4DQQA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 204
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqqA01
3KKRA 3PMNA 3QIPA 3KLHA 3PW7A 5J0SA 5KG6A 3V72A 4GC6A 2ZUCA 2X6SA 3E01A 4RZRA 3LANA 3WNGA 3BQ1A 4DTMA 4UBCA 2VWKA 3FYHA 1MQ3A 3I0RA 4ZTJA 4HVJA 4YCXA 1ZQYA 4KHSA 1VSJA 2A1SA 5IINA 2HVHA 2C2DA 5KI6A 2KN7A 3KK1A 5BPCA 2D0AA 1KTQA 4DFMA 1NK6A 4KLIA 4EP5A 3NE6A 4DU4A 3QERA 2ASLA 4TUQA 2VG6A 4M6WB 3RBDA 1QS4A 4ED3A 4XIUA 3FFIA 1BPDA 2BCUA 9ICIA 2ZJ5A 1Z3EB 2G8FA 4JS5A 4HTUA 1RYSA 2RF2A 2F1HA 4RPZA 2VWJA 4Q43A 2NRTA 1HYZA 1IM4A 3P1GA 5IIMA 5C24A 5KFMA 5KFGA 2W9BB 1HUOA 4NM1A 4CGDA 5KT6A 3ZT2A 1S1XA 1EXQA 3ISNC 1C0MA 4O5BA 4KLMA 1ZQFA 3NFAA 3TR8A 1YTAA 4CJFA 3AO4A 3RR8A 3NGYA 3OYAA 5L1IA 2BKEA 3VQQA 5J0RA 5KFCA 4DF4A 4FM2A 3PO5A 4KLEA 1RBVA 2BANA 5KFNA 4AHUA 1KDHA 3MFIA 4FJ9A 4J9OA 3HPGA 4EBDA 3QEXA 3Q8RB 3ZSQA 1A5VA 3C1ZA 3SQ1A 1JLCA 9ICCA 8ICRA 2RDJA 3OYNA 1T3NA 1EKEA 1ZBFA 3QINA 3EY1A 3K5LA 3M9MB 2BQ3A 2XRIA 4KI4A 1BI4B 4CHPA 4J9RA 3AO5A 4XRHA 3SNNA 4DQIA 4KITB 2D0CA 3NAEA 5J2FA 2W8KA 4B9TA 5DB9A 2P1JA 4GXKA 1SKRA 3H40A 3MFHA 8ICKA 3NF9A 4CEZA 4PQUA 3IRXA 1K6YA 2Q0ZX 5HRSA 4BDYA 1Z00B 3HVRA 1C0TA 3QE9Y 4W5QA 1S1WA 3HK2A 4RQ1A 1S0NA 4KLTA 3DLGA 4Y1DA 4O3NA 4BDZA 3FDSA 2HNZA 4Z6DA 4J9LA 2UVVA 4GW6A 3K5MA 4DSLA 3ZSOA 1TKXA 1TVAA 2F1JA 1VSEA 3AVIA 2R8KA 3CFOA 1IH7A 5DB8A 5KFIA 3AVBA 3RB4A 1N56A 5CWRA 3BQTA 4B9SA 4ID5A 5FROA 1LAVA 4KHNA 3IAYA 4NYNA 5FDLA 8ICNA 3KHHA 4Z4GA 5D4BA 4Q8FA 1ZJNA 1NK4A 5DKWA 2IGIA 4FYDA 3SJJA 3HX0A 4CJVA 1S0VA 1HUZA 4ED7A 4C8OA 1YT3A 3MAQA 3OJUA 3L2UA 4QWAA 4JRQA 4F3TA 4KN7A 1SKWA 3K59A 3ZDEA 3N4MB 1UT5A 