4DQQA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 204
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqqA01
1NK9A 3C2KA 4QZIA 4F8RA 2XCAA 1RDDA 4BACA 1FXXA 4QWCA 4KHNA 4RW4A 1YTUA 4YFUA 2ITGA 4MEYA 4FLVA 2QKKA 3C1YA 2EHGA 4ED6A 2B6AA 4DLEA 3VQ9A 4ZH4A 5J2HA 4IQUA 5C24A 1S10A 2ZTDA 5D3GA 4IQVA 4O9MA 2MUTB 3LAKA 1VSJA 4RQ3A 4P4OA 4ECXA 4J2AA 1NOMA 3ZDCA 1WN7A 2BCSA 1UA1A 3UXOA 5IIMA 1A5XA 3C95A 4ECSA 4JUZA 1S6QA 4EBDA 3VQEA 3T1AA 5KRTA 1CUKA 4HYKA 1IKXA 1VSKA 3B6OA 4FZXC 4B3OA 3KTQA 1ZJNA 4RW6A 1NK0A 4M9GA 4RQ0A 2XHBA 1D9DA 4QZEA 3MGHA 4E7HA 4M3XA 3PX4A 4DSJA 3C2LA 7ICHA 2MAXA 3DLRA 1N48A 4TSXA 2F1IA 4KITB 2FLNA 5KG7A 4L8RB 1JX4A 1A5VA 3RRGA 4RNOA 3ISDA 4FJIA 1PZNA 4RNNA 4DTUA 4GW6A 4DFPA 4K8ZA 5SWMA 1WSIA 1QHTA 1ZQEA 5HRNA 3G10A 3L3UA 2XO7A 2XY7A 1T4GA 2PZSA 2J6SA 4YMOA 2FPKA 1RYRA 2YNHA 1B9FA 4YR0A 2G8KA 3DI6A 3RB4A 2B4JA 1C6VA 4X5VA 1N6QA 1VK0A 2YNIA 3PVXA 3TR8A 2R8HA 3IS9A 4QWDA 4CECA 1RYSA 4KREA 1ZQSA 5J1EA 4C8OA 8ICEA 3VN5A 3RMCA 1JMSA 4AHTA 1WSEA 3OYNA 1BIZA 1VRUA 4FJLA 4M3WA 3EPGA 5SZTA 9ICRA 4W5OA 3OYKA 4BDYA 2BGGA 4CCHA 2B21A 1T3NA 5KFRA 2VWKA 3SCXA 1FKPA 3SPZA 2R8JA 5CA7A 4IFYA 4ECUA 3T5JA 3C5GA 3MXJA 4FJ8A 3PO5A 1RT7A 1LAWA 4AHUA 4AHRA 3TAFA 2D5RA 3KKRA 1C1BA 3BQTA 3PX0A 3LK9A 1FKOA 1ZQMA 1WAJA 3EPIA 4DS5A 2F96A 3RAQA 3LANA 3V72A 4TUPA 4F5RA 1JN3A 4HUGA 4DSFA 3VQ7A 3S3MA 4QZDA 3RMAA 4DU1A 2X74A 5DLGA 1BPYA 4CGIA 4Z4CA 4KLLA 4I28A 4JS4A 3F73A 4KTZA 3RJKA 2G8UA 4DF8A 4YR3A 3CFOA 7ICPA 3D45A 3AVHA 3OYFA 3MDCA 4GMJB 3I8DA 4RT2A 4KLMA 4KV8A 4ECWA 4XUSA 2IHMA 1NOYA 5DB9A 1QSYA 3CFRA 4DTSA 4GLXA 4JLHA 3DLBA 2XY5A 1GOCA 2ETJA 4KHWA 3PW0A 3AU2A 1K6YA 4G1QA 2R8GA 2VG6A 4O5BA 1KRPA 2A1JB 4CE9A 1C0MA 2PFQA 4FBTA 3JPNA 4EP5A 5HHIA 3ISBA 4J2EA 2FBVA 4OVLA 2HHWA 3CG7A 3T5HA 1W9HA 4FJMA 3AVCA 3MFIA 1ZQQA 2HVIA 4KN7A 1NK7A 2IOCA 2E6MA 5EU7A 3ETLA 3PR4A 4R65A 4I2GA 1G15A 4OKEA 3MFHA 2DPJA 3SQ1A 4UB3A 1Y97A 4M45A 3F9KA 3P5JA 3K4GA 5J2BA 3E2EA 3AVKA 4QZGA 3AO4A 1HNVA 4QZFA 3JPPA 2V9WA 5KI6A 2C2RA 2ZUCA 3K5MA 2RDIA 1BCMA 4FZZA 3RR8A 2PFPA 4QZCA 4CHZA 7ICGA 4CJUA 3B0XA 2BPCA 4CJLA 4K8XA 3BQ0A 2YV0X 3SUPA 1L5UA 3C6TA 3WNFA 3GDXA 3L3VA 4K4GA 3IM1A 4HUEA 3HK2A 4QAGA 4JRQA 5FROA 3HJFA 5JS1A 2ZUDA 3ZSYA 4P4MA 4FBUA 3ZSVA 4FS1A 1QTMA 4CEAA 4RQ8A 5DBCA 4O44A 2HHQA 5CZ1A 3K5LA 4J9SA 1KDHA 1TL1A 4RQ1A 1T03A 2ISPA 2F1JA 4QZBA 4DWIA 4J9RA 4O3PA 4ZHRA 3HL8A 4DMNA 4KI6A 3G6XA 4QW9A 4CK1A 1KFSA 3PW7A 4CF9A 4YMMA 1BI4B 3SUQA 8ICIA 1GOBA 4CEBA 8ICMA 5KG1A 1WCLA 2RN2A 4DL4A 3UPQA 1QQCA 4KLIA 3SZ2A 5DBBA 1VSIA 1EXQA 3V7LA 2Q0ZX 4M9JA 1NK4A 4N47A 1XSNA 4I2JA 8ICRA 1NKEA 4IRDA 1ZQOA 8ICSA 2XY8A 3AVIA 3QNNA 2PI4A 2XGQA 2PI5A 4CF2A 3V7KA 1U9LA 4F4KA 4FM0A 4FM2A 4DTPA 2ISOA 3K2PA 2VA2A 3CM6A 3ISCA 4NM1A 4FM1A 3FYHA 1ZQCA 4CHNA 4DL6A 3HT3A 5CP2A 4AHSA 4HCCA 5J2FA 2FLLA 1ZQDA 3NH0A 2G8IA 8ICGA 2BCVA 5FDLA 4YXJA 5KFCA 2VG7A 4DFKA 1NK5A 4OKKA 4DTOA 3MEEA 4ID5A 4CFBA 4E19A 1JLQA 1ZQVA 2G8HA 3OYDA 3UQ2A 1MQ2A 5C42A 3AVNA 4NLGA 1RZTA 3KD1E 1RT6A 1WSHA 4I9QA 4PUOA 3LAMA 3HW8A 5KFBA 4PHDA 4FK0A 4K4HA 3GV8B 2FMSA 3GIMA 3QEBZ 2BCRA 2ZUBA 3V6KA 4NM2A 4H4OA 5DBAA 4OGCA 4GC7A 7ICKA 3HVTA 5IINA 1Y88A 4NCGA 3PNCA 4YQWA 1UT5A 2ZJ8A 3H8WA 5DLFA 4NYNA 4NCAA 1IKWA 1J53A 5KFPA 4DL2A 4TQSA 4OJRA 1B22A 4KLJA 4O55A 5HP1A 4NLNA 1HJRA 3D0PA 5DB7A 3SQ4A 1ZBIA 2JEIA 1X9SA 2ZD1A 3QIPA 3S3OA 4OPJA 4FJ5A 1TFRA 1BISA 5KT5A 4Z6EA 3HPHA 1MQ3A 1ZQZA 2HNZA 2OYQA 1RNHA 3AA4A 4F2SA 3JPSA 5HP4A 4I2AA 5KFEA 1U04A 3TAMA 2Z1IA 2H5XA 1ZQFA 4IDKA 4G3IA 1EX4A 3BGRA 4AHVA 1KTQA 4FXDA 5J0RA 2NRWA 1ZQIA 2BCQA 4J9KA 3JPOA 4LZDA 3WNGA 4CJWA 3OYEA 4MF2A 4E3SA 4DSIA 1BQMA 4FJXA 4Z6FA 4CIGA 4PHPA 1U45A 2Z1JA 5JS2A 3S9HA 4F5PA 3AVBA 3V1OA 2OZMA 3KHGA 5HBMA 5L1LA 3AVAA 4LY7A 4I2DA 5TZVA 3HSTB 9ICLA 4HHTA 4DO9A 1SKRA 2ZJ5A 4DFJA 4NLZA 3O3HA 3TAPA 4CF8A 1NK8A 3GIKA 3Q8PB 4DQPA 3K59A 3RJFA 3OS2A 4ED0A 2Q3SA 4EZ9A 3Q8SB 3ZSRA 4R8UA 4DSLA 4FLUA 2P5OA 5J2NA 3JYTA 1U48A 3L2VA 1I3AA 3HM9A 4UBCA 5J2GA 2DFHA 4RW9A 3HO1A 1DLOA 3T3FA 3RH6A 2ZJAA 5HHHA 2BKEA 3GV7B 4B8CA 4MF8A 5J2AA 2JGUA 3DYAA 5CYMA 3OYGA 5KFIA 4Q44A 5I3UA 7ICSA 2OPSA 1V9PA 3C5FA 3GILA 4DLGA 3GFKB 4W5QA 1MC8A 1IM4A 5EWEA 5L1IA 4KB1A 2PXIA 4BWJA 7ICRA 3KHRA 4UQGA 1TL3A 1EP4A 1ZQWA 1HRHA 2FBTA 2KN7A 2D0AA 4OLAA 4KLDA 8ICAA 3QEAZ 4DEZA 4RZRA 3ITHA 1BIUA 5IIIA 2OWOA 1S76D 4CEZA 4DTRA 1Z00B 3UXNA 4M9HA 2QXFA 4DU3A 4RG8A 2UVVA 3L2QA 3SNNA 4FK2A 4O3OA 5EOZA 1VSHA 2G8FA 3V9UA 3U3GA 4RPYA 3L2RA 1NKCA 1RPLA 3VQ4A 5JUMA 4YVZA 4F91B 4F92B 4E7LA 4CGGA 3PY8A 1C0UA 1S1XA 1VSEA 4DG1A 1S9EA 2GV9A 5DB6A 1RBRA 3OY9A 4BE2A 3MR2A 4M41A 1NJWA 2QKBA 1NK6A 1ASUA 4DSKA 1EXNA 3GQCA 2WTFA 3ISNC 1ZQUA 5KFNA 1IO2A 1HNIA 3CQ8A 4F3TA 3ULDA 5EWGA 4B9SA 4PHAA 4IR9A 1KVAA 5BOMA 1HJPA 2VANA 1WSJA 4Z4GA 4Q43A 4ED3A 4DL7A 3RR7A 1RT5A 1ZQPA 2OPPA 4RQ2A 2J6TA 4Z4FA 3HYFA 1HUZA 4ECVA 4RW7A 4ED2A 2BPGA 9ICAA 5DMRA 3Q8QB 2GWSA 3GIIA 9ICBA 4E7IA 3AA5X 2ATLA 3OYCA 3BQ2A 4KO0A 4JK1A 5DDMA 4KLEA 5J2DA 3FDSA 1R0AA 4GVMA 2FMQA 3LP1A 