0P 5KNIA 3MCNA 2QJ3A 4KGKA 4XAKA 4FZXC 3AVIA 5G5HA 2Z7JA 2GA7A 3MTJA 1RU2A 4O3OA 1R27B 1ZYQA 4DV4J 3BN4A 3KK2A 1XO0A 5A8WB 1WHVA 1FRIA 2PO4A 4DU4A 4KLHA 4L76A 1RHQB 2XM3A 2P6TA 2KIWA 4CM2A 2RP5A 1WF0A 3DI6A 2W4PA 1SUQB 1VQ6N 5DDYA 3GPAA 3UDCA 2KFYA 5J0TA 2PSZA 1E6YA 4F67A 3CJ7A 4I27A 4HHUA 1ZM2A 4MO5A 2QB0A 3J81Y 3BF3A 1QSSA 3MUMP 3HWTA 1IKYA 2OTLS 2OD6A 5E41A 2A1JA 1VISA 3EZUA 2WK4A 2MQLA 3E01B 3B0YA 5CAAA 5LJ3Y 1BL3A 9ICOA 1WJ9A 2BH1A 4I2HA 2JH1A 4EYIB 1B43A 3TADC 3CRXA 2B7CB 3L0QA 5F3TA 1E6YB 1Q86T 3Q8YA 4JI5F 2YPYA 2A42A 4I2AA 3HP6A 4EHUA 2PFOA 5BPLA 1FERA 4JKGB 1SQGA 3K7RA 1C1BB 3MN7A 3HOTA 4J03A 4DFKA 3HHEA 2YX6A 1U0HA 3RTVA 4FNIA 4M95A 1SC3B 1TAUA 4ZVSB 1BUXA 5KFKA 5KFZA 2DY1A 3PSFA 1UPPA 4RQ1A 1DTQB 4X66J 9ICRA 1S1XB 2GMJA 4RT2A 2GOLA 2KH9A 9ICUA 4NXNJ 4OX7A 4BRGA 1Z19A 3LQVA 1RTZA 1HBMB 1FXLA 2WCXA 4EU0A 2HBMA 3W2WA 3IG5A 2KI2A 1UA1A 1REVA 2MLYA 5FPEA 1SQFA 4LRDA 3LH2S 1RDCA 4AHRA 1M1KO 3IFRA 2C2RA 1JKHB 1IJJA 1Q7YT 3FSYA 4BRKA 4ILRA 3ZDCA 3JSRA 4HCBA 1T11A 5JVGQ 5AKLA 4OMFG 2UU9K 3CD0A 1F0XA 2XICA 3TKAA 3DDKA 4PPXA 5EX5A 2F1IA 4IH5A 3QATA 5KFBA 5HANA 1H98A 2MZSA 2NXJA 4FJ7A 3NVYA 2FVCA 2IMOA 2GO9A 3TARA 4CF2A 5K14A 4V19J 3AH6A 2PYJA 1T3VA 4BE2A 1DRGA 9ICXA 2W6KA 1V4SA 3TTDA 1IKXB 2DFEA 1J2VA 3CCSN 2JHEA 4BR0A 2YV0X 1CZ9A 3DRYA 4AYBF 9ICIA 3RJHA 1R8HA 2HNDB 3H8MA 1SZPA 2LYVA 1NO8A 4B3MJ 1VQ9S 3EVWA 3HFVA 1EX4A 4M3RA 5GINA 2W25A 5KFHA 3QZ8A 4FLXA 2GV9A 1FX2A 3MCMA 2NRVA 3TTFA 2FGCA 3HFKA 4ECUA 2HHTA 1LW0B 1D5AA 5JRTA 5IT4A 2FJAB 3QGGA 4WU3A 4BC9A 5IXUA 2E9ZA 3CCES 4BRNA 3SQ0A 3PHEA 3AFGA 3W61A 2FZCB 1GXUA 5EU7A 1U2RA 2O6KA 3DXSX 1ZM9A 2DGSA 1L3KA 1QUPA 3IGNA 5KFSA 3W2WB 1WSVA 4M6WB 4JLHA 5D4LA 1GNKA 1NJXA 1N34K 3NVWA 1U1OA 2D41A 4HACA 2HHWA 2IHNA 5KFMA 1RK8A 4A8EA 2UUBK 4ICLB 4QU7A 3HP9A 1O03A 2XYPB 3IS9A 1VOMA 4EBEA 1SS6A 1KCFA 4DPXA 4XUSA 4Y2YA 2OYQA 4LSZB 4DCJB 4J7CA 4F5RA 1NK0A 4DTMA 4BJQA 2MQMA 3PW5A 4FWRA 1TR0A 1IH7A 1OUQA 4UAUA 3DN9A 2ACYA 3AVAA 2E1EA 2V4RA 3TZWA 1S72N 1HQ2A 1DGKN 4JI8K 1O6XA 3V1OA 3KBBA 4JI1F 2OD4A 4E98A 3VWSA 5AZIA 1COOA 4IC9A 2XO6A 2R7XA 1E4FT 3V72A 5D4PA 2X7IA 2EBGA 4FK4A 4ED6A 2XNQA 4I2GA 2XMVA 2QA4N 4CRXA 4F50A 7ICKA 2E1CA 4JI0K 1I1GA 3NRWA 3VQ9A 3KD3A 2BDPA 5ADXH 4OPHA 1VSKA 2EAOA 2VPWB 3NP5A 2CPDA 2KRRA 2D1KA 5J0RA 3G6ES 3DJCA 4Y00A 2FMPA 3VEVA 3B9JA 2B51A 1XNQK 4M5DB 1K73T 5IIOA 3A3NB 5H2FU 4JI7F 5TKWA 2AP1A 4Z4HA 3F44A 2G8UA 4F5OA 4W4MA 3CCJN 3SSRA 2VJ5A 1R8AA 2F1JA 3E2EA 3W9JA 2H4YB 2KJ8A 3M8QA 4QZIA 2WB1D 3ZFVA 3SENA 7ICHA 1RCOB 2M8DB 3WEEA 3ULDA 4L3KA 4ZLNA 3CDEA 2UUCK 1NGBA 4ECQA 1BD6A 3RAQA 1X4EA 2Y9HA 1VI7A 1N5XA 4DCOB 4JEPA 1JIHA 2Q6BA 3NGUA 1FNOA 2ZUAA 3A5MC 3IBWA 3FC9A 5HI7A 1RWWB 4RR5A 5GADI 2MPUA 3K0SA 1EKEA 4IOAL 