3SUOA 4FW2A 4O3RA 5DGBA 3S3OA 3OSNA 1QE1A 4I27A 3AO1A 3C95A 5T7BA 1VSKA 4CEFA 4ZHRA 4QZBA 4IRDA 1Z26A 3L3VA 7ICRA 4CFAA 3L2WA 4J2BA 3TWHA 1HNVA 5EWFA 2JGUA 2R8GA 3IS9A 3L2VA 3VQEA 3CM5A 5KFKA 2PY5A 4M9JA 3OYGA 3ITHA 2YNHA 8ICEA 9ICFA 3H8JA 5HHIA 3HYFA 4YMNA 3M8PA 1DTQA 1BPYA 2ZTEA 5KFTA 2OPSA 4IRCA 4F91B 4YMMA 4ED2A 1JXBA 2FLLA 3SUQA 3I0SA 1VSMA 1HYVA 2P51A 4UB3A 7ICTA 1ZQUA 4KTWA 3M8RA 3AA4A 2V4QA 1SUQA 4E89A 4H4OA 3OHAA 1J54A 1RILA 4HCBA 4DLEA 3O4QA 1WLJA 4YD1A 2W9CB 1ZQDA 2ZTCA 3C2KA 2FLNA 3GIIA 3NCIA 5J29A 4IQVA 1VRTA 4DSFA 2XY7A 1VSHA 5J2GA 3MDCA 4I7FA 4I2HA 1HMVA 1QSYA 4UAYA 4ICLA 3VQ5A 3RAQA 1BQMA 1RCHA 4NCBA 4GXIA 2OZMA 2F8TA 4F4XA 3JPQA 3SQ0A 4OVLA 2DPJA 3SPZA 3TAMA 4NM2A 1RT4A 1UT8A 4FJIA 3LP3A 5BOMA 4DOBA 1S10A 1FXXA 1RTHA 1H38A 5HP1A 3PW2A 4LD0A 2Q3SA 1TK0A 1NK0A 7ICJA 4I2BA 2XY6A 4P4MA 4TUPA 3VQDA 1Q9YA 4I2EA 1NKCA 4QZFA 3QEWA 3C94A 5KFDA 1BPXA 3PMLA 1ZYQA 4M3YA 2OWOA 1T05A 8ICVA 3VQBA 4Q8EA 4DTNA 3V1QA 3OS2A 3KLEA 5DG7A 3GV7B 4DL3A 1BVSA 5CA7A 1G15A 4FK2A 3V4IA 3S3MA 3ZDDA 3V9ZA 5J2AA 4RW7A 4FJ8A 1ZQZA 2I9GA 3LP0A 3AU2A 5KG7A 5KFEA 4JS4A 5E41A 2AGPA 4I2PA 3K58A 4CESA 3TANA 4RNOA 7ICLA 2GUIA 1TAUA 5KRTA 3ZDAA 4AHRA 3TAEA 3V6KA 4JWMA 3HT3A 4AHSA 3VQCA 8ICMA 1BIZA 1RDCA 4EBCA 1S6QA 4YG2A 1B22A 4BE2A 1Q9XA 4CJ4A 3QZ7A 3F9KA 2IHMA 4W5NA 3NDKA 5DQIA 4YR3A 4PH5A 1ZQMA 2D0BA 5KFWA 2XGQA 4N5SA 3SI8A 3OYHA 2FPLA 1LB2B 4QZIA 2BHNA 3JSMA 2G8HA 1KCFA 3TAFA 2Z1JA 1WSJA 3AVAA 4O3PA 2NRVA 3SV4A 4TSXA 4DFPA 7ICKA 4DG1A 1RT1A 3MBYA 2FPKA 3VA0A 2V4RA 8ICSA 4FJJA 4CEOA 1KFDA 3DLRA 1KVBA 9ICSA 4J2DA 2O4IA 4CGHA 1T03A 4J2AA 4DTOA 1NOMA 3D0PA 2JLEA 