4DQQA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
molecule tags Transferase/dna
source organism Geobacillus kaustophilus
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
total genus 204
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqqA01
4CF0A 3OYCA 3SV4A 4KLEA 4FW2A 3JPTA 2DY4A 4J9KA 1S6QA 4CJQA 4IQUA 4CF9A 3QNNA 2WONA 3JPQA 1QLNA 3HVTA 5EWGA 4JV1A 2F1HA 4DL7A 4RQ4A 1T3NA 5KFAA 3SI8A 1TKDA 4DSJA 9ICVA 4KLGA 4I2PA 3QINA 4RW4A 2C2EA 4FBTA 4IG3A 1JLGA 3K5NA 3NBPA 1JL1A 5J0UA 3MEEA 2R8IA 5KFXA 2Z1IA 4RUCA 4FJIA 2AJQA 3AVJA 1NOMA 4YMMA 1S1VA 3OJUA 1UT8A 3FDSA 5TZVA 5KT4A 4PGQA 3IAYA 9ICRA 3ZSXA 4E7JA 4RQ1A 3MEDA 2R8HA 3QESA 3ISDA 4GMJB 1J54A 1WCNA 4KLMA 1S0MA 1UA0A 9ICLA 3BQTA 4BXOA 3JPSA 4KLUA 4FM0A 1KVBA 4M3RA 4FJ9A 1T4GA 4N76A 1KCFA 4P4MA 1S0VA 4ED6A 3PW2A 5C24A 3GFKB 5J0WA 4B9UA 2VA3A 4R8UA 4FLVA 2HMIA 4NY8A 3PX6A 4BWJA 3O3FA 1HYSA 1ZBUA 3QZ7A 1S9FA 2J6TA 2ZJAA 4CHPA 2P1JA 4AHTA 3GDXA 3M8RA 3C5GA 4KMUA 9ICBA 4DQPA 3LZIA 2PI4A 1X9MA 3RAQA 3UPQA 3T5KA 5KFHA 4Z4HA 1TV6A 5J0OA 1S0OA 3ZDBA 3ZCMA 2DPIA 1C1CA 1S1XA 3MBYA 2RKIA 4QZ9A 5D46A 4CIEA 1KFDA 4DTXA 1BIUA 4DTOA 4R5PA 2F8TA 4BE2A 8ICHA 4TQRA 2VA8A 4JUZA 1RT5A 2KZMA 2FBVA 1HUZA 3VA3A 3V7LA 1BIZA 1ZQDA 4Z6EA 3T3FA 4O55A 4F5QA 1XS9D 1VSKA 1W0HA 4FJ7A 2P66A 4E1NA 4DLGA 4ECXA 3HJFA 5KG0A 3HYFA 3KD1E 1ZQSA 8ICBA 1LW2A 3P83D 3JPNA 4Y1CA 3HPHA 4N5SA 5J0PA 4ECQA 4DTPA 4IKFA 2JZBB 1ZQLA 1S6PA 4IFYA 5KFSA 4BXOB 3TI0A 4M3TA 2GWSA 1ZQPA 5KFQA 4UB5A 2FPKA 1S5JA 4GW6A 4AH9A 1RTJA 3SZ2A 1JX4A 2YNGA 3LWLA 2W42A 1RBVA 4G1QA 4ELUA 3HX0A 3UXNA 4GXJA 1ZYQA 4I2QA 1ZQVA 4O3PA 3NTUA 4CHOA 2G8FA 1BVSA 5DG9A 4PPXA 3S3NA 8ICEA 2VANA 4RQ3A 2F8SA 2W8LA 3KK1A 8ICSA 3RMBA 5J0QA 5KFGA 4FJMA 4ED3A 4C8LA 3ZSVA 3EPIA 2EX3A 2BHNA 1BL3A 4ZTFA 5KT2A 2AGQA 4MFAA 5DG7A 5FRNA 3KD5E 4F5PA 4Q5VA 1D5AA 5KRSA 3MR5A 4I2HA 1U04A 4K8XA 3H40A 2PY5A 1Z3EB 3DYAA 7ICRA 1EKEA 4M9LA 3SUPA 3AVGA 4YFKA 9ICWA 1FKPA 1RT3A 3VQPA 3QEPA 4KLIA 3DLEA 2ATLA 1J9AA 3NGYA 4YD1A 4F3OA 3QEXA 4F3TA 4YXJA 3ETLA 1MC8A 5KG1A 3AA4A 4P4OA 4FZZA 2W9CA 2PXIA 3Q8RB 1WNSA 2ZTCA 3QEWA 3RH4A 3TWHA 1NJXA 4O44A 5KG3A 1RT7A 5CHGA 2FBXA 3EPGA 1LB2B 5DB8A 8ICTA 2GUIA 4LZDA 2Q0ZX 4FK0A 5KFRA 3SUQA 3NH2A 1T8EA 4F5OA 3Q8PB 4FO6A 3GIMA 5IIOA 3ZT2A 2QKBA 4ED0A 1IO2A 4CK1A 4DL5A 2FMPA 4CJRA 3RJFA 3NHGA 3SUOA 5EOZA 2WOMA 7ICTA 4YXMA 4CFBA 2VWJA 1GOCA 1Z00B 4M9JA 3RBDA 1BI4B 2BCUA 1BPYA 4CF1A 3PMNA 3ITHA 1I3AA 4M2YA 4RNOA 9ICEA 1DGSA 4YR0A 2XGQA 3KHGA 3PX4A 5HP1A 4CF8A 2RF2A 1T03A 2UVVA 9ICIA 4E7HA 3N97B 1X1PA 4O5EA 1EP4A 1JMSA 4JRPA 2A1JA 2IOCA 4RU9A 4CJKA 5HHHA 4CHQA 3AVMA 4QW9A 2B4JA 2ZJ8A 1JIHA 9ICTA 5DMRA 3B0XA 4DFMA 1AROP 5F9LA 2YKMA 4DS4A 3OJSA 2ASJA 4BDPA 4M9NA 1Q9YA 9ICNA 3V4IA 4OJRA 3ZT1A 2XRIA 4J2DA 3WNFA 3WNHA 1BPZA 4NLGA 3ISCA 5J0RA 4CE9A 3TAEA 3VQQA 5J1EA 1ZETA 4Z6CA 1FXXA 3RJIA 4UAYA 3BQ2A 9ICSA 4XUSA 3QO9A 4DMNA 5J2MA 4DFJA 1RTDA 3LPUA 2X74A 3NF6A 3RB4A 2A1JB 4YN4A 3MDCA 4E7KA 3ZT0A 1UOCA 4C8MA 1RTHA 3KK2A 9ICCA 3O4NA 5KT7A 2KZ3A 1BGXT 1XO1A 2OPQA 4OPKA 4ED8A 3DLGA 3SUNA 3C5FA 4O4GA 4Z4EA 4KLTA 2HHTA 2KN7A 4Z4GA 4UB1A 1WSFA 4I9QA 9ICMA 4HVJA 1ITGA 4DQRA 1ZQEA 4ECUA 4C8OA 3QERA 4QCLA 5KFWA 4QZBA 4O5KA 2W9BB 3OYEA 3OYNA 8ICVA 1ZQBA 2RN2A 3OYMA 2JEFA 3D45A 1LV5A 3MGIA 1FK9A 2OPRA 5I3UA 4HUGA 3V9ZA 3GIJA 1TAUA 4PY5A 3AO3A 4FLXA 1BPBA 3HP9A 4O9MA 5KFKA 3DI6A 1TAQA 3KLIA 1XI1A 2NRZA 3OGUA 4CEAA 4AHRA 2FC0A 3KLEA 3L2VA 2P5GA 3CFOA 5KT6A 2VA2A 3RJGA 5L1JA 5J2IA 1VRTA 4CFDA 1ZJNA 2XY8A 9ICXA 9ICPA 3TQ1A 4FCYA 1MSWD 1QTMA 3V6DA 4B9MA 3ZSQA 2X78A 4NLZA 4QZ8A 3RB6A 1ZQYA 3SPYA 3OYHA 4WE1A 5HMLA 8ICWA 3V72A 3M8QA 5DLGA 3ZSZA 2XY6A 5KTQA 3GV7B 1Z00A 1BI4A 2ALZA 3LZJA 2E6LA 3TANA 2KQ2A 2ITGA 3OS2A 4ECTA 1WAJA 4BE1A 1IG9A 4EBDA 1CXUA 7ICJA 4RQ6A 2J6SA 4DU1A 2VG7A 3K57A 4KAZA 3S3MA 2JGUA 4OKJA 4R8UB 3HWTA 2DTUA 4RNMA 2Y1JA 2XO7A 3HO1A 4OGEA 4KLSA 1B22A 3UQ2A 3B6PA 5HBMA 5J2QA 3ZDEA 3EWAA 5BOMA 3MFIA 1RT4A 1HUOA 2AU0A 4XQ8A 4EYIB 4FJGA 4CJPA 3MXMA 4MEYA 5J2EA 3ZD9A 5HP4A 2FLNA 3KHLA 3PUFA 4JWMA 4DTSA 4KHSA 4TQSA 1S9GA 5J0TA 4C8NA 2ISPA 4UAZA 4FS1A 2C28A 2HHUA 2VWKA 3P1GA 4ID1A 2PYJA 4HCBA 5DB6A 4O0IA 4B08A 3LANA 1DLOA 3O4QA 3L3VA 4Z6FA 4Q8FA 1V9PA 1NJYA 2OZMA 3JSMA 3I0SA 2BCQA 4F2SA 9ICAA 4FLZA 4HTUA 2D0AA 1X9WA 1L3UA 4DQQA 3QEIA 1X9SA 3LK9A 3NGZA 4FZXC 3LAMA 1TL3A 5HLFA 4M04A 5KT5A 5J0XA 4NCGA 2F96A 3OHAA 3JPOA 1Z26A 4KFBA 1K1QA 3RMCA 3DMJA 2YV0X 1MU2A 2ASLA 4O0JA 3V81A 3EYZA 1RBSA 8ICGA 2X6NA 2OYQA 2IAJA 5DG8A 3HVRA 2EHGA 4OGCA 1HNIA 2IA6A 2HNZA 1WSGA 5L1IA 4IG0A 4QWEA 3NF8A 2JLEA 2OZSA 4UB4A 1RILA 1U45A 4HUFA 2FBTA 4M41A 3SI6A 1CZBA 3Q8LA 4EZ6A 4R65A 2BPCA 5E41A 7ICGA 1L5UA 1RBTA 1WSJA 5KGXA 1L3TA 5IIMA 3V6KA 3RRGA 1ZQRA 4UAWA 3PO4A 1EXNA 3CYMA 1U49A 3C6UA 5J2PA 1GOBA 4FYDA 2W9BA 5CA7A 1REVA 4Z4IA 4KHUA 3M8SA 1SKSA 4NXZA 4ECRA 1LAWA 4KN4A 4CEDA 3V1OA 2IHMA 1QQCA 5CJ7A 1SKRA 4O5CA 5JUMA 5KFFA 2VG6A 1ZBIA 3DLRA 4NLNA 4DSKA 4AHVA 4KLFA 2ZUCA 5HRNA 2FLPA 4ED7A 1TK5A 1VSHA 1MQ3A 3SQ2A 4I2DA 1N6QA 3UXPA 1B92A 