3JTOA 3IRWP 4CGGA 2CNOB 3A8EA 3KK1A 4DV3F 1QZ6A 3K17A 3NAHA 2IJRA 3EL2A 4B3OB 2KNJA 5AK3A 2BCQA 4JS5A 2FE9A 1VQKS 3VPZA 3S3NA 2FMSA 1TFRA 2PFNA 2JEJA 3PSIA 3KJVB 1JLBA 4KN7A 2G2OA 4PHDA 3KMQA 1ZQEA 4KBIA 3EUNA 2AQ4A 3KK7A 1LFWA 3IRUA 4DQIA 2VKZG 4JV5F 1BPYA 2R7OA 1M1GA 4OLPA 2NRZA 4UZCA 1NG9A 3SDEA 1H7XA 1FNXH 1XNRF 4YP3A 3BBFA 4WTYA 3K5NA 5ALRA 1S6UA 4J9VA 4ER8A 1RAFB 2MZ1A 2Z2LA 5J2EA 1ZD3A 2Q3SA 4OYIA 2W3RA 4AILC 3LDAA 2HKEA 2DR5A 2I2YA 4YOEA 3NE6A 1RADB 2Z30B 5AQPA 4I6MA 2Z8QA 1BA1A 3OR1B 4JB3A 4QIVA 3CCVS 1Q95G 5F8IA 3RJEA 3EY1A 4KTWA 4Y2SA 2NYVA 2C2EA 4J5OA 1QUVA 5KOXA 4F4WA 2ZKTA 1S12A 2RJZA 3M9MB 1SQKA 4JV5K 4CFBA 4OPJA 3MM5B 3TJ8A 3FEZA 1NGJA 1XQSC 5JMNA 3ZEUB 3SCXA 3P31A 3C66A 4ZLLA 1IG8A 4JKAA 5J1EB 2Q3PA 3ORYA 1NB2A 3QUBA 2UV8G 4CEZA 3X1LB 3ZDAA 3QGHA 2FLNA 2CJKA 2WSFC 3AO2A 1DZ5A 5B66U 2ZM6J 4QWCA 1RT4A 3FC4A 3Q8VA 2Y8WA 2QWQA 1OVQA 4A2AA 3HM9A 3B4MA 4CJ7A 2K8AA 4MHVA 5KFIA 1TFYA 5GIOA 3OYEA 1X31C 3CCLN 4FKXA 3H8YA 3IFEA 5HR7A 4QJVA 5DZ6A 4FJ9A 1DEJA 2BQRA 1QD1A 2AJ0A 5ALWA 2VG5B 4KHWA 4LBPA 4FJ5A 4B1ZA 3A8JA 1DFDA 3RBZA 1N61A 1YSJA 5AKKA 2DB1A 3QO9A 4TYAA 4Q5VA 2YJEA 4Y2XA 1ASUA 2HVDA 4JI6K 2RB7A 1S1WA 1YT3A 3SEOA 2C3OA 1N8RO 3AY9A 5AQNA 1HUOA 3VEWA 4C3MA 3QQCD 1DRZA 3DYAA 4DN9A 1BGXT 5B08A 1ZOLA 3CDAA 2LI6A 3NBPB 1HI8A 3WUHA 2W9MA 3UCGA 2CH5A 3TRGA 2QW9A 3UNGC 3AN1A 1EETB 1N52B 4HHTA 3TA0A 3AXKA 3S41A 5J2BA 3Q7CA 3N97B 2XWXA 4FP9A 4FPIA 2ZJAA 1RT2A 2XVTA 5F9LA 3HSGA 4G6VB 2ZQBA 1IBMF 2D0PA 1BO5O 3AV9A 1JJ2M 1UVMA 2DKOB 1SJQA 4P10A 3LAMA 2G8HA 2FIUA 2X78A 3S3MA 3J7Z5 1AT1B 1NKBA 2KIVA 3KDNA 4NWBA 3BPDA 4R63A 4CLLA 3EUB2 4J90A 3ZSYA 4AHSA 1KSPA 5H9FJ 1KXPA 3E9PA 3CHWA 1CULA 4HUFA 3S01A 3SBTA 3H4DA 1D1UA 4O3NA 1GMVA 1RAOA 2ZJPQ 3K1ZA 3NMUA 3DGVA 2YWGA 3NGRA 4QQBA 1MLAA 1B4FA 4RU9A 1RILA 4A8YA 1M5KC 2QN6B 4X64F 3C6HA 2IRXA 4YY3F 1SAZA 4OHZA 2IM0A 4MDAA 1YJ7A 1P7DA 2X1FA 3R1LA 4XO0A 3B6OA 5KPZA 2OKQA 2UU9F 4NLKA 1NGFA 1SJRA 1S22A 8ICCA 5E0OA 4ECYA 2HOIA 3J7AN 4DTUA 2MZRA 5IZHA 2HSZA 4KLSA 3WNHA 4ED2A 3ISZA 3KG4A 1VK0A 1H3DA 2HAFA 3WK4A 2KVIA 3L09A 2NO5A 3GCWP 3I33A 3O1WA 3D6JA 3D3CJ 3OUYB 1EQ0A 3AO4A 2LXUA 3KJNB 2YTCA 1BLUA 4YHHF 3IG8A 3QBXA 3MWBA 2W8KA 3UQSA 2E8NA 4CF4A 3KLFB 4CEFA 4WJBA 4DFDA 4JK7A 1WG4A 4CLKA 1X5TA 2ZC4A 5D0EA 4K59A 1O8BA 2VQEF 1Q82O 4YR3A 1TAQA 3FZHA 3V1QA 1LWEB 2RUSA 3O4WA 4WFNQ 3WNEA 4FM2A 1AFIA 2BGGA 3FCWA 2ZVSA 5AM1A 4ZK7M 3MFIA 2O8FA 2AZ3A 4ANDA 5ALNA 3RSEB 5GAGI 1NMNA 3ZETA 3HK2A 1LAVA 1BG3A 1S1WB 4ZVHA 1V85A 1KAXA 5DDPC 1YXQA 4Y6IA 2XMKA 1U2VB 1NBWA 2WMMA 2E1ZA 3SCLE 4ILJA 1EXQA 3HVTB 2QB1A 5CYQA 2OPRB 3I56S 3I5BA 4WWSA 2KM8C 1SB3C 4M0AA 1IKYB 2UVWA 3GV5B 2J6TA 9ICFA 5KGXA 1BHLA 2NNWA 5EWEA 4I2BA 3MCOA 1C0TB 4JHDA 5L8RC 1X9MA 