5HMLA 4KLGA 3ZSWA 1ASVA 3G6YA 3JPRA 2GUIA 1TKTA 1SV5A 1CEZA 4DFMA 2W9CB 4OPKA 3HWTA 5J2KA 4ECTA 2AQ4A 3BJYA 1Z25A 3MR6A 2AU0A 3LP0A 3QETA 3C2MA 5KFMA 4E7JA 4FLXA 5FRMA 3DLEA 3LP3A 4F4WA 9ICTA 2BANA 3QO9A 4PPXA 4FJHA 4KRFA 2HB5A 2JZBB 2D0CA 1BHLA 3LDSA 4M6WB 4M0AA 3KHLA 3M8RA 4FJ7A 1S0NA 1EETA 3VQDA 3LPTA 5J2MA 2OPRA 1KLMA 1X9MA 4AH9A 3S3NA 2PY5A 4DL5A 3AV9A 4KB0A 9ICJA 3KLGA 3LZIA 5DQHA 2KQ2A 1X2IA 4DTMA 2P5GA 1XHXA 4IG0A 5DB8A 4BDPA 9ICXA 5I42A 4FZYA 4W5RA 3KK1A 4RQ7A 1CXQA 8ICOA 5J2PA 4QOZB 3A2FA 5CZ2A 7ICUA 5HMMA 8ICZA 3TFRA 4LSLA 2PFNA 9ICKA 3EWAA 3TABA 4N5SA 3LZJA 1C7YA 2C28A 4RU9A 4PGYA 5KG4A 1JLCA 1ZQLA 2HHVA 3MDAA 4M04A 4E0DA 3M8QA 3OJUA 2FPMA 3KKSA 3OYHA 1JIHA 3ZT0A 5J0UA 1KLNA 4KMUA 2E4LA 3U6FA 1ZBHA 4JV0A 3I0RA 7ICOA 2G8WA 5DDYA 1REVA 4HVJA 5BPCA 5J0XA 3V6HA 4R5PA 3CFPA 2Y1JA 1KVBA 1L3SA 1ASWA 2IS3A 4IG3A 3DOKA 9ICOA 2W9BA 1S5JA 3DOLA 3LALA 4CGDA 4CJQA 1XO1A 1RT3A 3KLFA 2BQ3A 2DFFA 3SPYA 2VG5A 5DGAA 3RMBA 1LWFA 5KFVA 4YFKA 1RTJA 4CJKA 3JPQA 3L2WA 4CJRA 1VSMA 3VQBA 3SQ2A 1TGOA 2NRVA 4CFAA 3NF9A 3OHAA 1L3UA 3ZSZA 4WE1A 2AQ0A 4ELVA 1QE1A 3TAGA 5KTQA 3ZSOA 2IMWP 3MBYA 4KKOA 4PH5A 4F4XA 8ICJA 1UOCA 1JLFA 2ALZA 4QZHA 1RXVA 2VA3A 4F93B 1QSLA 3AO5A 2IBKA 9ICMA 3V7JA 3K57A 5DG8A 4ZTFA 1RBVA 4ECZA 5KFZA 4EYIB 4CHQA 3IAYA 1C1CA 4JWMA 1JL1A 1KVCA 4LD0A 2NRXA 4IRCA 2F8SA 2HHUA 4O0IA 1JKHA 4ELTA 5J0TA 2HHTA 1RBTA 2ATQA 4M9LA 5KGXA 3AO1A 4KFBA 2HVHA 4FCYA 3PW2A 4KHQA 4OKJA 1JLEA 4KHUA 4MEXA 1ZBUA 2P66A 2IAJA 3KK3A 5KFGA 4BE1A 4IBNA 4EBEA 3VQAA 5KFKA 3QESA 4B9TA 2KW4A 3KK2A 4B9VA 3ZCMA 1IG9A 4TURA 5KFJA 4YCXA 4CJ4A 2W9MA 3AU6A 3M8PA 4Z6CA 3LDAA 3IRXA 4YMNA 4DQSA 2KZ3A 4ECRA 3AVJA 3PX6A 1C1AA 3LP2A 5CR0A 1J54A 1VRTA 3NGIA 4LVSA 2OPQA 4P4PA 2OA8A 4RUCA 4XIUA 2HNYA 5CYQA 4PWDA 4IQWA 5KFQA 9ICFA 1SKWA 4RPZA 3ASMA 3WNEA 3K5NA 4KLUA 3RB0A 8ICXA 5J2CA 8ICUA 3ALYA 3KIOA 1T05A 3NF8A 3OYIA 8ICVA 3RMDA 3VQQA 1NOZA 3MAQA 3RB3A 3H4DA 4B8AB 4NXZA 1ZQHA 1QLNA 3DLKA 2J6UA 3VA3A 4Z4IA 2C22A 4R66A 1TAQA 4QZ8A 4IRKA 3KHHA 5IIKA 2PYJA 4NYFA 1QS4A 4DL3A 3SJJA 2C2EA 1Q8IA 1HYVA 4DOBA 4NLKA 4CJPA 3U3YA 4FLYA 4LSNA 3ZT1A 1C0TA 2DFEA 5HRPA 2XCPA 3V1RA 4UAYA 2P1JA 3H08A 1WCNA 4KN4A 5HRSA 3OHBA 3DLHA 4JV2A 2JEGA 9ICIA 4CF1A 2ASLA 4F5OA 5KT6A 4MFCA 2YNFA 1TK0A 3QLHA 3QZ7A 2BQUA 3WNHA 3JPTA 3RJHA 1IKVA 4KAZA 5K14A 1D9FA 1TAUA 1AROP 5F9NA 1BL3A 2W9AA 1FK9A 1S77D 3EW9A 4QZ9A 4UAZA 1IXRA 3M8SA 4DS4A 5J0PA 2ZTEA 1BCOA 1VSDA 3OYAA 3V9ZA 4J9QA 3OYJA 1X9WA 9ICUA 3VQ8A 4AHCA 2Y1IA 4BXOA 4ECYA 4KI4A 2BGWA 4MFBA 3RBDA 5KFUA 3B6PA 3SV4A 2ASDA 3T5KA 3ZDAA 4UAWA 1UAXA 4CJEA 4J2DA 4ECQA 1S97A 3OS1A 1WSGA 4Y1DA 3TWHA 5KFHA 1ZJMA 4UBBA 4M3UA 2XGPA 4FVMA 4E1MA 4C8MA 4CEOA 3NAEA 4CGFA 2HHXA 3PV8A 4DQIA 4M9NA 1TKXA 4YNQA 4Q8EA 4N41A 2W9BB 2O4IA 3AVFA 1S1VA 3AO2A 1S0VA 3OSNA 1KFTA 3H8SA 3NH2A 4UB1A 4PGXA 2D0BA 1XSPA 3TI0A 2ZE2A 2YHAA 4CJSA 3MECA 3RB6A 1SL1A 3ZD9A 3V1QA 3SYZA 3IHQB 8ICNA 2Z1HA 4N76A 4FW1A 1XS9D 3G6VA 4CESA 4GXKA 4CEFA 4O3QA 4F3OA 3RJGA 1D8LA 4F2RA 4KLOA 1MU2A 1RDBA 4JWNA 3M9MB 9ICCA 3CYMA 4FJNA 4KTWA 4CJ3A 2I5JA 4GXIA 2PFOA 5HNKA 4UB2A 1TK5A 1ZQRA 2X78A 4M42A 4DOCA 4F50A 4CEQA 3NDKA 2ASJA 3MR5A 1CXUA 4EZ6A 5DK5A 2NUBA 8ICHA 5KFAA 5CHGA 4KTQA 1WAFA 3ZDEA 1S0MA 4PA1A 3THVA 3NGZA 3MEGA 3RRHA 1B43A 1XU4A 2V4QA 1HQEA 4M3YA 5KRSA 4YN4A 3AA2A 4IFVA 4CIEA 1RTIA 1NKBA 2KTQA 7ICTA 4XQ8A 3UXPA 3RWUA 8ICTA 5T7BA 4DF4A 3NF7A 1F21A 4CEEA 2A1JA 1L3TA 3SI8A 3O3FA 2YKMA 1ZETA 4RQ5A 5KFSA 2XRIA 3L2UA 3B0YA 3QIOA 2R7YA 3RTVA 5D46A 3AA3A 3ZD8A 4KLQA 4UB5A 7ICFA 3OJSA 1LV5A 3QEXA 1JXLA 4FJJA 1O1WA 4YG2A 1S0OA 4EBCA 2I9GA 1LW0A 3TQ1A 4CJVA 2GBZA 1DTTA 2P6UA 4F4YA 3QNOA 2IC3A 3N97B 5J2IA 3VQCA 4H4MA 5DKWA 3ZSQA 3IG1A 3ZT4A 2KZZA 5HROA 4TUSA 1Z26A 4B08A 3DRSA 1KCFA 4RPXA 4CFDA 4F5QA 2JLEA 2W8LA 4I2PA 3Q8LA 4IR1A 1N56A 3MGIA 4GC6A 4E7KA 8ICBA 3OGUA 4PQUA 4B9LA 4FLTA 4B9NA 4CF0A 4O3NA 3QERA 4W5NA 1SZPA 3C6UA 1X1PA 4KPYA 5HLFA 5BOLA 5KG6A 4LZGA 1HPZA 5J29A 2V4RA 5IIJA 2W42A 1RT2A 3MEDA 2KFZA 5FRNA 3TAQA 4N56A 2FPLA 4KLHA 4J9PA 3EZ5A 4B9UA 3KLIA 1U4BA 4I2BA 2C2DA 4KHYA 4YP3A 2E6LA 1UA0A 1BPBA 1IKYA 1CZ9A 2AJQA 5D49A 3H8JA 1HYSA 1BI4A 2WOMA 3Q8RB 2FLPA 4F5NA 4QCLA 3NH1A 3TARA 4Q45A 3TANA 4BXOB 5C5JA 3OSPA 1H38A 7ICVA 3PUFA 4TQRA 1A5WA 4Z6DA 2VA8A 2IHNA 2R8KA 9ICVA 1HYZA 3QEWA 2AGOA 3K75D 4CK3A 3DRRA 4CHPA 3EY1A 3RAXA 4PHEA 8ICYA 4AILC 2BPFA 2X6SA 2R8IA 2NRTA 2XC9A 2LYHA 5KFFA 4Q8FA 3SI6A 4J9LA 3HX0A 5KG3A 4E89A 5CB1A 4EYHB 3H40A 4Q5VA 5E41A 3QEPA 3H4BA 5CY4A 8ICLA 7ICMA 1ZBLA 8ICKA 3HP6A 1ZQAA 4M3TA 3DRPA 3QEVA 4DU4A 4XA5A 3BDPA 4I7FA 3RBEA 4KHSA 4J9MA 4I27A 3O4QA 4I2IA 4P2HA 4F4ZA 1RILA 3RJIA 3Q8KA 3V9SA 4ED7A 1N5YA 3N4MB 5IILA 4DTJA 2B5JA 3VQPA 5J2EA 1SL0A 4MFAA 3O3GA 3QEIA 3NHGA 5DQGA 1JL2A 4R8UB 3K5OA 2NRZA 3KD5E 4BDZA 3AVLA 5DGBA 8ICWA 3O4NA 1RTDA 4Z4HA 4DTNA 4IKFA 3JSMA 1XSLA 9ICSA 1LB2B 3P83D 2DTUA 1LAVA 1JLGA 1LWCA 1ZQTA 5J2QA 2P51A 2DY4A 5DG7A 2BE2A 4M47A 4CFCA 3NGDA 3OVNA 4YR2A 8ICPA 4KLFA 3H7IA 4LH5A 5KT2A 4MFFA 4CJ5A 1XC9A 