4QOZB 2C22A 3SQ0A 3C6TA 3H7IA 1RZTA 1U9LA 4UBCA 4L8RB 4CF2A 2ZTDA 4KRFA 3KLFA 2BCSA 3QIPA 1RTIA 8ICMA 4Z6DA 4F4XA 1RT6A 4DO9A 4YFUA 5KG7A 3G6YA 4FLWA 4ZHRA 2HHVA 3MAQA 1VSDA 4W5TA 3RRHA 1Q8IA 4OKKA 3EZ5A 1NK7A 2DFHA 1S9EA 1VSFA 5C5JA 3TABA 1F21A 5KI6A 4I9LA 3SPZA 4I2IA 4CIFA 2UVWA 3TAPA 3P5JA 3CM6A 9ICHA 1COOA 1SL2A 1RPLA 4BDZA 1RYRA 2HVHA 1QSSA 2PFOA 4HHTA 1ZQNA 1BQMA 3HP6A 5KFIA 3C2KA 3HW8A 1RBRA 4KHWA 4JLHA 1JXBA 4NM2A 4J9PA 3RJJA 4CGJA 4CJ4A 3AU2A 2AGOA 4LZGA 1QE1A 2ATQA 4B9LA 4ZTJA 3VQCA 3BJYA 2HHQA 3AUOA 4W5NA 5KFZA 3PW4A 1KFTA 2V9WA 1YTUA 4FBUA 5F9NA 2FPMA 3G0ZA 3AA3A 1ZQMA 2JZBA 1ZBLA 5HHIA 4CJLA 4J2EA 2LYHA 4RPXA 4LY7A 3K75D 9ICJA 5J2BA 1IKWA 1IKXA 2XGPA 1S77D 4KHYA 2XCAA 2Z1JA 4BDYA 7ICEA 4RPZA 4I2BA 3RJHA 5DDYA 1JLCA 1L3SA 4CJUA 4MFFA 4KO0A 3OYKA 4RUAA 4DF4A 1S97A 1S1UA 1KRPA 2BKEA 3V6HA 3H8JA 2V4QA 1CUKA 2PI5A 8ICNA 4RW7A 3HSTB 1QSYA 4RPYA 4PHDA 3HXMA 1HYVA 4RW6A 4R63A 2PZSA 4RQ0A 3V9WA 1D8YA 7ICIA 4F93B 3AVAA 4CK3A 3CQ8A 4DTMA 5HRPA 1BPEA 4PHAA 1RT1A 4XRHA 3MGHA 2GBZA 4F4WA 3RWUA 4DG1A 1HQUA 4IR9A 1CZ9A 4CEQA 4M45A 3Q8QB 1RNHA 4MQ3A 3OYIA 4F50A 1C0MA 4FJKA 2R8GA 4KLLA 3VQ4A 2IDOA 4I2GA 3DOLA 4OVLA 4R64A 7ICMA 7ICSA 2F1IA 3NH0A 3RBEA 1L3VA 4O3RA 2JEGA 1VSMA 1S1WA 3TARA 3KTQA 4FJLA 3DLKA 1RXVA 3PR4A 5D49A 3V6JA 1ZBHA 4UB3A 1C1AA 1ASWA 3UIQA 1J53A 3HL8A 1A76A 1EX4A 3N4MB 1KFSA 1XSNA 1ZQAA 4E7IA 2HNDA 1TVAA 2ZTEA 4I2JA 2Q3SA 4I7FA 3OY9A 1D9FA 4NCBA 3MEGA 1JN3A 3PY8A 3ZSWA 4J9LA 4HYKA 5HROA 2F1JA 4CEFA 2BGGA 4CJVA 1LWEA 2ZD1A 3IRXA 1ZQXA 1NOZA 2DFFA 1TL1A 3AVKA 2KW4A 3KJVA 4Y1DA 3L8BA 5CB1A 1LAVA 4QZDA 3K59A 4DTNA 3ZSRA 1G15A 4DFPA 2ZE2A 5BPCA 3L2QA 4EEYA 2BGWA 3OS1A 4DTUA 1XU4A 1C1BA 1RDCA 1JLAA 4ICLA 3NAEA 4CGDA 4QZFA 3RH5A 5SZTA 2A1SA 5J2FA 3CM5A 1TK0A 1VSLA 5IIKA 1VSJA 1C7YA 9ICQA 1JKHA 2O4IA 4OKEA 3ISNC 1BPDA 3VQAA 1BCOA 2IC3A 4M0AA 5J2NA 4RQ7A 4ECZA 4FLTA 2XCPA 3OYLA 4EBEA 1T05A 1D9DA 3AU6A 3ORYA 4G3IA 4M3ZA 4E19A 4YMOA 3DLBA 4KITB 5BOLA 4DWIA 4AHCA 1WLJA 1C0TA 3NFAA 4PQUA 1ZQOA 4QZGA 3VQ5A 4FK2A 1S10A 3HM9A 4FJJA 1VRUA 1TKZA 3C1YA 3H8WA 1NK6A 3O3HA 1S1TA 4J9SA 1C0UA 4LD0A 3K5OA 1KEJA 4PHPA 4RQ8A 2BDPA 1IKVA 3NF9A 4FW1A 4H8KA 4BE0A 3ISBA 1TKXA 3SNNA 8ICYA 3NF7A 3K58A 2ZUDA 5HNKA 4K4HA 3PO5A 1K6YA 3T5HA 4J9MA 2PFNA 3PW0A 1LW0A 3M9OB 3AVFA 4YCXA 3L2RA 3BQ0A 3PVXA 3DRRA 1KTQA 1ZQGA 2NRVA 3FYHA 3JYTA 4KPYA 3LP2A 1J5OA 4FXDA 7ICHA 1KVAA 2C2DA 5KFDA 1HMVA 4FJHA 8ICQA 4M3XA 4CEZA 4JS5A 1LWCA 4J9NA 4DOCA 3V1QA 3VQ6A 2XY7A 2NRWA 4MF8A 4PWDA 4YP3A 4KREA 7ICVA 1EETA 5KG4A 5DGAA 5SWMA 4M3YA 2I1QA 4PA1A 1VSEA 4IQVA 4QWDA 4O5BA 4KLJA 2HNYA 4N47A 4CJ3A 1A77A 1IKYA 2ZQBA 2RPIA 4HUEA 4CFAA 4F4KA 2PFQA 2A1RA 5HMMA 2MUTA 1A5WA 2D5RA 4CCHA 4DL6A 3DM2A 4LSLA 2W9AA 1XHXA 2AGPA 4FLYA 1CEZA 4YD2A 2H5XA 4CGFA 2R8JA 2G8KA 5D4BA 5J2AA 1XSPA 3MXJA 4NCAA 3SQ4A 2QK9A 4CGGA 3Q8SB 4DU3A 4OLBA 2P51A 3S9HA 8ICLA 5KFOA 3SYZA 1IH7A 1HRHA 5D3GA 4KB1A 4M6WB 2RDIA 5JS2A 5HRSA 2LSNA 1UA1A 1NJWA 3OYBA 3CFPA 2MAXA 4CERA 1ZQCA 5J0YA 1JLBA 1Y97A 3V7KA 1JLEA 1BCMA 5T7BA 5DBBA 1JLQA 4CK2A 2YNHA 1SUQA 4CJSA 4W5RA 4I2EA 7ICPA 4BACA 2AQ0A 3T5LA 4AILC 2ISOA 2JEJA 4KLHA 1XWLA 3NCIA 3AV9A 3AVIA 1DOQA 3K4GA 2BE2A 4N56A 4EP4A 4DOAA 5KFEA 4J2BA 4JV0A 5DQGA 3MR6A 4I2FA 2IGIA 1NK5A 3RAXA 3AVLA 3AO2A 3AO4A 1Y88A 3GQCA 5CZ1A 5DLFA 3MFHA 1T7PA 4DQSA 4NM1A 1RT2A 4I2CA 2NUBA 1U48A 3OYFA 3T5JA 4R66A 1ZQHA 3BGRA 1KVCA 4I2AA 5C25A 2HVIA 1A5VA 2IMWP 1C6VA 1WAFA 3VN5A 4KLOA 4ELVA 1JXEA 4CJ5A 1ZQIA 4DOBA 4GLXA 7ICFA 3AO5A 5CP2A 4KI4A 2G8VA 4PHEA 2PYLA 3H08A 2FMSA 4KHNA 4NYNA 3T19A 5J29A 1HYZA 1BPXA 3RR7A 3KIOA 5KG6A 4KTQA 1N48A 3G6XA 4IRCA 5FRMA 4IFVA 3GV5B 4ECWA 8ICZA 4I27A 4KB0A 2OA8A 2O4GA 4FJXA 4RZRA 2IS3A 4PGYA 4F4YA 2BQ3A 3AA2A 4FS2A 1U4BA 1WSHA 3QLHA 1EXQA 5DB9A 4QZIA 3E2EA 4E89A 4IQWA 4QWCA 4BWMA 5L9XA 2P5OA 3OYAA 4P4PA 3VQ9A 1YT3A 3KK3A 4CESA 4KTZA 3C1ZA 3A2FA 4LVSA 1KLNA 5KT3A 3PW7A 4GC7A 3AVHA 2BANA 4ECSA 9ICOA 3QE9Y 5EWFA 4H4OA 4YG2A 5DQIA 2Z1HA 4YNQA 3F9KA 2ASDA 4CEOA 3NDKA 3ZDAA 3RR8A 4UQGA 1RBUA 4HCCA 4DF8A 5KFJA 3M9MB 3EW9A 3KLHA 3BDPA 3AVCA 1S0NA 5C42A 3QEVA 3I0RA 1Q9XA 3WNGA 4X5VA 4F91B 4ELTA 1K1SA 1NOYA 3RH6A 2BPFA 1RDAA 3H8SA 4DSLA 2XC9A 3HT3A 4QW8A 2B21A 3EY1A 3OYGA 4KI6A 1BQNA 9ICKA 1ZJMA 1X2IA 5CR0A 4DL2A 4IRDA 4E0DA 5EU7A 2YNIA 3VQ8A 3HPGA 3OHBA 5DK5A 4EYHB 4DFKA 3UQ0A 3LDAA 5J2HA 3IHQB 3L2WA 5CYMA 4CEEA 2Z1GA 3IG1A 2B5JA 4UB2A 2DFLA 4B8AB 2G8HA 4PGXA 5J2JA 1WN7A 2ETJA 3NE6A 2KFNA 2BCVA 8ICUA 2AQ4A 3VA0A 4CHZA 3KHRA 2W9CB 4EBCA 3MABA 4J9RA 2OPSA 1N56A 4GC6A 4FK4A 3UXOA 4FM2A 2E6MA 4RQ5A 4Q45A 1ZQQA 8ICRA 1NJZA 4RT2A 4Z4CA 4Q43A 1ASUA 3ZDDA 4DLEA 4E7LA 2G8IA 3PX0A 7ICKA 2B6AA 3CFRA 5J2KA 4QZEA 2YHBA 1XC9A 3S3OA 3RTVA 3KKSA 3DLHA 3Q8MA 3V9UA 3PW5A 1KLMA 3SJJA 4YQWA 3QEBZ 5CWRA 1RCHA 7ICLA 5DB7A 8ICFA 1QHTA 4DSIA 5IILA 4ECYA 9ICFA 4O3NA 3VQDA 4CJTA 1SV5A 2X6SA 4DU4A 1WCLA 1SL0A 1VK0A 3MR2A 4J2AA 4DS5A 4DSEA 3LALA 2E4LA 4MF2A 3C21A 5IINA 2NRXA 3FFIA 3M9NB 4IRKA 3K5MA 3IM1A 4IDKA 3MDAA 3MR3A 1N5YA 5KFLA 4F5NA 4I28A 