4DQQA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 204
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqqA01
3V9SA 2G8HA 4CHQA 4FJ8A 8ICXA 2RPIA 4TSXA 3T5KA 3AO1A 3SPZA 3C2MA 3V7LA 4WE1A 7ICEA 4EEYA 5KT6A 2O4IA 5KFJA 3Q8KA 3DLEA 2JZBA 1XS9D 4W5TA 1L3TA 3UQ0A 1NOYA 3C6UA 3V9WA 4TURA 3QIOA 1NJYA 3SV4A 4CHNA 4HUFA 3HWTA 1QSYA 3G6VA 2O4GA 2QXFA 3WNGA 2FLNA 3THVA 4RT3A 2NRZA 3TI0A 2M9NA 4OVLA 2W42A 3D45A 4TQRA 1NJXA 1KFTA 1KLMA 9ICOA 3HVTA 2FPKA 1ZQPA 3SYZA 4QZ9A 3HVRA 4CEDA 4UBBA 3ASMA 9ICBA 4CK2A 4M3RA 1BPDA 4F91B 2JEJA 4NY8A 1S5JA 2PZSA 3V6HA 5DG7A 3VQCA 4UQGA 4Q0BA 2PFPA 4DTPA 4CF9A 3MAQA 3TAQA 4ELTA 4M2YA 4KLDA 3AA4A 4DEZA 3TR8A 1UA1A 4FJ7A 5KFAA 5CR0A 4F3TA 1S1TA 4LZGA 1ZBFA 3ZSZA 4CEBA 4AHSA 3JPOA 2PI5A 3G10A 2NRVA 4CJPA 5J2PA 3RB4A 1JXEA 3L8BA 4M9HA 1ZBUA 2KW4A 1S76D 3U6FA 3MXIA 4CEOA 4RW8A 4KHNA 2YKMA 1RZTA 3HPGA 3BQ0A 4O3OA 2VG7A 4CJUA 1CUKA 2AGOA 4KLGA 3T5JA 1TKDA 3C2KA 4FM2A 1RDAA 2HNYA 2DFLA 1U47A 4DSKA 4DSFA 1VRTA 5L1JA 4KLSA 4KI6A 3KJVA 3V6DA 3LDAA 3OHAA 4J9KA 1RXVA 4DL6A 3C94A 1VSHA 4E7IA 1VRUA 1XI1A 4GXJA 2R8KA 1B9FA 5IIJA 1NK8A 3KHGA 4DFMA 4CGHA 1EX4A 2KN7A 3NAEA 3C1YA 3UQ2A 4DU1A 5J0UA 4M9JA 1B92A 3AU6A 3QERA 3DRSA 5J1EA 5BOLA 2XCAA 1FKPA 9ICFA 3L2RA 7ICPA 1NKBA 3CYMA 5DMRA 1J9AA 4DS5A 4CERA 3OYEA 4QZGA 3V1QA 2B6AA 1S0NA 3UXNA 2RKIA 2XCPA 2LYHA 1DTTA 4NYFA 5CB1A 4DFKA 1KRPA 4FYDA 1U49A 4LH5A 3NF9A 4RUCA 4XA5A 4CJKA 2E4LA 4O3PA 3K4GA 4E0DA 3AO2A 5C42A 2OZMA 4MF2A 3AA5X 4CJVA 2IMWP 1RBUA 3RRGA 1RT3A 1RCHA 1O1WA 3RAXA 4X5VA 4HVJA 3V9XA 1S97A 4M3ZA 2ASDA 3JPSA 3KK2A 3NTUA 4DL3A 3QETA 2OZSA 3NBPA 5J2KA 1SL1A 4EYIB 3BDPA 1VSLA 5KFEA 4DL4A 3NH0A 1XO1A 1GOCA 4JV0A 1HYSA 1U9LA 1VSDA 4YR3A 4P4PA 3IAYA 2AQ0A 4QW9A 5KFUA 5CZ2A 1B22A 3CFOA 3VQBA 4W5QA 2FBTA 2YNHA 7ICNA 4KHWA 1ZQZA 1C1BA 1CLQA 2VA2A 2NUBA 4J9RA 1UAXA 4ECSA 3Q8PB 1CZBA 5DQHA 4KN7A 2PY5A 2NRXA 4M04A 2HVHA 1MU2A 3EY1A 4XUSA 3RJKA 4Z4EA 9ICXA 1RDDA 3VQPA 4R65A 4CESA 4CGFA 1J5OA 4ED0A 4KFBA 3QESA 3PW5A 3OYAA 9ICAA 4OGEA 5D3GA 4B3OA 4RZRA 3CM5A 3V9UA 2HNZA 4EP5A 2BPGA 1K1QA 2QKBA 4FLZA 3L2QA 3ZDCA 4I2DA 1BVSA 1S10A 4DSLA 2G8FA 4E3SA 1HJRA 3HX0A 5K14A 1TV6A 4E1NA 2BQRA 1ZBHA 2B21A 1ZQDA 2XY7A 4O5CA 3KKRA 2XGQA 4Z4CA 3RMAA 4CEAA 5KFNA 3MR3A 3AVFA 8ICSA 1C0TA 5DLFA 3OJUA 2AQ4A 4FBUA 5HP4A 2BE2A 4CHPA 2XGPA 4Z4FA 3AO5A 1TVAA 2FBYA 3D0PA 5HRSA 8ICBA 4Z6DA 5D46A 2E6MA 4N76A 3T5HA 1K6YA 1ZQQA 3DLKA 4B8CA 4W5OA 1BPBA 4QZ8A 4LD0A 5KFGA 1XHXA 1Q8IA 4IQVA 3RJJA 3MXMA 4F5OA 3AVCA 4QZAA 5KG1A 3PW7A 1XWLA 3GQCA 4NM1A 2JEGA 4K8XA 4DTRA 1RTIA 3MEGA 5KFXA 4QZDA 4IQTA 3PO4A 4KLLA 1QHTA 4FBTA 1C6VA 2WONA 4CF2A 8ICEA 9ICIA 1BGXT 3IRXA 2YV0X 1XSLA 7ICSA 2V9WA 5HMMA 4M0AA 4YXMA 1QSLA 4EBCA 4RQ0A 5KT4A 2H5XA 2KZMA 3OSNA 1A5WA 2MUTB 4OKJA 2W9BA 3JPNA 3V7KA 3FFIA 2Z1JA 1BQMA 2OWOA 4NLNA 1JN3A 1GOAA 4R5PA 4KTZA 2W9CA 4C8MA 3TANA 1FXXA 4J2AA 4UBCA 4K4HA 1XSNA 3M9MB 4IQUA 1LW2A 4FZYA 4YVZA 2HHWA 1LWFA 8ICRA 3ZT2A 1BI4B 5KT2A 4J9QA 3SV3A 2OPRA 3UIQA 4H4OA 2YHBA 2YNFA 4RQ6A 4CJFA 3RJFA 2FMQA 1X9MA 4IRCA 2DFEA 2DPJA 3MBYA 3RB3A 4NCGA 4CJSA 3NHGA 3ZDDA 5L9XA 1QE1A 3NH2A 9ICRA 3VQAA 2HHVA 4CECA 3HO1A 5DQIA 4BDZA 5IINA 5IIKA 3P5JA 1TKXA 4AHCA 1JIHA 2BPCA 3G6YA 5KFQA 1Z00A 3KLHA 3ZSQA 4KLOA 4QCLA 4J9NA 5HMLA 2W8LA 2J6SA 5DGBA 4PGYA 4EYHB 5DGAA 5KFTA 3VA3A 5J0XA 3AV9A 1TK0A 4GC7A 4O3RA 5IILA 4M9GA 4W5NA 1HUZA 3L3UA 5KFOA 4DOAA 4R8UB 4CJ5A 2ZD1A 2DTUA 3IHQB 4LSNA 4FJLA 2HHUA 4RPYA 3WNFA 4QZBA 3K5OA 4HUEA 4CF8A 1IXRA 1ZQCA 4FLYA 4PPXA 4HYKA 5TZVA 4JRPA 1KFDA 4AILC 1WAFA 3AVBA 5HRPA 3GILA 3K5LA 1ZQMA 4RQ1A 5J2JA 1Z26A 1ZQJA 3F73A 4HCCA 4UAYA 7ICQA 2FPLA 2P5OA 5HHHA 1JLQA 4CE9A 4IDKA 4ZHRA 4FVMA 2KTQA 1S0OA 9ICCA 4JLHA 4FJJA 2XRIA 1A5VA 5SWMA 3OYNA 4Q8FA 3ALYA 2KZZA 5FRNA 2P5GA 5JUMA 2JZBB 5CA7A 4C8KA 4EBDA 1NK4A 1WCNA 2F8SA 4AHVA 1RNHA 3HP6A 1IO2A 1VSIA 4O0IA 1S1XA 4KLUA 1S6QA 2VA8A 4FK0A 8ICQA 1CXQA 4KLFA 3ZT0A 3RAQA 1N48A 4XQ8A 3DLHA 2DFFA 4I2QA 4RW4A 3LP2A 2QK9A 2AGQA 2WTFA 4FJNA 2GWSA 3PW4A 1TK8A 3DLBA 1QLNA 2V4QA 4ECZA 3TAFA 2KZ3A 3VA0A 3RR7A 4Z6EA 3ISNC 3T5LA 3S3OA 4FLWA 2KQ2A 5DG8A 4MEXA 4B9UA 3LP0A 3PR4A 4E19A 1CXUA 3P83D 4E7KA 3ZD9A 4YD2A 3L2UA 1EXNA 3IG1A 3KK1A 1SL0A 3O3FA 3A2FA 4C8LA 3LP1A 1J54A 5DB9A 4IFYA 5DB7A 2I1QA 4C8OA 5DQGA 1KVCA 3DOLA 3QO9A 2OPPA 3PX0A 2A1JA 3H40A 2ATQA 1DTQA 2F1JA 1NOZA 4KITB 3K2PA 3V9ZA 9ICEA 1REVA 2G8WA 4RW7A 3TABA 1HYVA 2ZTEA 4FS1A 4I9LA 1WSFA 4DG1A 4DTOA 2DY4A 4LSLA 3TAGA 3DM2A 4CK1A 4CGDA 2PFOA 2Y1JA 8ICFA 1LW0A 1I39A 1L3VA 1Z3EB 1IKVA 7ICGA 1L3SA 4DU4A 4FXDA 4KTQA 2D0CA 1NKCA 4YR0A 2ZTDA 5KI6A 3SQ4A 4ECTA 3GFKB 4EZ9A 3QEAZ 1WSIA 4RQ2A 1ZQWA 4IRKA 5DB8A 3OSPA 3OHBA 4CJWA 1MC8A 3N97B 1S0VA 3PNCA 2F96A 4DSJA 5J2MA 3C2LA 1VSFA 3MR6A 1NK6A 4DQRA 2NRWA 4O3NA 3H4BA 3RTVA 4CJ4A 3CG7A 4KLJA 4IG3A 4CEQA 4DS4A 2PI4A 1S77D 4RQ7A 1YT3A 4Y1CA 7ICMA 4O0JA 2IDOA 5KFFA 4J2DA 3OYDA 5EU7A 4JS4A 3RJIA 1ZQNA 4O3QA 4JUZA 3V6JA 2G8KA 1YVUA 5HHIA 5KRTA 2BDPA 3SPYA 4EBEA 1BHLA 5EOZA 3ISBA 1Z25A 4F4YA 1RDBA 4RU9A 