5KG5A 3SQ0A 3LPUA 1SUQA 4B9MA 3NFAA 4ID1A 3PW5A 5KFXA 1VSLA 4I2FA 1KEJA 4W5TA 2O4GA 5HRRA 5J0QA 1L3VA 4Z0UA 2M9NA 9ICWA 2DPIA 4DTXA 5CWRA 1B9DA 3BQ1A 1T7PA 1TVRA 3QINA 1XWLA 1EKEA 1A76A 1SKSA 1HMVA 4O0JA 5C25A 3KJVA 1XI1A 4QWEA 1Z3EB 5D4BA 1TV6A 1RT4A 7ICJA 4QWBA 1KFDA 3QZ8A 3K58A 4DSEA 3PR5B 4EP4A 4BE0A 4Q0BA 2RKIA 5EWFA 1YVUA 1HUOA 3C21A 3T5LA 1TKZA 2BQRA 1RTHA 2FBYA 2QK9A 1ZQBA 3M9NB 4M3ZA 4CJFA 3ZDBA 2YHBA 7ICQA 2HNDA 2F8TA 1D5AA 1S1TA 2BR0A 1WLJA 2HW3A 1YTAA 4BGDA 4FJGA 5J0YA 4O4GA 3SUNA 2I1QA 1RBUA 1NJYA 2G8VA 4DQRA 2P6RA 1S6PA 4M2YA 1T8EA 3ORYA 3OYMA 3HXMA 1S9FA 1Q9XA 4NCBA 3DLGA 2PYLA 1JXBA 4Z4EA 3NGYA 5KG0A 1B92A 4JV1A 2WONA 3E01A 4RQ6A 1W0HA 5DQIA 4I29A 5J0OA 4RW8A 3RJEA 4J9NA 1LWEA 3AVMA 2KFNA 1S1WA 5KFYA 4CERA 4CGJA 3T19A 4BWMA 3AVGA 1BPZA 1CLQA 4O5EA 1RBSA 8ICFA 3VA0A 1BPDA 2JEJA 3PMLA 5F9LA 3V9XA 1Z00A 3TFSA 2RF2A 3V6JA 4QWAA 1UT8A 4RUAA 1HQUA 3G0ZA 4E1NA 1Q9YA 4ED8A 4OGEA 3NE6A 1YT3A 4J9OA 3OYLA 2RDJA 1JLAA 3TAEA 3ZDDA 8ICCA 2MUTA 1A77A 2KZMA 3PW4A 2VWJA 4NY8A 3NBPA 4I2HA 3ZT3A 5CJ7A 1RDCA 3HVRA 4JS5A 4QW8A 1K1QA 4ELUA 3NCIA 5KT7A 3OS0A 1U49A 4J2BA 3C23A 5KGWA 4C8LA 1JLBA 2YNGA 5IIOA 4EEYA 3MR3A 1TK8A 4CJTA 4CHOA 3V81A 4FLZA 4YD2A 1ZQNA 1BQNA 3RH5A 3GV5B 1KSPA 2A1SA 5L9XA 3Q8MA 3AO3A 4YD1A 1UWBA 1NJXA 2YKNA 2FMPA 3QE9Y 7ICEA 1QSSA 4XRHA 7ICNA 3LWMA 2IA6A 5J2JA 4I2CA 1RDAA 5L1KA 4KLSA 1J5OA 4KLTA 2A1RA 1DOQA 3LWLA 4DQQA 1RXWA 2LSNA 4M3RA 2FC0A 2EX3A 2JEFA 7ICIA 4HUFA 2UVUA 4RNMA 3MABA 2BHNA 4K4IA 4HTUA 3KLEA 1NJZA 4GXJA 3UIQA 4IQTA 4YXMA 3MXIA 4H8KA 1CZBA 5KT3A 1ITGA 1TVAA 1DTQA 3ZSXA 2BCUA 4Y1CA 2W8KA 2IDOA 2DFLA 3EYZA 2W9CA 5DG9A 2ZTCA 2AGPA 4TUQA 9ICPA 4FO6A 2UVWA 4O3RA 9ICNA 1MSWD 9ICEA 3M9OB 3C94A 3HP9A 9ICQA 1VSFA 3I0SA 3AUOA 2OZSA 4FW2A 3MXMA 2Z1GA 3NTUA 4OLBA 3RJJA 9ICHA 4RQ4A 4C8NA 2JZBA 5KG2A 4M6WA 1J9AA 1DGSA 3C1ZA 4PGQA 1ZQKA 4RT3A 3SUOA 4CIFA 1K1SA 3FFIA 5J0SA 5KT4A 1XHZA 2HMIA 1ZBFA 1ZQXA 3UQ0A 1TV9A 3L8BA 3SV3A 1ZQGA 1RT1A 4ZTJA 4MQ3A 2AGQA 3PMNA 1LW2A 1BGXT 1I39A 4UB4A 1RCHA 1BPEA 2ZQBA 3HPOA 3DM2A 3HPGA 2RPIA 4CK2A 4FYDA 4ED1A 2UVRA 2F1HA 4R63A 4CEDA 1U47A 2FBXA 3ZT2A 4I9LA 2BDPA 1GOAA 1ZQYA 2X6NA 3NF6A 2XY6A 3CM5A 4ICLA 1S1UA 4LH4A 3V6DA 5KFOA 3RH4A 3P1GA 1TKDA 1WNSA 4FLWA 4CGHA 1ZQJA 5KFWA 4PY5A 4FJ9A 5KFLA 1D8YA 5KFTA 4DOAA 4FS2A 4HCBA 9ICGA 3VQ5A 3DMJA 4FJKA 5J0WA 4I2EA 1ZYQA 4JRPA 4O3SA 4QZAA 1BVSA 7ICLA 1IH7A 2HHSA 1SL2A 1BPXA 1S9GA 2IGIA 1COOA 3PO4A 3OYBA 5L1JA 3VQ6A 4FK4A 4C8KA 4R64A 4I2QA 4CHYA 4O5CA 3GIJA 5KFDA 4O5KA 3V9WA 8ICQA 1WSFA 3V4IA 1JXEA 3KLHA
chains in the Genus database with same CATH superfamily
4QZIA 2XCAA 1W2BR 1RDDA 4C1NI 1KD1T 2FF3B 2OPQB 1S5ZA 3FZHA 1LWXA 2K4IA 4XK8C 1WWHA 4MK8A 5CYQB 1S7IA 5AIBA 3J81O 2HDOA 2ITGA 2JWKA 1PYSB 3NS7B 7FD1A 3IAM9 1GFWB 2MZSA 4MEYA 3QXGA 2YJFA 2QKKA 4CGZA 3MTJA 1E6VB 4DLEA 2ZWOA 4ZH4A 5J2HA 1S10A 2LA6A 1VBKA 2HMXA 4WP3A 1WB9A 4PL2A 4DB3A 4J2AA 3BPSP 5B0AA 5EY4A 1IWGA 4DV5K 3ZDCA 3UXOA 3C95A 3CULA 4ECSA 1WC3A 3T1AA 3GL1A 2HFZA 3KG0A 2HBLA 3KOOA 3B6OA 4FZXC 3VAIA 2DR8A 4RW6A 2M2BA 3E9OA 1FJGK 1NK0A 5T7LB 2FXUA 3R8YA 3C2LA 1J5OB 4LF8J 3FEYB 2C1EB 1NJIO 2V6AA 4M1KA 4TSXA 4U8YA 2UYTA 5KG7A 4L8RB 2DR9A 2OFGX 1A5VA 3RRGA 4RNOA 1S12A 2VPZB 2KL8A 3WUHA 4FJIA 5E0OA 1MMLA 4KX5A 1HBMB 1NSPA 1WSIA 4ZCMA 2FJVA 3UKRA 3P39A 4J7CA 1LVHA 2RDDA 4C7YA 2IOFA 4JKEA 3RSEA 2YNHA 4UAUA 3DI6A 3T1YJ 1FO4A 4X5VA 1N6QA 3QYYA 3F5AA 1DBDA 4FO0A 4FOEA 3TR8A 3KFWX 2R8HA 4YB6A 2KXFA 4QWDA 1RYSA 4KREA 3I5AA 2J9DE 3VN5A 3EEQA 4AHTA 1WSEA 4AT1B 1VRUA 4FJLA 4C0HA 3NVVA 4LIWA 1U2VB 9ICRA 1BDGA 1NNLA 5TKYA 4CZEA 1UEVA 3W8PA 2V5HG 4DV5J 4BDYA 2PMZD 5AQKA 1HFEL 2B21A 1T3NA 3ISZA 1B64A 1FKPA 3RGIA 1COKA 1HWIA 4MKBA 1VQKN 3UN2A 1WTBA 2ZH1A 2WW8A 3C5GA 3CCTA 3CCWA 5LJWA 2OTJN 1SB3C 5H2FU 2CQDA 3RYLA 1FJGJ 4WKRA 3LK9A 2VQFJ 1FKOA 1WAJA 2CZ4A 4JHDA 2HVEA 5CRXA 3LANA 3V72A 4JI0F 5K8OA 4TUPA 3NKYA 3QDKA 1X7VA 5BREA 2I5JB 1JN3A 3FBBA 1PC4A 4DSFA 3VQ7A 3RMAA 4ES2A 4DU1A 3M4XA 4JS4A 3F73A 3D2NA 2G8UA 1N62A 4DV0F 4YR3A 1ZM2A 3D45A 3J80U 1U8WA 2MKHA 3CC4S 2QKQA 4CM0A 4LRAA 4EHUA 1YJ9N 5JXSA 2QA4G 4ZOSA 4JI3F 1F5SA 2F44A 3M6WA 2Y9HA 5HQLA 3DGPB 5KAKA 2QLFB 1QSYA 4DTSA 5ALFA 2VF3A 4JLHA 2L5YA 1A9NB 1K6YA 1S9GB 4G1QA 2B0CA 2VG6A 1JQGA 1KRPA 1C0MA 4FBTA 4HKQA 1YJ7A 3KOAA 3JPNA 4J2EA 1HIYA 2FBVA 2YVSA 4OVLA 1VQ7S 3SBMA 3CG7A 5E3PA 1GMWD 3T5HA 3KLHB 2YHYA 2HZAA 1RGVA 1VRQC 2NYIA 1RCOB 2HVIA 2E5IA 5LL6d 3LVWA 1NPPA 4OI3A 4ER8A 2GV1A 3SEOA 1AQ6A 5HQ8A 4RPFA 4C4TA 2L9WA 4ZP7A 1FX4A 2HQGA 4QZFA 3D0IE 3WC0A 3OTQA 2C2RA 2ZOMA 2ZUCA 3VVUA 4I6WA 4WJ3B 1CQMA 2F7TA 5HROB 3RFAA 3RR8A 1UJ5A 3DHXA 2DNMA 1NLVA 3DRSB 2L08A 3B0XA 2DRDA 2VL1A 1PK1A 1FFVA 3BQ0A 3EN9A 3SUPA 2H3FA 2LM1A 2PFUA 4P2SA 4K4GA 1S72N 1KWMA 3IM1A 3HK2A 4JRQA 5AM2A 3HHKA 1X4HA 3SCKE 4ED4A 2BE7D 3J7A1 2H65B 1U6FA 5DBCA 4O44A 2JH1A 2HURA 5CZ1A 1VQYA 2PEBA 3K5LA 4J9SA 1XNSA 1T03A 2ISPA 3SDEA 2F1JA 2QT7A 4IDHA 2LQBA 4DMNA 1SQGA 4EELA 3D6MB 4JB8B 3AGKA 2KOBA 5AZIB 2YKOA 3PW7A 4BVPA 5H9FK 