3C2LA 2FPLA 3K5LA 1QS4A 3BQ1A 3OYJA 1RDDA 2KTQA 3RJKA 3U6FA 3LWMA 5KFYA 4RT3A 2I9GA 4CIGA 3LDSA 5KFMA 3RJEA 3SV3A 3THVA 4AHUA 4DEZA 2BQRA 4W5OA 4K4GA 3GILA 2BPGA 7ICNA 3HK2A 3Q8KA 4KN7A 1NKBA 1HPZA 3TFSA 1KSPA 2BQUA 2XY5A 4IBNA 4DTJA 2P6UA 4QZAA 1ZQJA 3AA5X 4KLQA 4KLDA 4MFCA 1PZNA 1GOAA 4FVMA 2YKNA 4J9QA 1ZQTA 3ULDA 2HHWA 4FM1A 2Y1IA 5J2DA 2HHSA 1SL1A 1I39A 3OYDA 4FJNA 1DTTA 5I42A 1RDBA 5JS1A 4KTWA 1XHZA 4M9HA 1WSIA 4TURA 3KLGA 3C2MA 3TAGA 2BCRA 4NYFA 1NKCA 2J6UA 3RMDA 4Q0BA 1D8LA 1FKOA 3AVBA 3KHHA 1HJRA 2OWOA 9ICGA 4Q44A 4GVMA 4UBBA 3VQ7A 3PMLA 3TAMA 1BISA 5L1KA 4JWNA 1NKEA 7ICUA 3I8DA 3TR8A 4YR2A 1RYSA 4RW9A 4CGIA 3H4BA 2HB5A 4F92B 4B8CA 2BR0A 2FLLA 5K14A 4FLUA 4QZCA 4DSFA 1XSLA 3DRSA 4ZH4A 3NH1A 3QETA 5KG5A 9ICUA 4CECA 4MFBA 4E3SA 5KFUA 5FDLA 5CY4A 4RG8A 3OS0A 4J9OA 4JRQA 1TK8A 4XA5A 1NK0A 2IBKA 4LH4A 5DKWA 8ICJA 4CHYA 4RW8A 4JK1A 2IHNA 3ZSOA 1WSEA 4YMNA 5CYQA 2I5JA 4M3UA 4B9NA 3K2PA 5L1LA 1MQ2A 5KFTA 5EWEA 3TAFA 3NGDA 3O3GA 4CJFA 2PFPA 4CJWA 3PNCA 3OVNA 4TUQA 4JS4A 5J2CA 5DBAA 5IIIA 1ZBFA 4O3OA 1QSLA 4C8KA 4I29A 4DL3A 3DOKA 4RNNA 4M6WA 1DTQA 1CXQA 4IQTA 1TGOA 5FROA 3RB3A 3M8PA 4DTRA 4EZ9A 8ICCA 4ID5A 3PV8A 2UVRA 4JV2A 2FMQA 1RXWA 1HNVA 7ICQA 4K8ZA 3RMAA 2HHXA 8ICAA 4CHNA 4FJ8A 1B9FA 3PR5B 4F4ZA 4FZYA 5HRRA 5KG2A 4B3OA 1KDHA 3LP3A 3L2UA 2ZJ5A 2FBYA 1BHLA 5KGWA 2QKKA 8ICXA 3T1AA 1SZPA 4YVZA 1HJPA 4CGHA 4P2HA 3LP1A 1Z25A 3CG7A 3G6VA 4IR1A 1W9HA 2GV9A 4N41A 3QZ8A 1TVRA 2QXFA 2G8UA 2DFEA 1JLFA 3D0PA 1ZQWA 3C95A 1UAXA 3V1RA 4TUSA 1HQEA 1S76D 4NLKA 3H4DA 4KHQA 4Z4FA 1ZQKA 2XHBA 4QZHA 3G10A 4M47A 3B0YA 4H4MA 1NK4A 1UWBA 5J2GA 4CJEA 4AHSA 4Z0UA 2C2RA 3GV8B 3SCXA 3V9SA 2UVUA 5J0SA 5DBCA 1VSIA 1O1WA 3AO1A 3VQBA 4QWBA 3B6OA 5DDMA 4OLAA 2YNFA 3ALYA 2ZUBA 3WNEA 1JXLA 2RDJA 2WTFA 1B9DA 3ZT4A 4B9SA 4MEXA 2V4RA 3AVNA 1NK8A 3QNOA 3TAQA 3QIOA 2HW3A 4GXKA 4YR3A 3VQEA 3F73A 1NK9A 5KFCA 2W8KA 1IXRA 3SQ1A 1LWFA 7ICOA 5KFPA 3QEAZ 2KFZA 3IS9A 5CZ2A 4F2RA 4PUOA 3JPRA 4ED1A 1B43A 1TKTA 4M42A 2P6RA 4E1MA 1ASVA 1JL2A 8ICKA 3RB0A 2JEIA 2M9NA 3JPPA 3V7JA 2NRTA 4DQIA 1CLQA 3U3GA 5KFBA 3OSPA 2W9MA 4OPJA 1H38A 2R7YA 3LPTA 4M9GA 1UT5A 4BGDA 4EP5A 1TFRA 2KZZA 1YVUA 1ZQUA 5KFVA 4LSNA 1ZQZA 3U3YA 4O3QA 5KRTA 4DL4A 8ICPA 5DGBA 3DRPA 2G8WA 3MXIA 5KFNA 2D0CA 5DQHA 1ZQFA 1IM4A 4TUPA 3TFRA 4O3SA 5IIJA 1SKWA 3E01A 4TSXA 3L3UA 3ZD8A 4M3WA 2VG5A 3GIIA 4KKOA 2D0BA 4QWAA 4FJ5A 2MUTB 3LP0A 8ICOA 3GIKA 3ZT3A 1A5XA 4LH5A 8ICIA 1U47A 4ECVA 4K4IA 3C23A 4ED2A 2DPJA 4CEBA 3C94A 4XIUA 3ZDCA 1TV9A 3LAKA 3KKRA 3V9XA 4F8RA 4QAGA 3MECA 3NGIA 4Q8EA 4GXIA 4RQ2A 4KV8A 2R8KA 2OPPA 4B9VA 4B9TA 3ASMA 3OSNA 4W5QA 3HPOA 3ZSYA 4CFCA 1R0AA 4PH5A 2YHAA 4F5RA 1YTAA
chains in the Genus database with same CATH superfamily
1K0VA 3SV4A 4DR7J 3HOSA 1FJEB 4J90A 2JSXA 5AQMA 3QNNA 1TKTB 2WONA 2K4PA 3HVTA 1ZTTA 5KOWA 2WSFC 4GKJF 4DL7A 4RQ4A 3SI8A 2G1HA 1TKDA 4DSJA 3LDLA 2XHCA 2LMIA 3OA9A 1LVHA 3K5NA 3NBPA 3CCSS 2GELA 1RHJB 1GLLO 4IYQA 2HFOA 1PVQA 3TUIC 3VAKA 1JL1A 3MEEA 5AE3A 1R6YA 4RU2A 2MKKA 4B3MF 1GX5A 3Q83A 4QS8A 2AJQA 3OJUA 1UT8A 1I1GA 1TFWA 4ZJOA 2WAQD 4ZKAA 2FVPA 3IAYA 4E7JA 3Q24A 2E66A 2RQCA 3SQIA 3P31A 4OJ3A 4IQMA 1J54A 4F26A 4WYWA 4KLMA 2LYAA 3NCRA 1J5EF 3MCOA 5CH7B 3CCQN 3HSJA 2DVIA 4N77A 4I64A 3ZNUA 4P4MA 3OTOF 3EE3A 1TV6B 2NNWA 4C7QA 4RO0A 4AE5A 1WG5A 2J0XA 4UY8T 3GFKB 2RQMA 1AW0A 1RTJB 1UW4A 5D4LA 2DF4B 2HMIA 4IOAQ 3O3FA 3G4SN 3NVWA 1SQFA 4P6QA 3QZ7A 5CYJA 5EDWA 2G2YA 2ZJAA 1H2VZ 3M8RA 4Y00A 1NCLA 2B4UA 9ICBA 2VJUA 3UPQA 4MTPA 5KFHA 4ZVEA 1FDDA 1C1CB 1S0OA 5J2PB 2IMOA 1MDUB 4NLRA 1KFDA 1ULRA 2QYGA 2YWFA 4PWWA 4R5PA 1RT5A 2NPFA 4TQRA 2FBVA 5HMYA 3WKEA 1HUZA 4A5AA 1EAYC 3V7LA 1ZQDA 3TZXA 4M5IA 1L7PA 2AA4A 2N4CA 1VSKA 3H8YA 4IG0B 5JLHA 3CJTA 5D3GB 2P9UB 1WC1A 5KG0A 1JALA 3HYFA 2KU7A 1N8RO 3LM2A 3PNIA 1KOOA 1RAHB 4K2JA 4JI0K 4Y1CA 1SGGA 3RF9A 3EXYA 4RQMA 5JTIA 4YB6A 4ECQA 2F44A 4I6AA 3DM2B 4MMOA 3UB5A 4DTPA 3PEHA 4KE5A 2PEHA 4M3TA 1T11A 1NMDA 5AI8A 1ZQPA 2AX0A 4AH9A 1REVB 1JX4A 4G1QA 3CDAA 1URNA 1ZYQA 3GU3A 5AIAA 4O3PA 3NTUA 1SH2A 1RWXB 5F1XA 3S3NA 3U02A 4Z94A 8AT1B 2VANA 4RQ3A 4WP9A 8ICSA 5J0QA 5KFGA 5ETVA 3EPIA 3CJKB 2AGQA 1GNKA 5DG7A 1YZ6A 3KD5E 3BKFA 3O5TB 5IQQA 3ISND 1WKLA 4YEAA 1W2BM 3HRGA 1LWEB 1EKEA 3SUPA 4WPAA 1DJ0A 3PM9A 3ULEA 1MMDA 2JR5A 4P73A 3M6XA 3DLEB 3KLVA 4F3OA 3TSPA 4URQU 1R43A 2NREA 1NGEA 4AXJA 3CO9A 5KG1A 1U0HA 1Q81O 5ALDA 2BE9B 2LEBA 4A8XA 3CB4A 1CS4A 1NB7A 4M5GA 4KHPF 1OSCA 3I5AA 5DJBA 2XYPB 5ALZA 1RT7A 1PK3A 1L6NA 1T9YA 3CCUS 3Q8PB 1HHSA 3KWIA 1NZAA 3ZT2A 2GOLA 2ZGYA 3CQXA 2CPFA 4ED0A 4BC3A 2CPDA 3W3DA 3RJFA 2FVSA 5EOZA 4KH6A 1YVFA 2AP6A 5F8NA 2CVIA 4YXMA 2VWJA 1Z00B 1BPYA 3VEOA 1NGIA 4YOYA 1HJOA 2MHEA 3ITHA 3FZKA 4YR0A 2XGQA 2L5YA 4CF8A 9ICIA 3QPIA 3N97B 1RT7B 1EP4A 4CJ7A 1N5XA 4YDDB 2F5GA 2RB7A 3NWGA 3RBZA 2MA1A 3EZOA 4QW9A 3IAS9 4DR7F 3SAFA 3SXLA 4KJIA 2HSTA 1AROP 2GFFA 2ASJA 4M9NA 4LUBA 5AXLA 2J9DE 3I96A 3AXMA 3V6DB 5AE2A 4J91A 4X4VA 1BPZA 1V4TA 4WFBQ 4B1UB 3TAEA 3ATVA 3FZMA 3VQQA 2A42A 4B3TK 1ZETA 3UVJA 3NNCA 1F3FA 1MWMA 