1S9EA 3Q8MA 4ZTJA 5KFZA 1C0MA 2ALZA 4I2GA 1S9GA 1VK0A 1RYSA 1LV5A 4Y1DA 4DQQA 5JS1A 3OVNA 2Z1HA 2DFHA 5KG2A 4M3WA 8ICIA 4DL5A 3RB6A 3L2VA 4DOCA 4FK4A 1UT8A 4CJTA 4R66A 1D9FA 4PA1A 5C24A 4M3XA 4I2HA 4JV2A 4UB4A 5DB6A 3C95A 1EXQA 1MQ3A 1ZQKA 3U3YA 4Z4GA 3C5GA 1JLEA 3ISCA 4RQ5A 3DRRA 8ICMA 2FBXA 1D5AA 4C8NA 3K5NA 3HYFA 1K1SA 2HVIA 3RJGA 4N47A 3FDSA 4PGQA 1JL2A 4LZDA 5KFPA 1Y88A 4PHEA 4CIEA 4RPZA 4DSIA 4FJHA 1WCLA 4YMOA 3GIIA 4IG0A 3NF8A 4CHYA 5KFSA 4RUAA 2FBVA 8ICKA 2PYJA 4RW9A 2IBKA 4CIFA 4J9MA 3VN5A 4I2IA 4CJRA 8ICUA 3O4NA 5HP1A 1X9SA 5KG4A 1HUOA 1RYRA 4M9NA 4CJLA 3HK2A 4K4GA 3PUFA 5KG6A 2D0BA 4F4KA 2C22A 3O3GA 4KLQA 4EZ6A 4W5RA 1IG9A 3ZSXA 3V6KA 4CHZA 2A1SA 4I2JA 5HLFA 9ICSA 4KAZA 4KLEA 3AO4A 4RG8A 3ZSOA 2KFNA 9ICLA 4ED2A 1U4BA 4YP3A 4FCYA 4Z4HA 3MGHA 1I3AA 2R8IA 4M3UA 3HT3A 1LWCA 5J2EA 4G3IA 2UVRA 4E89A 1JLBA 1VSJA 2FMSA 3AVLA 1ZBIA 2BGGA 3KTQA 3VQ7A 1RBTA 1ZQUA 1LB2B 1JXBA 4FM1A 4YR2A 5I3UA 3OJSA 3AU2A 2I5JA 2V4RA 4E7LA 2ZJ8A 1ZJNA 5DBAA 4AH9A 3HL8A 3PMNA 3JPRA 4CHOA 3JPTA 3ZSVA 5J2HA 2P6RA 1BPZA 4GW6A 3KHRA 1QTMA 4I7FA 4YCXA 3KHLA 3QE9Y 2XY8A 3TQ1A 2HHTA 2E6LA 5J2BA 1JKHA 3T19A 3KD1E 5CYMA 3LDSA 4Q5VA 4KHQA 9ICMA 4MFAA 4RT2A 4BACA 2VANA 1BISA 3HW8A 4KO0A 1LAWA 3ZCMA 5KFBA 1HYZA 3DMJA 3KK3A 1ZQGA 1RT5A 3M8QA 2JEIA 3O3HA 4NYNA 1JMSA 1HJPA 4Q45A 5HNKA 4JWMA 5DKWA 1NK7A 3ZDAA 4QWCA 3AVGA 4N5SA 2J6UA 4K8ZA 4RQ3A 1DLOA 1S6PA 4FZZA 4KREA 2UVWA 1IH7A 1YTAA 1LAVA 4DTJA 1ZQTA 4OLAA 1L3UA 1HRHA 2W9BB 4Q43A 1NJZA 3PO5A 1TKTA 2Z1GA 5KFHA 4ZH4A 4DF8A 4UAZA 5KT5A 8ICAA 2HHSA 4CFAA 5J2QA 4FJ9A 3HM9A 1Q9YA 4RNNA 2W9CB 4RNMA 1VSKA 2OYQA 4FJXA 4ECXA 5J2CA 4DL7A 3ISDA 1X9WA 2UVVA 3TAMA 2RF2A 3K57A 3JYTA 2VG6A 4AHTA 3H4DA 3VQ8A 3HPHA 2Q3SA 4FJ5A 4N41A 2RN2A 5F9NA 4R63A 4B9VA 9ICHA 4DFJA 1C1AA 3QEBZ 4O55A 2RDJA 4DLGA 4J2BA 1XHZA 1RTDA 3MFHA 3ZDBA 4DLEA 1BPEA 3B0XA 4BE2A 1RT1A 1ASWA 4BXOA 3VQ9A 5KFRA 3RH6A 4P4MA 5HBMA 4E1MA 2WOMA 4PY5A 4RW6A 4TQSA 1IKXA 1VSMA 1D8LA 4CFDA 2YNIA 1D8YA 1QQCA 4K4IA 1ZQLA 4E7HA 3OGUA 9ICVA 3MFIA 4CJ3A 4CFBA 1KVBA 3RRHA 1Z00B 3M8RA 3B6PA 4PWDA 1JX4A 3ITHA 1WSEA 1F21A 8ICLA 1KTQA 4I2FA 1ASUA 2P6UA 3S3MA 1WSGA 4ECYA 4O5EA 4TUPA 4P2HA 5J0OA 2IAJA 3LAKA 2ISOA 5KRSA 4DTXA 3O4QA 1NJWA 3QNNA 1S1WA 4UB3A 5I42A 3DRPA 2Q0ZX 3EW9A 1KFSA 2IHNA 4B9MA 3QZ8A 5JS2A 4BWMA 3K58A 2MAXA 3Q8LA 1IM4A 4ECVA 5CYQA 1COOA 2JGUA 3SZ2A 3VQ4A 5DBBA 2VWJA 5CP2A 3MR5A 3SQ2A 1IKWA 2EHGA 3NF6A 4UB2A 1HMVA 3CQ8A 2OPQA 3K5MA 2XY5A 1RTHA 4FO6A 4ELVA 1NK0A 1TV9A 4I2CA 4FS2A 2BANA 3KD5E 2NRTA 4HUGA 3AVIA 5J2FA 2P66A 4FJGA 1N6QA 4PHPA 1BL3A 2YKNA 2EX3A 4FW2A 1RBSA 2B4JA 3ZSWA 4F93B 5EWGA 3NE6A 3QINA 1XSPA 1RT6A 1JLFA 3B6OA 1KCFA 2X6SA 3H08A 3NGYA 3OYGA 4F3OA 5L1KA 3VQEA 2OA8A 3JSMA 4KMUA 3E01A 1BIUA 4GXKA 3VQQA 2YHAA 2IA6A 5EWFA 3M9NB 4CJQA 3L3VA 1RBRA 3K75D 4E7JA 4QWDA 3T3FA 5DK5A 2B5JA 2PFQA 4ICLA 3EPIA 3OS0A 1ZQYA 4FK2A 2ZUDA 3VQ5A 4NLZA 2JEFA 3AVHA 1QS4A 4XIUA 3NCIA 1TFRA 1ZYQA 4IQWA 2PYLA 4NCBA 3RB0A 4PGXA 7ICKA 4RQ4A 7ICOA 4MF8A 4M6WB 3LZIA 2X74A 4ED3A 4R64A 3I0RA 1CEZA 3ZT1A 1VSEA 9ICKA 4YQWA 4AHUA 3DOKA 4PHAA 3KIOA 1EKEA 4QOZB 5J2GA 7ICFA 4MFFA 4YNQA 4O5BA 3AVJA 3RMCA 3NFAA 3EZ5A 2VG5A 5BOMA 2BGWA 4KB0A 5F9LA 4CF1A 4J2EA 3LWMA 5J0RA 4DTMA 2A1JB 3B0YA 4YD1A 4O3SA 3UPQA 2FLPA 4JV1A 2LSNA 3E2EA 8ICPA 5KG3A 8ICHA 4IBNA 2AJQA 3KHHA 5KT7A 1TK5A 1T03A 1JXLA 3MEDA 1MQ2A 4M6WA 4J9SA 4DQSA 4NLGA 1BIZA 2PXIA 3KKSA 4PUOA 5J2AA 4DOBA 1JL1A 1XC9A 4I9QA 3Q8SB 4DL2A 4YG2A 4PQUA 1LWEA 7ICJA 4F92B 7ICLA 3ZDEA 5EWEA 3MDAA 3AA2A 2BCRA 2XC9A 4ED6A 2QKKA 4QZHA 2DPIA 2IS3A 5CWRA 2X6NA 1KDHA 3GV5B 3RH4A 1KSPA 4B9SA 3LP3A 4JWNA 3GV8B 3AO3A 4IKFA 2BCQA 3IM1A 1A77A 1UWBA 1U45A 3BQ2A 3PX4A 3QEWA 5J0TA 3AVNA 2F1HA 1XU4A 4TUSA 1NK5A 4H8KA 2W9AA 1HQEA 3H7IA 5DDMA 2P1JA 1T05A 4F5RA 4Q8EA 1R0AA 3G6XA 1NOMA 3OYLA 1G15A 1TL3A 4FJMA 1TGOA 3MEEA 2W9MA 3NGZA 4F5PA 2GV9A 4DO9A 4DTSA 4ECRA 4O4GA 3BQ1A 2BCSA 4BDYA 2C28A 4F50A 4GMJB 4QZEA 1TAQA 7ICHA 3QZ7A 4CFCA 3DYAA 3V7JA 4GVMA 7ICUA 3P1GA 2ATLA 1KVAA 2BQ3A 3VQDA 2Z1IA 3HP9A 3F9KA 4JS5A 3V81A 1TKZA 2ETJA 3LPUA 1SV5A 5KT3A 4KB1A 3TARA 2IGIA 2HW3A 4O44A 3ZSYA 1DOQA 5FROA 3C23A 4UB5A 3M8SA 2ITGA 4CEZA 1JLGA 3HSTB 3ORYA 2FPMA 4F2SA 3C1ZA 3ZD8A 2G8UA 1ZQRA 3RH5A 2G8IA 4AHRA 5CJ7A 5D4BA 3CM6A 4EP4A 4ZTFA 8ICTA 4TUQA 2FMPA 5J0PA 4F4WA 9ICTA 4KPYA 4QW8A 2XHBA 3HJFA 3SI8A 3EWAA 2GUIA 4M45A 2D5RA 4QZFA 3V1OA 4CGJA 1ZQBA 1HNVA 1PZNA 4KV8A 3MECA 4YFKA 5KFDA 1SUQA 3K59A 3BGRA 3AA3A 1TAUA 4QZCA 4ECQA 3RJEA 3ZT4A 5D49A 4DTUA 5C25A 3OYCA 3AVKA 4CF0A 5J0SA 3LPTA 3SUQA 1FKOA 3GIKA 3OS2A 4I29A 1SL2A 3PV8A 3MABA 4FLXA 1BQNA 4KKOA 4BE0A 4MEYA 5KGXA 4DTNA 3H8SA 4KTWA 4CGIA 4BDPA 2IHMA 4F2RA 4QAGA 7ICTA 4I2EA 2VA3A 4OKKA 2ISPA 4ECWA 4B08A 2ZE2A 7ICVA 5IIIA 2OPSA 4I27A 4OLBA 3QEPA 2ZQBA 4F8RA 4KI4A 2A1RA 4F5NA 4IFVA 1ZJMA 3QEIA 9ICQA 4CCHA 3HPOA 4Z6CA 1KLNA 1RT2A 8ICOA 4BE1A 1BPXA 3KLEA 3SCXA 1HNIA 3JPQA 4ED8A 1RT7A 5J29A 1S9FA 3SQ1A 4M3YA 3QEXA 1C7YA 2ZUBA 2FLLA 1SKSA 3BJYA 1C0UA 4DMNA 2Y1IA 4KHYA 2BCUA 