4CF9A 3GDQA 4YMMA 1F6TA 2MQOA 4DUYK 2PA8D 3K9JA 2RN2A 2GELA 4DL4A 3SMPA 5GAGP 4F72A 4ANCA 3SZ2A 3WXLA 5DBBA 1JI7A 2V4JB 3EE8A 2VODA 3KDNA 1XSNA 4RCHA 1XN9A 1H6KX 1RU2A 5AKGA 3GP9A 2HFVA 3DRRB 2YNHB 1NKEA 5BR8F 3F2CA 2XI9A 3AVIA 2GOLA 2XGQA 1SGGA 2VBZA 2R7RA 4L6V3 1U9LA 4HL9A 3PIOL 1KQKA 5AXMA 3NXZA 4FM0A 4IC9A 4FM2A 3WU2U 2HOEA 3ZXWA 4FM1A 2MEWA 2Z2ZA 1BMQB 2XEXA 1OVYA 4F0KA 4AE5A 4YXJA 1ZOLA 3NVZA 3VQSA 4DFKA 1RAEB 3CQXA 1O8BA 3MEKA 1RAJA 4DTOA 3MEEA 3PHTA 3DLLQ 1ZQVA 2G8HA 3UQ2A 5C42A 4XPCA 2E9TA 3AVNA 4NLGA 4BR4A 3KMQA 1PAEX 3VTIA 3NLCA 3HW8A 1EWQA 5KFBA 3CCJN 4FK0A 2EZYA 4K4HA 3GV8B 2FMSA 3GIMA 2F2AB 4A8SA 2G2ZA 4OGCA 4GC7A 4NCGA 8RUCA 2KM8C 3PNCA 3MAAB 3L5KA 3H8WA 2FHJD 4M7YA 2VB6A 5T14A 2P9UB 3N7PD 1WC6A 2A2CA 4O55A 5H9FJ 5HP1A 4NLNA 4DUYJ 4L3QA 1XNRK 1NCLA 1MROB 2G5HB 3UMGA 4Z6EA 1MQ3A 4L74A 2E9RX 3RG6A 2QLWA 4OZLA 4CT9A 3THXB 2OYQA 3NP5A 2AZ1A 2GEMA 1RNHA 3R3TA 3AA4A 3VETA 4NWBA 3IDWA 3DRXA 3NG8A 4BR7A 5KFEA 2KH9A 1PG5B 2Z1IA 3GLJA 2Y1RI 1QQOA 1YDLA 1JJ4A 2MGZA 3VF4A 1RQ0A 4NOHA 4DDFA 3BR8A 5J8YC 4HH0A 4J9KA 5LY3A 4DPWA 5EXWA 3VGUA 3W8GA 3EL2A 5D0EA 1BQMA 1YZ6A 3TOQA 4LF8F 2NO4A 2CQGA 1U45A 5JS2A 1IR0A 1FF2A 3AVBA 4FZLA 2MY7A 1I6JA 4FF2A 2OZMA 2X3DA 2QIFA 5HBMA 3G9CA 3SAFA 2DCUB 2HEKA 1OWXA 1VQKS 4Q0BB 5TZVA 1CULB 3MC1A 4IJNA 2WF8A 2OTJS 2LM4A 2ZJ5A 1TYQB 3JSYA 1NK8A 4DQPA 2M70A 4EZ9A 3O5TB 3R5BA 2HF4A 3JYTA 2RRBA 2HBQB 1X5SA 1WDTA 3T1YF 4DCJB 2ERRA 1V3RA 3HO1A 1S1TB 3JTOA 1DLOA 1U0SA 2HGMA 4JK9A 5M2RA 4LBIA 4B8CA 3IO1A 3ULHA 2N4DA 4MF8A 1XNRJ 3OYGA 1DGKN 1LNQA 1N0UA 1NU0A 1VLYA 3OL8A 2GLEA 3IGNA 1QHAA 3VHQA 4O44B 3JS6A 3FE1A 1YJ9S 2YX6A 4LR8A 2VPXB 4JMUA 3D6TB 3E01B 3NS5A 1T03B 4KB1A 2IDLA 2MKCA 4CH1A 4CRJA 3KBBA 5HJXA 1HRHA 4OI4A 2FBTA 1HA1A 2NXJA 3QEAZ 1F5BA 3FNNA 4RZRA 3ITHA 2UUAK 2OWOA 4CEZA 2WB1F 2VQFF 2GO8A 5F8LA 4M9HA 1KP6A 4RG8A 4A8XA 5D8HB 4B1YB 2QZ8A 4HAIA 4CZFA 2J9DA 1JLAB 4WU2A 2XMAA 3U3GA 4KPCA 4BG8A 1OW5A 4RPYA 3L2RA 1VMBA 2CGKA 4W92B 4J91A 1VSEA 4UQTA 2GV9A 3SSSA 2JC0A 3OY9A 1X4DA 5L9NA 1S4FA 4W90B 1FRHA 3NNHA 1IBLF 3VAMA 2E5SA 4H0VB 3ISNC 4BRHA 5HL7Q 2E1FA 1KQSM 5B66U 2DHSA 5JLFA 1PUZA 3OTEA 3Q24A 1GTEA 1MN9A 3SQGB 2QB0A 3P31A 1S72S 3A8JA 3MEEB 1W97L 4ED3A 3RR7A 4PPDA 3ET6A 4QR0A 5C42B 4WF9L 1JNRB 3R7SB 4RQ2A 4V19S 3PJ9A 3RU0A 5ALXA 3AOCA 3PLAA 1YWXA 5C15A 3F41A 3S8SA 3RW7A 4QYRA 4JI8K 3PEHA 3OPXA 1VHIA 2AP6A 2BPGA 4QIEA 3UR3C 5DMRA 3J7YI 4ZKAA 2LBOA 1DK2A 1NSQA 2B56A 2RQ4A 1RHUB 2DNZA 2NCKL 3AA5X 5AM1A 1B4SA 4KO0A 2DXDA 3H2UB 5ALJA 4M5NA 1MMNA 5J2DA 1R0AA 1ZC6A 3WKCA 1CG2A 2Z58B 5AQSA 1DTQB 3ZSWA 3U27A 1DURA 2UUAJ 2GUIA 1TKTA 5F3XB 5ELZA 5DO2A 1UQVA 4Z7YA 3CJ7A 1HUXA 1J2VA 4NEYA 4DR1K 5J2KA 2O6KA 1RKJA 2ZBIA 5ALKA 1PVRA 2GO9A 3MWPA 4DV7K 1Q7LB 4C0OC 3QETA 3Q0AA 2KIVA 4FLXA 3IP4B 1VC5A 3T7ZA 1XQIA 3TW0A 1BHLA 3E58A 2MGZB 3KHLA 4FJ7A 1HWUA 1DRGA 1U2RA 2D9OA 1VISA 3NOCA 3CNQP 3FFIB 2HMIB 5AHXA 4OZ3A 2F7VA 3NAHA 1OH5A 3R9PA 3AV9A 2AJ2A 4V19X 3MM7B 3KLGA 3TSQA 2OHDA 3EUB2 2KT5A 1X2IA 5HBMB 3ETMA 4C23A 1UZHA 9ICXA 4JV5J 8ICOA 2LKYA 2YCHA 5J2PA 3A2FA 1X42A 1YRUA 2X1BA 3CCJS 2ESEA 4MLEA 4JD2A 3VAGA 1KKXA 2BJ3A 4JI8J 4QIFA 2KLAA 3W5XA 3ZZUA 4I6AA 3QU9A 4Y34A 3V6DB 4PYAA 4RNHA 2HHVA 3MDAA 4JEPA 1IQZA 1VC0A 1NGDA 4WCEL 1DLOB 2KHVA 3I8BA 4OX6A 3ZT0A 1KAXA 2UXBK 4Y2QA 1EKSA 1U1KA 2HFOA 1KLNA 1ZBHA 4JV0A 3I0RA 2KSOA 4H4KA 1D0EA 4LQ3A 5DDYA 3PRVA 4HVJA 5BPCA 5J0XA 2ZHBA 1SC3B 2IS3A 4ZIVA 2OMLA 4DV7J 2IM1A 3PSTA 3DOKA 1O03A 1S5JA 1ROFA 1IQTA 4BRKA 3CJ3A 4JKFA 4CJQA 1KTVA 4GFJA 2BQ3A 2VG5A 3V4IB 5DGAA 5TISU 4YFKA 3VGSA 2J8SA 4CJRA 3QJLA 2RU3A 1S48A 3ITHB 3OHAA 4WE1A 4MKVA 4NL9A 3QT6A 3ZSOA 2IMWP 2AT1B 4PH5A 4QZHA 1RXVA 4LF4K 3IAS9 4F93B 1R8CA 2IBKA 1Q8KA 1Q3VA 9ICMA 3AQFA 4A5AA 4R0EA 4YHHK 4B1UB 2Q79A 1JNZB 5AK4A 5DG8A 3QAUA 4A8QA 1ZPVA 2U1AA 1RBVA 4ECZA 4FPIA 3UVJA 3IAYA 4ALZA 1PCAA 4NASA 3AA9A 1Q7YT 4FZNA 2D3OR 1X9JA 2P9SB 2G4BA 3M2VB 1S6QB 2VJUA 4IRCA 3QQCD 2KVSA 2RNEA 3TTDA 4EAHD 2V2VA 1NDLA 4ICAA 3OBIA 2M7SA 2VZ9A 4RUHA 1VHFA 1CJKB 1OIAA 3ZI4A 4K5RA 4KHQA 3TJ9A 4OKJA 2UXBJ 4X84A 3ET6B 4KC5A 1YAGA 4IKAA 3KK3A 5KFGA 1CQNA 2CN1A 3H45C 3VQAA 2NV3A 5KFKA 4OZ5A 3QESA 2KYXA 5ALTA 2KW4A 4FNHA 5AQHA 3HHLB 2K4EA 1IG9A 1S8OA 2L48A 2D3ZA 4C48A 1GO3F 4Z6CA 2VHGA 4WQ4C 2LECA 2ZJPL 4NMXA 4QU7A 2FHJA 3AVJA 4MJKA 2P6TA 1NGHA 3BN7A 5KFQA 1SKWA 3LDQA 4RPZA 3WNEA 4GO7X 1HNZK 4NLRA 3RVCA 2V9KA 3ALYA 4LF4J 3J7AN 1PKUA 4F67A 8ICVA 1UW4A 4MKAA 1NOZA 4KB7A 1T9WA 4YHHJ 4B8AB 2YWGA 2IVPA 2DGVA 1WACA 4IRKA 1Q81T 3L7PA 3UM9A 1Q82O 4YDXA 1QS4A 4DZDA 5EDWA 2C2EA 1Q8IA 5I9EB 2FVCA 2K8BB 2AWZA 2IM2A 4DV2K 4LSNA 1J5EK 2XWXA 1C0TA 5AQUA 3Q8YA 3H08A 5HRSA 4X65K 3WK8A 5DETA 1TUYA 4F5OA 1TK0A 2NS1B 1NMDA 3KLGB 4TYBA 2AH5A 3O1BA 3WNHA 4JI5J 2K8CB 1IKVA 2XMVA 3VCDA 2I7NA 3TZZA 4JI1J 1F3FA 2AJ1A 3JAMO 5L39A 5EE3A 3NL0A 1BUPA 1W25A 4HHUA 5A2QY 1AROP 4DX6A 2XWYA 3D0HE 1IXRA 3LDPA 4DS4A 3MMAA 1N5XA 3DDNA 4FE3A 5IT0A 2P9CA 3NCQA 2WVBA 3VQ8A 1V3ZA 4AHCA 2Y1IA 3VMFB 4NA2A 4PL8A 4NEZA 4TU7A 2ASDA 