4ANEA 4ZOHC 4NCGB 9ICSA 4XUSA 5AI4A 5J2MA 3GFZA 1VQ8S 3LPUA 2HK3A 3VGLA 4IZ9A 2CADA 4YN4A 5L1MA 2LBOA 1IKXB 3ZT0A 9ICCA 5BJRA 3O4NA 5KT7A 4YY3K 3N9UC 2ZH3A 2EZXA 2QW9A 4ED8A 4GV6A 4DV7K 4Y34A 3QSYB 4O4GA 2I1RA 1OJ4A 2XZDB 1S72S 1WSFA 1Z4UA 9ICMA 4JKAA 3LO3A 2XLIA 3SSSA 4PL7A 1DT9A 5KFWA 4E1JA 1O0PA 4BRHA 4O5KA 3BY5A 2D6FC 2G0AA 3IMQJ 1JRPA 1RB0A 8ICVA 4OJOA 3QMQA 1ZQBA 2RN2A 1FFVA 3OYMA 4DL0C 3MGIA 2IM1A 3I6PA 5I3UA 3QJJA 4HUGA 3V9ZA 3THWA 1OY6A 4EUVA 1ZM9A 1S59A 2LPEA 3THXA 4O9MA 1HARA 5KFKA 4P2SA 3DI6A 3QDKA 2R2TA 1UJ6A 3KLIA 2JXJA 3RAMA 2X1AA 4AHRA 2VC1A 3KLEA 5KT6A 1WF1A 3OBYA 2EQYA 5J2IA 3F9MA 1PAEX 2CNKB 1XR5A 1ZXOA 2G5IB 2XY8A 3DRYA 9ICXA 1PBAA 4WIIA 5ALWA 3KVGA 3JYTB 4PWDB 4PYDA 5A8RB 3OFHA 3SCJE 3MM7A 1FK9B 2V2ZA 5AQPA 2ZXIA 3RB6A 8ICWA 1IR2A 2IJNA 3GYGA 2ES6A 4JKHA 2FHKA 5DLGA 1A9NB 2UUBK 3UWTA 3FBFA 5AKXA 4G1QB 5LMNJ 5DM6Q 1RTIB 3HF5A 3TANA 3NRZA 3N4QA 2KQ2A 2ITGA 4P2FA 3U1NA 2OYYA 1WAJA 3MCPA 2MZRA 2YJFA 4ITSA 3JQJA 2CNOB 1R89A 4XDCA 2B56A 3K57A 1X66A 2V0NA 3HWTA 2VBZA 4OZLA 4PWUA 4C0BA 4LRDA 5HBMB 2ZH7A 2V51B 4KLSA 3RSEB 4K4SA 4EIAA 5ALFA 1AFJA 3B6PA 3DV9A 3EWAA 3MFIA 2AU0A 2KK0A 4XQ8A 3R5DA 3QATA 3W0LA 3UQSA 4DTSA 4TQSA 3F56A 5J0TA 2ISPA 1OSDA 4UAZA 4BBYA 2QGFB 1VHFA 3UDLA 3SDEA 4DV2J 2W40A 2WVEA 3P1GA 3DDKA 4L72B 4EEKA 1K44A 5EN1A 3NVMA 2LLZA 4IWVA 5J2QB 4BRGA 3L3VA 4CLWA 5AQSA 3T1YK 3O80A 4CZJA 3J80Y 3D6RA 3I9V9 4A2AA 2E3TA 4BVPA 4HI1A 3JSMB 2BCQA 3PLAA 4F2SA 4HTUA 1L3UA 4DQQA 1IBLF 3LK9A 1NJIT 3NGZA 2LXFA 4NE9C 4OZ5A 1TL3A 2HRTA 1U0HB 2EI5A 5KT5A 2F9WA 4BLGA 2IRXA 2OMOA 2F96A 1QE1B 2E1RA 4JBCA 3RZAA 5CZXA 3JPOA 1Z26A 1K1QA 4V19J 1HQ2A 3DMJA 3IC1A 2YV0X 5KAFU 3ATUA 1MU2A 5A0YA 5AKYA 3FEZA 3JS9A 2DUYA 1RBSA 4PRFA 2UXBJ 4M5DA 4GY2B 3QU7A 2CQ4A 2VG5B 1JLBB 1HNIA 2IA6A 2HNZA 4M5JA 4TLQA 4JI7J 1DURA 2P9PA 2OEJA 3C8YA 1G4CA 2OZSA 2YMMA 4Y2IA 1U45A 3WUHA 2FHMA 2ZIWA 2WBMA 3Q8LA 4NYZA 3WK4A 4J5OA 5KGXA 3EVMA 1L3TA 5GAHP 1FA0A 2GQ2A 3O4WA 1ZQRA 3PO4A 1EXNA 1RYUA 1DY3A 2BV3A 2Y9TA 2D7SA 1WC0A 2E20A 1GOBA 2R2SA 4FYDA 2W9BA 2MMYA 4MO5A 3DRXA 4KHUA 1SXEA 1WKJA 1T6DA 3UVJB 2CG8A 4IQXA 3P3DA 2HQCA 1LAWA 1ECWA 1PSDA 1GXTA 4LFCJ 4JI5F 3ZI4A 3DLGB 1SKRA 2NRHA 2YTCA 2C2KB 4ZPAA 2VG6A 1OH8A 4NLNA 4AHVA 3VAJA 4KLFA 5GAGU 2W2PP 3SD7A 5IT9U 5M1PA 2U2FA 3W2WA 5HRNA 1VSHA 4MKYA 4QOZB 1RTZA 2PFDA 3SQ0A 2G1DA 3IBWA 1VLOA 1YJRA 2IDEA 1SWVA 2QZ8A 4PHTX 2IM3A 1VIXA 2D1KA 4F4XA 1Q0NA 4XAKA 2QLJB 4YFUA 2CXYA 1F44A 5KG7A 2B8PA 3L6QA 1IKVB 3MAQA 4JI6J 1Y7PA 3IR5B 1Q8IA 2OP5A 3LTOA 4NXMF 2F8MA 4H5TA 5CE3A 1F21A 4BR2A 4I2IA 1HQEB 4ANCA 2F9JA 3GMGA 4NEYA 5EE3A 4X65K 3I56N 1ZPWX 3CM6A 1QSSA 3OD2A 2RIJA 1ZQNA 2J7KA 1IQTA 2DHGA 3C2KA 1AUSL 1RBRA 4BC5A 3BZKA 1XIQA 4QS9A 1CSJA 3SCKE 1T9UA 4J9PA 2FZCB 5ALSA 5BN8A 3MF5A 4CGJA 4CJ4A 6AT1B 3HKZD 4F36A 2Z2ZA 4PZNA 4PG6A 3QU4A 2O8BA 4OX9J 2ATQA 1NSAA 2ACYA 1TKZB 1RHUB 3VQCA 2GVZA 4JD2A 3AUOA 4W5NA 5F0UA 3MPDA 5AQRA 1KFTA 2V9WA 4CLPA 4RQNA 4RW6B 4FBUA 2N82B 3G0ZA 1RGIA 5GTIU 4DV5J 2OD4A 3AA3A 1ZQMA 2JZBA 3K0SA 4J2EA 4RPXA 3MPVA 1KC8T 2ZDPA 4KIAA 1YJWS 9ICJA 5J2BA 4LFCF 2E2NA 1IKXA 1N8RT 1S77D 2Z1JA 4RPZA 3QGIA 2O8CA 4TXSA 1V5IB 1VIOA 3P8BB 1KQQA 4OYPA 2HLUA 4DF4A 4RUAA 2CZ4A 2VYPA 2QWPA 2DR6A 3WIVA 3W2VB 4ILHA 2WTUA 1L7MA 3E58A 2PI5A 4RW7A 2DR9A 3HSTB 3DOMB 1QSYA 4IO8A 4P2MA 1RT2B 4BX9C 4HTLA 1K8AT 2ZC4A 4RW6A 1XR6A 3U4LA 4F93B 3AVAA 1DLOB 1BPEA 2GIFA 1RT1A 2ZHOA 2NXJA 3KLIB 2GMLA 4YY3F 1GQEA 3ZZYA 1IM6A 4WFYA 2P9GA 3GJQB 4YN3B 4ER8A 3M3ZA 3Q8QB 1VISA 2OTLN 3KMQA 3MWTA 4DV0K 3DU6A 2R8GA 4KLLA 2EFOA 4ALZA 4R64A 5AICA 3H6EA 4OJLA 4O3RA 2RD5C 1S1WA 3KTQA 4JP8A 1VSMA 2I6WA 1S5LU 3J7Z5 1PO6A 5D49A 2DNKA 4DV2F 5EXWA 1ZBHA 4OHWA 4USMA 3W9IA 1C1AA 3BSCA 1J53A 3MM8A 1KFSA 2YKAA 4B3SJ 1XSNA 4E7IA 3P38A 4EELA 3BF3A 4W90B 4QIWC 1DQAA 3DLLQ 4NCBA 3ZZTA 3H20A 3ZSWA 4J9LA 1QY7A 4L3NA 4CEFA 4K41A 1W25A 1LWEA 1U8SA 3H25A 5J8YC 3RG6A 2D3OR 1JJ4A 3KG1A 4DU7A 1NOZA 2Q1LA 1UVLA 4MKVA 3R9LA 2VQEJ 1VLBA 1Q53A 5CB1A 2WW8A 1JJHA 2D74B 1G15A 3L4PA 2F8EX 2WB1D 4DUYF 3ZEUA 2BGWA 3OS1A 1AT1B 3MUVP 1YI2S 5GADI 4ICLA 3C3LA 1N5QA 3MM6A 4BG9A 4QZFA 1NU0A 2IY5B 2A1SA 1TTHB 1AUDA 5AM3A 1VSJA 3TX0A 9ICQA 2P9UA 2OIHA 1E6YB 2P9PB 1WHVA 4HHUA 1QQ5A 1UZDA 4M0AA 5J2NA 1IUJA 4ECZA 2VQEK 4FLTA 4JI7F 4CLZA 3RW7A 4CH7A 3CETA 1NNDA 3QJLA 1DAXA 2VICA 4G1IA 1CRXA 3DLBA 5BOLA 2Z2MA 2CN1A 1UWBB 5AT1B 2CH6A 3RFAA 4PQUA 3GOIA 4Y2JA 3AHPA 3VQ5A 3CEDA 3RYLA 3HM9A 4EFHA 1C0FA 1VRUA 5GAEP 3IBCB 5B0DA 4A8WA 1BLUA 1HMVB 3P39A 1S1TA 1VR6A 2O67A 2DNNA 2MRLA 1C0UA 2MY8A 3K5OA 5A8KB 2K60A 1S6QB 2BDPA 3ULEB 4H8KA 3GSDA 3ISBA 5F3TA 4M1KA 2RRNA 3K58A 2ZUDA 2A41A 3ZX2A 3EWGA 4CW7B 3PO5A 3T5HA 1AA1B 4BJQA 1NEEA 3R97A 2Q36A 1HNWJ 3PW0A 3HDSA 5B0EA 3M9OB 4U7BA 4YCXA 3BQ0A 3PVXA 2IM0A 2YCHA 1ZQGA 4LMZA 1F0MA 2DNOA 1J5OA 2LQ8A 4U7UK 7ICHA 1KVAA 3BO3A 2CDQA 1H73A 1V85A 2B51A 5E3AA 4CEZA 4YOXA 1TR0A 2YX4A 4J9NA 2DIUA 3EKUA 4WF9Q 5GINA 2NRWA 1RDFA 2CJBA 4MK7A 3CJQA 4DV4K 1NH8A 1U8WA 2ZIXB 4YP3A 2I5JB 1Q8BA 2GQQA 5K14B 3TR5A 4JMUA 5IM0A 5JICA 