3OYBA 3L2WA 4KLMA 1N5YA 3PY8A 3NGDA 3QEVA 2F1IA 9ICUA 4JK1A 4HHTA 8ICNA 8ICVA 3MXJA 4FM0A 2R8JA 3H8JA 4M47A 3MGIA 2ASJA 4YMNA 4DSEA 3MDCA 3V72A 4B8AB 4KHSA 4M9LA 3QIPA 9ICGA 9ICPA 1ZQVA 1JLAA 4ED7A 3FYHA 3GDXA 1ZQIA 2FC0A 3RBDA 5HRRA 1A76A 2W8KA 2HMIA 4B9TA 1FK9A 1W9HA 5SZTA 5C5JA 3TWHA 4MFCA 4IR1A 1ZBLA 1A5XA 1ITGA 5HROA 5KGWA 4NM2A 8ICWA 4P4OA 4CEFA 1UA0A 4F4ZA 3PW0A 5KG0A 2IOCA 2PFNA 2GBZA 1UOCA 3TFRA 2C2EA 3RJHA 4QWEA 4O5KA 5KFKA 4N56A 1ASVA 1RILA 2AU0A 3MR2A 3SJJA 4PHDA 4BXOB 1EETA 3I0SA 1T3NA 5L1IA 1TVRA 2R7YA 2HHQA 2VWKA 2IC3A 3SUNA 4RNOA 3GIJA 1X1PA 4HTUA 1S0MA 4RPXA 3JPPA 2J6TA 3S9HA 3OY9A 3RBEA 1X2IA 4M3TA 3AVMA 4IR9A 4J9PA 3M9OB 2XY6A 1QSSA 1WNSA 1ZQOA 2BCVA 5L1LA 4KLIA 1BPYA 2ZJ5A 3ZT3A 5KFVA 4ECUA 3PW2A 4J9OA 1WSJA 1RT4A 4LVSA 4LY7A 5CY4A 4CGGA 2D0AA 1JLCA 4GXIA 4DU3A 3EYZA 4J9LA 4B9LA 4OJRA 4OPJA 4NXZA 4F5QA 1ZQFA 5KFIA 5KTQA 4YMMA 5DLGA 4BGDA 4FLVA 3PR5B 4QWBA 1SKWA 3RMDA 1SKRA 4I2PA 4CEEA 4Q44A 4FZXC 1MSWD 2G8VA 3ZSRA 1RTJA 1WN7A 3V1RA 4MFBA 1IKYA 1L5UA 1WSHA 3IS9A 1HPZA 5DG9A 5KFMA 1NK9A 1T7PA 5KG5A 2HB5A 2C2DA 1GOBA 3OYFA 8ICCA 4RQ8A 1V9PA 5J2DA 3LWLA 3QLHA 3GV7B 4YXJA 4HCBA 3Q8QB 3RWUA 4KN4A 2XO7A 3S3NA 3HXMA 5KG7A 4OPKA 4FLTA 4ELUA 2BKEA 3AVAA 3SUPA 1T4GA 5DBCA 9ICJA 3CFPA 3SUOA 2ASLA 1H38A 5FRMA 4Z4IA 1W0HA 4DFPA 2C2RA 3SI6A 3ULDA 4ID5A 1T8EA 3LZJA 3T1AA 4GLXA 4KLTA 1RXWA 7ICIA 5HRNA 3KLFA 3OYIA 1NKEA 3TAEA 3VQ6A 1BCMA 3TFSA 2MUTA 8ICGA 3V4IA 3KLIA 4DWIA 3C6TA 3U3GA 5DDYA 3EPGA 2HHXA 3N4MB 4LH4A 2ZUCA 1RPLA 3M8PA 4OKEA 1ZQHA 2UVUA 4ID1A 8ICZA 4FJKA 1Y97A 1WAJA 3NGIA 4L8RB 2P51A 5IIMA 3DI6A 1HQUA 5J0QA 4IRDA 4NLKA 1BI4A 3DLRA 3NH1A 1CZ9A 3SQ0A 1ZETA 3AUOA 1N56A 1ZQXA 4B9NA 4GC6A 7ICRA 5J0WA 3OYJA 3UXOA 1BCOA 4Z0UA 5BPCA 4UB1A 4M42A 4G1QA 5KFCA 1S1UA 3WNHA 2BHNA 8ICJA 9ICWA 4QWAA 5KFYA 2X78A 3Q8RB 3LALA 3OYKA 4I28A 4NCAA 4F4XA 4O9MA 2R8GA 3LAMA 3KLGA 2F8TA 4CJEA 1RBVA 4KHUA 4I2BA 5KFLA 2AGPA 1B9DA 4FW1A 5FDLA 1ZQSA 1U04A 1C1CA 2BPFA 3LANA 2ZJAA 3GIMA 5CZ1A 4YN4A 4I2AA 1EP4A 3I8DA 4PH5A 3UXPA 3OYHA 4QZIA 2JLEA 2YNGA 3ETLA 1U48A 4BWJA 5KFWA 4KRFA 4ED1A 1ZQEA 2KFZA 5J2NA 1ZQAA 1TL1A 5E41A 4MQ3A 5CHGA 1SZPA 3OYMA 3C5FA 3SNNA 4DF4A 4OGCA 4UAWA 4R8UA 3RR8A 3NF7A 1B43A 5IIOA 3BQTA 5J2IA 2I9GA 2HNDA 3QNOA 4M41A 4JRQA 3DLGA 8ICYA 3OS1A 2ZTCA 3PVXA 9ICNA 1UT5A 2BQUA 3NDKA 3RMBA 3H8WA 4DQPA 1S1VA 1Q9XA 5J0YA 4DQIA 4CK3A 2RDIA 4KLHA 1J53A 3PX6A 2R8HA 1AROP 1KEJA 4XRHA 3PMLA 5T7BA 4FJIA 3TAPA 3CFRA 4FLUA 1DGSA 4CIGA 4H4MA 1D9DA 1YTUA 4Z6FA 3WNEA 3C21A 2BR0A 3G0ZA 1RDCA 4YFUA 1WLJA 3LK9A
chains in the Genus database with same CATH superfamily
1UWBB 2UUAK 4PZNA 3ATVA 2BMBA 3MOZA 5F3TA 3ZTSA 1SH0A 4A61A 3ELHA 3AO1A 3SPZA 4W4MA 3V7LA 1T05B 3J7ZT 2E5LF 1R0AB 2F7TA 5KFJA 3Q8KA 3DLEA 4PG8A 3AODA 2JZBA 2PSZA 2I6WA 3MEEB 4W5TA 1BWVA 4XTTA 5D8HB 4YOXA 4NPOA 3JTNA 5F8GA 4I6AA 4ISEA 4O4GB 3TSQA 3G6VA 3CCES 4JKFA 4RT3A 2NRZA 2W42A 3D45A 4OZ2A 3HVAA 4TQRA 5HN0A 1S5LU 2HK2A 9ICOA 4RW8B 4C1NI 1FDNA 2KYXA 2ERRA 1TKZB 3HVRA 1UCVA 1SV5B 5LJ5Y 4KYZA 3ASMA 1U8SA 4PL1A 3DRXA 4M3RA 4NY8A 2JEJA 4NLPA 2PZSA 4C1NK 4UQGA 4ZVUB 3BO4A 3X3UA 4LF5K 1XR7A 5BYRA 2VQEJ 3DCAA 4ELTA 1I6JA 4FOIA 5CHCB 2PT0A 4ETZA 5HVHA 4DEZA 5ETQA 3TVKA 1AYEA 2VD3A 1FXDA 3EGWB 4AXJA 2YX6A 2QWPA 1C4AA 1RXOB 2FB0A 2J5AA 3R2CJ 4M9HA 2KW4A 3MXIA 4HH0A 1HI0P 4KHNA 2HBKA 3U4LA 4GVLA 2UUAF 2ILYA 4KV8B 3MECB 2I1RA 3SFGA 2CQCA 2VJ5A 1NPRA 3PTWA 2YMMA 4ZVHA 4DSKA 2WF5A 1XMOJ 2HGMA 3D6TB 5L1JA 3NMRA 5K9FA 3LDAA 2VF3A 4DL6A 4E7IA 1QAYA 1XI1A 4GXJA 2COLA 1BWFO 2OJ3A 3ULEA 2KN7A 3I55S 5J0UA 4M9JA 2OPSB 3FSYA 3AU6A 3QERA 3KUGA 5HVFA 3L2RA 4KGVB 7ICPA 4UAVA 1NKBA 1J9AA 2ACYA 4CERA 3L7OA 4QZGA 2QFIA 2B6AA 1S0NA 4CBUA 4HI2A 2RKIA 2RRAA 1K9MO 2H3FA 3RW7A 3ENAA 4FYDA 3MN6A 4LH5A 4M1KA 4B3RK 4RUCA 3E51A 3CT9A 4WU3A 4E0DA 1RT7B 2PFUA 4LBIA 3QDKA 4WK3A 3KUHA 2E5GA 3C0BA 3CJKB 4LFBK 5KPZA 1PKUA 5AXKA 5EDWA 1RAFB 4X5VA 4HVJA 2IJFA 4EWTA 1F3FA 3RG6A 1YITS 2QB0B 1S97A 4F7VA 3RZAA 3JPSA 5F8NA 2DNPA 4YDDB 2ES6A 2EZXA 3CC2N 1IBMK 3N7PD 1FJ7A 3BKFA 3MDQA 3NH0A 2HWTA 4JKEA 4USTA 1GOCA 2K8BB 1HYSA 1IXKA 1B0XA 2IBOA 5F8IA 1U6FA 1RDWX 2PN6A 1YF5L 3VQBA 2FBTA 3D1HA 3ZFVA 7FD1A 3H46O 1HWUA 2YNHA 4QJVA 2FJBB 5EXWA 4YY3F 2UXBJ 3O9UA 3O9TA 2NUBA 3FBCA 4RL1A 3UN3A 1UAXA 3ENHA 3MMBB 1HPMA 4P75A 3HOTA 1Z1BA 3EICA 5CD4H 3ZO7A 2HIYA 2JWNA 4IH5A 1EETB 3I0SB 3ZZTA 9ICXA 1R89A 3VQPA 1TVRB 2IC3B 3FBEA 3RSEA 1J5OA 2RMLA 2MMYA 2GO7A 5D3GA 2GC8A 3CQYA 4OYMA 4EP5A 2MZSA 3VVUA 2V69A 5DM7L 2BPGA 1K1QA 3KZIU 3JXOA 1R8HA 4DR6K 3L2QA 4JI6J 4WYBA 1JRPA 3R3LA 5JMVA 5D4OA 4OJ5A 2P9NA 5K8NA 3HX0A 1D09B 5K14A 4K5SA 3GJRB 2ZVSA 4KH0B 2YPYA 1M1HA 4JI0F 2V50A 2DKXA 5ADXA 2VGNA 3AOBA 1ZD2P 2GFFA 3R7SB 3KKRA 5A6WA 4JKBA 3RMAA 4QIVA 1RK8A 2M0GB 2EPIA 3MR3A 2WZ1A 5AIBA 1UJ6A 3VF4A 8ICSA 1S7IA 2E9RX 3OJUA 1SI9A 2RNEA 2NREA 4CHPA 2K2PA 4FWKA 3T1YF 1A0OB 3D0PA 5ALSA 1V97A 1XERA 4Z6DA 1PILA 1ZQQA 3N79A 3J7YU 1SWWA 2AEMA 1XHXA 4PR6A 1KQSR 1WTFA 1Y10A 4ZK7M 4IQVA 4A46A 1UW9A 2KM8B 1A6LA 