3ZDAA 5AQPA 4ECQA 2QARA 3LPEA 1S97A 5ADXA 4NLWA 3ISND 1T6CA 5B08A 4X62F 4WQ5C 4I6MB 5M1NA 4GY2B 5KFHA 3PM9A 2LU2A 1HNZJ 1HNWK 3NAEA 1VOMA 1WEXA 3L4BC 1TKXA 2MZQA 1XMQF 3DOKB 4N41A 3AO2A 1S0VA 4JI6K 1KFTA 3NH2A 5ALOA 2VG5B 4HH1A 4DXLA 4EK2A 3BBFA 1Y9OA 3CCEN 4LF1A 1YHQN 3MECA 1SL1A 3P5BP 3VV2B 4N76A 2R7XA 4ES1A 2FJWA 1EAYC 4RU2A 4F3OA 1QTNB 2ILZA 1D09B 1HNVB 4E98A 4ISEA 5BRHA 3IKMA 1EARA 3WKAA 5LSRA 3EUNA 4X65J 3VWSA 4BRFA 4F2RA 2BTFA 3IUCA 2OAUA 4OLPA 4JWNA 4BRLA 9ICCA 1Q4RA 4OX8A 4CZCA 5BPNA 4ZP6A 4GXIA 2FIUA 4CZIA 3ILJA 1Q7YO 4M42A 1I94K 5AM0A 4CEQA 2VQEK 5F0WA 4F25A 1UETA 2CJQA 2ZIVA 8ICHA 2RVJA 2EDUA 3KNGA 1S0MA 1MWMA 4JKGB 4BVOA 3PIOQ 1XU4A 2V4QA 2DXFA 5GTIU 4YN4A 1E6YA 3KK3B 3I55N 3CCLS 4KRWA 2D0PA 4RTFD 2KTQA 1HNWJ 1GNKA 3Q86A 3RWUA 4ZK7M 3W60A 1SC4B 3NF7A 1F21A 2A1JA 5KNIA 2LYAA 1NAQA 2FI1A 4JYAK 5AM4A 1L3TA 4OQJA 1HD1A 3H25A 4JI6J 2VFSA 2E9ZA 3O2IA 5KFSA 4JV5F 2YTUA 3EWGA 3KJNB 3AA3A 4UARA 3OR2A 4UB5A 3C14A 3QEXA 2D3O1 4FJJA 2OO4A 1XJWB 3GE1A 1LW0A 4JI8F 4CJVA 3OLBA 2GBZA 4F4YA 1YXQA 2KHOA 5J2IA 4WK1A 5T41A 5AE2A 3ZSQA 1Z26A 5E5NA 4B08A 5JLHA 4F5QA 3GG0A 4WZMA 2JLEA 4I2PA 2UUCJ 5KPTA 4PQUA 5JICA 5SUHA 1Q81O 1U1OA 1I94J 4LFBK 2VQEJ 5KG6A 4DV7F 4LZGA 2PGCA 3JSBA 4FDFA 3GOIA 1HPZA 2M52A 2V4RA 5IIJA 2B9WA 1RT6B 3KG4A 4GV6A 4PUOB 4MK7A 5FRNA 3TAQA 1JCGA 3O3LA 2FSKA 4JN4A 4OZ0A 1OQ3A 1OPIA 4MT1A 4MH8A 3PSFA 1WF1A 4YP3A 4JNEA 1IKYA 3R5CA 1CZ9A 2AJQA 3NOGA 2OELA 3CJRA 5AJ3K 1VHXA 4Z37A 2EWHA 1HYSA 1RAIB 2LA4A 2MB0B 4LRCA 4JYAJ 2FLPA 1K5OA 1Z1ZA 3TANA 2ZD1B 2V8HA 3GB0A 7ICVA 4TQRA 3PYGA 1A5WA 3P6YC 5LXRA 4Z6DA 3A3NB 1HYZA 4OX9K 2EEYA 1HW8A 3K75D 3B9JA 1HI1A 2R3VA 5FLXU 3J81Y 4M63C 4CHPA 5ETVA 3B4MA 2E1PA 4IOCL 1VS3A 4PHEA 1VR6A 3DXKA 1R6VA 8ICYA 1GLJO 3BUZB 2EFNA 5KFFA 5AE3A 5ALSA 3BGRB 5CB1A 3L3FX 1F9FA 3H40A 1MDUB 5E41A 3WQTA 1SIJA 3QEPA 1K9MT 2EBGA 5LSLA 3FAHA 3LH2S 1ZBLA 3HP6A 5GAHI 3DRPA 3QEVA 2W54A 3H5UA 4ILHA 2CQIA 1D1UA 4KHSA 3HBTA 4P2MA 3MECB 2LP4A 1O51A 4C11A 1WSVA 4W98A 2O3DA 2RE2A 4UW2A 1RILA 3SMSA 1Y7PA 2R18A 1PO6A 3MMBB 3D2FA 5GADI 2M88A 2NQPA 5A8WA 4JB3A 2FD2A 1FRJA 3MM6A 5M1QA 2PEHA 2ZHOA 5DQGA 3W3SA 2AIRB 3EVMA 1GH8A 1H1VA 2ZOGA 4X4RA 1NM2A 3VTHA 3GYGA 3OVBA 3MUMP 3W61A 4EUVA 3SBGA 2KT3A 1UJ4A 3O4NA 1NMEB 5AJ3J 4DTNA 4IKFA 3Q89A 2E1MC 9RUBA 4LF4F 3CD6N 5MAOA 3Q23A 2EQYA 1KDNA 3UE5A 2W1BA 1JROA 4PZOA 1WNEA 2R7SA 4IQXA 2E3TA 5J2QA 3AB2B 1VC6A 5KPRA 1NU4A 2DY4A 5J8YA 4CFCA 2KVIA 5K8PA 4OX9J 2XS5A 4KLFA 3H7IA 4MFFA 4G65A 3WK6A 4PL1A 3LPUA 1SUQA 8AT1B 2D7SA 4B9MA 2CQ2A 5D6GA 5KFXA 2BUNA 1TL3B 2QLTA 2Q66A 3E9LA 4KBIA 2O4GA 2WF7A 5HRRA 1VIOA 2JVRA 3B8AX 3WDOA 1YF5L 2I6WA 4PXCA 9ICWA 4DTXA 5CWRA 1B9DA 4JI5F 3I82A 4HACB 4JI1F 2YBVA 3PEJA 4WF9Q 3LGMA 2YY3A 4Z7CA 2HYIB 1A76A 1HMVA 3WKEA 3F44A 4KH5A 5C25A 3SFUA 2XI2A 3CCES 1YHQS 5A0LA 1ZBSA 3OR2B 3C14B 2V52B 1TR0A 3C8YA 1RAAB 3PR5B 4URQU 4EP4A 2HSTA 5AKJA 3QFHA 2RKIA 3MURP 1C0UB 1YVUA 2EH9A 3C21A 1S9EB 1TKZA 2QWPA 3NEKA 4M3ZA 1T44A 2ATCB 2RSQA 4K4UA 1ZZNA 1HKAA 5CA5A 7ICQA 2FC8A 2ASOA 3FCWA 4I2PB 4NWIA 2OEMA 2BR0A 4OJ3A 3U8XA 5ETQA 5J0YA 2I1QA 4CYUA 3CXCR 2G8VA 2Q6BA 3BDEA 1KN6A 2EAOA 1S6PA 1DQ9A 2C3PA 3PHEA 1XTZA 1OSDA 2OPPB 1AW0A 1S9FA 2MZTA 1Q9XA 3HKZF 1P1TA 4RW7B 2YTCA 5KG0A 2YH1A 3CCSS 2WONA 3GYXB 5J0OA 1AFJA 3I55S 2PO4A 1IKYB 4IZ9A 2KFNA 1S1WA 1N8RT 3AVGA 4O5EA 4X65F 1RBSA 1OH7A 2DEIA 4BUGA 8ICFA 4B17A 3PMLA 4AYBF 4WFXA 1SV5B 2HLTA 3CDAA 4ZN1A 3I4HX 4YOEA 1YK9A 4CO0A 3HSZA 3MCOA 1C0FA 1Q9YA 4OGEA 3NE6A 4A2AA 2CQCA 4Y00A 2JX2A 4J9OA 3PFOA 5IM0A 1Z2ZA 3MD1A 4P10A 4P0QB 2V67A 1O0PA 8ICCA 4A2BA 3BGLA 3ZEUB 2MUTA 1ZAWA 3BSCA 1A77A 2E1EA 2XMWA 3A8YA 3PW4A 2VWJA 4A61A 3PJXA 2ZJQL 1RE1B 3NBPA 3J80O 3FM9A 4WCEQ 5KT7A 2HK3A 3C23A 2B9EA 1IBKK 4U67L 1JLBA 2ZDPA 3L7UA 3FEZA 4CHOA 1K9MO 1EETB 1BQNA 3GV5B 2JWLA 1X3MA 1KSPA 1KLMB 3AO3A 4DHVA 4WFAL 2AX0A 1HNWF 1K8AT 7ICNA 3LWMA 3G6EN 5L1KA 4IG0B 5ALDA 3S1TA 4B3MJ 3D2FB 1RXWA 2DGQA 3G96A 7ICIA 4JI6F 1CS4A 5A8WB 4RNMA 4J5OA 2O8DA 4AL6A 1OXJA 1NJZA 2RS8A 2MMYA 3UIQA 3H8MA 3L9ZA 3FCHA 2B7CB 4ITSA 2ABYA 2EPIA 4FZMA 5KT3A 1ITGA 3W65A 3X3UA 2XMMA 1HWLA 5G5HA 3A0IX 4AFFA 3CQYA 5GTHU 3VEVA 2G0IA 3M1VB 2IDOA 1APSA 2B43A 3H0RB 3C6HA 3CCMN 1Y5IB 2W9CA 2AGPA 4ZVPB 4FO6A 3BYRA 3ZZYA 1MWKA 9ICNA 4XO0A 2UUCF 4R5PB 1NLKL 3M9OB 4IO9L 2MRLA 1E3MA 4GKKF 3OTBA 3ZTRA 5CXTA 3ADAC 2Q97A 3TU5A 2E5JA 4Y2TA 3DOLB 5J1NA 1I94F 1SH3A 2E1CA 3UDVA 2Z1GA 1SWVA 1LOUA 1SUQB 2DO4A 2H3EB 3SCLE 3RJJA 9ICHA 3HFKA 5C2GA 5KG2A 3NGRA 4GIBA 3VOVA 1FXDA 3FQKA 2F8HA 1DGSA 3MI7X 4PGQA 1QVGR 1IBKJ 2E29A 3RZAA 1K1SA 1XHZA 3EE9A 1FRMA 5RUBA 3L8BA 1HMVB 3PYDA 1I39A 3KWGA 3CIZA 4MYUA 4OJPA 2ZIXA 2ZQBA 1M5PC 2O8FB 2UVRA 4NPOA 4JYAF 2V50A 2FBXA 2RKIB 2ZJPQ 1KONA 2DGWA 2ZUGA 1AT1B 5IT9Y 2BDPA 2DNRA 1OMSA 2XY6A 2UU9K 3CM5A 2DKOB 4FXWA 4ZS6A 2AP1A 1JKHB 3J7AP 5KFOA 3RH4A 1BNPA 2BJ9A 5JVGL 1IV8A 1D8YA 4MYTA 5KFTA 1LEOA 4FS2A 9ICGA 1N60A 3VQ5A 3CD6S 2DO0A 4I2EA 2I1RA 4M5LA 5E3QA 4JRPA 4DZ6A 5E33A 4M5DA 1FT8A 4CLLA 1S6PB 3KHYA 1RCXB 