4CF1A 3LZIA 2XHBA 4KFBA 1T7PA 2Z1HA 3TAPA 2OZSA 4JWNA 4J9QA 4M47A 1KRPA 7ICIA 4R64A 4CFDA 1JLBA 4J9PA 4M3RA 4PHPA 3AVLA 4R5PA 5KGWA 5J0QA 3NBPA 3JPPA 1SZPA 4CJPA 4DQPA 2VA8A 1ZBHA 2AQ4A 2JEGA 5CHGA 3RWUA 3ZDBA 2ALZA 3DM2A 3IM1A 4CIGA 2UVRA 2BGWA 3AVGA 9ICJA 3PX6A 3C6UA 3HM9A 4FK0A 4M45A 1SKSA 4E19A 3KK2A 3NTUA 4DSKA 1VSFA 2HHXA 5J0PA 1DOQA 3MABA 1RXWA 4AHTA 5IIIA 3CFRA 1DLOA 3LDAA 3RB3A 3OYKA 3MEDA 5D49A 2G8VA 2B5JA 4DL6A 4FLXA 1K1QA 2PYJA 9ICLA 3PR4A 3VQ8A 3BDPA 4C8NA 1XHXA 4CHZA 4TQRA 4GXJA 4ECRA 2AJQA 8ICYA 4Y1CA 4CJ5A 3RRGA 2I1QA 4EEYA 3BQ0A 3PVXA 1O1WA 4L8RB 2QKBA 3L3UA 3HJFA 1RT7A 3NH0A 4QAGA 2W9AA 1XHZA 1IKXA 1L3UA 4B08A 4I2DA 4EP4A 5C25A 1C1BA 3RMCA 4M42A 3CFPA 4J9SA 1TL3A 5CZ1A 4QW8A 5KFBA 8ICPA 4FVMA 2XCPA 5J0XA 2DFHA 2ZE2A 2A1RA 1DGSA 3ISBA 4EZ6A 3K5NA 2HMIA 3QESA 1BCOA 4ED8A 4NYFA 3JPTA 4FS2A 2KZZA 3T1AA 7ICOA 2P6RA 4M9GA 1WCNA 4QCLA 4HUFA 2IS3A 1A5WA 2BQRA 5KG1A 4KTZA 4O0JA 5DDYA 2LSNA 4CIEA 1X9MA 3HSTB 3V9UA 3PW5A 4N56A 4DTJA 4I2IA 4FLVA 2E6MA 3HPOA 3EYZA 4F5OA 3GV5B 4M9HA 1Q8IA 5DBAA 1TAQA 2DPIA 4KLUA 2B21A 5JS2A 1ZQBA 1TKZA 1LW2A 4PGQA 1RBUA 2FMQA 1S5JA 2ISOA 4MFFA 3AVHA 3C6TA 1RTDA 3MR2A 1XWLA 3G0ZA 4QWBA 4RQ4A 5IIOA 3EPIA 4M9NA 3NGIA 1ZBUA 2WONA 3OSPA 5EU7A 2OPRA 5DLGA 3LK9A 4MFBA 2BCVA 1L3SA 5HROA 4FJ5A 1Y88A 4YQWA 3C2LA 3VQ7A 5J2NA 7ICMA 2HHTA 3Q8PB 4B8CA 4DU3A 4FJLA 8ICXA 3H4BA 3T5KA 2YNGA 5J2PA 4OLBA 2VG7A 1X9WA 8ICUA 1VSDA 3QIOA 3GIMA 2MUTB 1ZQIA 1IKWA 2YKMA 4KPYA 4IFYA 3GIKA 1KVCA 3L2QA 1ZQGA 1N5YA 4FJMA 3RH6A 5KRSA 4PHAA 1WSIA 1CZBA 4CECA 1WN7A 4RW6A 1BIUA 4DL2A 4Z4HA 4EBEA 2J6TA 1S77D 1RDAA 2GV9A 3V81A 2UVUA 4PPXA 