3NWRA 1NJIO 4DPWA 2UXCJ 4QU7A 2AEJA 1X4DA 4K8XA 2QJ3A 1YWXA 3CTRA 5BR9A 3GMGA 9ICIA 1F5AA 1VJ5A 1WG4A 1XSLA 7ICSA 4H0YB 4YXMA 3LDOA 2G08A 2H5XA 3HKZD 3A4TA 4LF9J 1TYQB 2LQ8A 3KLIB 1NU0A 1J2VA 3CUNA 3FFIA 3IWNC 2OWOA 4MTPA 2Q97A 1GOAA 4UAUA 4DR3K 3LW5C 2W9CA 2CXEA 1FXXA 5HVGA 3M9MB 5BXIA 3JTOA 5D6GA 3DI6B 4YVZA 2HHWA 4DR1J 2NYIA 2NXJA 1I1GA 2OEHA 1S72S 4OZ0A 3AAPA 4NEZA 4B9QA 2DNRA 4M7XA 3B9JA 3SBTA 3THTA 1Q81T 2IVMA 5LMUJ 2Q4TA 1XMBA 1E6VB 1X9MA 5E26A 2DFEA 3BM7A 4GO5X 1NUEA 1Y3JA 1U2CA 5L9XA 2MZTA 1X42A 2B9EA 5ETMA 2FGOA 1UVNA 2F8HA 2O8FA 2HHVA 2HG4A 4CECA 2O6KA 1U0HA 1XNQJ 3DXMA 4PZOA 1QUVA 1WDTA 1VDVA 1JIHA 4AHCA 2FY8A 1O5JA 2KHCA 2RIJA 4OHZA 5JICA 1XMQK 2BJEA 4J9NA 3CPWM 2YNGB 3UFCX 4EYHB 1RTZA 3K8VA 2C42A 1TK0A 2R4FA 3FE1A 5J2NB 4W5NA 3POTB 4WF9L 1LKYA 5KFOA 1ATNA 5E3QA 5ETPA 3WK8A 4R8UB 4CJ5A 1L7PA 4AE5A 3IHQB 2HNDB 1RWNB 2QSWA 1B70B 3IBCB 2ZOGA 3SQIA 1NJIT 4CRXA 2E5HA 4DUYF 2LMIA 2KRBA 1QJHA 4FLYA 1FA0A 5JVHQ 1F0MA 3PIOL 4AILC 5FPNA 2Z2ZA 4A8MP 4AQYJ 1WAFA 1Z05A 2XMVA 5HRPA 1ZQMA 1U1MA 3EZOA 2P9UA 4RQ1A 2X1AA 3HZEA 1SXLA 4A4JA 1S5ZA 3A0HU 5GADU 3OTDA 1WSRA 5GMEA 4D3GA 2P5OA 4P2MA 1UZHA 1P1LA 1CSJA 4X64J 2AYEA 2KTQA 3A5OC 3UNGC 2DHSA 2KFYA 2VQFF 3PHEA 4WE1B 1YJ9N 3B54A 2W43A 2XMKA 4C8KA 5CA7A 3M2VB 4EBDA 3CJ4A 2G0AA 5GAGU 2DNKA 1WCNA 2F8SA 3IG1B 3EUB2 2HQCA 3WKBA 3OFGA 2GH1A 1VSIA 4LIRA 4IFYB 3EEQA 4FK0A 8ICQA 4BROA 3ZT0A 4KLFA 2OANA 4Z37A 3RAQA 3FZMA 5CQGA 3LL3A 2K7KA 1I51B 3QT8A 4WFBQ 3KYLA 3KLVA 2IVNA 5ALYA 4K2XA 2QK9A 2WTFA 3A8JA 4FZMA 3PW4A 2GWSA 4LRCA 1TK8A 3DLBA 1QLNA 1C0GA 5AKXA 2QXLA 4ZLJA 5HK4A 3RR7A 3VA0A 4Z6EA 3T5LA 1ZAVA 1RAGB 5DG8A 4B9UA 2Y9TA 3LP0A 4IOBA 3J7AN 1CXUA 2E8PA 1B4SA 4Q0BB 4YD2A 1IJFB 1EXNA 3L9ZA 1TAMA 3KK1A 3A2FA 1J54A 1UKUA 5DB7A 2Y9HA 5DQGA 3DOLA 5ALOA 4HHHA 3EXCX 2EBEA 2YMQA 2VQEK 4L73A 3V9ZA 2HKEA 3MXHP 2DJWA 2W41A 3PSIA 5CH7B 1HA1A 2YKMB 3TAGA 3ADAC 3IBPA 1NGAA 3O3LA 3GG0A 2CWKA 3U9ZA 4LF8K 1L3VA 2A2DA 4IDHA 1WB9A 4DU4A 2WF7A 2QL5B 4CWBA 1Q16B 1NKCA 4GV3A 2OIHA 3RJMB 5KI6A 1VC0A 3SQ4A 2HI0A 3EVMA 3D6FB 1WSIA 2DNNA 4IRKA 3PG9A 1R6VA 4CJWA 1ZS6A 1RABB 2LP4A 3Q8UA 3VMFB 3KJFB 3T6BA 3C2LA 2ZH6A 1IG8A 2D8CA 2UUCF 3V6DB 4UF4A 2DNZA 4P0PB 1VRUB 2J7UA 4IG3A 1AXQA 1FE4A 5F8LA 1RHUB 1XMOK 1PK1B 4PAAA 3THYA 4PPDA 3QUCA 3D2WA 5KFFA 3GFZA 4J2DA 3DRSB 1FRXA 4FF1A 1AZSB 4JS4A 4DV1F 3ZNJ1 2IA0A 2BKNA 3V6JA 4TYBA 5KAIU 2G8KA 4OV1A 5KRTA 1Z6RA 4EBEA 4L6V3 1HBOA 2H1YA 3SAHA 3Q8MA 4ILLA 3FZLA 4MLEA 4I2GA 2RUGA 1S9GA 1VK0A 1RYSA 1LV5A 1FRIA 4ZPDA 3OVNA 3U1LA 4HTLA 3M1YA 4M3WA 8ICIA 3CCJS 2DGQA 3L2VA 4EMDA 2P9SA 1UT8A 2JWKA 3ICXA 1REGX 4JBCA 3K1ZA 2H51B 5DJBA 3JSRA 1MQ3A 1ZQKA 4LBPA 1NDCA 2DIUA 3L7PA 4GKKF 4F36A 3MAAA 3DEEA 2JFDA 4J37A 3UDEA 1P9YA 8ICMA 3NBPB 4B1XB 2RQ5A 2FBXA 1D5AA 3M2UA 3MTJA 2YWGA 3UI3A 1K1SA 2HVIA 2JLFA 2CJBA 3RJGA 4LVNP 4PGQA 1JL2A 5CD4A 2LA6A 3C15A 3W7BA 5JJBA 3IUCA 1Y88A 3QU4A 1XN9A 4DSIA 2BBEA 4JI1F 5AI9A 1PSDA 1NSPA 2MQPA 4IG0A 3UDLA 4CHYA 1NPPA 3CCQS 3K9KA 4RW9A 2PYJA 4OI6A 2HZAA 3ZX2A 4J9MA 4I2IA 2DISA 4CJRA 2MKIA 5AQFA 1TFYA 1X9SA 2DK2A 4QS8A 1H74A 1VLOA 2WHEA 4EZ6A 4W5RA 1MU2B 4YUDA 3ZSXA 4BRHA 2FJWA 2KJ9A 3V6KA 3L6QA 5HLFA 3ZEUB 4GO7X 9ICSA 3SMVA 4KAZA 4KLEA 2O3DA 1AFIA 1RQ0A 3ENQA 3HILA 3AARA 4KFBB 1I94F 1IUJA 4Z4HA 1EO1A 2FTRA 3HT3A 2LXUA 5J2EA 1GMUA 1LWCA 4G3IA 4JI0J 4E89A 4LRFA 1KS2A 2FMSA 1BD6A 2RILA 2Q1LA 4TY9A 1UHUA 1UCNA 1LB2B 2DPNA 2KJ8A 1ROFA 4FM1A 3Q86A 4FSVA 4WZMA 1ZJNA 4JI6K 2WBMA 4A8FA 4AH9A 3HL8A 1VR6A 2V67A 4CHOA 2KHVA 4CD1A 3NCRA 1T95A 2CN1A 4IJAA 3KHRA 4I7FA 3BF4A 2MZJA 3QE9Y 2HHTA 2HK3A 5J2BA 3T19A 5G5HA 3O1WA 1VJQA 5AI6A 4KHQA 3TW0A 2YH0A 9RUBA 4ZCMA 4RU2A 3GSIA 3SSQA 2OHDA 2G5HB 4KO0A 4PG7A 4US8A 1LAWA 3VQSA 2Y9UA 1N32F 3I4PA 1ZQGA 4FE3A 2MTLA 1HKBA 2B8PA 1NLKL 3M8QA 3CRXA 2FGCA 4D3HA 1JMSA 4Q45A 3C8YA 1RTIB 5HNKA 1NRKA 3HHLC 1N52B 3QWUA 2NNWA 1KWMA 3WK4A 1S6PA 4WIQA 1NM1A 3VTHA 2UXCK 1YTAA 4DTJA 4JI3F 5K20B 3L09A 1NJZA 3PO5A 5AKYA 1MMNA 4A8YA 3BYPA 1XR5A 1SC1B 1BQMB 4CFAA 5AI0A 3F9MA 4R5PB 1Q9YA 4F26A 3H6EA 4FJXA 3RW6A 3TZZA 5M2RA 2XZWA 3IA0A 3MDFA 2ZDOA 4K50A 3ISDA 2KG1A 4KHPK 4DKWA 1EX8A 2OPRB 1HNZK 3CC7S 4B9VA 9ICHA 4DFJA 4BLGA 1RHRB 2RDJA 3SQGB 3PACA 4MDAA 2C2NA 1RTDA 2Y0BB 4NCGB 2R7RA 3DJCA 3V4MA 1RGVA 1BPEA 1QE1B 4DCHA 4ES3A 4ZCLA 4PKHA 3UKUB 5KFRA 3AJ1A 4P4MA 3B82A 1IVZA 2IDEA 4E1MA 2WOMA 4RW6A 4H0XB 3BGOP 4NA3A 4TQSA 2HHHF 2KDOA 4MYTA 4DV4J 4CFDA 2EQYA 2PGCA 2YNIA 2CQ2A 2JR5A 1U2VB 5FD1A 4QS7A 1Z00B 4EENA 3M8RA 4PWDA 3ITHA 1X60A 1YX2A 1FXRA 2F2AB 3CXCR 4X62K 1KTQA 3SFUA 3S3MA 3CIZA 3HI9A 2RQMA 8ATCB 1WSGA 2A10A 4DUYJ 2R3VA 1P1TA 1X4EA 1BXNA 3H45C 2A3ZA 1RAEB 3AEVA 3LAKA 2ISOA 4LSNB 2GAHC 3QNNA 2RHQB 5I42A 2ZH4A 3EN9A 4CD3A 3QX7A 1NBEB 3MN5A 4B9MA 2EDUA 2MAXA 3Q8LA 1VBYA 1IM4A 1Q5YA 1J97A 3SDEA 3JSYA 3M4XA 2JGUA 3F53A 3PJWA 3SZ2A 5C2GA 5DBBA 2VWJA 3MR5A 4YB7A 2VV5A 1IKWA 1QQNA 1HIWA 1HMVA 2XY5A 1RTHA 2AIRB 4FO6A 1Q8KA 4ELVA 1S6UA 2A2CA 4N77A 4FS2A 2BANA 1HNZF 2NRTA 3M8WA 5J2FA 3R5AA 4H0PA 