4NXNK 5HJYA 2HHSA 1BPXA 2GW8A 4KY3A 3PO4A 3AD9C 3KYLA 4WXOA 5D0RA 4FK4A 5IXUA 1JJ2R 4R64A 4IYQA 2DRAA 5KFDA 1SZ2A 2QMUB 2KYZA 1WSFA 2GWKA 2WCXA 2VOPA 1AYEA 4R0JA 1S1WB 3CC2N 1WG1A 5BR9A 1VRTB 1FXXA 1N8RO 4RW4A 2HNYB 1RAHB 1SCJB 1M6YA 2HBKA 3R5DA 2JL9A 3I56N 2VH7A 1PJ6A 5ALVA 2YMQA 4FLVA 3C1YA 3ZZ0A 2B6AA 3VQ9A 4BRAA 1T05B 3BS5B 1HX1A 2MKYA 2ZTDA 3UN3A 5AJ3F 3OFFA 4IQVA 5D3GA 4ZP8A 2MUTB 3LAKA 5AK3A 4RQ3A 1TP7A 1BQXA 2OANA 1X0FA 2BCSA 4FL9A 1UA1A 4EBDA 4K41A 5KRTA 3MMCB 5GVQA 1DFDA 4MLHA 1CUKA 1FI4A 2UU9J 1VQPN 4OX9F 4HYKA 1IKXA 5AQMA 2DNLA 1BQNB 4OMFG 4FWQA 4M9GA 4RQ0A 3CJ5A 4M3XA 1JXVA 4DSJA 2RD5C 2FHKA 7ICHA 2V8PA 5K14B 2BJ1A 4WQ4A 2QLBB 3BBCA 3DLRA 3IG8A 3ZETA 2FLNA 1FK9B 5KAIU 3ISDA 1IBMK 2O8DB 2HQ3A 1PZNA 4DTUA 4DFPA 4WYWA 1VAZA 2DBBA 1KXPA 2PBDA 1ZQEA 2E8NA 3G4SS 3G10A 4OIXA 1UEKA 1NB2A 4BR9A 4G1IA 2PZSA 4F4AA 1KOOA 2FPKA 1BU6O 4YR0A 1KBRA 1CJUB 1WC1A 3RB4A 1ELOA 1C6VA 2ROGA 3D6FB 1VK0A 4K42A 4USKA 2YNIA 3MXHP 5F0XA 1N34K 3PVXA 1UCVA 4CECA 1ZQSA 1Y5NB 3CDEA 1GAOA 4RBVA 4K50A 1S1VB 3NMUA 4AQYK 2K60A 3EPGA 1QM9A 2WAQF 3TVZA 2XNRA 2NR0A 1Y10A 3A5LC 5KFRA 4PKDB 1C4AA 4IFYA 3Q83A 4CD1A 3D7EO 3T5JA 2IVYA 4ZJLA 3PO5A 2DKXA 4AHRA 1W2IA 2HWIA 3BQTA 2RQCA 1MU2B 3FK4A 3MN5A 3EPIA 2KHCA 4DS5A 2EFVA 3RAQA 3G6ES 5EX3A 4ERDA 4PR6A 4CQ1A 2Q6CA 3OBYA 3QT7A 1IBMJ 4Z4CA 2KN4A 4I28A 3KKAC 2JRZA 4UAVA 2WBRA 4QJFB 4KJIA 2H5EA 2BDUA 7ICPA 3AVHA 4B3RK 4KR0B 5FPDA 4CO5A 1PILA 4UASA 3MEGB 3PCOB 3T1HK 2KT2A 3EZOA 4ECWA 1S6OA 4XUSA 1HQEB 2ES6A 1N5SA 1NOYA 4Y2UA 3FBCA 3CFRA 3CCMS 3ENBA 2XY5A 2CNKB 1GOCA 3THYA 4KHWA 3PW0A 1N34J 1IWAA 4C3LA 3LM9A 2R8GA 2DBYA 1PYOB 5ALZA 2CNNB 1LKYB 4YOUA 4X66K 4TU9A 2Q2RA 2KP7A 2PFQA 4USMA 4FPRA 3E0FA 3TZXA 1S59A 5ADZA 4K4YA 2LHTA 2YKMB 2DHHA 2QFIA 3R3LA 4AQYJ 3AXKA 1W9HA 5AQLA 4B3MF 2V68A 2VFUA 3RBZA 5AFUA 2HCFA 4I2GA 3DWLA 3N6LA 2DPJA 4UB3A 4M45A 3THWA 1R0BG 2ACYA 4HTLA 3QPIA 4CDGA 4QZGA 2IC3B 3AO4A 3FSYA 2D41A 4C0BA 2V9WA 4BY9C 1OUQA 2OI2A 2ZDOA 5KI6A 2B6AB 5ETSA 5AK6A 2RDIA 4C4RA 3J8AA 1RISA 5D3GB 1OH8A 4CHZA 2JSXA 7ICGA 4IUFA 4CJUA 3WIVA 2CPDA 4OCZA 3VGLA 3NS1A 2OD4A 4V19J 4DU7A 1N33F 5K5MA 3C6TA 3WNFA 3GDXA 3MDFA 3L3VA 5I4MA 4HUEA 5HLFB 2LCWA 2V34A 1SXLA 3HJFA 3QNWB 5FROA 2NYHA 3ZSYA 1IKXB 4IOCQ 3GU0A 4DPXA 3M5RA 4B3RJ 2RMLA 5C10A 3MEDB 1RP5A 2HHQA 3HZEA 3N79A 4PZVA 3QWPA 3GJTB 3T1HJ 2ILYA 3B6BA 5BYSA 1KDHA 1TL1A 4RQ1A 2Z30B 1IBKF 4QZBA 4DR6J 1QVFM 3LGHA 4NE9C 4HWIA 1RSCA 3NRWA 3HL8A 4DV4K 1AZSB 3HHDA 1KR4A 4QW9A 2G9OA 3I76A 2KJVA 4X66J 4UOFA 1ESVA 5CAAA 2G08A 3VF2A 8ICIA 4UATA 3D1HA 1GOBA 4CEBA 3ZX0A 5KG1A 5IT4A 1QQCA 1T9UA 2CIMA 1N36F 1EXQA 1YJWN 2PE8A 5EE0A 3CC2S 2Q0ZX 2IYIA 4M9JA 4DR7K 4CTAB 4I2JA 3SQIA 4BC4A 4R25A 3WIUA 4IRDA 1ZQOA 2XY8A 3I56S 2GAGC 4FWLA 4DPTA 1N5QA 1RABB 2YNIB 3V7KA 1XMOK 2CWXA 3NAIA 4OZJA 4F4KA 2F76X 4DTPA 5M2PA 3CCRN 2LQ8A 1UW9A 3ISCA 3FYHA 4TY9A 1RDWX 4DL6A 5CP2A 5J2FA 1H0HB 2G8IA 2AHOB 5FDLA 1B3TA 1X5TA 4DU8A 4OKKA 2QA2A 5D15A 4ID5A 2V51B 2KKHA 4WJBA 4Y2AA 1LFWA 2ZG6A 1VQPS 3OYDA 2EW9A 4UB8U 3TA1A 3P45B 3CHWA 3QIDA 1WSHA 2CJKA 2ZHAA 3LAMA 2VKRA 5EE9A 4O4RA 3U9ZA 2VDIA 5AQXA 1WJ9A 3WC2A 2BVZA 4DV4J 2ZJ8A 5DLFA 1UPHA 1RDRA 4I56A 2OTLN 3QFUA 1RTDB 4FNIA 5KPZA 4DV6F 4NCAA 1IKWA 1J53A 4DL2A 4JKHA 4TQSA 4M63A 2A0FB 3VAKA 2JLFA 2JEIA 4Y0WA 2GIFA 3S3OA 4FJ5A 2NRHA 4OPJA 1TFRA 2GS8A 1BISA 5BRFA 2V8DA 1LWCB 2A5XA 4OI6A 2BE2B 4DR7J 3F53A 1NGFA 4F2SA 2W2QP 3DJCA 1FESA 3NNAA 4WPAA 3FLCO 2QL7B 1U04A 1HIWA 3CMQA 3TAMA 2UU9F 3GWCA 2H5XA 1ZQFA 2GO7A 3THYB 1Y11A 1EX4A 3C7NB 4AHVA 1XMOJ 2DNOA 5HI7A 1ZQIA 2BCQA 4CJWA 4CLZA 1PK3A 2CPYA 3M32A 1TVRB 4B1XB 1V9OA 2Z1JA 2ZZNA 2VGNA 4PABA 4F5PA 4NLDA 4EU0A 1S3XA 3FZBA 1TV6B 4P52A 3KHGA 1WHVA 4I2DA 1QQ7A 2RHQB 5AQFA 4DO9A 1SKRA 2BV3A 2OHFA 4CF8A 3BREA 3GIKA 1VLBA 2KKPA 3RJFA 3DXSX 4ED0A 2G07A 3ZSRA 3C2PA 2P5OA 5J2NA 2AJFE 1U48A 2HNDB 1YBAA 4A57A 2K4PA 1Z05A 4XTTA 4RW9A 4OZ1A 3T3FA 3PIPQ 2BKEA 4Y2SA 2QA4N 1GK8A 3W3DA 2BW2A 5AKZA 4XDDA 4WP8A 5J2AA 3DYAA 2E5LJ 3CJ2A 2KRRA 3D67A 3OW2M 1SWWA 2ZJQQ 3OUYA 1U1RA 3CJ4A 1RWNB 1LXNA 3DLGB 2OPSA 1V9PA 2HQCA 1D8BA 4U67Q 1FRXA 4NA3A 5EWEA 5L1IA 1U02A 4ZVOB 1FERA 2PXIA 2QL5B 3SEIA 2BM1A 3KHRA 4UQGA 3HX9A 2A6OA 5CH7B 2KN7A 4WFAQ 4KLDA 3G25A 1XNQJ 4DEZA 2WZ1A 3BZQA 1WG4A 4DTRA 1NNEA 1Z00B 1V3SA 4M7XA 1M5OC 4HHJA 2BKNA 4FK2A 5EOZA 4RQNA 4QR1A 1L3KA 2LYBA 4USTA 2DL0A 2FJ6A 2XICA 2CPIA 4F0MA 1RPLA 2QWOA 1IBMF 5JUMA 4YVZA 4QZVB 2V8VA 4F91B 3B82A 3ZZZA 4E7LA 1S1XA 1A7GE 4ISFA 2CNOB 1KL9A 4J03A 5AXKA 1NJWA 2QKBA 2YNGB 1ACMB 3MCPA 3AAWB 5HMWA 1HNIA 3CQ8A 4LF5J 3DFEA 3LO3A 4F3TA 4GVBA 4DR3K 5EWGA 1RLCL 1W7AA 5FDLB 2MDAA 1UWBB 4BRMA 2ZVSA 3TUZC 1KVAA 4IO9Q 1AXQA 1N34F 3J7ZT 2P9IB 2QC3A 2OUGA 1WSJA 2FDRA 4BRPA 2HQDA 2H4WB 3GIRA 2KMDA 2G2OA 2MPUA 5GMDA 3O9RA 1R89A 5LMUK 1ZQPA 3QGGA 4EFAC 2M4MA 4Z4FA 4AQYF 1HUZA 4ED2A 2XHWA 1VQON 3CIMA 1HKCA 3Q8QB 2CVIA 2FVSA 1IJJA 3DDIA 2RLTA 9ICBA 4E7IA 2P9EA 5EUHA 2G0JA 3BQ2A 2ZJRL 5DDMA 1RGIA 3TNVA 4GVMA 3L4PA 2FMQA 4LRDA 4I0WA 1SPBP 1REGX 