4LJMA 1S9EA 5ETOA 2ZUGA 5EHHA 1Z00A 3PYDA 5HMMA 4DSLA 1V38A 5FPMA 1RU1A 4R5PB 2J76E 2IRYA 3K0JA 3IHQB 5DDQC 2UYTA 3F2CA 4KLIA 2IVNA 4CO5A 2FBYA 2O8DA 4NLNA 3ETOA 3ZZTA 4ZN3A 2EC0A 3LZIA 1ZQWA 1YQHA 2HHHJ 4DV5K 4CJEA 1NGDA 1VSMA 2ITMA 3MPVA 1KAYA 2EDUA 4FWNA 3DOLA 2PFPA 2VICA 2YY3A 3HHLB 5KFQA 2ZBIA 3DU5A 3UR3C 5F8NA 4FF2A 5D46A 1KR4A 1YJ9S 3FGVA 3K8VA 4LF8K 4CF0A 2V0NA 2DFHA 1KQFB 2HQIA 2BCRA 1VLYA 3THWB 3HKZF 3ENWA 3RSEA 2C28A 3R2CJ 2LKZA 4YNQA 2FF6A 1DGJA 4IKAA 1ZC6A 1N48A 1X5OA 3J7YI 4OGEA 3RB3A 3J81O 1DBDA 4M94A 4UB3A 1WSRA 3OYJA 5GAGU 4O0NA 9ICWA 1P8GA 3WEEB 4FK2A 4NPOA 4I6AA 4CHOA 1L7NA 4O3QA 1YBAA 2ZDOA 5KL1B 4C8YA 1TL7B 5ALJA 4CF1A 1X9JA 2EHGA 1U24A 2YXLA 4FJNA 4HAIA 1FJGK 5HVGA 1FD8A 5SWMA 1TV9A 4TUQA 3OHAA 4HUGA 3KK3A 1BY9A 1QCKA 3NS6A 3MABA 3OYDA 1QQ7A 1J5OB 3AA2A 2HHVA 5LMNJ 1N34J 2D0CA 3CW2C 2BVZA 5ETPA 2FC8A 5D3GA 4DR1F 4USVA 4FJIA 5C2CA 1FTRA 2BE7D 3CCRS 2NO4A 4OI2A 4H03B 2OELA 4XH5A 3PSPA 2WVEA 4DU3A 2RHKA 2CPHA 2RHFA 1GOBA 5GTIU 5KI6A 2QZ8A 4BRAA 5CD4H 2QEXS 2JZ5A 2LU2A 1LFPA 2DXDA 3ZZPA 2F2AB 4DUYK 4FPRA 5AE1A 4M3XA 4GFJA 5LMUJ 2ZIXA 2RRBA 1PK1B 1H2UX 2DNQA 1WHYA 2OLWA 1YZ6A 2K4PA 4YB6A 1VQNN 1WSIA 3PO5A 3M8PB 5D0GA 4LQ9A 3WT0A 2PKEA 4GXIA 1JL1A 2W4DA 2IYIA 4A8KA 3ET6B 4DV2F 1OW5A 1U45A 2DEJA 3SNNA 1RBTA 4ZVQB 3NY0A 3T79A 1VQ4S 4YOUA 4B3RJ 1QVGR 9ICHA 4K2XA 4M5MA 2YWHA 3MEEB 2A2DA 1ZM4A 4CT8A 5J2QB 4PRFA 2CZVC 3JYTA 4Z7CA 2QX0A 3CQ8A 1RGIA 1CVJA 4KTZA 2BABA 4B8CA 7ICLA 4KV8A 4OZ5A 2H3IA 4L74A 3LGHA 4ZCKA 7ICMA 1GEHA 1VSHA 4RQ2A 1HNIA 3GE1A 3AD7C 1FO1A 2XYHB 4Z4GA 3ENVA 1ZD5A 4EELA 3OV7A 1XSNA 4ISEA 3G4SN 3TO8A 1BWEA 2J9DA 1TK8A 1BU6O 2I9SA 1KQGB 3THPA 3POTB 5G0RB 5J1NA 3ZD9A 3HFZB 5K20B 4OJGA 1X9SA 3RGIA 5D3GB 3OTDA 5DS7A 3HD1A 1PBUA 5FP0A 3LVVA 1Z1BA 3NVKA 2B9YA 1NGIA 2LA4A 4O4GA 2DY9A 2QL7B 1XMOJ 1V3SA 1OVYA 3NGDA 3IR5B 4ZVUB 3R1XA 3BGFA 2BKNA 1U1QA 1TVRB 2YX1A 3A0BU 4Z4CA 3UCZP 3K4GA 4ED8A 3FVYA 2PI5A 3D54A 2FHKA 3BN7A 3GMGA 1U2FA 2O1PA 1R59O 3NNHA 1GLJO 1VIXA 4I2JA 3ENAA 4NLDA 2O8CB 3QUQA 1RTJA 2HQGA 2GUPA 2R18A 5JS2A 8ICXA 1JN3A 3BV8A 4JKDA 1CJVA 2ZJQL 4EYHB 2HWTA 3AJ2A 3A3OB 3C8YA 5IINA 3CO0P 2HFOA 1P1LA 4YR2A 3VGLA 2LQJA 2G2ZA 2UUTA 4G65A 4L8RB 3FZFA 2V8PA 2MGZA 3FR0A 4DTPA 9ICKA 4B3MK 3CC4S 4RWWA 1SJ4P 4NX9A 2O8CA 2BE9B 3HKZC 2BPFA 2VANA 3O9SA 4MIAA 4E89A 2EANA 3C6TB 4AD6A 1J5EF 4ZS6A 4CO1A 1MN9A 3CJQA 4W5OA 3KHGA 4K4VA 2VJ4A 4H54A 4YB5A 5J0OA 2LDYA 4DX8H 2CDQA 4Y2IA 3PEJA 4DL3A 3ZX2A 4CEDA 1YVUA 1EJ7L 1VQ7S 3NOGA 3AAWB 2YMPA 2FHJA 2C2MB 2HZAA 4O5CA 3OYBA 2VFRA 3ICLA 1CZBA 3EW9A 2A3VA 4LZDA 1NK4A 5HQMA 1CBKA 1A76A 3UMBA 2Z56B 2W8LA 1KWMA 4KH0B 4CO2A 3NRZA 2A6AA 4MO4A 1JXLA 5FRNA 4HCCA 2PEBA 2DGQA 2V9WA 3CC4N 3RBEA 5CCLA 4MH8A 4A8QA 2Q0ZX 