2I1QA 1VSEA 2O8BB 4M5LA 1U1NA 5C10A 1VI7A 3AB4B 5J1EB 2OD6A 2F7TA 4J03A 4N47A 4CJ3A 4DPYA 2KXHA 3AB2B 4RW8B 1PYSB 2FJAB 4MDAA 4LBIA 2ZQBA 2RPIA 4CFAA 4F4KA 2PFQA 3OBWA 1HKGA 4V1Ak 2GEMA 2MUTA 3CCES 5BR9A 1T9WA 3SAHA 3CCZA 5DM7Q 4CCHA 3I28A 2E88A 2GHWA 2KM8C 2NRRA 1KW4A 1XHXA 4CLKA 4YD2A 2G8KA 5GAGP 2J9CA 3VTHA 5J2AA 1XSPA 4DV3K 4EFAC 4FOEA 4LREA 4OI2A 3GJRB 5ELZA 4WZQA 4UARA 4ZMMA 2E9RX 1V3SA 5KFOA 1BU6O 1IH7A 2CJAA 4NLUA 4KB1A 5DDQC 4UB6U 1XTZA 5HRSA 1UA1A 4YB5A 3CFPA 1D1UA 5J0YA 1UZHA 1VCTA 4H4KC 4BC9A 3V7KA 3BGFA 2ASYA 2ZBCA 4QQBA 2MQMA 5AFUA 3WT0A 1A7GE 3U27A 2C1EB 2ZBIA 3FSYA 3U1LA 2V7ZA 1CJUA 3LGMA 4FO0A 1SUQA 4CJSA 4YB7A 2XMUA 3G9CA 5D4NA 4KX5A 2P9KB 4OX8A 3QYPA 2IAJB 2AQ0A 3OL7A 3HHLC 3MEEB 1VQ7N 1NM1A 2XHWA 4DR1F 4QJFB 3B78A 3TUZC 1K8AO 1FIQA 4PUOB 3UKUB 1RCXB 1Q46A 2CJKA 1LNQA 5BPNA 3AJ1A 1R0AB 3AVLA 3AO2A 4DPXA 3SSQA 3CJ5A 5CZ1A 2KVSA 3DC2A 2IOHA 1T7PA 4ZDNA 3BQ7A 4NM1A 3HTVA 4I2CA 3D3BJ 5HMZA 2NXUA 4LF8J 3T5JA 4HI2A 4I2AA 3IN5A 3V81B 3CPWR 2HVIA 3ONNA 3DI6B 3TEHB 4FZMA 1C6VA 2AX1A 1JXEA 4CJ5A 4J9UE 3QU5A 1JK9B 2L9WA 2W04A 5I42B 1WSRA 2FSNA 2G8VA 2DKXA 2IA0A 3H08A 5IWAK 3MPUB 4P7TA 4KHNA 5BPLA 5BREA 5A0LA 5ALRA 1Y3KA 1T3QA 3G6XA 2HVEA 3NAHA 2FDNA 4IFVA 2CNNB 3ILJA 3KJNB 1MROB 2FF3B 1SIZA 4KMOB 1HLUA 3GDQA 3MM6B 4H54A 4FS2A 1U4BA 1WSHA 2WSCC 2YKMB 2HOEA 3OTEA 4JI8K 3LP1B 1VHXA 2PN6A 4H0XB 1SJ1A 2RDDA 3L7PA 4QZIA 1FFSB 4QWCA 4BWMA 5L9XA 4CLSA 2KYZA 5DM6L 1T95A 5ALTA 3M2VA 4CESA 4H0YB 5BRDA 4KTZA 2RNEA 4ISFA 2CPYA 4NEZA 1RLDA 4A8EA 2W43A 3AVHA 3CWJA 2V63A 5E3RA 3HM8A 3M7DA 3NMRA 2K4IA 3EO3A 4ERDA 2G13A 5I9EB 1QD1A 1F2GA 4FF2A 2OTJN 1FCAA 1FERA 4DV7J 3F9KA 1HHQA 3I55S 2DGOA 3TTFA 1J2MA 4DV0F 3ZDAA 1W7WA 3E3XA 4UY85 4OYWA 1CJVA 4H0PA 2AEJA 4AYBC 4OJ5A 4CZCA 2GX9A 3I31A 4LF5K 2MQQA 3AVCA 3QMLA 4ZVPB 2BXJA 3J7YU 1N5TA 4CP5A 4ELTA 2MQ8A 3H46O 2BPFA 3GFXA 2GMHA 4Q2LA 4QPXA 4LF5J 2XC9A 2B21A 3EY1A 1VYAA 4JNEA 3VCBA 1X2IA 2CQBA 2OPSB 2WBRA 4IRDA 1HUXA 4HH0A 5EU7A 1RWOB 3M32A 2N7CA 4I56A 3HPGA 2BRLA 1KR4A 4KQZA 2A1BA 1RJJA 2LXUA 3CDUA 3SBTA 2O8EB 3OV7A 1VHIA 3CC2S 4OJHA 3QRRA 4P0PA 4UB2A 1MMLA 2HF3A 4IEIA 4B8AB 4WU2A 4M7YA 1SZ2A 3NE6A 1HFEL 8ICUA 4CHZA 4OO1J 3CJBA 2JH1A 4J9RA 2OPRB 2YWKA 1N56A 3ZO7A 4O8KA 1CJTB 2E2OA 4DR5K 2RRAA 2I5HA 1ASUA 1ED1A 3UE5A 1GO3F 3NASA 3D5MA 4CLUA 3PX0A 1RDUA 4DCHA 1H2UX 4CO1A 4CO4A 1NNLA 2YHBA 4NZ0A 2OEMA 4EK2A 3DLHA 2M0GB 4N8OA 2WMMA 3W63A 2VFTA 2CXEA 3G71S 3PSTA 1T44A 2ZIUB 1UQVA 1KLMA 4DN0A 3QAEA 1Z4OA 1Y4ZB 1RCHA 4AQYK 7ICLA 5DB7A 4CLLA 1UPHA 2DY1A 3ET6A 1IBKF 4ECYA 3CGIA 3PJXA 1MW7A 2X6SA 2YTUA 1SL0A 3MR2A 4J2AA 4DS5A 4DSEA 2ZGZA 3LALA 2E4LA 3C21A 4NL9C 4R25A 4O4GB 2DHXA 4H0VB 3HHEA 2HGLA 5C2DA 2NRXA 5JVGL 5J8YA 2V2KA 4IDKA 1FDAA 3C2LA 3CO0P 3H3OB 3GBTA 1XNQK 2MB0B 1VJ5A 3OYJA 4ILMA 1RDDA 1MMNA 4WTOB 1HBOB 4RT3A 4BQLA 4CIGA 4LIWA 3OTBA 3TJ8A 1SV5B 3SV3A 3THVA 2BQRA 2KXNB 4W5OA 4A61A 7ICNA 3ZX3A 1CQMA 4RL1A 2PMZC 1HPZA 5BR8J 1XNSA 1EKSA 2J8AA 4WK1A 2ZH8A 4IBNA 4DTJA 4QZAA 3CJ0A 4KLDA 2JNJA 2F3JA 1PZNA 2E7WA 3CD5A 3MMCB 4J9QA 3ZX0A 2Y1IA 1NRKA 3QAUA 1XQSC 1JNRB 2ZHBA 5E3CA 2HHSA 2HFUA 2C2MB 1DTTA 4ES1A 3FBEA 5I42A 4KKOB 3FRZA 3HD2A 1S57A 1KONA 3C2MA 4O8UA 3TAGA 2BCRA 1C2PA 2J6UA 1TP7A 1REGX 2KT5A 3MMVA 2WVDA 2YJEA 3KHHA 2DKOB 2XMAA 3I55N 1UCNA 1GH8A 4OYXA 5KPTA 4I68A 2OTJS 3PMLA 2HK2A 3TAMA 5L1KA 3J81O 4JI8J 1QAJA 4YOTA 7ICUA 2Y0SD 2LQJA 3I8DA 4YR2A 1RYSA 3OXGA 3G82B 1UCVA 2AZ3A 2BR0A 1JI7A 1BHNA 4QZCA 1G7CB 1GXUA 1XSLA 4IUFA 2MZJA 4ZH4A 1S6OA 5KG5A 1WC5A 9ICUA 2VG7B 2IVOA 4CECA 4IFVB 1B3TA 4E3SA 5KFUA 3S8SA 4QIGA 3OS0A 1NK0A 2BTFA 3VGMA 4ZLNA 3PRDA 1IBCB 2IHNA 2YXLA 4OX9F 4K4YA 4NV0A 3QGHA 5L1LA 3K2PA 1MQ2A 5HMXA 5H9EJ 1X3NA 3O3GA 1TUWA 2QSFA 4CJWA 3OVNA 4TUQA 1L8OA 4JS4A 3QU9A 1J2VA 2K8AA 3H7HB 5CR4A 2ZE2B 4I29A 2ADCA 1UTAA 4DL3A 1ITPA 3TEGA 1CS4B 2Z57B 2FXUA 1TGOA 2DPNA 1RAAB 3M4XA 1TL4A 4A8KA 4C7YA 4EZ9A 4ID5A 1KKXA 4DV5K 4JV2A 1RXWA 7ICQA 3O6WA 2KKPA 4NX9A 2GAHC 5CD4A 2W7PA 5HSPA 1LKYB 1WG8A 1B0VA 1RDRA 2KVIA 5KL1B 5KG2A 1KDHA 3L5KA 4EHUA 1IV8A 2ZJ5A 2HWTA 2NXCA 4TVAB 4F71A 4YVZA 5ALLA 1TUVA 4CZHA 3LP1A 3CI5A 3PYDA 4JKDA 3G6VA 4IR1A 1W9HA 3O08A 3FKBA 2WFAA 3RGIA 4AQYF 2QXFA 4I6WA 4U8VA 1JLFA 4IG3B 4DG1B 3K2YA 1UAXA 2ZXHA 4NL9A 2PSZA 3BN7A 4CDIA 4EHTA 3MZIA 3AQFA 4KHQA 5AI9A 4M47A 2D3DA 1U1LA 4H4MA 1UVJA 4NA3A 1WNEA 1UWBA 3E9PA 4CJEA 2DR8A 4H5RA 1SPBP 2C2RA 1GTEA 1LCUA 3GV8B 3FLCO 1LWCB 3V9SA 2UVUA 5J0SA 3AODA 5H1SV 3DAWA 4LF4K 4URSA 1DHMA 2AT1B 3ZZUA 4U7UD 4QWBA 5DDMA 3VF0B 2YNFA 2BKPA 3CP8A 2V4RA 1NK8A 4WIQA 3QIOA 1EZZB 1IBMK 3VQEA 3F73A 1IXRA 1TYQA 2H3FA 2F2AB 4X64K 2JZ5A 5KFPA 3ZETA 3QEAZ 2MLXA 3T6JA 4ED1A 1F5BA 1TKTA 2WONB 3IDWA 4M42A 2P6RA 2QLFB 2XLKA 4E1MA 3QXGA 4TYAA 2YQ1A 2E1CA 4EO6A 4X4NA 3SQGB 1CLQA 3U3GA 5KFBA 4OPAA 4JKGB 4YOVA 2GGPB 1IBKJ 1ZOTA 5ETLA 2R7YA 3EL2A 2AYGA 2E1AA 1ACMB 4FWKA 4DMZA 2KZZA 4ZVHA 1OWXA 4DPWA 4O3QA 2QI2A 3U3YA 2G0IA 3FGVA 2VJVA 4LRCA 4NWBA 8ICPA 4JYAJ 3LYSA 5EOYA 3W64A 2F4VK 3TFRA 3Q89A 4TSXA 3MWPA 2JMGA 4KKOA 