3B4MA 4FJGA 2CQ1A 2VQFJ 1BL3A 1YIJN 4FW2A 4Z2XA 1RBSA 3LDQA 4ZVQB 3MGJA 4RNFA 1KCFA 3H08A 3NGYA 2FUG9 4ZLPA 2DHHA 2W2PP 2OA8A 4DR7F 2VL1A 4WFNQ 3JSMA 4KMUA 3E01A 3Q7CA 3WX8A 1N34F 4I6MB 1IR1A 4X64K 1Q82O 1IIPA 2C3MA 5LY3A 1D9AA 1N36F 2KJVA 3K75D 5ALJA 5GTHU 2AJFE 2V34A 2Q31A 2PFQA 4ICLA 4FK2A 2ZUDA 2GQ2A 4NLZA 3AVHA 1QS4A 4C0ZA 3IR7B 4IQWA 1HHQA 2HQDA 5ALTA 4I2QB 5HJXA 4P6QA 2IOHA 4ED5A 5DDPC 7ICKA 1KKHA 2GNKA 5HO4A 4EHTA 1TUWA 3W9JA 2P9CA 3MCNA 3QJPA 2CNNB 2HMXA 4XH4A 2JH3A 3DOKA 4PHAA 1EKEA 3LTOA 5J2GA 3M8ZA 5B0FA 4W90B 1YRTA 4CTAA 1XQSC 3EZ5A 3DDIA 3LP1B 4P71A 4IO1A 3CCSS 4KB0A 2MB0B 2VFTA 1CC7A 4BGAA 4J2EA 2OPPB 2IOFA 4OI4A 3TKAA 2A1JB 3B0YA 3KJQB 3QQCD 4DTMA 4DU8A 3UPQA 4JYAJ 2FLPA 4JV1A 2LYAA 4NYZA 1REVB 5B08A 2RS8A 1IQTA 4P73A 2EZZA 3VEWA 8ICHA 4IBNA 2AJQA 3C14B 4DG1B 1TU0B 1ATSA 1JXLA 3MEDA 3OUYB 2I7PA 4J9SA 4OHYA 3EDRB 2A1BA 5FPDA 3JAMY 2UUCJ 3KKSA 1LK5A 1MROA 4PUOA 5J2AA 3CGIA 5AQLA 4DOBA 3ZTRA 4IS7A 1ZTWA 3KMSA 3Q8SB 1JMTA 2R7OA 4K4SA 7ICJA 7ICLA 3ZDEA 4XDCA 1KC8T 1TMMA 4LF7J 5GAEU 1BC6A 1AW0A 5B0EA 3CMAS 2PIIA 1KL9A 5A8RB 4DV0F 1FFUA 3I9ZA 3CCTA 4BBYA 2XICA 5IC6B 1J5EJ 3GV5B 3RH4A 1NHKL 2MKHA 1B0VA 1SH2A 4B9SA 1EWQA 4GY2B 2MJNA 4ZCIA 1ZXIA 2BH1A 2FF6A 3KWGA 1KBRA 1W25A 3WXMB 1KQSM 3CD6N 4IKFA 2HBMA 1A77A 1S9EB 3D66A 1LOUA 3W2WB 4C98A 3C7NA 3PX4A 2KKVA 1MMLA 2W1BA 3QUQA 1F5CA 1BHNA 4G1PA 1CJUB 1HI8A 3G4SS 2RRDA 1HQEA 2P1JA 4GKKJ 4X4SA 3N7SC 1W7AA 4CLYA 3D7EO 4NE9C 3C29A 3G71N 2W9MA 5C24B 2GHWA 1FO4A 1KTVA 4OZ3A 5DM6L 4DR2F 2D3O1 3ID8A 1JLEB 3R5JB 4YB5A 2BCSA 2NSCA 3N6LA 1GLBG 2C28A 4DN0A 1JJHA 4JI1J 1JWWA 4QZEA 7ICHA 4LC9B 2AJ1A 1YTYA 4CFCA 5I3PA 3V7JA 7ICUA 1FRKA 2OTJN 2FHJA 3P1GA 2MKKA 3F9KA 4U8YA 2Q1NA 3MM9A 2ETJA 3LPUA 2NRHA 1W2IA 4P74A 5KAKA 4KB1A 2IGIA 4O44A 1DOQA 2W25A 1JLGA 3HSTB 5IM0A 4J7CA 4NYOA 1FERA 1FDAA 2XEXA 5ETSA 3PKYA 5BR8K 3C1ZA 1FKOB 4DZDA 1Y5LB 4WCEQ 4Y2XA 4CNYA 1HNXF 4J5OA 9ICTA 1BLUA 3A5LC 5BN9A 4FZVA 2XHBA 2DCLA 5D0HA 2FJXA 5ETLA 1X4CA 1N8RO 1OY8A 2YQEA 3HJFA 3GR0A 3SI8A 2GUIA 2QL9B 1E4FT 5D0RA 1PZNA 2W2QP 1SUQA 2ZITA 4IFVB 3BGRA 2QO3A 2N3OA 2VBXA 3RJEA 1NB2A 4DTUA 1BNPA 5J0SA 3VEOA 1JLBB 4O23A 4HACA 2R7SA 2FDRA 1XQIA 1ULRA 3CCRN 3UR0A 3MABA 1VQ6N 4WFYA 3TADA 3M6KA 3EMTA 4FLXA 1LCUA 4BE0A 4DTNA 3H8SA 4KTWA 2BTFA 1FNXH 4ECWA 4UTGA 2ZE2A 4JB3A 3QATA 1ZXOA 3LQVA 4YDUC 2A1RA 4F5NA 3RFAA 4W92B 2VKRA 4AFFA 5CYMB 1N32J 2EBGA 2NRRA 3O44A 1CQNA 2IYIA 2ZJRL 3N6MA 4YN3B 4FO0A 5CR4A 4FKXA 2DR8A 5CCLA 2KH9A 2CJKA 1R8CA 1HD1A 3FMBA 3SCXA 4OX9J 1HNIA 3KK3B 3SQ1A 4IOAQ 5H9FJ 3W2VB 3DXBA 1EJ7L 4M3YA 3QEXA 4NXNF 1N61A 4HHJA 4NL5A 4I67A 3IG8A 4DV7K 3O4WA 2O8CA 1C0UA 2Y1IA 4KHYA 4R0JA 4KLMA 1F44A 2NCKL 4OZNA 4DUZF 3NGDA 3BP8A 5ALKA 1DLOB 4ZIVA 3TUPA 4HHTA 8ICVA 2AYGA 4UASA 2KSOB 1WKLA 3MGIA 3B4DA 4HH1A 4DSEA 1EQ0A 4K2JA 3MDCA 1KOHA 4C0BA 1DFDA 1KN6A 4KHSA 2QARA 3BY5A 1D1UA 3QIPA 2VICA 4O4RA 9ICGA 1QQ5A 3FEZA 4MIBA 4K0KF 1ZQVA 4X84A 1HHTP 2W8KA 4V1Ak 2AWZA 5ALFA 4LSZB 1M5PC 2C3YA 4BRFA 1W9HA 5C5JA 2C2KB 3TWHA 2XULA 1A5XA 5CZXA 4IC9A 5HROA 5KGWA 2VG6B 2PA8D 1DQ8A 8ICWA 1L3KA 2CQPA 2QG9B 3BSOA 2YB1A 3KDNA 1E4GT 1XNRF 2CZVC 2Y0SC 1GH8A 2GBZA 2HHHJ 3M1VA 4QWEA 1RCOB 5B66U 4DB3A 5HQMA 1M0SA 2AU0A 4PHDA 5FLXY 5IOLA 1T3NA 1NI3A 2KEYA 2HHQA 2VWKA 2W01A 3X1LB 4HLBA 1U1PA 1H1VA 5F2RA 3JPPA 3BR9A 3HFVA 4QIFA 1A0PA 2M7SA 5M1OA 4DPUA 1L7MA 1X2IA 4U8VA 3AQPA 4M3TA 3IRUA 4J9PA 2XNQA 3M9OB 2FIUA 2B43A 1UAWA 4TLRA 2DYAA 4OJGA 1IR2A 1GMVA 2LU1A 5L1LA 2BJ8A 4KLIA 4DV4K 2OELA 2Q79A 3F44A 1VLBA 3ZTOA 1C4CA 3PW2A 2J9DE 2BE7D 2ZH7A 5ADZA 3EYZA 3P31A 4NXZA 4F5QA 3DXKB 4A5AA 3W8PA 2F8EX 4FLVA 3SBMA 4KR0B 3PR5B 1SKWA 3PZPA 3WEEA 3RMDA 1SKRA 1DRZA 2W11A 1FRLA 4CEEA 1W2BR 2G8VA 3ZSRA 2KT3A 5DS7A 1IKYA 5B8HA 3IS9A 2MGZB 5DG9A 5KFMA 4C4WA 4JKDA 4NLQA 2C2DA 2KOBA 3OYFA 8ICCA 3LWLA 2RJZA 1JNZB 3GV7B 4JI4F 4HCBA 3THXA 4KN4A 2XO7A 2KVSA 4OYPA 3DAWA 4U67L 3DOMB 3HXMA 4ELUA 2K60A 4QJFB 1QDUB 5DBCA 1O13A 2CPHA 1WF1A 3NMAA 3AQOA 4HKQA 4Z4IA 2DO4A 1N34J 2UU9F 3BR8A 4I1TA 2R7VA 1JQGA 5AKKA 1N36J 5LJVA 2P9PB 3T1AA 4NLWA 1EHWA 4GLXA 3FCWA 4FP9A 2ZBIA 4ZPAA 4YS2A 1WYGA 2BZFA 2KMDA 1N4LA 1FWLA 1PYTA 3KLFA 3VQ6A 2FJAB 3C6TA 2B4PA 1EKRA 3EL2A 3U3GA 5DDYA 3IKMA 2ZUCA 4LJMA 3M8PA 2DRBA 3UCZP 3CJTA 3G96A 4UB8U 4XO0A 1CULB 2CNLB 1Y97A 4CZKA 4A8KA 4FF2A 4AM7A 5I9EB 1PK3A 2PA3A 4UOHA 1HQUA 5M1NA 4NLKA 2X1FA 3C6HA 1K8KB 1ZQXA 2VU5A 7ICRA 3TQEA 3MUTP 4OZ5A 3CSKA 2B8QA 3W3SA 1SC6A 2JDJA 4DPYA 1OH5A 3TZYA 5CXTA 3RUBL 1BA1A 3MM6A 3VAGA 3CJ7A 4X65F 3LAMA 3DLGB 2F4VF 2F8TA 3BSAA 4OHXA 2C1EB 4ZA1A 3Q23A 4FZLA 5ALGA 4MIWA 5FDLA 3MR7A 1YI2S 3OTCA 2ZJAA 3D2FA 1HARA 3ILOA 4I2AA 1KBUA 3I8DA 4PH5A 3UXPA 2PMZC 4QZIA 2JLEA 4C4TA 4LUBA 4LF6F 2KFZA 4JYAK 3MGVA 2W6LA 1ZQAA 3BV8A 2Y0SF 2DO0A 4OGCA 2YCHA 1NMEB 5J2IA 3H2VE 2XSJB 4CLWA 2OEKA 3CD0A 3MPUB 3QNOA 4DV0J 2ZTCA 3PHTA 5EHHA 2EFPA 2WVBA 5TISU 4HR2A 1VQLN 2RT3A 1S1VA 1SQKA 1ZD3A 2ZDPA 2ZWPA 3G82A 4DQIA 3MWPA 4ZVTB 3SCLE 1J53A 1HBUB 5A0YB 1AROP 1KEJA 3EE9A 2I0XA 5HJYA 3DDHA 