8ICLA 4NYZA 2B5JB 2XBPA 1E3MA 1EO1A 1HNXF 4DLEA 3NGYA 1FRLA 1T9VA 4PABA 1NNDA 2HFZA 5LSLA 1EIYB 2OI2A 3DGPA 3R5CA 3CMEN 2JEFA 2GGPA 3SZ2A 4IWVA 2HI0A 4I29A 3PMNA 1YX2A 4CO0A 4B8AB 5GAEI 1BI4B 1XNSA 4GW6A 4CO4A 2GHVC 4M9JA 4CZIA 4OFZA 1FK9A 4JOUA 2P9NB 4NV0A 3IM9A 3RB6A 2A3JA 1L3UA 3OBIA 4QPXA 3H08A 2NSBA 1R0AA 1QSYA 3QEAZ 4JWNA 4M63A 3IWXA 3LDNA 1RAJA 5AT1B 2XMAA 5D15A 4CESA 4CH7A 4IZ9A 4X84A 1BQMB 2W54A 1GOAA 4CZGA 3DLRA 3C7NA 1RT1A 4OZNA 5IWAJ 4USTA 4PL8A 2HGLA 1Q4RA 2IRUA 4EFHA 2GX8A 1U49A 1NZPA 1JLAA 3U1NA 3GILA 4YOYA 5KOWA 5BREA 3UKUA 1IN0A 1B0XA 2FC0A 1NEEA 3OSPA 5DRKA 5KFOA 1S9EB 5KG3A 4NL9A 2UUAF 3B6PA 1BQNA 5SZTA 3T41A 3D2QA 1XNQJ 1CXUA 1Z2ZA 5KT5A 5K8PA 2MQOA 3NVMA 2XQCA 4YXMA 2G06A 4RUHA 4FOIA 1VK8A 4B3TF 3EXYA 3A5OC 2BPGA 2GJ2A 3O3LA 3WBZA 2HHUA 2P5OA 3MDQA 5AK6A 1TUUA 2ASYA 3NS7B 1WCNA 4ZJLA 2V52B 1J97A 3SV4A 2O8DB 4IG3B 4M5DA 4AL6A 4LF4J 1UT8A 3IG1A 5I3UA 3UPFA 1NKEA 4DTSA 2CJXB 1U2VA 2ZZMA 2CPFA 1SWWA 2R2RA 3H45C 4X5VA 3N7SC 4Q2LA 3H2VE 2HFVA 2KSOA 1UA0A 4CDIA 3F5EA 2NRRA 4FZVA 2QMUB 4IL6U 4TU7A 4C11B 4DR3K 5M1FA 4CBXA 5IS2A 1R8PA 2ZIUA 2Z2ZA 4H4KA 4RCHA 5I4MA 4CI0B 5F8HA 1HRHA 3Q7BA 3R7NB 1C0TA 4JHDB 3L9ZA 4FNHA 3H1VX 1BNOA 1RA7A 5FROA 3GYXB 3TZZA 4LVOP 3MEKA 1HR0F 2WFBA 3QZ7A 4QZAA 1B0TA 1R0AB 4HLBA 4QOTA 4LBIA 3PDNA 2X1GA 2ZIVA 3ONNA 3CC7S 1VQPS 1HBOA 2GBZA 2AW0A 3NXZA 3WX4A 3ISCA 2CNLB 6AT1B 4AXIA 2P9SA 2P9NA 1IWGA 4CNZA 1B7YB 2WF6A 1HUXA 3OVNA 4BR4A 1R0BG 2VHGA 1KDNA 1ZS6A 1M0SA 4J9KA 4RX6A 2IOCA 4X4TA 2HS0A 1FRHA 1KBRA 4C7QA 3B4DA 2PFFB 3OYLA 3M8RA 2CPJA 2HNDA 5DDOC 2EFNA 3H3NO 2JSXA 2XGPA 3CI5A 5AM0A 4M3ZA 3ZXWA 2V6AA 2QXLA 5HRSA 4B9NA 2L9DA 3EPIA 3CCRN 4IOCL 3AQEA 2C2NA 2I5JB 3M05A 4H4KC 2BACA 2AJ4A 3GZFA 1RTJB 5THWA 3C1YA 4KE5A 5ELZA 2D9PA 1DAXA 1Q9YA 2FXUA 3UD5A 2DK2A 1L8OA 4F7VA 4CJTA 3W65A 1Q8IA 1S5LU 3EE3A 5BN8A 2OM6A 3V5RA 3CCMN 4IJAA 3VHQA 3VAMA 3AQFA 5F9NA 4MF2A 3BS9A 1RP5A 4NYOA 5LOQA 3QNWB 3K9KA 1IR0A 3UN5A 5JVHL 3QYPA 5BR9A 2D6FC 2AF6A 3VF4A 5GAEU 1XSLA 4J9SA 3UR0A 1ZRNA 5ALDA 4BR9A 2HGNA 3J7ZO 4WCEQ 4ED1A 1GLAG 5DB9A 3DAWA 4ISGA 3LDLA 2Q4TA 3BF4A 7ICOA 3BF1A 2J0XA 1Q1KA 2DT9A 1RAHB 1DT9A 2K7JA 1WC3A 4HTJA 1FDAA 2DRAA 4CJFA 5ALEA 3ZEUA 3QSYB 2G07A 1FT8A 3BB5A 4HH1A 2HFSA 2ZM6K 4O4RA 5J1EA 3HULA 2E44A 4UY8O 4TU9A 4DR5F 3A0IX 2ZKUA 3M6WA 4DV4K 3QNOA 5KT2A 7ICGA 4FLZA 1CS4B 5HBMA 4RNOA 4LR7A 4LFAF 4CK3A 2KKZA 3D67A 3OR1A 4IDKA 3AOAA 4DBQA 4DR6F 2HWIA 1CSJA 1Q81O 3K5PA 2M9NA 3F9KA 4C0BA 5FPDA 2HURA 3CULA 5HRPA 1FNMA 4CZLA 5EE1A 2F7TA 4W90B 4LIRA 3P49B 2OEKA 3M8PA 1KVBA 2ZBCA 5AM4A 2C2DA 3KK3B 4Y1DA 4BGDA 4JI6J 3ZSVA 5LJ5Y 1T9YA 2BTFA 4RW8A 1X7VA 2HHHK 1EB0A 2P6UA 2HBQB 4GRSA 2VGMA 5EWGA 2OMLA 3ZNUA 4DR4K 4QR2A 4TVAB 3R97A 3O5BA 1JJCB 