3ZSWA 3ULDA 4RQ5A 3KJVA 2WOMA 2OA8A 5F9LA 4EZ9A 4CEQA 1S1UA 4FXDA 1C6VA 4E7HA 1RBTA 5KFLA 2QKKA 3U6FA 4KLHA 2ITGA 4PUOA 1L3VA 4I9LA 1XI1A 4FK4A 4ELVA 3LP2A 4E7LA 4JUZA 4OLAA 1B43A 4C8LA 3CM6A 3RJGA 1LWEA 2PI5A 1LWCA 1PZNA 3VQ4A 3ORYA 3OYLA 1BGXT 4IQTA 5J2BA 3MGHA 3EZ5A 2HVIA 3T19A 1FKOA 1RT6A 3KKSA 2X6NA 4F3OA 2ASJA 7ICGA 3Q8SB 1ZBLA 1RXVA 3OS0A 2FC0A 4QW9A 1KFTA 4BACA 4QZAA 2BCQA 4M3XA 4PGYA 1WAJA 4IQWA 5FRMA 2BGGA 1JLAA 1ZBIA 2BCSA 1U45A 1L3TA 4O3OA 5HBMA 3QEAZ 1HRHA 4LSLA 3HW8A 2IA6A 3KD1E 4OPKA 2FMSA 4CGJA 5J1EA 2HW3A 4QZ8A 4CEDA 1KVAA 3ISCA 3UXOA 1QLNA 3GV8B 2GWSA 9ICVA 2PYLA 1BQNA 9ICQA 1VSLA 9ICEA 3C23A 5HNKA 3AVKA 4RQ2A 4CF2A 5J2MA 1K1SA 3H7IA 4W5OA 3HPHA 3V9SA 8ICJA 1C1AA 4UB4A 3LPTA 9ICPA 2QK9A 4FLYA 1BPEA 2X74A 4W5RA 1T8EA 3DOLA 2W9CA 1ZQRA 3QETA 2IHNA 2KZMA 2ATQA 5CP2A 1WNSA 3B0XA 4EYHB 4O4GA 3EW9A 3O4NA 2JZBB 3GQCA 2VA3A 2R8HA 1J9AA 2C28A 3QLHA 4AH9A 4J2EA 4HUGA 1YVUA 4Q0BA 3M8QA 1U04A 4NLZA 4B8AB 1RNHA 8ICWA 4UQGA 3AV9A 4FW1A 1HQUA 1QQCA 1TL1A 3HL8A 3ZCMA 3RMBA 4Z4IA 5HP4A 1CLQA 1U48A 4FBTA 3RTVA 3OYDA 3V6HA 3RR7A 4F2SA 1KEJA 4TURA 3OYMA 3KD5E 3LALA 4QOZB 3H8SA 2YV0X 4CJQA 1RPLA 2DFLA 4K4GA 2ZQBA 4RW4A 2X78A 5C42A 3DYAA 2BE2A 3QEBZ 2IC3A 4RQ6A 3T5HA 2LYHA 2ZUBA 4P2HA 5HLFA 1ASUA 3AVFA 1ZQWA 3AVCA 9ICMA 2NUBA 2JEIA 3RJFA 1NK5A 4MFCA 4F92B 3MGIA 2G8KA 1UAXA 2ZD1A 4MEYA 4KHWA 9ICGA 3G6VA 3KHLA 3ETLA 3DLEA 4MQ3A 3N97B 2FLPA 1W9HA 4WE1A 2Z1IA 4FCYA 1MSWD 4CJWA 3MR5A 3KLGA 4FM1A 2G8WA 3JPSA 4BE1A 1CEZA 2FMPA 4O3SA 9ICRA 4OKKA 1ZQJA 3ZSXA 1VK0A 3ZSRA 5DDMA 1SL2A 4LZDA 5L1JA 4E1MA 2GBZA 3ZT3A 2RDIA 1TFRA 4ECZA 9ICTA 4O9MA 1UA1A 2DY4A 