2YKOA 2X1GA 4LF7K 1SVDA 4EGLA 4RX6A 3KNAA 3FGUA 1DGSA 4X4NA 4H4MA 2E8OA 1D9DA 2MZ1A 3C21A 4MKVA 5CRXA 3S7RA 2D74B 1WLJA 1M6YA 4USVA 3LK9A 1J5EK 3FRZA 2E1PA 3HVTB 4BQLA 2RPIA 1PYOB 4DR2J 3PXGa 7ICEA 2IVPA 5KT6A 2O4IA 2KVIA 4FYYB 3P45B 2A6AA 4RKUC 2E20A 4BVPA 3LF0A 2HWIA 4LFAF 2DRDA 5ETVA 1L3TA 3UQ0A 1NOYA 5IZHA 3V9WA 1YJNS 3A8KA 2BA9A 4LQ9A 3SV4A 4NLOA 2P9KA 1VC6A 2K4IA 5KL8B 1RISA 2QXFA 5T7LB 3WNGA 2FLNA 1F5SA 4OVLA 1RAHB 2ZBRA 2YB4A 2GCFA 4US9A 3CEDA 3I6PA 4JKAA 3M32B 3A3OB 3W63A 4DV6F 2RD5C 1JJCB 2ABYA 1BPDA 3KNGA 4F04B 3BQ7A 4OV6A 2ASPA 4DTPA 4CF9A 2UUBF 3FCHA 4J91A 1M1GA 2QT7A 3QSIA 3CJRA 4CQ1A 1ILYA 3AA4A 5AQJA 3TR8A 2DWQA 1MMDA 2DR7A 5KFAA 1I3OB 2MXYA 2CPIA 1S1TA 4LZGA 2A6MA 2GLEA 3WKEA 3TSPA 4AHSA 3VAKA 2PI5A 4JKGB 3RBZA 2PMWA 3O5TB 1TTHB 3QFUA 1NO8A 1WEZA 1ZBUA 3U6FA 1S76D 5JMNA 4PHTX 4CEOA 4RW8A 2JC0A 4BG8A 1U1NA 3R5BA 5J1EB 3HHEA 2AHOB 2P6TA 3OFHA 3BQ0A 4PZVA 3VESA 3OVSA 4H5VA 2EG1A 4C11B 3CXCM 4DFDA 2VG7A 3NVVA 4KLGA 4OZLA 3T5JA 3HSDA 2ZH8A 3OTOK 1TKDA 4B3SK 4BREA 4U95A 4FM2A 1S22A 2BM1A 4Y34A 1RDAA 2HNYA 3LH2S 3NVWA 2AEFA 1ZAWA 1VRTA 4CYUA 1YBAA 2DB1A 4KI6A 1UEUA 3CD5A 4KB7A 2VODA 1YVFA 4BRIA 1WI8A 2K4HA 2R8KA 5K5MA 1B9FA 3KHGA 4DFMA 2QI2A 3NAEA 3ZX3A 3C1YA 2DNOA 3UQ2A 4DU1A 1X0FA 4WKYA 3H59A 3NWGA 3ET6A 5BOLA 4Q7AA 1FKPA 3I1YA 2B4OA 2HEKA 2QLFB 2PMZF 3FVYA 3RBXA 1S59A 3CYMA 3FZHA 2G07A 3R6LB 4JI5F 3KVGA 4DR5J 3HZ6A 3OYEA 1QCKA 3UXNA 3CCWA 2XCPA 2KYZA 4NYFA 1R27B 2HBYB 2XWYA 2ZH3A 2P5VA 4XA5A 4CJKA 2BXJA 3KLEB 2Y0SD 3TU5A 2G1DA 5GAHP 3M2RA 4M95A 2E2QA 1WOOA 2DR9A 1X6IA 5E33A 2HWHA 4CJVA 2B4VA 1KXPA 2YKQA 4FWSA 3C46A 2OLWA 1RWVB 1RT3A 2RSQA 5AKHA 4OX9K 2LI6A 2HVDA 3IMQJ 3K89A 4A8WA 4K0KJ 5H9FK 4M3ZA 2ASDA 3KHYA 1N0VC 5SUHA 2OZSA 1MWQA 3QBCA 1SL1A 1MA7A 2W55A 4OCZA 1R8AA 2AYMA 2O67A 4RBVA 1BUPA 4DL4A 5BRDA 3D3CJ 4B3SF 2RRNA 5JVHL 2V8GA 2UXDK 4P4PA 3H5UA 2ZWHA 3IAYA 2IIHA 2WRMA 1TL4A 2AQ0A 2OXOA 5KFUA 2HNZB 3WXKA 4ITSA 2CH6A 3MM5A 1SQGA 3NCQA 5G5GA 2ROGA 2D3DA 1CJVA 4USWA 2VA2A 4J9RA 2E5SA 2A6OA 3Q8PB 4LFCF 1CZBA 5DQHA 4KN7A 2NRXA 2JH1A 4OZ1A 4UY8T 3HRGA 2I7NA 2HVHA 4WFXA 4PQAA 3N9UC 4B3MJ 3BH6B 3O6WA 3RJKA 2YQ3A 4WK1A 3CMEN 4R65A 3OT9A 4CGFA 2YWKA 3QESA 1FDBA 2HIQA 3PW5A 9ICAA 4B3OA 3CM5A 2AJ0A 1RE1B 1BOTO 2QKBA 3MWTA 4I2DA 1ZZNA 4YB1P 3GPAA 2G8FA 2J0XA 4E3SA 3EO3A 3MMBA 4CZGA 1RT4B 3KG4A 4E1NA 4OJPA 2QMUB 5G0RA 1ZBHA 2EANA 1SV0C 3LUYA 4NZ0A 3T1HK 4AXIA 2BJ7A 3NAHA 4MKBA 5ALPA 3RVCA 2VYPA 1VBZA 4Z4CA 1TR0A 4JV5F 1VBKA 3TUZC 2CRXA 4I2PB 4WFZA 4BG9A 2F76X 2AQ4A 5GTIU 2ROEA 5C2DA 1DURA 2XO6A 3AD8C 2A0FB 2BUNA 4Z4FA 3TVYA 1HBMA 2UU9J 4QOTA 8ICBA 3QLHB 4N76A 4PXDA 4W5OA 4H5TA 4LD0A 5KFGA 2D69A 1Q8IA 3RJJA 4F5OA 3R5GA 3VVTA 1HW9A 1LW2B 3S8SA 1HJOA 3VEVA 3PW7A 3GQCA 1DZ5A 3QAUA 3BYRA 4NM1A 3BKUA 4DTRA 3O8WA 1JXVA 1QHTA 4I68A 4NWBA 4F02A 4FBTA 2WONA 2V9WA 4M0AA 2XS2A 1YBTA 1QSLA 2VONA 4RQ0A 4X66J 1RB0A 3OSNA 1KONA 1ZD4A 1LVHA 1NGJA 3AM9A 2O8DB 1H2UX 2PMZD 2D6FC 2DXFA 3S1TA 2HRTA 4DCCA 1TMJA 1NSQA 3TANA 2QTWA 3VTIA 3WK7A 4UBCA 4K4HA 2J8AA 4M5IA 1WF0A 3BO3A 3JAMO 2X1BA 1FESA 1J27A 3ZT2A 2L9NA 5J8YA 1K73O 3PDNA 4JN4A 4B1UB 4J9QA 3SV3A 4Y2PA 4B17A 4QPTA 4H4OA 3Q89A 2YNFA 1PVRA 1QY7A 4CJFA 4NMXA 2H54B 3RJFA 1KP6A 2E1AA 2E1FA 4IRCA 5ALEA 2VPXB 3BS7A 3ZDDA 2YTUA 3SAFA 2P9LA 4I69A 2O01C 9ICRA 2DY9A 1ZAXA 1WWUA 4BR7A 5LL6d 1F9FA 3KLGB 1WORA 2QWNA 3HO1A 5DQIA 1UW4A 3R2DJ 5IIKA 2J0SD 4ID8A 4TNOA 1V5IB 2MLYA 1YZ7A 1C1CB 4TY8A 3CJ0A 4N8OA 5KFQA 1FRMA 4FF4A 4AF1A 1EP4B 1GQEA 3ZSQA 4KLOA 2FY1A 3CC4S 4PGYA 4GKJJ 1PJ5A 5DGAA 4UUWA 2IVFB 5IILA 4M9GA 1KQKA 2OEMA 3MUVP 1TL1B 4JI7F 2AH5A 2K7JA 2ZM6F 2I6XA 2ZD1A 5AM4A 5H1SV 1GXLA 4CLLA 3K5OA 1QVGR 1VLYA 4HUEA 4CM2A 2ZGYA 2D1KA 3CB4A 3VALA 1KVJA 1ZQCA 4A2BA 2I5HA 2RE2A 2E2NA 3AVBA 3VAHA 3GILA 4PG6A 3K5LA 1IV8A 1TFWA 2LBOA 4OJ6A 4ZPTR 1ZQJA 3DLJA 3WK9A 4HCCA 3CJQA 2LQJA 2M2BA 3NVKA 1CI4A 2NZTA 4RW4B 3QJLA 2MZQA 3LP2B 2QC3A 3TRGA 1B4FA 3MM8A 1M90O 2BRKA 2F9TA 2JVRA 4ZHRA 4DX8H 5E5NA 3TJ8A 2GGPA 4DN9A 5DZ6A 5SWMA 2V4JA 4JOUA 2MDAA 1CBKA 3VAIA 1NHVA 3ALYA 2P9IB 2Q43A 4BR0A 2P5GA 3DLEB 4OJHA 2BDUA 2MKYA 2JZBB 2YPZA 2XM3A 3QRQA 3W60A 2CJXB 1NK4A 1VQ7N 3BBCA 1L8LA 3HP6A 2YX7A 1GLJO 1S1XA 3E66A 1QH9A 3KKAC 4DV6J 2VA8A 1KVKA 5AM5A 3DLLQ 2FJVA 4OPHA 4M5GA 1U2RA 5CAAA 4NWIA 3FBFA 4MO4A 2HOIA 4NV0A 4PWUA 2V4QA 3H0MB 5EE1A 3W9HA 2MU2A 2KZ3A 3D1QA 1V3RA 4FLWA 1IKVB 1Q7LB 1FNMA 1SZ2A 4Y2TA 1YK9A 4UUXA 3PYFA 1WSVA 2FHOB 2YJEA 2QA4N 3M2VA 4NLXA 3IG1A 3SCIE 1SXEA 5DB9A 1T6DA 4IFYA 4M5DB 3QO9A 4PL8A 2P2CB 1DTQA 1OWXA 1VQ9N 1NOZA 3H1QA 3TABA 4CDGA 4FS1A 1X9XA 2XMJA 4WQ5A 4DTOA 4LSLA 2KJ5A 2N1RA 4AP9A 4DPXA 7ICGA 1QQOA 4FXDA 2MHNA 5IWAF 5GMKa 3R8EA 3GFKB 5AJ3J 4OHWA 1SJ4P 3D67A 3QEAZ 4JI2K 4FZNA 1MC8A 1S0VA 5J2MA 2F96A 4DSJA 1MWKA 1S3XA 2W7AA 3FBBA 1VSFA 4YEAA 4GVBA 3VOVA 4O3NA 2E2OA 2DVIA 1NNDA 2GEMA 1VQON 2GVZA 1W2BM 2LDYA 5JVGQ 6FD1A 1WKKA 1X4HA 4LT6A 1S77D 5I3QA 3ULEB 4RQ7A 1YT3A 4Y1CA 1NGDA 4Y2AA 3CERA 7ICMA 4O0JA 5DDOC 2IDOA 2QRRA 1V3SA 1YRXA 1OW5A 