1XMBA 3IM8A 4FJ5A 5I4MA 5C0YA 4UAUA 4FPBA 4LVOP 4Q0BB 5B09A 2PGCA 2KXFA 4LSNB 1U47A 1TUUA 2W2NP 3V4MA 2VHGA 3C23A 2CPIA 4CEBA 5HL7Q 3CCRS 3P4UB 3LAKA 4IO9Q 3U9DA 3TQEA 5LOQA 4YDUC 4UY8O 3W3SA 3PHTA 1TE2A 1F60B 4GXIA 5LMUJ 2R8KA 5K20B 4B9TA 3ASMA 5THWA 4W5QA 2JRZA 2P9SA 2VQFJ 2OSQA 3GYXB 2BJDA 1R0AA 2UUBJ 1D09B 3S6JA 4USWA 2HBZB 1VQ4S 2HHHJ 3PIOQ 1RT1B 3C66A 1NM2A 4CF0A 3OYCA 2W4DA 5AM2A 1F1BB 4CJQA 3DLJA 4WBFA 2EK6A 3CE8A 2JWKA 1Q8KA 4WZMA 2MSNA 2EKNA 2F1HA 1OMSA 3ICLA 3I8BA 5EX3A 1FFWB 4B3RJ 4KLGA 3QINA 4UOHA 3NUQA 1HBUB 4RW4A 2NSBA 2C2EA 5CRXA 3DGPA 4DDFA 1YJNS 5ALUA 2IVPA 1FVSA 3K8WA 1BWFO 1OH6A 4K43A 5HQLA 2Z1IA 4RUCA 3AVJA 1NOMA 5LMNK 1VQ8N 1X4HA 3KJFB 5TZVA 2EAPA 5ETKA 2GQCA 5D8HB 1JROA 2M88A 3ZSXA 4YDUA 4BC4A 3QESA 2QLXA 3ISDA 4GMJB 2VFVA 3JQMA 1WCNA 1S0MA 1UA0A 1XR7A 4F0HA 3FAHA 4KLUA 2LA4A 3HHDA 3OVBA 1T4GA 3ZXWA 1S0VA 5BYQA 5AQZA 3BGOP 9RUBA 2FI1A 3AL0B 1T9XA 3O9UA 3VAMA 1EKRA 4NOHA 4ES3A 1KXPA 2JOQA 2PD1A 4HT5A 1IJJA 1JCFA 3M8WA 7FD1A 2RQKA 2J6TA 1M5VC 4CHPA 3FCWA 2P1JA 4AHTA 3GDXA 4M5DB 2ZITA 5LMUF 4DQPA 2PI4A 1X9MA 3RAQA 4EX6A 2Q6CA 3T5KA 4OHVA 5JMVA 2OEKA 5J0OA 2LU2A 3CCMN 2ITMA 2DPIA 3B8AX 4LSZB 4ZVUB 3CC2N 1S1XA 2DNQA 1KQFB 1FEZA 3MBYA 2RKIA 4PZVA 2CWKA 5CXTA 2XTJP 5DO2A 1N0UA 1BIUA 3D68A 3OW2R 4JUZA 4ILJA 4CO3A 3D4JA 2BYCA 5CD4H 1BIZA 2GO7A 4Z6EA 3T3FA 4O55A 4F5QA 1HNXK 1XS9D 1NZBA 1YRUA 1W0HA 4FJ7A 3QRPA 2P66A 3OXLA 3HJFA 3QBXA 2DQNB 4KGZB 1ZQSA 4KB7A 1Q95G 1H7XA 2R7QA 3D2NA 4DR5J 3HPHA 3IWXA 3PRVA 1M5PC 3M2UA 1Y5LB 3A12A 2F7VA 2J0WA 1MROA 4IKFA 3M6WA 2QA4N 3P6YC 1RAOA 4USKA 4C7ZA 2MGZB 3H59A 1OPIA 5KFQA 1BQNB 4UB5A 2QLWA 2FPKA 3B4MA 1S5JA 5B7WA 1P27B 2I38A 3C16A 2RQ4A 3LWLA 1F5CA 3BO2A 3R2CJ 2WVBA 2W3RA 4ZCLA 3PIOL 3HX0A 2ZNYA 4GXJA 4I2QA 1ZQVA 1U2FA 4Y0WA 2EWHA 2YNHB 1CULA 2Z8QA 1BVSA 4B3MJ 4C98A 5L9NA 2ERRA 8ICEA 3UPFA 4F4AA 3D2EB 2W8LA 4CTAB 2NLWA 3KK1A 1EQYA 3EZWA 2APOA 3NGTA 3FCHA 1IQZA 3CJRA 5E33A 4O5FA 2HS4A 2VPWB 4MFAA 4F5PA 2V8VA 3MR5A 5KRSA 1U04A 2RU9A 4OHZA 4ACOA 2B4OA 3DYAA 1YJVA 1H1VA 4M9LA 2ODGA 4JAXA 9ICWA 2ZH6A 3VQPA 3DLEA 2FJVA 3ALRA 2ATLA 2GWJA 3A5NC 4U8YA 2B0GA 4I67A 3QEXA 3LOUA 4YXJA 4EGLA 4X62K 5AI6A 3ETLA 3TYTA 1TUYA 1LW2B 1B70B 3FCVA 2EFPA 3G8QA 4DHVA 2YQ0A 4ZPVR 3SK3A 5BYRA 3N79A 2E9ZA 1WNSA 5F8LA 4AUKA 4B3RK 2KSOB 3VGTA 1NJXA 4DR3K 2KG0A 4O44A 1N34J 2FBXA 4DV4J 5DB8A 2KICA 4LZDA 4HT7A 5KFRA 3D9BA 4HLBA 4ATNA 4F5OA 3HVTB 1SKUB 3A0BU 4PEOA 1NMNA 4ZVSB 3T1HF 1QJHA 4DR5F 2FMPA 4CJRA 2J0QD 3PXGa 3UKRB 1SB3C 4EU0A 2WOMA 4CFBA 1SI9A 4BG8A 4LBPA 4CF1A 5ETTA 3AD9C 1I3AA 4GKKK 3M1VA 4M2YA 4RNOA 4NA1A 5HP1A 3KHGA 4USUA 3AY9A 2OAUA 3QRQA 4JOUA 4YOUA 2M5YA 3OPKA 1OIAA 4BUGA 4E7HA 2ROPA 2RUGA 2UUBF 4DR1K 4O5EA 4CGZA 2X1FA 3QT8A 2QTWA 1GLEG 2A1JA 4RU9A 3KOAA 1S5ZA 4MKBA 4ZA1A 3AVMA 5B0AA 2ZJ8A 4IOBA 3B0XA 1FWPA 3RBXA 2MDAA 4KSEB 4DFMA 5F9LA 1PVPA 1QCKA 3O44A 3R1HA 1URRA 3MD3A 4KAIA 2XRIA 4J2DA 2EVZA 2A3VA 3EGZA 4PZOA 3HVWA 2HG4A 3WZ0A 5J0RA 4C3LA 4CE9A 4FPAA 5JVHL 2IBOA 1XMQK 2O01C 5HATA 5AM0A 4KH0B 2HURA 3QO9A 4A5BA 1R8CA 2VCPA 4DFJA 2OKQA 1EB0A 1OO0B 2X74A 2GH1A 2A1JB 4O23A 3GYNA 2F40A 2E8NA 1S6UA 1RTHA 1K73T 2IIRA 4PG8A 2KZ3A 3RRKA 2GUPA 1XO1A 3MM5B 3MDFA 4Z4EA 4WFAL 2VD3A 2QWRA 2GTDA 4Z4GA 4I9QA 1WBBA 2YWWA 2OO4A 4HVJA 2QX0A 1ZQEA 3QERA 2EXUA 4QCLA 2A6AA 3LUYA 2KB2A 2Y0SF 3SDEB 3OYEA 4LFAK 1NBWA 2JEFA 5HQ8A 4ISGA 1FK9A 1KD1T 5H2FU 2FGCA 1TAUA 4FLXA 2DNZA 3EE9A 1TAQA 2FJBB 1ZC6A 1XI1A 5A2QY 3OGUA 4CEAA 2FC0A 1PJ7A 4KRWA 8RUCA 2B9YA 3MOJB 3QGPA 3RJGA 1NWKA 1U24A 3CJSA 1M5OC 1VS3A 2ZIVB 4CFDA 1ZJNA 1N36K 2I8EA 9ICPA 1Q86T 3TQ1A 3ILOA 1C20A 4B9MA 3M8ZA 2X78A 4ICLB 4H5NA 4DCJB 2EBEA 4LF9J 2O8DB 2EZZA 2J8SA 5DRKA 5A2QU 2EZYA 1W2BR 3HZGA 2KEYA 1BI4A 2MXYA 1WG1A 3A13A 3MR7A 1U7LA 3OS2A 2IJFA 2QB0B 2HWHA 4ECTA 4CD1A 2A18A 4BE1A 5HR6A 4EBDA 7ICJA 5GAHI 4FWQA 3CHWA 3S3MA 2JGUA 1M1GA 2HBKA 2UXCF 4OGEA 3UQ2A 1VRUB 5J2QA 3ZDEA 3IFEA 5C2GA 1WC3A 5AHXA 3IUCA 3CF5L 1HUOA 3M05A 1LXNA 4FJGA 4A8OA 3MXMA 4MEYA 5HP4A 3ZD9A 3MTJA 4OYAA 3LDNA 2FLNA 3PUFA 2XZTB 1HA1A 3AOAA 4QZVB 3R1XA 1I94K 4Z7YA 1Z6RA 3DJCA 3M2VB 3KHYA 4EWTA 2RKIB 3IMXA 3R3LA 4JV5J 1MNEA 2VWKA 2YKOA 5IT9Y 4HACB 2IIHA 4HCBA 5DB6A 5E3QA 4GKKJ 2H5JB 4O0IA 3WDOA 3IRWP 3Q8VA 4B08A 1RWKB 3LANA 4W98A 2YQEA 3CPWM 3CT9A 4X65F 4FWRA 4Q8FA 1NJYA 2OZMA 3JSMA 4DR2J 3TRGA 2DL0A 1SJ3P 2J7WA 4GFJA 3OR1B 4MO4A 9ICAA 4FLZA 3W2WB 2D0AA 3QEIA 1X9SA 1Q4RA 2R7VA 2LECA 5HLFA 5F2RA 4M04A 2ZH4A 1P9QC 4DB3A 1VC6A 2RAQA 2ZFHA 1QQNA 3OHAA 4CDGA 2K4EA 4KFBA 4JI0F 4OFZA 3F2DA 2QWNA 2ASLA 4DPUA 4O0JA 3AD7C 3D7SB 1N34F 1FW6A 2OYQA 4HAIA 2V8DA 5M2UA 4IXCA 4K25A 4CLYA 1PG5B 2LQBA 1ZH5A 3UR0A 4D3HA 3KG0A 2E2PA 4QWEA 1DKGD 2I7NA 2JLEA 1P8ZA 2PE8A 3N5FA 4UB4A 2G0JA 1RILA 4GNIA 3HD1A 1UFWA 2UV8A 4HUFA 4FDFA 2MJNA 5CABA 4M41A 3SI6A 1CZBA 4DU8A 4EZ6A 4R65A 1QAYA 3KZXA 3ET6B 2L9DA 1HBOA 4CNYA 4NMXA 2A2CA 4UAWA 1U49A 2LXIA 2XM3A 1ZAWA 1HKCA 3NS5A 3ZTOA 1HIWA 2ZC3A 4Z4IA 3M8SA 2ZKUA 2I7PA 3HILA 4CEDA 1YJ7A 3WK5A 3D66A 4M63C 3THXB 3W5XA 3NY0A 3IKMA 