1UA0A 5HHHA 3ZSZA 4BWJA 4M0AA 3T5LA 3TAGA 1QSLA 2HHUA 4PA1A 3OYIA 1XSLA 3ISDA 4R8UA 3S3NA 3QEIA 1JL2A 3EPGA 4F50A 2M9NA 3PUFA 3SUNA 1Z00A 3PY8A 4Z0UA 4NCGA 4F4KA 1XU4A 5EWGA 4CJTA 3SPYA 4Z4CA 1JN3A 4KLQA 1D8YA 4DTPA 3SZ2A 5KG2A 4KHQA 1QHTA 4RW9A 3QEPA 1BI4A 4W5TA 4Z4FA 5DBCA 3HWTA 4KLGA 3OS1A 4I2QA 2EHGA 5SWMA 1XSNA 8ICGA 3V6DA 3QNNA 1RT3A 3JPRA 4KREA 3SV3A 4BWMA 1HJPA 2ZUDA 2G8IA 4AHCA 3LPUA 3LDSA 5KFHA 4E1NA 4PWDA 4QZDA 1B9FA 1RYRA 1HQEA 3ZDCA 4CE9A 3V1OA 3RH5A 4Z4EA 2AGOA 1HNIA 1BPBA 1ZQOA 3DRRA 3KLFA 5DLFA 1IKYA 3OY9A 3TABA 4KHUA 2J6UA 3V6JA 9ICKA 3T5JA 4IQUA 4QWCA 3PV8A 5KFOA 3TARA 4IKFA 5D46A 4DSEA 1ITGA 2AU0A 3SQ2A 5D3GA 1BCMA 4QZCA 3PW4A 3K2PA 4CHYA 1T4GA 4OJRA 1X2IA 2OYQA 2JZBA 4RPYA 1NJZA 2E6LA 4ZTFA 3V7LA 3RJIA 5DB7A 4F8RA 1S9EA 3UQ0A 3Q8MA 3THVA 1Z25A 4YD2A 7ICQA 1YTUA 2HHQA 2AQ0A 5KFPA 3LWMA 4G1QA 1NK8A 1KSPA 2MAXA 3TI0A 3EWAA 4QWDA 4YR2A 3RB0A 2KFNA 1ZQSA 1A77A 2MUTA 1ASWA 2A1JA 4CK1A 4I2FA 3OYBA 5BOLA 5KG5A 4IG0A 4KAZA 3NHGA 9ICOA 4KLSA 3AU6A 2B4JA 3VQ9A 3L8BA 5EWEA 4XQ8A 4R8UB 3IG1A 4B9NA 2HB5A 4YNQA 4ED0A 4DO9A 7ICNA 3AA2A 1TK5A 4ELTA 3HP6A 3JPOA 5J2KA 1LV5A 4UBBA 8ICHA 4FLTA 3Q8LA 3H4DA 5K14A 5KT2A 3ALYA 4GLXA 1KFSA 4F5RA 2XY8A 1LW0A 1JKHA 4F5QA 1XS9D 1QSSA 4B9UA 4KO0A 1JLGA 3VN5A 2XGPA 1N6QA 4HYKA 1TKDA 2VG5A 3SQ4A 1ZQXA 2PZSA 5J2IA 4B3OA 1XC9A 5KT3A 4B9VA 4I28A 2UVWA 4DQRA 4CK2A 4JRPA 4ECTA 9ICUA 1ZQNA 3B6PA 3VA3A 3NF7A 4QZEA 5IIKA 4CHQA 1I3AA 3PX4A 7ICSA 1WSHA 1JLEA 2YHAA 1EP4A 4UB5A 2P5GA 2QXFA 5I3UA 8ICAA 4HHTA 4HUEA 5DBBA 7ICFA 4DTXA 1U9LA 1JXEA 4KN4A 4ED1A 4F5NA 4OPJA 1ZJMA 1BHLA 1GOAA 2XY5A 1HJRA 1S97A 3AO2A 3O3GA 