3DHXA 1HNWF 3RJIA 1ZQNA 2ZUGA 2E3TA 1WHYA 5U47A 4E8UA 3QRPA 4LBHA 3H1VX 2G2OA 2BDPA 3SPYA 2AZ1A 3LYSA 5EOZA 2F9WA 2RKIB 4DR4K 4F4YA 4RU9A 2CPYA 3LGHA 1YZ6A 3WKDA 2DGWA 2HGNA 3BKTA 4CT8A 4DQQA 1HR0F 2Z1HA 3VQTA 4DR5K 3BGLA 2JRSA 4DL5A 5HATA 2KXFA 3WQUA 4QZVB 3UB5A 5FLXO 4M3XA 4F0MA 2VOPA 4OX7A 4UB4A 1E6YA 5DB6A 3C95A 1EXQA 1AZSA 3ISCA 3IGNA 3H5YA 3DRRA 1VCTA 2MQ8A 3D1OA 2V51B 4CO4A 4NLBA 4N47A 5IT9U 1HYSB 3G6EN 4RPZA 4PKDB 3MURP 1WCLA 1VQPN 1ELOA 4LFCJ 5KPRA 3K17A 4BRCA 4CNZA 8ICKA 2YNHB 4CLKA 3TX8A 4CBWA 2IBKA 4OYBA 2KICA 3VN5A 3UKRA 2RQKA 8ICUA 5DO2A 2K1RA 3W0LA 1TZ0A 5HP1A 2XMTA 3ZETA 2GIRA 4PL2A 1Q0NA 4K4GA 2HAIA 4I56A 2D0BA 2OP5A 4KLQA 4WFNL 1IG9A 3TJ9A 5BPMA 1UQVA 4CHZA 3EJMA 5AXMA 2PD1A 4I2JA 2QKQA 2D1CA 1KHWA 4KGKA 3E58A 3AO4A 3ILIA 4OYAA 3AJ2A 3RSEB 1HWJA 3U1NA 1J5OB 1IBKF 2KFNA 4ILMA 2AJ2A 3TX0A 1U4BA 4YP3A 4NRUA 5D3GB 4FCYA 3CJSA 4I4BA 4R0EA 2CH5A 1BQXA 3C16A 4DV5F 4MHVA 5D0GA 1OVYA 3UW1A 1ZBIA 2KO1A 1Q7YO 3KTQA 2RAQA 3VQ7A 4KX3A 2P9NB 1RWKB 1ZQUA 1RBTA 4ZPBA 5I3UA 2I5JA 2BACA 4E7LA 4MH8A 2MYFA 4NLYA 3NEKA 2WAQC 3J81j 3L7UA 7FDRA 3FFKB 3JPRA 3M6VA 4ZVGA 4RWWA 3MM7A 3JPTA 3OR2A 3BSCA 4GW6A 4O0NA 3EGZA 4YOVA 4C7YA 2OSQA 4YCXA 1G2EA 2HBJA 4KE5A 1UJ4A 3MD1A 2AT1B 1SB3C 3J7A1 2PE8A 3H25A 3KD1E 2E5JA 3G8QA 1YJRA 2YX1A 2XG8A 4MFAA 4RT2A 5J2QB 1SJ1A 2D7SA 4JMUA 2WVFA 2LA4A 4WZQA 1AQ6A 2HVEA 1H3DA 1HYZA 2B51A 1X0PA 3BGUA 1RT5A 2E7XA 2JEIA 4NYNA 1N33K 1T94A 2LM4A 1Z19A 3MHYA 1DT9A 3ZI4A 1HJPA 3JYTB 4JWMA 3UMCA 5AM3A 3AVGA 4QR1A 4N5SA 5KQ8A 1IH7A 2WBRA 2LQ5A 3BB5A 2C2MB 4OLAA 4DX5A 4Q43A 2R42A 2R2SA 2Z1GA 2AYBA 3ALRA 3FFIB 4DF8A 3E9LA 2HHSA 2VPWB 3BH7B 1LWXA 1FJGJ 2XLIA 4X66K 2W9CB 4C4SA 2RQCA 3SBGA 4RNMA 2OYQA 3ETRA 4ECXA 1G99A 3THWA 3NNCA 3FC9A 4Y3CA 2MQLA 4ZVOB 1DRGA 2WSFC 2IJRA 1IM6A 4DL7A 2AZ3A 5DDQC 2EH9A 2H3GX 2BRLA 4AHTA 1K5OA 1YJWN 5CE3A 2F8MA 3VQ8A 1N5SA 3HPHA 2IIRA 1F9EB 3A0BU 2Q3SA 4JK7A 2RN2A 1G3OA 4O55A 4UOFA 5D4PA 3MI7X 1H2TZ 1Q7YT 2NYHA 1Z1VA 1R31A 2JSXA 1EZZB 3T9NA 3ISZA 4BE2A 4M5NA 2IAJB 1FWPA 3VQ9A 5B7WA 2O8FB 2HAFA 4L75A 3MMAA 3FMWA 4PY5A 1FX4A 4ZMMA 1QM9A 3K7RA 2VZ9A 1GEHA 3DXMB 1ZQLA 1VYAA 9ICVA 3GFHA 3IGVA 3C19A 4CJ3A 1Z4NA 1KVBA 1X4GA 3B6PA 1JX4A 2OPQB 1WSEA 2ZM6J 8ICLA 4I2FA 1ASUA 5BYQA 2EFGA 3HJEA 2P6UA 1B0PA 2LEPA 2ZJQQ 2YXLA 2QWRA 5ADXH 4ZS6A 5ETOA 3HHKA 4ECYA 5AQNA 3MD3A 2W6KA 1LKYB 4JKCA 3GL1A 5J0OA 5KRSA 4DTXA 4MDBA 1TUVA 4O3MA 3DRPA 2Q0ZX 4OYOA 2IHNA 4U7UD 1VQ5N 2KXNB 4WCEL 3QZ8A 4G65A 4BWMA 3K58A 1B0TA 3EGVA 2DGSA 2DTJA 5D4LA 2EHGA 4UB2A 3CQ8A 4J9VA 5AQQA 3K5MA 4O5FA 2P9UB 1VC5A 4XAKA 1TV9A 4Q2LA 2LVWA 4K7QA 3LGMA 4FDFA 2UUTA 2RHKA 4ALZA 1N6QA 4PHPA 3OW2R 3S6JA 1GAOA 2YKNA 1WUDA 3ZSWA 5EWGA 3NE6A 2WAQF 4EU0A 1XSPA 2XLKA 3GFYA 4KH1B 2DRAA 1NAQA 1N5VA 4IOCQ 3VQEA 3N01A 4L3QA 5JTIA 3TO8A 1BIUA 4QYZJ 4GXKA 3PYGA 5HANA 1G4CA 5EWFA 3MEKA 3M9NB 4RCHA 1NSAA 5BREA 1FCAA 4FYWB 1RBRA 4E7JA 3T3FA 1YDLA 3PSPA 2B5JA 2V2VA 4PXEA 2VC0A 4TU9A 2BEFA 4O8UA 1OMSA 2WBNA 3RF9A 3HKZC 1CPZA 3KZBA 2AMCB 1ZYQA 1UJ5A 5LT5A 1OS5A 3VERA 2VOOA 3RB0A 2NLWA 3CO0P 4Y2MA 1APSA 1VAZA 4YHHJ 4M6WB 2X74A 4ED3A 2ZOMA 4BRNA 3WKCA 2JZ5A 3LP0B 4AHUA 2WFBA 5LL6Z 4DV2F 7ICFA 1IJJA 4YNQA 1U26A 1UTAA 3KK1B 4IOAL 3RMCA 2SXLA 5H1SQ 4DV3K 5F9LA 4CF1A 4FWOA 4O3SA 1N5QA 2H5JB 3IFRA 5AK4A 1KD1O 3BZCA 4B3TF 3VCDA 5IWAJ 4OO1J 1T9XA 1NNLA 1WC4A 5KT7A 2K3IA 2OFHX 1T03A 4DL0C 3OTEA 2IOFK 2K8GA 4DQSA 1GXUA 3SQOP 2FVSA 5LM7E 1OYDA 4LF4F 1XC9A 1VQNS 1K47A 4DL2A 5CCMA 4YG2A 1NBWA 1YSJA 5HAOA 4PQUA 2HQFA 1KR4A 4F92B 3D2SA 1FFGB 5LMNF 1HNWJ 5AJ3K 1T3OA 2V2ZA 1O6XA 8AT1B 2AD9A 2BCRA 3G8TA 3H3NO 3IO1A 2KP7A 1N54B 2VJ4A 4PYDA 5F8MA 3OUYA 4WP8A 5CWRA 3VAFA 3QBWA 3I56N 2JRZA 2J76E 1KDHA 2CGLA 4A2AA 1LQ9A 4QR0A 1MA9B 1UPMB 2IHR1 2BVZA 3DYAB 2HFZA 1M5KC 4C9DA 2O66A 2BYCA 3SJHA 3TZWA 3N5FA 1WELA 2ZZMA 2KKHA 3IG5A 1S9GB 2F1HA 2G9OA 1NK5A 1LNQA 2W9AA 2CWXA 2GV1A 4ZPWR 2HLTA 1NOMA 3OYLA 1TL3A 3GYNA 2P9SB 4JI8K 3IAS9 4NX9A 4FJMA 1H0HB 2KT5A 3KMQA 3GJQB 5A8RA 1LOTB 2GV9A 3OQ2A 2ZXHA 1B99A 3L0QA 4YORA 3BQ1A 3MAAB 4BDYA 3BUZB 5M1KA 4GMJB 4IYQA 1TAQA 3O9QA 4U7BA 3M2UB 4PKIA 4ZPVR 1OUQA 2PFDA 2DH7A 4XPCA 2DBYA 2Z1IA 4NXMF 3HP9A 4JS5A 3C15B 1QVFR 3JB9k 1Y4ZB 4P72A 3O8MA 3BPDA 1IBLJ 1F1BB 1KVIA 4RQNA 4UB5A 2ITGA 3G86A 2WAQD 3DNCA 2H3VA 2YWEA 4F2SA 2MA1A 2GJ2A 4RW9B 1GLDG 5ALIA 2BZ2A 1NGBA 3IMXA 4PWWA 3RH5A 3CCMS 4CZIA 3F2BA 2IFXA 4ZTFA 3U02A 8ICTA 2QWMA 4TUQA 3TSUA 5DETA 4F4WA 1UFWA 2PC6A 1T11A 2HQ3A 2JX2A 4DOZA 2BW2A 3HKZF 4MJKA 2V8HA 1VQ8S 5HLFB 4OLOA 1HBNA 1OO0B 3QSYB 3IC1A 2GZOA 4HI1A 4WF9Q 1HNVA 3SENA 5KFDA 2LDIA 3NS5A 3AA3A 4IKAA 4W98A 4ECQA 3VETA 2WC9A 1LWCB 2DR6A 2OI2A 2F7VA 3ENBA 4Z7CA 3AT1B 3LPTA 4JI8F 3UD5A 1FKOA 2DNMA 1D3WA 2P9EA 4LF5F 3OS2A 2QTDA 3PV8A 1U25A 4CO3A 5RUBA 2ZFHA 5AR0A 1OSDA 2DD8S 1PVPA 1BQNA 4KKOA 4MEYA 3JQMA 2Y3YA 4BDPA 4F2RA 2PMHA 4QAGA 2WMMA 2FHMA 4I2EA 1QVGM 4QPXA 2EEYA 2ZHBA 3CDAA 2VBZA 2ISPA 2HF3A 7ICVA 1ZOTA 5IIIA 1F2HA 2B0CA 2UYTA 2JHEA 3QEPA 4I7FB 2YHYA 3FC4A 2ZG6A 3E0FA 4M63C 5AE1A 