2KKVA 1WOQA 4OI6A 1CVJA 1ZBIA 2HNDB 3DLRA 2NS1B 1FI4A 2L3MA 3UD3P 3FVYA 4AQYJ 4P2XA 2FLPA 4ED7A 4I2DA 3UXPA 2VPYB 4JK8A 2HIQA 2C22A 5G5GA 3C6TA 1RZTA 3ZZ0A 4L8RB 4CF2A 1LXJA 4TY8B 1FEEA 3VAIA 3QIPA 2YWHA 2V9KA 4A57A 5B0BA 4FLWA 3UN5A 4CLFA 1VSDA 3RRHA 1RFQA 2ZVSA 1IVZA 4KBIA 5CQGA 4B3MK 1UFKA 4CD3A 2WW4A 4OKKA 3EZ5A 1X7VA 1NK7A 4ZPBA 4E98A 3SPZA 4I9LA 3A4TA 1TKXB 5AKGA 3N01A 3TAPA 4BHQA 3NBPB 4TYBA 4M95A 3WEEA 3ZTSA 1YG0A 1SCJB 2XIDA 1JLQB 3RW6A 2PFOA 2YWGA 3J81j 2AEFA 4CLTA 3HP6A 3D0GE 3HW8A 4JLHA 2M8HA 2HCFA 1VC5A 4DKWA 3R5JB 2AGOA 1S12A 1RP5A 1RKJA 4B9LA 4ZTJA 3BJYA 4RW9B 4K0KJ 3KMSA 1WOOA 2QFIA 5EY4A 1IBMF 1VBZA 5F9NA 4LIRA 1HNXJ 2XMJA 5HO4A 4JI7K 3WQUA 5HHIA 1YBUA 2DH7A 2Y0SC 4LY7A 2UUCK 3K75D 2WZ1A 5B66U 1IKWA 2XGPA 4ZPWR 2V4JB 4K4TA 3W8PA 2ROGA 2HVDA 5DDYA 1JB0C 1SIWB 1BOTO 3ZC4A 3KXDA 3OYKA 1MN9A 4UT4A 3V6HA 4P0QA 2QV6A 1QAXA 3BS5A 1M1HA 4KC5A 5LL6d 1VAZA 5AKHA 2EAMA 4URGA 5ALJA 1OY8A 3C6UB 1QVGR 4M63A 4PHDA 1HNZF 1RCOB 1UPMB 3QFUA 1HYVA 4DX6A 4USTA 1S1WB 2FJWA 3MCNA 1D8YA 1VQ7S 3CQ8A 1EHWA 1H72C 2MZSA 5HRPA 5ALPA 3MGHA 1VQPS 1M5SA 4WF9L 2GBZA 4MDBA 4DG1A 4A48A 1HQUA 4IR9A 1XK8A 2J4RA 4M45A 1C0MA 1YX2A 2IDOA 7ICSA 1ZQ1C 2F1IA 4Y2XA 3IA0A 1R59O 3NH0A 1CULB 1L3VA 2JEGA 4I69A 3D6HB 4FJLA 1VC0A 1G2EA 1VMBA 3PR4A 4UB3A 2NZ4A 1ASWA 4NPOA 1A76A 1N2XA 1OUQA 1KNZA 3UD5A 2OXOA 3K7RA 4G9ZA 4NJ8A 4I2JA 4ILRA 1PJ5A 2Q3SA 3OY9A 1N33F 2EKYA 3GIRA 3F41A 3PY8A 3OR1A 4X65J 3PIPQ 2F1JA 1JLCB 1RHMB 1P1LA 1VBKA 4IJAA 2HDOA 4CH0S 4LF8F 2ZD1A 3IRXA 2WF9A 3CSKA 1TYQB 1K5OA 2AWZA 4DUYK 3OQ2A 3CCQS 3L8BA 5M1QA 4NASA 2B4PA 3FZFA 5IFMA 3L4BC 2PA8D 3K59A 4PXCA 4ENOA 3CJ7A 5BPCA 4NLOA 4EEYA 1XBWA 3WX8A 1XU4A 5GVQA 1TFYA 1RDCA 5D0GA 1JLAA 2RMLA 1CJTA 1U0SA 2WHEA 1VSLA 5IIKA 1NNEA 1NDLA 1JKHA 3SJHA 5ALOA 4NWIA 1BCOA 4RQ7A 3QFWA 3OYLA 2Z56B 1OYEA 2VU5A 4QIEA 1T05A 1HNZJ 3VAHA 3ORYA 5AKLA 1ZRMA 2NO4A 2HAIA 3R5CA 4YMOA 2QWQA 3WKBA 3FEYB 2BX6A 1C0TA 1U1OA 2GS8A 1VJWA 4GRSA 2G07A 2FZKB 5AQWA 5HJYA 2HZCA 4FK2A 2Y0BB 5JVHQ 2IVMA 4FJJA 1RAEB 1HD0A 3R5GA 4GIBA 5ETPA 3O3HA 3DLLL 2F9TA 4UW2A 4LF7K 1FRIA 3QBWA 4WQ5C 4FYWB 4DN9A 4CF4A 4OZJA 4YDXA 4FYYB 3NF9A 2JC0A 3UMGA 3SNNA 3NF7A 1IG8A 3NGSA 4K4HA 4C23A 1OVQA 3OR2B 2PFNA 1U25A 1BE4A 1NDCA 3ETRA 3FYHA 4KPYA 1OH7A 3LP2A 2CNLB 4ED4A 8ATCB 2B9XA 1DTTB 3VMFB 3MXHP 2UU9K 2WBNA 1WJ9A 4QIFA 3QIPB 3VVUA 1E3MA 2BA9A 4LJXA 5L39A 3JSRA 4JS5A 3V1QA 3VQ6A 2IVNA 2XY7A 3TPQA 5AXKA 2W6KA 2BJ8A 4C0ZA 2G4BA 4PWDA 3GFYA 3HFKA 1SQEA 4KREA 3U7JA 1QUPA 2Y8WA 1QM9A 4X64J 5AKZA 4M3YA 2FF6A 2XMTA 5I3QA 1FFUA 1R8BA 1RQLA 1XNQF 1FNMA 4IQVA 4QR2A 3R7SB 4O5BA 1KQSM 5KL8B 4WKRA 1NPKA 3NEKA 4HTJA 4C4WA 2GJIA 2RHQB 4C6AA 3MM5A 4UOGA 4CT9A 2QARA 2HFVA 1VQ9S 4IS7A 5HMMA 3PCOB 2VB6A 1YJTA 1N32F 3CJ1A 4DL6A 1UJ5A 2QL7B 4LSLA 2HEKA 5CYMB 1CEZA 1HBMA 4CGFA 2R8JA 5D4BA 4AD6A 2OHFA 2C3YA 2QK9A 2PT0A 4HVZA 2QEXN 1YHQN 3Q8SB 3MEGB 1BMQB 3PJWA 4EAHD 1YJUA 1D0EA 4DBQA 2C3OA 3VGVA 3VF6A 4HH1A 3G4SS 3S9HA 2VIHA 3MM8B 4JK7A 3K89A 2K1RB 2DNMA 2HQDA 5D3GA 1HRHA 1PJ6A 2LSNA 4CWBA 2MAXA 3GR0A 4NI2B 2M8DB 3FMWA 1HWLA 2BMBA 3O1WA 2KL8A 1BCMA 2E1FA 4H4KA 5T7BA 1HNXF 1B4SA 5DBBA 3MN5A 1JLQA 4JI6K 1U1MA 2HSEB 5F3XB 5CCMA 1WEXA 5F8MA 2O6KA 4WJ3B 1RAJA 4I2EA 7ICPA 4X4SA 1X5SA 3QO9B 4NLSA 3I5BA 3E8OA 3WKCA 3PIPL 3L3CA 3DHXA 1VQPN 2CQ0A 5MLCQ 1NGJA 2GZOA 3DDNA 1E6VA 2Z7JA 5LXRA 2NR0A 5K5MA 1RBOB 2KIVA 3T5LA 2MZQA 3L0QA 3HKWA 3VEXA 3AVIA 4N56A 3ID8A 2BE2A 1Z2ZA 4EP4A 3UKUA 5T41A 3GP9A 3AOBA 4Z7CA 3J81U 2JHEA 3FQKA 1HR0K 2PMZD 5HL7L 1HNWK 1UWAA 4BRCA 2HLTA 4I2FA 3MR6A 2CRXA 2V34A 2IGIA 3TSUA 1T3VA 4TY9A 4MLEA 2XG8A 4B1ZA 2ZIVA 2V69A 3VHQA 3LPEA 1BD6A 1VFJA 2ILYA 1ZQHA 5M1NA 1BQMB 5E7OB 1TL7A 3FJ2A 3OLBA 4C8ZA 3VAGA 1A5VA 3VN5A 3T41A 3QUBA 4ELVA 2W01A 3HJVA 2RP5A 3JTNA 4DOBA 4GLXA 1BUXA 2A2DA 5AJ3K 1KP6A 2KDOA 2PYLA 1SXDA 2FMSA 1KHVA 1ZOLA 1A6LA 3T19A 3UMBA 5AQGA 3RR7A 4ISEA 4KTQA 3NXZA 3GV5B 1Q79A 8ICZA 4I27A 3KJQB 2H51B 1H98A 2ZH9A 3CERA 2BQ3A 3A1YG 1RWMB 3QUCA 3H0RB 1EXQA 2QLBB 2ZUGA 3CCWA 3E2EA 3CCEN 1DGKN 1FRXA 4P4PA 4OX7A 3M6ZA 4PABA 3DRPB 3EDQB 4L75A 3KK3A 1YBTA 2NLXA 3ULHA 3C1ZA 1KLNA 1D8ZA 3NCPA 2UXDK 1VK8A 3LA0A 5L38A 4ECSA 4F04B 5EWFA 1RWVB 1XO0A 4H5VA 2FIUA 2BEFA 4LF5F 1VBYA 1YLXA 5DQIA 5AQNA 3ZZZA 2XQCA 1UVIA 2E44A 1TAMA 3QWUA 2UU9J 1U6BA 5DDRC 5AQOA 5HANA 4WTYA 1WI6A 3CMEN 3W7BA 1KLMB 1R7IA 4JI3F 1N63A 5KFJA 3M9MB 3EW9A 1MN8A 1EIYB 4X4PA 3C15A 1Y11A 2J7UA 1S0NA 1PYTA 3QEVA 3I0RA 2O8EA 1LFPA 1Q9XA 4H4OB 4X5VA 3O9RA 5JLFA 1K1SA 4A4JA 3PFOA 3H8SA 4DSLA 1IR0A 2MPUA 2VGMA 5H1SQ 2LU1A 4KI6A 1ZJMA 3QBCA 3TA0A 3TACB 4E0DA 1SQGA 3OHBA 5DK5A 4KH1B 6FDRA 4RPFA 4EYHB 1JMTA 4DFKA 1N88A 1KL9A 4MYTA 3LDAA 5J2HA 1HPZB 1ZD4A 2F4VJ 4XDDA 3G96A 4CEEA 2Z1GA 5ALXA 4LF9K 1AFIA 1O5JA 3CC7N 2D8CA 2KT3A 5J2JA 4UUWA 2OMLA 3DFEA 1NSPA 4EBCA 4NLDA 3MABA 5I3UB 2JRSA 2AJFE 4GC6A 4FK4A 4JV5K 3UXOA 3I4PA 2E6MA 3P4IA 4U6PA 4DFDA 1WWUA 4ZK7M 2MZ1A 8ICRA 3DWLA 3ZDDA 3Q7BA 3KKAA 2QA2A 4FVCA 2B6AA 2W2QP 1ELOA 1DK3A 4QZEA 1L7NA 1RAFB 3FEXB 1ZXIA 2YQ3A 3S3OA 