4CF9A 1ZQVA 4DSIA 4FS1A 3M9NB 4YMOA 3D45A 4DTRA 4LY7A 2NRZA 3TAQA 3RJJA 1JLQA 3MEEA 4NCAA 4RNNA 2ZJAA 4KMUA 5KFVA 4F93B 4O55A 2HHVA 1JLFA 3CYMA 3DLHA 4FJHA 3OGUA 2W42A 1VRUA 5KG3A 4CF0A 4G3IA 3AVNA 2IDOA 2J6SA 3C2MA 4DL7A 3G6YA 3GDXA 2PFNA 5J2QA 5J2HA 3ZT4A 1B92A 4CEAA 4KB0A 4KI6A 4CEBA 4AILC 1N48A 3PW0A 4CHOA 4DOCA 4P4OA 4ECUA 3CG7A 2D5RA 1ZQTA 5J0UA 2AGQA 4DL4A 3MXJA 4Q5VA 3L2RA 4C8KA 4FJNA 3HXMA 2IOCA 1IKVA 2PFQA 4FBUA 3RAXA 2BPGA 4J9KA 1ZQPA 3P83D 3KIOA 1RZTA 4CJKA 3C5GA 5DB6A 1S76D 4TQSA 3V7KA 3OJSA 4BE0A 2EX3A 3I8DA 4JV1A 5DG8A 4ECYA 3G10A 5J0TA 1RT2A 3WNFA 2I5JA 4YXMA 1F21A 4PHEA 3NGDA 1B9DA 4YN4A 1D5AA 4M3TA 4O44A 4CGGA 1VSIA 1BL3A 4YR0A 3WNEA 1ZETA 2HNYA 3RB6A 4IR9A 4BGDA 3U3GA 3AA5X 1S0OA 4RUCA 4EYIB 1L5UA 3MDAA 4ID1A 3CQ8A 3F73A 1ZQCA 2Y1JA 3KHGA 2RKIA 4ECVA 2P66A 4MF8A 3OYCA 1EXNA 1ASVA 4NLGA 3DI6A 1TGOA 4NXZA 2P6UA 8ICBA 4KLFA 4M9LA 9ICXA 1ZQKA 4PY5A 3PR5B 4I2JA 9ICAA 5KFJA 5L1KA 2V9WA 2ZTDA 1IO2A 2OPQA 1SV5A 3P5JA 1TV9A 3SI6A 4GVMA 2JEJA 5CZ2A 4I29A 2P5OA 4CJLA 1XO1A 3JPNA 2YNIA 4DOAA 2KTQA 3AVJA 1RTJA 3UPQA 3KTQA 4YFUA 4H8KA 4KRFA 3OVNA 2KFZA 4P4PA 4GMJB 3PNCA 4OGEA 1CXUA 1I39A 4DU1A 4LSNA 1ZQAA 2W8LA 2FBYA 3ZT1A 8ICLA 4UB1A 9ICBA 2HNDA 5KFQA 4RNMA 4QZGA 5J0YA 3M9OB 3HO1A 1CZ9A 2BPCA 4ECSA 1TK8A 4RW8A 2HHSA 3RBEA 2Z1GA 4H4MA 4CEEA 4JK1A 4FZYA 1R0AA 5KFRA 4KLOA 4CFCA 4CJUA 4IDKA 2PFPA 4Z6CA 4NY8A 5KG0A 4PHDA 3RJHA 1NOZA 4K8ZA 3JYTA 3NF8A 3MR3A 2FBTA 2BDPA 7ICEA 3K4GA 7ICVA 3LWLA 2C22A 4YFKA 5KFYA 4ELUA 3TQ1A 1NK7A 2F1IA 5TZVA 3MEGA 1WAFA 4M3WA 5J0WA 5J2CA 1S1TA 1KLNA 2RPIA 4DS4A 1RTIA 1J53A 3TFSA 2C2EA 1SL0A 3BJYA 4DLGA 3PX0A 