1TELA 3OBIA 4IFVA 3QEIA 2QA1A 9ICQA 2XBPA 2HFUA 3P6YC 5AQKA 5HL7L 1TL7A 4P7VA 4C4RA 1RT2A 5B0CA 4BRDA 8ICOA 1YVNA 4KO0B 4KSEB 2EFNA 2RVJA 1FTCA 5J29A 3NMUA 1U6BA 3M8QB 3MMCA 3CCVS 4BRKA 4KX5A 1IR0A 2ZUBA 2FLLA 3DHWC 1S79A 2JL9A 3MMJA 3CCUS 4LREA 3OYBA 1N5YA 3J81U 5AK3A 1RBLA 5FJ4A 3TWZA 1WOQA 1S6PB 1TUYA 2Z56B 3L4QA 2RLTA 2L08A 3AQEA 2R8JA 2WF8A 3V72A 3AHPA 3WXJA 4GIBA 4M9LA 4BVOA 4JKHA 1EIYB 5ALRA 1VQKS 5AQZA 9ICPA 4URQU 1PJ7A 3CMQA 1JLAA 5AE2A 1Q79A 1DGKN 2HS0A 4M5LA 4B3RF 4WTOB 3HI0A 1A76A 3DGPA 2HMIA 4B9TA 4KMOB 1FJGK 4MFCA 2LMRA 1ZBLA 2F5GA 3AFGA 3R27A 4P4OA 1Y0HA 4LFBF 2ZZNA 4DUTA 5KG0A 2OMOA 2B9YA 2GMHA 1K9MT 1UOCA 1JLCB 4ZLNA 4O5KA 1RTDB 4N56A 1YJUA 2LECA 3J7AP 2VWBA 3MR2A 1IBMF 3SJJA 4KH5A 1BNOA 3CF5Q 2VPZB 2MLXA 2WOMB 1YG0A 4RW6B 1S0MA 1NGIA 5ITHA 2NV3A 3S9HA 5AQUA 4KBOA 3P5BP 2B4UA 3IBWA 2YNIB 2JNJA 1VQ4S 3WQPA 3AVMA 4DPTA 2XY6A 4EO6A 5F1XA 1WNSA 1ZM2A 3IN5A 3EXYA 4PWDB 3ITHB 3HSCA 1BPYA 3CCZA 3LM2A 4ECUA 4IFEA 4CGGA 4LVSA 4LY7A 4AL7A 1RGIA 4OI1A 1RDFA 3GU0A 1Y3KA 2L3MA 2CFXA 4BHQA 1X31C 5KTQA 1VFJA 3T7ZA 3HSZA 3PNIA 3MC1A 2OMLA 4P9SA 1RAIB 2KHQA 2WFAA 2RB7A 4C6AA 1V4TA 4WQ4C 2ZVIA 5I42B 5DDRC 1KW4A 2F44A 1MSWD 1COKA 2I9SA 1RTJA 1WN7A 3V1RA 4MFBA 3QIDA 4I0WA 2ODGA 1WBDA 1HPZA 1T7PA 1SJRA 3KXDA 2L9WA 2ADBA 5KG5A 2HB5A 1O08A 1IKWB 4DR6F 4RQ8A 5J2DA 1HMVB 2QW9A 3RWUA 1RTHB 4CF3A 2HSEB 1Q86O 4OPKA 1Q3UA 2BANB 3AVAA 4QIGA 1T4GA 3HHLA 2G13A 1LFWA 9ICJA 3CCEN 3FZKA 3NVYA 2ASLA 4Y28C 1VS3A 3CJ1A 4IZ9A 4DPOA 1H38A 1W0HA 3DXKA 3H8MA 3A8EA 1GNKA 2C2RA 4Y0WA 4ID5A 1D0EA 1T8EA 1UPHA 2WF9A 4QYRA 3HHDA 3E01B 2KVQE 1RXWA 7ICIA 3PIPQ 3MCMA 1UWAA 3EKUA 2GJFA 4JAXA 2CYYA 4M5HA 2CVIA 2MUTA 1UZDA 4KBIA 2Q3PA 2OHFA 1VK3A 2HHXA 4LH4A 4OJLA 4ED4A 4H0VB 3N4WA 1RPLA 1T9UA 4OKEA 1NSKL 4QYZK 2UVUA 4ID1A 4FJKA 2EZYA 1R0CB 2XMWA 3VF6A 2MHEA 3D2EA 1WAJA 3NGIA 4L8RB 1HKGA 2P51A 1PYSB 1D4XA 5IQQA 2CKWA 2A1AA 1VQYA 1BI4A 3W61A 3A8YA 2J9CA 2QA2A 4OI3A 1ZETA 1XEZA 3NXZA 5J0WA 2ZH1A 3O9SA 3OYJA 2HRYA 4Z0UA 5F8JA 4G1QA 5KFCA 1DXSA 1H6KX 9ICWA 3BS9A 3DOKB 4QWAA 1RFQA 3U8XA 2NZCA 3QGGA 3UO0A 4CTAB 5BRHA 1VOMA 4I28A 4NCAA 2AKWB 5ALHA 3PFOA 1X5SA 4DR3F 4I2BA 3CETA 1G7CB 4M8LA 5KFLA 2AGPA 2V8PA 1ZQSA 4FKYA 2BPFA 3H2LA 4Z7YA 2Q2RA 5CZ1A 1M5OC 4NZ6A 1VHFA 2GO8A 3I55N 4MKAA 2HOQA 4BWJA 5KFWA 4ED1A 4KRFA 1ZQEA 2XSFA 2FQQB 4USHA 2ZBQA 5LMNJ 5A8KA 3C5FA 2DXDA 1MROB 2E5LJ 1Q86T 4PUOB 4UAWA 1WC0A 3HT0A 1OH7A 4IXCA 5IIOA 1HKCA 4IEEA 2NQPA 3DLGA 1IJEB 8ICYA 3OTBA 3OS1A 1QQ7A 2GO9A 3PVXA 5E7OB 9ICNA 2BQUA 3WUHA 3RMBA 3GIRA 3H8WA 1AB8A 4ZIWA 1Q9XA 3QB0A 2QEXS 5EY4A 2RDIA 2IM0A 3UD3P 2R8HA 3VWSA 3PMLA 1X5OA 1EARA 1XMQF 2VBWA 5GAHU 4FJIA 1GTHA 3PRDA 4DCOB 1YITN 3CFRA 3QRRA 1KAXA 2CPJA 3W3DA 4CIGA 4KY3A 1FX2A 3GJTB 3G0ZA 1RDCA 2RP5A 1NGHA 3FAHA 2U1AA 3Q8YA 3C7NB 4FJ8A 4TSXA 5AZJB 4C3LA 1HQEB 3C2MA 3SIPB 4IQMA 4EEYA 1QQ6A 4FNHA 3CCLS 2B56A 4Y2VA 1CJTA 1M5VC 5AQHA 4ETXA 1K8AO 1Y7PA 3QFHA 2QN6B 3C6UA 4M5JA 2F9JA 2OM6A 1RWMB 3KK7A 4HUFA 4ER8A 2UUAJ 4F71A 1WDDA 2M4MA 4A8QA 1DQAA 2R7QA 4H54A 2JLGA 3THVA 5AKJA 2XLJA 3TI0A 2M9NA 2CDRB 2HHPA 3TOQA 4IWVA 3M30A 3OTQA 2W40A 5ALDA 2NO5A 2GELA 2DGZA 1KLMA 3HVTA 1ZQPA 4ZOSA 3MM9B 3FM9A 3NASA 3P4UB 4CEDA 4UBBA 3LGNA 2RH3A 3N0VA 2MZRA 1Y64A 4F91B 1JLGB 1S5JA 4NMLA 5IM0B 1ZBTA 3V6HA 2PFPA 2KVCA 2RU3A 4M2YA 1IBLK 3R3TA 4K41A 4KLDA 4BC9A 1UA1A 2FF3B 4F3TA 3CD7A 5IS2A 2D3ZA 1YUWA 4CEBA 1EQMA 2NPIA 2WVDA 2YY3A 1U02A 4FL9A 3G10A 2NRVA 5J2PA 3RB4A 1JXEA 3L8BA 4MLHA 3EGNA 3M32A 1NB7A 5AIAA 2FLOA 1TL5A 3HZGA 3J7YI 3HPGA 4O3OA 1SUQB 3P96A 3QGPA 3WU2U 4B1WB 4BRQA 3BGRB 4OYZA 1CUKA 1EAYC 1YJTA 3I5BA 3C2KA 2QM1A 2V2KA 3GCXP 2DFLA 1U47A 3N4QA 1DTTB 4HACB 3QUTA 4DSFA 3O0FA 4KLSA 2NSBA 3ULHA 3KJVA 3VCBA 3OHAA 3TA2A 3C94A 5ALLA 1VSHA 3TEHB 3BS5A 5IIJA 2VQEF 1Q18A 3QT6A 4I64A 2VDIA 2MKJA 2X51A 3HKWA 2DKOB 3TJAA 2HSTA 4JK8A 5J1EA 4CW7B 3FSIA 2XCAA 4PPZA 4FWQA 4BGBA 3KK2B 2WSEC 3QU9A 1K8AT 1WOPA 4LF8F 2B6GA 3TUIC 5DMRA 2E1MC 3VEZA 3V1QA 4OFZA 3OW2M 2J7KA 3FEYB 4YY3J 1KRPA 4DFKA 4BR5A 3NF9A 2E4LA 3Q2TC 1RAOA 1HNIB 2KB2A 2DEIA 2E8AA 3K4GA 3AO2A 5C42A 3LA0A 4MF2A 2OD6A 3AA5X 3AD9C 2A3JA 2LKYA 2C2ZB 2IRXA 1NDKA 1VI7A 1VQSA 2VUGA 1XMOF 4JHDA 3MCSA 2O8CB 1C0UB 3RRGA 3D6JA 3NGSA 1RCHA 2CQGA 3CP8A 3RAXA 1S72N 3HFKA 2M8HA 3O1BA 4ILHA 1C2PA 3NTUA 3QETA 2UXBK 2DNYA 5D0EA 1CJKA 3BDPA 1VSLA 5KFEA 4K4WA 1SB6A 1XO1A 3MX2A 4QIWD 4AM6A 2QARB 4JV0A 3M7VA 2KG0A 1U9LA 3QIPB 2ZIUA 4DMZA 4V19S 3F5EA 4X2BA 5EGYA 2E2PA 3CVKA 5CZ2A 3AA8A 2W2OP 4LFBJ 2EAMA 2ZWOA 4BUGA 1ICEB 2XIDA 3KDOA 2BJ9A 2KIVA 1HLUA 4EAHD 3IDHA 7ICNA 1ZQZA 2IM1A 1C1BA 1N2XA 2DT9A 4LRAA 2WSCC 5HROB 1CLQA 3AY9A 3OXLA 4NLUA 5L39A 3M5RA 1P8GA 2M70A 2PY5A 3M1VB 1VDHA 1WNEA 3R7NB 2L41A 1Q8LA 1RQLA 4G6VB 3W1YC 3EY1A 4R25A 4XUSA 1ZPWX 4Z4EA 4ZN1A 3T1YJ 1RDDA 3JAMU 1A7GE 1AUSL 4LF2A 5K8OA 4ED0A 2C3UA 2RQ4A 3M6UA 2E9TA 3OYAA 4RZRA 3V9UA 2HNZA 5GADI 3A3NB 2AX1A 4A8XA 5IT4A 5AM0A 5AQSA 2LYVA 3DLLL 4FLZA 2POKA 3ZDCA 1BVSA 1S10A 2QA4G 4CBXA 3KWIA 1HJRA 1NZ8A 1TV6A <