3RTVA 2FUG9 2IRYA 3KLHB 4DR2K 3MMAA 3TP2A 3G71N 5MAOA 3FUYA 4OX9K 3V9UA 3P45B 3PW5A 4HTIA 2H3ZA 3SJJA 5A8RA 5AKEA 4UTGA 2BVZA 4DR2F 5ALHA 3F2BA 3F5EA 5CWRA 1HBUA 5FD1A 3FNNA 2XICA 3A5LC 8ICFA 3X1LB 1NGDA 1QHTA 3A5MC 4I6MA 2W11A 5IILA 9ICFA 3VQDA 3FGUA 4CJTA 2BRKA 1RGVA 3BBBA 1SV5A 4QIVA 4LRAA 2PAVA 1QHAA 3DEEA 3O1LA 4V19S 2ZJPL 2LYBA 2M3DA 5FP0A 1F9HA 3FFIA 5FLXY 1G1XA 3CW2C 4KYZA 3MR3A 1NHKL 4I28A 4F5NA 4DV5F 2KJ9A 2JDJA 2FPLA 5D0EA 4BRDA 3A8KA 3K5LA 3BQ1A 2K06A 1R0BG 1DARA 3KKAC 1G3OA 2KTQA 3RJKA 1QTNB 2V67A 2WB4A 4M5HA 5BRFA 2EFGA 4XTTA 3LDSA 5KFMA 5FLXO 1OYDA 5TKWA 2YI1A 4K4GA 2UYTA 2RSQA 3HK2A 4KN7A 2XWYA 1Q3VA 1RU2A 2BQUA 2DD8S 2P6UA 4G1PA 1GXLA 4FVMA 5AQLA 4US8A 4FL9A 1LWFB 3N4PA 1SL1A 1SC4B 2R9LA 4FJNA 2DKZA 4CZMA 5FDLB 1WSIA 4BRFA 4H5WA 3RVCA 4F72A 2B8QA 4NYFA 1NKCA 2L41A 1LFWA 3RMDA 1VQNN 2H4YB 1D8LA 1FKOA 4A8YA 1PILA 2Z2YB 4NLCA 3ENVA 2HBLA 3WQTA 1BISA 4ETXA 4MIBA 3NL0A 1NKEA 5LJVA 1X5PA 3TR8A 2B5JB 2ZUAA 1S1TB 3H2LA 2A1AA 1N5VA 1S9EB 2CQIA 4PCQA 3H1VX 4NYOA 1RHQB 2FD2A 3BEXA 3U26A 2EH9A 4HACA 5LXYA 1GMWD 4MFBA 3ZLJA 4JHDA 3JSYA 5FDLA 1EWQA 3D2FA 5E79U 2BZFA 4RG8A 2ZNZA 4JRQA 5IXUA 4XA5A 4LH4A 8ICJA 3AJ2A 1O51A 1Q7YO 2AH5A 1D4XA 3PTWA 3I4HX 3IR6B 3P5BP 3HFVA 4WXOA 1KEKA 4PL2A 5KFTA 2GHVC 4M94A 2CPHA 2C3UA 1IJFB 2D3O1 3HI0A 2BJEA 3BPDA 3PNCA 5J2CA 5DBAA 4CTAA 1S49A 4O3OA 3H5YA 2X1GA 1YJ9S 4YHHF 1X5TA 2OPPB 4IEEA 2BBEA 2QC3A 4RNNA 4I4BA 4M6WA 3L9ZA 4IQTA 3CCLN 3LF0A 1UEUA 5ADXA 1GMVA 2FHJA 3THYA 3CC4N 3PV8A 4PL8A 3J7YP 4K8ZA 3JTOA 3CCTA 1BQXA 5D78A 2RHSB 2R7TA 3SCLE 3HOTA 4F4ZA 4FZYA 2ZHAA 4WFAQ 5AQHA 2KVCA 3D28A 3SQGA 2E5GA 2UXCK 3LDPA 2QKKA 3DLKB 3T1AA 1SZPA 1FE4A 1HJPA 1AZSB 1PAUB 4CGHA 4P2HA 2P2CB 2A5XA 4CT8A 3C16B 2BUPA 1HWKA 2XS2A 2GV9A 1ATNA 5BR8K 4XO0A 3KK2B 2E7XA 3QZ8A 3VENA 1TVRA 1NGBA 2MU2A 1PK1B 3M30B 4FF1A 2DNPA 4X62J 2DFEA 3QT7A 5DZ7A 5BR8F 2CH5A 4F7VA 2HGNA 3V1RA 1KVIA 4TUSA 1HQEA 4WFBL 4P7VA 2OLWA 1LK7A 3CJ8A 4KGMA 4HHHA 4Z4FA 2HGMA 2A6OA 1F9EB 3I9ZA 1FJGK 2ZF5O 4Y2KA 4WQ4C 3JXUA 1KBRA 1HKAA 1NK4A 1CC7A 5J1NA 5J2GA 3KWGA 2HFNA 3ILLA 1S8OA 2RT3A 1GX6A 3NG8A 4PPZA 1FJGJ 4R5PB 4P71A 1K8KB 4R0JA 2Q31A 5DBCA 1R8AA 3WKDA 1VSIA 3B6OA 4OLAA 4B6JA 2ZUBA 3ALYA 3WNEA 5ALYA 3KWMA 4MEXA 2QWMA 1VBXA 3G86A 5T14A 2JJ4D 5KFCA 1UAWA 7ICOA 1ZM2A 3MMAB 2Q2RA 1HHTP 1KQKA 5F8JA 4UASA 1KAZA 3BSAA 4PUOA 3JPRA 2RLTA 1B43A 3LQVA 3BREA 2CQCA 4WFNQ 3RB0A 4FP9A 4K4ZA 1YUWA 4RBTA 2KRRA 3V7JA 2NRTA 3MGVA 3JB9k 5LL6Z 1Q16B 1M5HA 2ZM6K 4FZVA 1XMOJ 4KT0C 1RI7A 1S7IA 4OPJA 1H38A 2ZWOA 1TMMA 1UVNA 1Q86O 3BPSP 3ILIA 4M9GA 2NYVA 1UT5A 3TAMB 4BS2A 4EP5A 1YVUA 4LSNA 5AJ3F 2DH8A 3FC4A 1Q82T 3DOMA 1B0TA 5KRTA 2VF3A 5D4PA 4K8RA 1N60A 1UKUA 2Z0GA 4GVBB 3VWSA 4JI4F 4PG7A 2G8WA 4S0MA 1WHWA 5HP1B 2D0CA 2Z4PA 3BDEA 1NLVA 1ZQFA 4TUPA 1SKWA 4IH7A 4P72A 2GX8A 2XO6A 3FQLA 4GO5X 3SMZA 2DGXA 3ZD8A 2AV5A 2XI2A 2PO4A 2XI9A 2XMMA 3MAAA 3KNGA 4DUZJ 4LFBJ 2JL9A 4ECVA 4K4IA 3CCJN 1FEHA 4IOCQ 1KAYA 3EE8A 3Q8UA 1J27A 4U96A 3C94A 3NMUA 3R9KA 2DHSA 1VQ5S 1HLWA 4OD0A 3IG1B 1RWNB 1K9MT 1HNZK 2N3LA 2FJXA 1YITN 2YHWA 4Q8EA 2EDUA 4A2BA 4RQ2A 5HVHA 2EW9A 1FJGF 3OFGA 3TO8A 1YZ7A 3T1HJ 1XNRJ 2EAOA 3O0FA 4CM0A 1SB6A 4H0TB 4F5RA 2K3KA 5G0RA 4NXMK 2YBVA 1Z19A 3JQKA 1WACA 4FW2A 3JPTA 3KG4A 4F0MA 4C4RA 5FPEA 4J9KA 1S6QA 3K1ZA 3MPWA 5CYQB 3H3NO 4Y2AA 1XNQJ 3FZLA 2EC2A 3I82A 3JPQA 2ROEA 4X66K 3POTA 5EGYA 4TU7A 2ATCB 3QJPA 3SIPB 2ZZTA 3MPYA 3ADAC 2M7SA 3VQSA 3VZHA 3CDWA 4K7QA 4NLVA 4MK8A 4ZP7A 3R8YA 4KX3A 3ZFVA 3ETMA 5J0UA 3UM9A 4JK9A 5KFXA 2GWKA 4ZIVA 4FJIA 2JWLA 1TELA 2PFFB 5AQJA 3T9NA 5KT4A 4G9BA 4PQUB 3AH6A 2HQFA 2VH7A 4K4VA 9ICRA 2KHCA 2Y1RI 2BE2B 3AQPA 3M2RB 1QZ5A 4NLBA 1S48A 3IS9B 4DX8H 4DR7K 3MX2A 4BC2A 3BQTA 4A47A 4M5MA 4FF4A 3GLJA 2GC8A 1KVBA 4M3RA 5A8KA 4FJ9A 2JHDA 2AJ0A 4N76A 1OW5A 3CUNA 1KCFA 3C7NB 4ED6A 5HOOA 4RNHA 2DITA 5C24A 1RT6B 1I3OB 3BF1A 2YMPA 4B9UA 3K1RB 2VA3A 5AQQA 4X4RA 2W41A 4N8NA 4FLVA 3X3UA 4BWJA 1HYSA 1ZBUA 5EHHA 2WAQC 1S9FA 2LCWA 2DEIA 5C2CA 3MURP 3MCAB 3C5GA 4KMUA 2ZWPA 4KGKA 1HW8A 3DGVA 1JLEB 5IS2A 3I1YA 2Q66A 1D3WA 3H5UA 2BACA 3CC7S 3ZDBA 1KVKA 3ZCMA 1NLKL 1WOPA 2F8HA 1XEZA 3R5BA 2CJQA 3W1YC 4ZHRB 4IJNA 5D46A 4CIEA 3I0RB 1VQLN 4FPRA 5IM0B 3KOOA 4DTOA 2GNKA 3BR9A 8ICHA 4GO7X 2KZMA 1MG7A 4R0EA 3VA3A 3HVAA 5M2PA 1Q5VA 3ETOA 1VK3A 2H5EA 2Q1NA 4E1NA 2E5LJ 2VONA 2IM2A 2B0CA 4JB3A 3GJTB 3D0HE 3P83D 2D0PA 4FZNA 2H1YA 4BRAA 3EM1A 2FQQB 2HIYA 2DGTA 5L46A 4BRKA 1ZQLA 2FVCA 1S6PA 5ETSA 2PMHA 5KFSA 4BXOB 2AJ1A 3FBCA 4M5NA 5GMEA 3QT5A 4MIAA 4CI6A 3SAGA 2OM6A 4GW6A 3EUNA 1RTJA 2OJ3A 3SZ2A 1O13A 3SBMA 3O9QA 1K0TA 2W42A 4BR7A 1RBVA 2GIQA 3UKRA 1WDDA 2KP7A 3UXNA 3QT6A 2YKNB 3FBBA 1DRGA 5ADZA 2B9WA 4I0WA 5CCLA 3C6AA 1RKIA 5DG9A 4PPXA 1G6BA 2PBDA 4M7XA 4MHVA 2HOIA 3NVKA 3Q2SC 3PKMA 1BY9A 3RMBA 1WC4A 4FJMA 4C1NI 3PSIA 1SZHA 4ZP8A 2EX3A 2BHNA 3QQCD 4ZTFA 2DO4A 5KT2A 2Q43A 5FRNA 4C80A 2YMQA 2DGSA 1RT4B 1MWKA 4PKGA 1WG4A 1RT5B 4NXMJ 4YFKA 3AVGA 1EQ0A 4I6MB 5AKIA 1RT3A 3IAM9 3QEPA 4KLIA 4CZIA 4CYUB 3WK7A 1J9AA 3RUBL 3E51A 3ID6A <