2OSRA 3G6YA 4OLOA 3JPRA 2UV8G 5F8HA 3MN7A 1CEZA 4DFMA 4EIAA 2Y0BB 3JTNA 1YJWS 1S57A 1JALA 4QIWF 5AQZA 1GLEG 1ZXOA 3BN4A 3WEEA 1Z25A 2AU0A 3ID6A 1R27B 3K2YA 3GFYA 5KFMA 5FRMA 3TAMB 2KV2A 4FWSA 3QO9A 3VZHA 5JVGQ 5F1XA 2HF3A 4B3RF 4M6WB 3VGTA 4M0AA 3JB9k 3E51A 2HWTA 3W2WA 3CCRS 3FZMA 3T1HF 4BC3A 1S0NA 4WIQA 2FE9A 2JH7A 4DR6F 3H5XA 2CKWA 1RT1B 1BOTO 4AH9A 1TUGB 1UVMA 3S3NA 4DL5A 3I9ZA 1VGYA 1URRA 3G82A 2VONA 2R2TA 2ZITA 2F4FA 2VC1A 1XHXA 5J1PA 2ZNYA 1H98A 1P9QC 4OZNA 5DB8A 4OYMA 2HI0A 4W5RA 2G09A 1VQ8S 2QX0A 2O8BB 5LMUJ 4QOZB 4WWSA 1NO8A 2QO3A 4OL8A 1B0XA 1NZBA 3QGPA 8ICZA 3TFRA 4DI6A 5DS7A 4LSLA 4OZ2A 9ICKA 3EWAA 3TABA 3M05A 2LVWA 4AP9A 1C7YA 3HD1A 3PG9A 4PGYA 4Y65A 5AI0A 1JLCA 3TJ8A 4RW9B 3IV6A 5HOOA 3A12A 2CA9A 2FPMA 3DMJB 1XR5A 3OYHA 1R3NA 3GR1A 5A76A 2ZKTA 5J0UA 5AM3A 2E4LA 2DTJA 7ICOA 3CGIA 1VK8A 4KGMA 1REVA 3OFGA 3V6HA 3CFPA 1KVBA 2MJNA 1ASWA 1X60A 4IG3A 5IZHA 4K43A 9ICOA 2W9BA 3MM5B 5C7PA 1BA0A 2L3MA 4I2QB 2ZUAA 2NYVA 1XO1A 1FTCA 2AYGA 1J97A 4AUKA 1RT3A 3ZZRA 4URSA 3KLFA 2CGLA 3SPYA 3RMBA 4PXBA 1LWFA 3OR1A 5KFVA 2ODGA 1WHWA 1P1LA 2AMCB 4CJKA 2EZXA 3L2WA 1ZH5A 3BKUA 4UUWA 1VSMA 1YJRA 2NRVA 4CFAA 3NF9A 4PG5A 2HS3A 2V2QA 2AQ0A 5ITHA 1QE1A 2W6LA 1IV0A 2GGPA 2EAMA 4X4OA 3CSKA 4LSZB 1UOCA 1JLFA 3FJ2A 1NGJA 1QSLA 2QG9B 3QFPA 3V7JA 4OJ6A 3HJEA 4ANDA 4Y0FA 4DV0K 3M2UB 4G1PA 2NUHA 2HBMA 3B54A 4ZTFA 3TZWA 1GLLO 3E9PA 4MHVA 1C1CA 4JWMA 4JI3K 3HSGA 3HD2A 1ZOTA 4LF7K 2W2NP 3UNYA 1X5PA 1SJ4P 2F8SA 4UUXA 4JK7A 3AM9A 2HHUA 4DR7F 3V2UC 3CCUN 4ELTA 1RBTA 4ZVFA 4GVBB 3AO1A 4WXWA 1E4FT 4ZPVR 4UY85 1IG8A 3MPVA 4OX7A 2QA4S 5BPLA 4KHUA 3J7ZO 3OBWA 4XH5A 3QU5A 2IAJA 2VKQA 3HRGA 2GVZB 3NVWA 4EBEA 5B09A 5A2QO 4IO1A 2YHXA 4B9TA 3KK2A 1FRLA 4B9VA 1XEZA 1W7WA 2WF5A 2VIXA 5ETMA 1R8HA 1AUDA 4CJ4A 1RJJA 2W9MA 3O8WA 4DV1J 3LDAA 3IRXA 4YMNA 4DQSA 3ZTOA 2JZ5A 2OXOA 3IFRA 2J0SD 4NV0A 3PX6A 2IOHA 3D68A 3ZNJ1 3IWLA 5CR0A 3LP2A 1J54A 2OPQA 1KQGB 5AXLA 4ZVSB 3EICA 3HHLC 3CDUA 3CJQA 5CYQA 1N32K 4IQWA 1MA7A 2O66A 4DMZA 3H5SA 3D2QA 3ILOA 4NLTA 8ICXA 5J2CA 8ICUA 2P6SA 5E26A 4KX3A 1E6VA 2NPFA 1U0HB 1HHTP 3KIOA 5ALNA 1NEEA 5BJRA 4DV0J 2YY6A 3H4DA 1ZQHA 1QLNA 3DLKA 3KLVA 2OIHA 2QYCA 4Z4IA 2MZ1A 2E5LF 3CPWR 4PCQA 3KHHA 1DRZA 3J81j 2PYJA 4NYFA 4DL3A 2HBRB 4EEKA 2IRXA 4DOBA 4NLKA 4LF7J 4CJPA 4NB4A 3U3YA 4FLYA 3ZT1A 2DFEA 4F26A 1PAUB 3V1RA 5FPEA 1R8BA 4UAYA 4C3MA 4KN4A 1RT7B 3DCAA 5T7LA 4CF4A 2ASLA 4MFCA 4WP9A 3QLHA 4PKGA 3CXCM 2FSJA 3BPDA 2KE7A 3JPTA 3RJHA 1XNQF 4O0NA 1LOTB 1NJIT 3GU3A 2ZOFA 2BEFA 1MWQA 3QBXA 1ZQ1C 2W9AA 4GVEA 3K1RB 5J0PA 1R31A 3DGVA 1Y0HA 4J9QA 2CDQA 1X9WA 3OYJA 1HBMA 2K1RB 4NRTA 3JTPA 4KI4A 3I31A 2FJEB 3RBDA 3P5TL 3B6PA 2AEJA 2EG2A 3T5KA 3DHWC 4KV8B 1VBYA 1RADB 4CJEA 5GAEP 3GR0A 3L7OA 1Y4ZB 1N32J 4ZJOA 3VEXA 2I0XA 4M95A 1KBUA 4K5SA 1WOQA 4UBBA 3CO0P 3EJMA 4M3UA 4LF5F 4E1MA 2J0QD 4CGFA 4X4TA 1HR0K 1B70B 2EFGA 1H7XA 4DBQA 1EKRA 3M1YA 2X1FA 1FXLA 2W9BB 3QMQA 1CRXA 4A46A 3OSNA 2MZJA 3KLFB 3J80Y 3FMBA 2D0BA 1U2VA 1XSPA 3TI0A 5ALPA 3VGMA 1LWFB 3OR1B 1NZAA 4K7QA 4LR9A 5M1PA 3IM8A 3SYZA 2JLGA 2Z1HA 4CIOA 3A8KA 2IYGA 4FW1A 3G6VA 2KJWA 4GXKA 1X3NA 1QE1B 5DDPC 2PC6A 3FGUA 1X4AA 1D8LA 4Q2MA 1KN5A 1PVQA 4KLOA 4A8WA 3KKAA 3O8MA 2A18A 2XLJA 1FFSB 2CFXA 4C97A 2XQCA 5C2FA 4FJNA 1YJNS 2WHEA 4HI2A 3ETRA 2C3UA 1OVQA 2I5JA 3O5BA 3UDLA 2MZRA 2PFOA 3KK7A 1XR6A 3QUBA 3MGVA 4DOCA 2FJXA 2GC8A 4W4MA 2KJ9A 3FFKB 5DK5A 3J7YU 3ZDEA 5CZXA 2FDNA 3DU6A 4GO5X 3RRHA 1HNXF 5AQGA 1B43A 1P8ZA 3EVWA 6FD1A 2PKEA 3LGNA 4BHQA 4LF8K 4Q7AA 2IAJB 3N9UC 4USUA 1NKBA 1QJHA 4KAIA 7ICTA 1RWPB 3UD3P 8ICTA 3KK2B 1HR0J 4DF4A 3QJPA 3O3FA 1Q18A 4PYDA 2LXIA 4DPUA 4RQ5A 3IRXB 1Q95G 5E3RA 3HJVA 2QJ3A 3B0YA 1UPPA 1QVGM 5LMUF 3RTVA 4EFHA 3HVAA 3LP2B 3C16A 4KLQA 7ICFA 4QU6A 3N4QA 3CPEA 4YG2A 1S0OA 3C15B 2I9GA 4N8OA 1EHWA 2I8EA 3HILA 3T1YK 1FIQA 2P6UA 1FX2A 4OJLA 1BUXA 3N7RC 1ZA1B 3ZX3A 1UHUA 4O5FA 1FNOA 1TZ0A 2OP5A 3ALRA 5HROA 2UUWA 3R7BB 3UCZP 2OJ3A 2A3VA 2K7JA 3DLKB 3DRSA 1KCFA 4RPXA 2HQFA 3Q7BA 1NRKA 8ICBA 3OGUA 1RFQA 4FLTA 4B9NA 1NGBA 1RBOB 4CF0A 1G2EA 3QERA 3C6UA 1X1PA 1JLQB 3QT5A 3CCUS 3H7HB 1NGAA 5J29A 3M8WA 3BF1A 1N61A 2RAQA 5GMEA 1KQFB 2KFZA 1QAIA 4CO2A 2VQFK 4N56A 3QLHB 2E8PA 4Y6IA 5D78A 4J9PA 4LF6J 2A3JA 2RQMA 5ETRA 4I2BA 4ZVTB 3JQJA 2BRKA 4KHYA 2E6LA 1BPBA 2LMRA 4GNIA 4FN5A 3QRRA 5AZJB 1T02A 3ATVA 1CSJA 5AZIA 1JK9B 2BZ2A 4XAKA 3ENOA 2WOMA 3TYTA 4YDUA 3NH1A 4IOAL 2CXEA 1L7OA 2IVNA 2J7WA 3PUFA 3NVYA 4O23A 2V4JA 4CH7A 3IGVA 2DWQA 2VA8A 2IHNA 1IBLK 1VQNN 2DYAA 3MUVP 9ICVA 3PACA 4ZPTR 2YXLA 3IR6B 4CK3A 2VC0A 2UV8A 2KFYA 3DRRA 1N52B 5HK4A 4WKYA 3MDQA 3EY1A 5MLCV 1J2MA 4AILC 2BPFA 1HLUA 2X6SA 2NXUA 2NRTA 2NREA 1V97A 4IDKB 2LYHA 2WB1C 3B4DA 3HULA 2FHOB 2DEJA 4J9LA 3DXMB 4H5RA 3OXFA 3U9DA 2YJEA 2XNQA 5B0GA 4C4WA 1ZZFA 5CY4A 8ICLA 3IWNC 4DHYA 7ICMA 1FWPA 8ICKA 1ZQAA 2N3OA 3ELHA 1JMTA 2A6AA 2ASPA 2NNWA 3MM9A 4J9MA 4I27A 4F4ZA 1HBNA 3CD7A 5D4OA 2HPUA 4CI0B 5K20B 1NGCA 1N5YA 2P9KB 3VQPA 1NGGA 5J2EA 4YY3F 4DV1F 3VZIA 1FWKA 4K0KJ 2LXFA 4DV3K 1NBEB 2XMTA 