2AIRB 3EJMA 3BQ7A 1T8EA 3KJVA 3SAGA 4A47A 1X9XA 1AXQA 3MTKA 1C4CA 5GAHU 3GG0A 3AGKA 3P5JA 2IVOA 5A76A 1HA1A 4YD1A 2YWWA 1YBUA 1ZQNA 2KXFA 2F5GA 3LVWA 4CP5A 1NWKA 2ZNYA 2A41A 3C0BA 3VF2A 4UOHA 4PKGA 3J8AA 1UMJA 3OSNA 1ZZNA 5M1PA 2RDDA 1W9HA 5DLFA 3QT6A 3H0RB 1UETA 3D1HA 2F8TA 3UVJA 1FFSB 2XI3A 3D5MA 5EDWA 1OJ4A 4KLLA 1RCXB 2UZAA 1D4XA 1TV6B 2CQ3A 4E0DA 1YRTA 2G0AA 4IR1A 4RW4B 5AQXA 1X8DA 4QZ8A 1WG5A 3H6EA 4MLHA 2CG8A 3VAIA 4KKOB 2P6SA 5BJRA 2B0GA 2F9WA 4X66K 2LEPA 9ICMA 4NEZA 5J2HA 2VC0A 3EEQA 1TVRA 4AH9A 4O5FA 4JP8A 1IBKK 2F40A 3HL8A 4LSNA 2VOPA 4ZITA 2CPIA 3BREA 2HCFA 3M2VB 2OFHX 2IVFB 3PEHA 2P5GA 2YN4A 4BC5A 3DDNA 3SUQA 2YMQA 2GVZB 1IG6A 5JVHQ 2B56A 4A8XA 3DI6B 4FWPA 4LSLA 3AO3A 1QVFR 5D6GA 3HPOA 1W2IA 1M1KT 1OIAA 3W5YA 1CZAN 4BVPA 2K4EA 4QYZJ 1VJ5A 5ETMA 1GLEG 1RTDA 4AHUA 3CE8A 4B1WB 1VK3A 1LKYB 5LMUK 5AQOA 3TWHA 2VG7B 3GTYX 2MJUA 3NG8A 1VFJA 2R7SA 1K8AT 3TAGA 1L3TA 5JLHA 4ZP6A 1UPHA 2H5JB 1TU0B 2XWYA 1HBOB 3RUBL 3QFUA 2K8CB 4W98A 5TZVA 2QLFB 3BGLA 4YS2A 2FUG9 2ATLA 1CC7A 3V4MA 3EVOA 4UB6U 3ET6A 4AQYF 4H0YB 2LA6A 4ES1A 4GV9A 4YEAA 2BCUA 2Z1JA 2QIFA 2NZCA 4OJOA 2H3QA 3M32B 1FKOB 2QFJA 3LZJA 4JI2J 2GQ2A 2ROGA 5HBMB 4NXZA 2E1FA 3GSIA 3GB0A 3OHBA 3LAKA 5GVQA 1S76D 5T7LB 1LAWA 1B64A 2A5XA 1RQ0A 1DTQA 4CWBA 4OJPA 2E5LF 5MLCQ 2F8LA 3VN5A 5EN1A 4OKEA 4C3LA 3WKBA 3JTPA 1OO0B 3L2RA 4BE1A 2NLXA 3L95X 3L5KA 3NS1A 4RUBA 2CQCA 5ALYA 1NK7A 3I5CA 5IILA 4K4ZA 1YJWN 4ID1A 3F2KA 4V19X 1LXJA 1T95A 4B3TK 3LALA 1FJ7A 2XI9A 3C46A 1D8YA 2NXEA 1VRTB 1VSFA 3BYRA 1KP6A 3GONA 1B3TA 1S49A 3PJWA 2DH8A 4G1IA 3WQPA 4K25A 5A0LA 2XI2A 2V8DA 2J7WA 2RE2A 4RQ4A 1NZAA 4I9QA 4K4SA 4NLTA 1GMWA 2FLPA 4CD3A 3E58A 1TUGB 5HMLA 4C4RA 4M6WA 3FAHA 2YX7A 2ZJQQ 2RAQA 2KQ2A 3NF7A 4KTQA 1NXIA 3W3SA 4Q7AA 3AT1B 1CQNA 4WTOB 3KLFA 3T7ZA 4JYAK 2DGTA 4O4GB 1QQNA 5ALMA 3KKAC 1BPZA 1MQ2A 1KNZA 3R8YA 3FMBA 1FDDA 4M41A 1JLEA 1ZQUA 1ECWA 4F5PA 1XMQK 8ICVA 3VGSA 3MURP 2KZ3A 3H1QA 3FJ2A 3J7A1 1UEUA 3JAMY 3IXQA 1F5SA 3DDHA 3ASMA 3E3XA 1DTTA 1NZBA 2DRBA 3WXJA 2V7YA 4PQUA 2ASOA 4BREA 2X1BA 4DQPA 1XBWA 5RUBA 4CEBA 2XMJA 4M3YA 1S59A 3Q86A 2KOBA 1HUZA 1N33J 4WFBL 1PBAA 2DWQA 4H0OA 4TXSA 4PWUA 2NLWA 3JSMB 4JI0J 3NNAA 1S9GB 3KK2B 5KFDA 3ZSXA 2ILYA 3IG1B 1YTUA 4H8KA 2MQQA 4C8LA 2E5JA 4FLYA 4P2XA 4PHTX 4JV0A 4M8LA 4JKGA 3MWPA 4WP9A 1TE2A 3L2UA 4I2PA 4OJ6A 4ILGB 3RAMA 3A5LC 4GXKA 1N54B 3CC2N 4LMZA 3N4MB 1RWXB 4MLEA 1HMVB 3DHWC 3PX4A 3C65A 4AL7A 2I1QA 3ZX0A 4KC5A 4I64A 1KRPA 4PR6A 3ENQA 3A5NC 5LMNK 2D69A 5ALTA 1K47A 1HFEL 3OFHA 1VAZA 1RWUA 2A40A 2F44A 4HI1A 4ECVA 5E3CA 5F41A 2MRLA 4L73A 1FRKA 5AQFA 3TZYA 4K4YA 4XH4A 2OTLN 1N5WA 4KLGA 3LDQA 4DV1K 2AP6A 2KKVA 3QYYA 2WHOA 2DNOA 2HIYA 4KGZB 1JL2A 3THWA 1MWYA 5IWAF 2R9LA 3NNCA 2ZH9A 2PT0A 