2B9YA 4CWBA 2HVDA 2VPWB 3HHLD 3GCWP 1JL2A 4R8UB 2Y9UA 2ZBPA 3KD5E 1YVNA 3MAAA 2CQBA 3AL0B 8ICWA 4QBUA 2P9GA 1WF2A 2P9UA 2Z0GA 2FSNA 2JXJA 1M0SA 1HBUA 3F2BA 9ICSA 2E2NA 5CYMB 1MROA 1JWWA 3HM8A 2DTUA 3FBFA 4USHA 1JLGA 5I3UB 2P51A 4KHMA 3IBCB 3THXA 1IBLJ 4M47A 5D77A 1BY9A 4YR2A 8ICPA 1QZ5A 3WK5A 4DX5A 4LF7F 4L73A 3UQSA 3SQ0A 3MR7A 5AQYA 3PW5A 1RG6A 2Z4PA 4A8KA 4NL5A 5J0QA 1P7DA 4BRQA 1L3VA 5ALWA 3SMVA 2M9NA 1OO0B 2JMGA 3TEGA 4H5TA 1F9HA 2FVPA 4RQMA 1T7PA 2QA1A 2NLWA 3QINA 1XWLA 2Q1LA 3ENQA 2F8LA 4US8A 1Z3EB 3C16B 1Y3KA 2E66A 2RT3A 7ICJA 1T3VA 1KFDA 3QZ8A 1B0TA 3KMSA 3K58A 1WTFA 2WTUA 4X4QA 4Q0BA 4BE0A 1CULA 4H0YB 2XYHB 5EWFA 1FDBA 1A6LA 2ZJRQ 4DG1B 1HUOA 3HCXA 3DOMB 4U96A 2EANA 1TYQA 4DV3J 2WHOA 1WUDA 3CDBA 2YWKA 2QK9A 4G9ZA 4CJFA 3ZDBA 4C2MA 5DDRC 2F8TA 2R9LA 1T11A 1N32F 1Y3JA 2J0XA 2E7VA 1QUPA 4E8UA 5IWAJ 1S1TA 3IR7B 2HW3A 1CC8A 1WLJA 2BE9B 3NY0A 3SUNA 5AI9A 3C6UB 1RBUA 1YITN 1KS2A 3R1XA 3ZO7A 1T8EA 3TR5A 3ORYA 2F3NA 4J8FA 3GZ7A 2WFBA 3N4WA 1JXBA 3G86A 3NGYA 1B92A 3TA0A 4IJAA 4JV1A 1DAXA 3D2EA 4NZ6A 3E01A 4RQ6A 4UY8T 1W0HA 5B0EA 2FY8A 3HRDD 1BWEA 3I33A 3VGVA 3M6ZA 3ID8A 3MMVA 3H98A 4CERA 3EGNA 1XC3A 3M7DA 3N6MA 4BWMA 4P0PB 1T95A 4BRCA 1BPZA 3AJ1A 2V8GA 4JAXA 3VA0A 2JEJA 1M5HA 4K2JA 2GCFA 3V9XA 2WOMB 4X64K 2CADA 1HQUA 2D0OA 3IN5A 1YT3A 4P73A 5AI8A 1JLAA 4BBYA 3TAEA 3P38A 3LP0B 2Y0SF 2KZMA 2IFXA 3F2DA 1NHVA 2ZH5A 5HO4A 5A8RB 2BANB 3QT8A 3HVRA 4JS5A 3W0LA 3QUQA 3JSRA 2JNJA 2O67A 4IEEA 2XTJP 4YOVA 4CH0S 1TK8A 3GG4A 2J76E 4FLZA 1ZQNA 1FKAF 2CQ1A 3RH5A 3U7JA 2FY1A 4HDGA 5J2MB 2OPRB 1H2UX 2BA9A 4B3SJ 4C9DA 3MM9B 1NJXA 1L8LA 3SQGA 1WBBA 1TU0B 4XRHA 1HBNB 3M7VA 1HR0F 4BR2A 2XSFA 3A8IA 2POKA 3KDOA 3LWLA 1N5YB 2CDRB 2ZH6A 1VBXA 1HJOA 4DQQA 3CJAA 2G13A 2EX3A 1O08A 1AB8A 4CVNE 1X6IA 2DHAA 2MSNA 5IT9O 2QTWA 4HTUA 2XVTA 2ZF5O 4IQTA 3MXIA 3EKUA 1CJTB 3R5JB 1CZBA 1YVFA 2HFSA 4IWVA 2LFVA 2H4YB 4OHXA 2DPNA 4EHTA 2P9LA 1DTQA 4LVNP 2A41A 3ZSXA 3H0MB 1HBUB 3SLCA 4BRIA 2B8PA 1UVNA 3VC8A 3CO9A 3C66A 4KHRA 4X64J 1RWXB 1RM6C 9ICPA 2E44A 1HARA 2WVEA 1JLGB 9ICEA 3HP9A 1VQNS 3PNIA 3I0SA 3POTB 4FW2A 4OLBA 2DT9A 5EN1A 2HHPA 4RQ4A 2DH8A 1NSAA 1RTJB 1YKWA 2MTLA 1ZQKA 4RT3A 1RWMB 5D0GA 1FNXH 4BG9A 4X2BA 4CIFA 3HF5A 3SCJE 3CI5A 2CG8A 2RUSA 3FFIA 5J0SA 2HMIA 2W2PP 1ZBFA 4LF6F 1S22A 5KQ8A 3SV3A 2MQ8A 4KKOB 4ILMA 4ZTJA 3HOTA 3O44A 2GQCA 1EB0A 1BGXT 2G2YA 3MM7A 3UCGA 2MLXA 3MAHA 1BPEA 3KFUF 3L0QA 4NRUA 4U6PA 1ZM9A 3QU4A 2QB1A 2JHDA 4ED1A 1RHRB 4WFBL 3ILIA 3QWUA 4ANEA 3BEGB 4R63A 5JVHL 1U47A 2CH5A 1KQSR 3CJKB 1H7WA 1RU1A 4K4SA 1GXLA 1T6DA 4I9LA 5KOXA 3TKAA 5B0CA 2B4VA 1RHMB 5A8KB 1TFWA 4X62K 1KOHA 1S1UA 2YWEA 3SFGA 2JC1A 4LH4A 3V6DA 3FEXB 1XR7A 1GLFO 4FLWA 1F2HA 1WELA 2WB1D 4KFBB 2E2OA 1XMQK 1UVJA 4C98A 2DR6A 4FJKA 3UW1A 5J0WA 1JLEB 1ZYQA 1F5AA 1FD2A 1UZDA 4UZCA 1SJRA 2G5IB 2A1AA 2AYEA 3WBZA 2GJ2A 4I1TA 1COOA 3MMJA 3IFEA 1FVQA 3OYBA 5L1JA 3HHNB 3MOJB 3D2EB 1ULRA 1GLDG 1IR1A 2HBYB 3GIJA 4FWOA 2BBEA 2MXYA 3M8PB 3V9WA 8ICQA 4UY8O 1IG6A 3W5ZA 3V4IA 2MQLA 4ENOA 2J4RA 1NK9A 4JBCA 3C2KA 4K0KF 4I69A 4UZBA 4QWCA 4BC7A 3WZ0A 1MN8A 3F9MA 2WC9A 2HS0A 4YFUA 4PWDB 4U8VA 2R2SA 2CRLA 1HQUB 3R6GB 1IVZA 2EHGA 4ED6A 1HBOB 1VI7A 3SAGA 5GAHU 4IQUA 4DUZF 3CJ8A 4FP9A 4O9MA 4TVAB 2GVDA 3TTCA 5F8GA 4RNFA 1VSJA 3AFGA 3Q22A 4P4OA 4ECXA 1WN7A 1NH7A 3AD7C 4I67A 1A5XA 2P9SA 3M2VA 4JUZA 1S6QA 5GADU 5EE1A 3LTOA 2DCLA 5M1KA 4BS2A 3VGKA 4X62J 2YB4A 4NYOA 3RBXA 4EWTA 3S7RA 4B3OA 1VFJA 3U02A 4RWTA 2R42A 3KTQA 3CIPA 1ZJNA 3U1LA 1CJKA 1D9DA 4GKJF 4QZEA 3MGHA 1XMQJ 4US9A 2LDYA 1YITS 3QRQA 4DPOA 2B4OA 2RILA 4OI1A 4JV5K 2E8MA 4AM6A 3BH7B 3D28A 4KITB 1JX4A 1VK3A 4FYYB 4O8UA 5LXYA 4RKUC 4M94A 3HHLA 4RNNA 5H1SV 4OPHA 4KGVB 5SWMA 2EFPA 3R1LA 4MFBB 2XO7A 3GTYX 3BZCA 2WUSA 4P2FA 2XY7A 1RHKB 2GMHA 1T4GA 5LMNF 2KG1A 4Y2CA 2J6SA 5GINA 4DV3F 2P9LB 3RUBL 4ILRA 3VF6A 1B9FA 4DN9A 4IOXA 1FEEA 2B4JA 5ETOA 1SZHA 2WK4A 4HHHA 4CNYA 5IWAF 2NRRA 2IPOB 3DNCA 4C8OA 3I0SB 3RMCA 1JMSA 3ONQA 1DEJA 3OYNA 1DZ5A 1Q82T 3NVKA 2XMJA 5SZTA 1H72C 4W5OA 1GEHA 1TL7A 3HSJA 3A4TA 4CCHA 4KE5A 4BC9A 2QLJB 4WU3A 3SCXA 3ENVA 2R8JA 3J7YP 5CA7A 1VQLN 4K4ZA 3Q7CA 4FJ8A 2YHWA 4OHWA 1LAWA 2F5GA 1XIQA 3TAFA 1NH8A 3FZFA 3KKRA 1C1BA 3PX0A 1ZQMA 1C20A 1AA1B 2QWQA 2F96A 3TUIC 4F36A 2BJDA 3TVKA 4EI2A 4CLKA 3M2RB 1WYGA 3WX8A 2DGUA 5B0FA 2YQ1A 4HUGA 4FYXB 1BPYA 4CGIA 4QYZK 4KTZA 2VJ5A 4DF8A 3CFOA 1S1UB 1H2VZ 1SV0C 1LCUA 2VPYB 3SK3A 4CZJA 4JI2F 3OYFA 3BO3A 4GMJB 2FVQA 3I8DA 4KLMA 2CPZA 2GNKA 1WEZA 4F02A 3TX8A 4C0ZA 2IHMA 2W7AA 4OHVA 1UMJA 5DB9A 3T6JA 2H54B 4I6MA 2YB1A 4GLXA 4M5JA 5KAFU 1FEHA 1RTIB 2ETJA 4HT7A 1V5IB 4M5IA 4M5GA 3AU2A 4AD6A 1WUUA 3L3CA 4B3SF 4O5BA 1EQMA 4ZVEA 2E1AA 2LI6A 5EX5A 3JAMU 4EP5A 2O8CB 3ISBA 1MA9B 2YI1A 1D9AA 4C6AA 2GUPA 2HKEA 3R2CJ 1ZQQA 1ZD2P 2YPZA 4KN7A 5EU7A 2CPXA 2K3IA 2E6MA 3KZBA 1G15A 1Z4UA 3MFHA 2GHVC 3SQ1A 1Q79A 3H2LA 1BG3A 3P5JA 3K4GA 1DTTB 2E2PA 5ETKA 5J2BA 3E2EA 3AVKA 1HNVA 2VFRA 3UR0A 2DNKA 1DKGD 3W64A 1YSJA 4C80A 1S6UA 5JU5A 4P75A 3HMJG 5HN0A 3KUEA 3ZZTA 2GVDB 2NXEA