5CYQB 3BPSP 4RQ3A 2HMXA 4U9RA 4IFYB 5AKGA 2PMHA 2DKZA 3W8GA 1XNQF 1QQ6A 4CNQA 7ICPA 4K4UA 5TKYA 4A2BA 1QDUB 1XHXA 1QM9A 2WVDA 1UW4A 2O66A 4MT1A 3ONQA 4X4NA 5HP4A 1MROB 2K1RB 1H38A 2F77X 1PVRA 5FLXY 4OI6A 2ZIUB 1AQ6A 5A2QU 3LDOA 8ICKA 1WEYA 2EKYA 3QEXA 3K75D 4BDPA 2KZZA 3DLLL 2MYFA 9ATCB 5KRTA 5HOOA 2K2PA 1BQMA 4CZMA 2G2YA 4LF2A 2QLXA 4DHYA 3BZCA 1D9FA 3VQAA 3H0MB 4RWXA 3I96A 2ZJRL 1BUPA 2JFKA 4C1NI 4DQ8A 1P90A 1F5BA 2B4PA 1LW0A 2ZJ5A 4IO9L 4QAGA 4DLGA 1BWFO 3SDEB 3CC7N 2H1YA 4CJVA 4NMLA 1NJWA 4I6YA 4KLTA 1NDPA 4PGYA 2VASA 5J2AA 1B4SA 1EETA 2LCWA 4UY85 3KJFB 3LL3A 2F4VJ 2P66A 4GKKF 4C0ZA 4F4KA 5E3QA 4RUCA 2E29A 2G09A 3LP2B 4I0WA 4JBCA 4BG9A 1Q9XA 3QB0A 2H9ZA 2GQCA 3T6BA 2KJVA 3OL8A 3I9V9 3H20A 4NI2A 2DCLA 1Q8BA 3CFRA 3MPWA 3HRDD 3ID6A 2A1RA 3SCKE 1U4BA 1FFGB 2DO0A 4OCZA 1YK9A 2XMTA 1VQ5N 3R2DJ 2VZ9A 3Q8QB 3UE2A 1X6JA 2GEMA 1TP7A 1ZETA 3IKMA 1Y9OA 4CE6A 3KHHA 5L1JA 2G8IA 4NLZA 5CD4A 4RT3A 4K4GA 5BR8K 4P9SA 4Z4EA 1WNSA 1YJVA 1QJHA 2JNJA 4RW4A 1WG1A 2XRIA 2B4UA 4CRJA 2B6GA 3CETA 4CYUA 1RACB 3FBFA 3P45B 4KHQA 2MXYA 4DWIA 4U95A 2BJ3A 2NRXA 4DU1A 4KLUA 2C3YA 2BKPA 3T1AA 4HVZA 3W7BA 3M3ZA 2V5HG 4LREA 2PZSA 2KHDA 3RMAA 2BXJA 2ZG6A 3F5AA 2GV1A 1T03B 1R3NA 1HKAA 4FZNA 4LFCF 4IH7A 4B6JA 4LF7K 2Y1RI 1D8ZA 1U1LA 5LXYA 5L39A 3VVTA 1RAAB 2XG8A 4USAA 4MIWA 3TW0A 1XNRJ 3O9RA 2V63A 3TR8A 2GIFA 3BDEA 3U1LA 3OVSA 5HL7Q 3PLAA 2E1AA 1S0MA 1T94A 3H59A 4TY8B 2IOHA 3V6JA 2UVRA 3LP2A 3D0PA 3OBWA 4I2FA 3NGKA 3W9IA 4M5HA 4P2FA 1ROFA 2LXFA 2HBYB 5AQTA 4OZ1A 3OYMA 3ETRA 5DBAA 1TKTB 3BGOP 4I7FB 2RQ4A 4I2EA 2E6LA 5KT7A 2CJQA 2LU1A 3DC2A 4USMA 3VQCA 4LD0A 1Y97A 3DOMB 1JNRB 3MGVA 2HHQA 3LGMA 1WCLA 1FWKA 4CJSA 2QL9B 4LFBF 2G8VA 3EMTA 3KOAA 4LF1A 4LF7F 2VG6A 4PGXA 4AL5A 1RT4B 3O1BA 3D1QA 3QRPA 3M32A 1YVNA 1WUDA 3HVAA 3D9BA 3J80Y 2PMZF 3MPUB 3WK8A 4X62J 3CMES 1VQ8S 4U96A 3QT8A 2BW7A 2E7WA 4O5EA 3SUOA 4K5RA 1TK0A 4IG3A 2GAGC 1ZPVA 4ZTJA 3BSAA 3QNMA 4DV2K 4P71A 1DARA 2E8AA 2JWLA 1QHTA 1XR5A 1RWOB 2AMCB 2Y3YA 3TSUA 4E7IA 1ZQRA 1WKJA 4JI4K 1ZBIA 2D3UA 4F0MA 1TKDA 3MM9B 4EZ6A 4USIA 2AQ0A 3FYHA 4MEXA 1ZQYA 5CZ1A 3RF9A 2WBMA 1NAQA 2DNPA 2OXOA 4OYWA 4DKWA 2RVJA 1IIPA 2YPZA 3U9ZA 4FLVA 1HNIB 3MEEA 3SBMA 3CPWM 4TYBA 3OW2R 3P5BP 4Q2MA 3ZD8A 4OHYA 8RUCA 2ZZTA 1IBMK 4PHAA 1F5CA 2K8GA 3J7YP 1FVSA 7ICEA 4DPOA 3KWIA 4TQRA 2KN7A 5ITHA 1RFQA 3S1TA 3HHLC 2UUAK 3E66A 3UQ0A 1B7FA 4HKQA 3ZZZA 1WHWA 4JI4F 4KPCA 1NJIT 4MKYA 4M7YA 2J5AA 4LR8A 2W9AA 4F4ZA 3CJRA 2B9WA 2N4CA 4B9VA 2VFVA 3EGNA 4LF4K 3C94A 4M9LA 2UUBJ 1R6YA 3G86A 2LQBA 1RTDB 1A7GE 4IKFA 2DGVA 1AZSB 3POTA 2XCAA 3VA3A 4DV0K 3TJAA 4PQUB 1U48A 2RH3A 3NCPA 2NUHA 5BRDA 1JLBB 5E3AA 1CXQA 4LF6F 1HI1A 1IUJA 5J2CA 2WTFA 2ZUCA 3QFHA 4D3GA 3VAHA 5ALHA 1U7LA 2UXBK 2PD1A 1S9GA 4MIBA 1C0UA 4I2CA 2MDAA 5HL7L 4KV8B 2A1SA 2MTLA 3CCEN 3LTOA 3K1RB 3HILA 4OHWA 4QNLA 4IUFA 3G4SS 3UM9A 3GQCA 4QPTA 1FW6A 2LLZA 2O8EB 1SH3A 2BOAA 2BPCA 4E7KA 2VA3A 1MC8A 4HWIA 4F4YA 3ZDEA 3OTOF 2R2TA 5KFTA 1X6IA 3GIMA 2HZVA 4I67A 4B3SJ 1JWWA 2GIRA 1UT5A 3CJBA 1IM6A 4MDBA 5GMKa 3ZI4A 4DV0F 3GV7B 2RRNA 2Q0RA 3G87A 1IO2A 4NRTA 3NVVA 5DM7Q 4NXMJ 3T1HF 4X64J 4OYAA 1JLEB 4KRFA 4P74A 4IFVA 2RNEA 3QETA 2KK0A 4PG7A 4OZ3A 1PYOB 1EKSA 1NMEB 3LW5C 3GIIA 3MC1A 2HQ3A 3TEGA 3ZT2A 4FJLA 2EQYA 2ES6A 2WOMA 3B8AX 1ZTTA 3QO9B 1VQMN 4I1TA 3EICA 4A48A 1SVDA 1YTAA 4LC9B 4NA2A 5K4LA 1Q7LB 3THYB 2J8SA 2HLTA 1Q8LA 1N36F 4HR2A 2H54B 3JSMA 3WK9A 5A0YA 4DXLA 3VQPA 2N4DA 5HATA 3RRKA 5AFUH 3MR2A 1HWKA 2MHNA 4KHNA 1VHXA 1ACMB 3EZOA 3O3FA 3H46O 4QS7A 3SUNA 4UB1A 3OFGA 4WFAQ 4JUZA 1VYAA 5KG2A 3AO1A 3M6KA 1XN9A 4GKJF 1RDDA 3WQUA 2HRYA 2V2KA 1RQLA 1GMUA 4DUYJ 2DHHA 4ID5A 1ZQ1C 2KJWA 3GJTB 4BC7A 3C6TA 1K8AO 3SAFA 2IOFA 1RT7B 1UEKA 2BGWA 1ZBUA 1RPLA 2DY4A 1VQ6S 3BM7A 2P9KA 3SI8A 5K8MA 2W41A 2W2OP 4OKKA 2ZJPL 1XO1A 3E8OA 1U1PA 2FJXA 1AUDA 4U7BA 5C2GA 2H5XA 3LO3A 3ULHA 4J9RA 2R8IA 4Z2XA 4O55A 1YDLA 4WFXA 3AARA 1N33F 3JPSA 2AEMA 3HM8A 5IWAK 1BQNB 3OXFA 2L5YA 3F5TA 4QIEA 1RT1B 3THXA 4W5NA 3S6EA 3I55S 1W97L 2VQFK 3VEYA 2JZBA 1N32J 2MUTB 4PL1A 3HD2A 1XU4A 4F5QA 3CD6S 2WBRA 1WDDA 1Y00A 4TNOA 4Y2JA 2OWOA 1JLFA 5J0YA 3K59A 3NLCA 5HVHA 3QT7A 3L4PA 2K1RA 2NSCA 3DLJA 4IOBA 2HS4A 2YKOA 2F9DA 3RH5A 4C8MA 2NS1B 2HYIB 4CGDA 1VGYA 1ITGA 1UJ5A 3R5AA 1F2HA 4DV6K 4R0JA 4FYXB 3KG1A 1IKXA 2R7RA 2VKRA 2HOEA 1NGAA 3NEKA 3N9UC 5LL6Z 4Z7YA 1VQKN 5G4DA 2EBEA 4CZFA 1EKRA 4R25A 4DQRA 4F0HA 7ICRA 3VAJA 2ZH2A 3ATUA 1XTZA 5M1QA 1CRXA 4WFNL 3AVLA 1UVLA 4F91B 1RYSA 3JQKA 4ZVGA 4GXJA 5E3RA 1KVKA 3HHLA 4BR2A 1G7CB 4JI3J 1CLFA 4F3TA 3JYTB 4RW7B 4LRBA 4OYMA 1E4GT 4X4PA 3QJPA 1M5OC 1CI4A 3ZCMA 1M90O 3TADA 1WWVA 2M3DA 2P6RA 2VA8A 4DSKA 1W7AA 3LM9A 5HJYA 2RU9A 3V7LA 2QA4S 1T4GA 2VODA 2XHBA 1WN7A 1KHWA 1HWUA 3A12A 1BPBA 4UATA 1GH8A 1MU2B 2GW8A 3TU5A 1HBUA 2WRMA 3SQGA 2BKOA 2UUCF 5GADP 2NXCA 3UDVA 1MA9B 1JALA 3KVGA 2E2PA 2OZMA 4EEYA 4BG8A 4CIFA 2HGMA 3UD3P 3CCUN 3BJYA 4JRPA 2HVZA 2BBEA 3U02A 5I3QA 3W5ZA 1SH2A 2V50A 4X65F 3AAPA 3R6GB 1RSCA 4EBCA 3TR5A 4CW7B 4LY7A 3NWGA 1C0UB 2GGPB 5CQGA 5HQ8A 3V6HA 3KK1B 3MUTP 1RTIB 2YNGA 2YWKA 1Z1ZA 3HTVA 1LWFB 4H5NA 4ENOA 5LMUF 2EWHA 1J2NA 4K4HA 2AEFA 2RD5C 3TVZA 1LV5A 5AR0A 3TUIC 2JVRA 1Y5NB 5CZXA 2QI2A 4IFYA 1BDGA 2KP7A 3AVHA 3QU4A 3VZHA 1WBDA 2G1HA 1NSPA 1FEZA 3D6TB 2X3GA 2P9KB 2HDOA 4CBWA 3EVMA 2HRTA 5C42A 4CLZA 1MNEA 1N5QA 2P9EA 3EE8A 1XMBA 2HAIA 4QWAA 1RYRA 1U8SA 4GKKJ 1X9WA 1SXDA 2K8BB 3I56N 1NK9A 4U67Q 4B3RF 2PY5A 2HNYB 4WE1A 3AJDA 1Y64A 3CCJS 4WF9Q 1X4BA 1T44A 2VFSA 4O3MA 2XLJA 2B7BB 3KNAA 5AI0A 1OYEA 1RT2B 1T05B 5AK4A 3P96A 4JKEA 2Z1IA 3C2KA 4NMXA 5A8KB 1Q5VA 1NJIO 2CPEA 3VAFA 5AI9A 4RQ8A 2GIQA 5AHXA 4DR7K 3DRRA 3ZSQA 4ZPCA 5FLXO 3VAKA 3SJHA 2EG2A 4LJXA 2WB4A 2DR6A 4DL6A 1E6VA 3FZLA 4W5RA 3QAEA 1HW8A 4MMOA 5HNKA 4LRCA 4NLQA 1ZQKA 4PHEA 5EX3A 3AO5A 2OO4A 5EE9A 3O9UA 2XCPA 2N3LA 1X0PA 1TL4A 2EX3A 2F8SA 1X2IA 3C2PA 1S0NA 4J9MA 8ICRA 4DG1A 4PHPA 3PX6A 5KFRA 4G3IA 1KAZA 5EWFA 4JK9A 5JUMA 1XMOF 2OJ3A 2VDIA 4BY9C 2W2PP 1U1RA 5DMRA 1MN8A 4QR1A 2HVIA 2I38A 4QYRA 4CI6A 1KW4A 4YOXA 3R7BB 2DYAA 3UIQA 3C1ZA 4XRHA 5AQVA 8ICNA 4RW8B 1KLMA 2VBYA 4DL0C 1KQKA 1K73O 2XY8A 3RJFA 2FJ6A 2MSNA 2Q31A 1RDFA 3MUVP 3H2LA 3KD1E 4IG0B 2Q1LA 2MGZB 4BXOB 2AJ2A 2U1AA 3DNCA 2KTQA 1W26A 4DOCA 4RBTA 4FJHA 5F8GA 3ILLA 1IBLF 3SFGA 1QZ5A 3FBBA 4OV6A 3MOZA 1FEEA 2V8HA 2CPRA 3SSQA 1I94J 4CEOA 4DR3J 1VQ4N 2RRDA 4LF7J 4C9DA 1CEZA 2QRRA 1NGEA 1XC3A 4DSEA 5ALUA 4A4JA 1M5SA 3NBPA 3KLIA 5KQ8A 1ZQIA 1RT7A 4FO6A 5IT9Y 5EOZA 4CFDA 2IM2A 1JLAB 5DDRC 3JPTA 3C16A 1X3NA 4KBOA 4DL5A 2GVZA 2G0IA 4R0EA 1K5OA 4KLDA 1LKZA 5DDMA 3LDSA 4OV1A 3LWLA 4LSNB 1DHMA 4AT1B 1MROA 1N88A 3H2UB 3MM7A 4EO8A 3KJQB 1VQON 2DUYA 2KYZA 2OTJN 3CPEA 1D8BA 3NDKA 3AAQA 3D2FA 1VR6A 2D1CA 4UUXA 4FJJA 4BGBA 2WHEA 1X3MA 3ZSRA 1T9XA 3A13A 2XO7A 4HHJA 3I8DA 2E8OA 1Y5LB 4KHYA 3L2VA 4LR9A 3QNNA 5AE2A 2VG5A 1LK7A 2YH1A 3SD7A 3BS7A 1PGZA 3NOCA 1VHIA 4Q8FA 3RYLA 1NRKA 3ELHA 3IUCA 3AQOA 8ICTA 4RW7A 3LGNA 2YKAA 3DV9A 3JQMA 2D3DA 3G8SA 1GXLA 2H65B 2VG7A 5KG4A 3L7OA 1TV6A 4DCCA 1U9LA 2E1RA 3T1YJ 2L9NA 4J2EA 4DX5A 2BJ1A 2W9CA 3DYAB 4US9A 2W7OA 1WHXA 4YB1P 4I2PB 3QWUA 4NLRA 1TYQA 2EK1A 2HSEB 4JI4J 4IG0A 1T6DA 2B6AA 2A1JB 3I1YA 2GHPA 3QEWA 5C2DA 2B5JA 2W03A 1Q3UA 3SAHA 3QFWA 3OL7A 4K4WA 4LZGA 1WF1A 3ZZRA 2I7PA 4KHPK 1H2VZ 4YCXA 2HF4A 5G5GA 3MGJA 4ZCMA 4FZZA 5GAGP 3RMCA 2E7VA 4LF6J 2FC9A 3KFUF 2ZH3A 3BGUA 2BA9A 4RW6B 2FBVA 2RDIA 1NNLA 1FJGJ 4IOAQ 3ETLA 2L3MA 1NLKL 8ICSA 1JI7A 3HMJG 3SI6A 3C6UA 3RJJA 3C16B 3IBFB 2DD8S 2BYCA 2VBWA 2IY5B 4B3TJ 1MWMA 3TOQA 4ZLJA 2G8WA 5T41A 1NOZA 1XSPA 3CSKA 4HUEA 4ED4A 4DU8A 1ATRA 3D2EA 4NO7A 3DXKB 4XPCA 3TWZA 1BVSA 2QG9B 3MM8A 3KYLA 3EM1A 1IV8A 4O9MA 1YJUA 3HRGA 4CFCA 2OPSB 4Q0BB 1BIZA 3M6UA 1WSGA 2XMWA 3IDWA 2J6SA 1NOMA 3KLHB 3MCSA 1RTIA 3W63A 5ALLA 2CJAA 2BUNA 1ZQAA 5DM7L 2KXNB 1Z1VA 1SC1B 2XS7A 4DF8A 4UUWA 4I2DA 2Y1LB 1U6FA 1UVKA 1JLQB 1ZQTA 1Z26A 1XQIA 3UWTA 4ZVRB 1X4HA 4QZEA 2JZBB 1HR0J 4UOGA 4KLEA 3D2WA 5KT4A 3N4WA 2ODGA 2D0BA 2P9LA 4TURA 3ULEB 2HNZA 2H51B 1GXTA 3MPDA 3ZNJ1 4WFYA 1CC8A 4QWDA 1SKSA 2BANA 1EWRA 2CADA 3GOIA 3RH6A 3HX9A 3EGVA 3G25A 1X66A 2VU5A 4ZTFA 5CEHA 3TANA 2N7CA 3JTNA 4LRAA 3J7ZT 1N56A 4WE1B 1NB7A 4W92B 3UW1A 5BPCA 1BPXA 2YHXA 3VVUA 4P75A 4YDXA 2YNFA 4OI0A 3MX2A 4F72A 1Y3KA 2O8FB 4GKJJ 5DGBA 3TACB 3FSXA