4RQ7A 5DGAA 8ICIA 4ECWA 1TV6A 2DTUA 4K4HA 5CYQA 4M04A 3V1RA 4Z6EA 2RN2A 1JXLA 5DK5A 1UWBA 1W0HA 3BGRA 4F4WA 1WCLA 2PI4A 3RMAA 2BPFA 1HPZA 1S1VA 2H5XA 3HP9A 2ISPA 5I42A 3A2FA 3ZSVA 5CR0A 3K5OA 4UAWA 2BR0A 5IIJA 4CJEA 4CFBA 2E4LA 4O5KA 2IMWP 2PFOA 3C5FA 5KT4A 3RJKA 3Q8KA 3NH1A 4M2YA 3GFKB 3AVMA 2NRXA 3SYZA 4K4IA 2NRWA 2O4GA 3ASMA 4AHVA 3V7JA 4LH5A 4XUSA 1MC8A 3OYJA 3VQ6A 2XCAA 4XA5A 5F9NA 2F96A 3QO9A 1D9DA 4N41A 4I2CA 4RQ8A 3KLIA 1LAWA 1ZQLA 3KHRA 1BPZA 4KLLA 5CY4A 4PGXA 5DG9A 1NKEA 1C7YA 5HMLA 2YHBA 4KLDA 2R7YA 4FZZA 8ICOA 4LVSA 4I2GA 4GC7A 3LZJA 7ICUA 5KFZA 2HHWA 3H8WA 1WSGA 3VQPA 3BQ2A 4B9LA 4CHNA 1JIHA 4R65A 4R66A 4QZHA 4CCHA 3MXMA 4DEZA 3GILA 7ICPA 4X5VA 2OPPA 1NKBA 2VA2A 1COOA 4FJGA 4BDPA 1S9FA 1GOCA 1AROP 5KG4A 4E7IA 1JL1A 2FPMA 1ZQHA 1X1PA 5KFFA 3KK3A 4DTUA 4KHYA 4DFKA 5JUMA 1WSFA 4DMNA 3OYEA 7ICHA 2FBXA 3V9XA 5KFAA 3T3FA 1EETA 2FBVA 4O5CA 4FLUA 3ZT0A 4DTSA 3UXPA 4F5PA 5CJ7A 4YXJA 3QNOA 4FO6A 5JS1A 3NF6A 3UXNA 4DWIA 1MU2A 2A1JB 5KFUA 4ECXA 1RT5A 4YP3A 2YKNA 5KGXA 5C5JA 3SUPA 4F4ZA 4O5EA 3H08A 2ETJA 5KT7A 1Y97A 2PXIA 1TKTA 2W9BA 1X9SA 2DFEA 4O0IA 1FKPA 2DFFA 4CJ3A 3B6OA 4ZH4A 4F2RA 8ICCA 8ICZA 4CGFA 4KV8A 1D9FA 4MF2A 5HRPA 1S0MA 4NLKA 8ICFA 1NJYA 1U47A 4O3QA 4ED6A 5CYMA 4IR1A 1WSEA 4RU9A 4CGIA 4E0DA 4FLWA 2KZ3A 3ZD9A 4BXOA 5HRNA 3O3HA 5J2EA 5DQGA 5HRRA 4JV0A 4HCCA 4RUAA 3QEVA 3OYFA 4KB1A 3UQ2A 1J5OA 2Y1IA 2BQUA 4LH4A 5L1LA 4FM0A 4DQSA 4ECQA 1UOCA 3M8SA 1U4BA 3DOKA 8ICQA 1TVRA 3S9HA 4MFAA 4DL5A 2C2RA 1NJWA 4M3ZA 1S6PA 4CJSA 4BXOB 4NLNA 4M6WA 1BISA 2XC9A 2F8SA 5DQHA 4I9QA 2JEFA 3WNHA 3DRSA 4J9NA 1CUKA 3V9WA 4OKEA 4RQ0A 1ZQQA 4IBNA 4M41A 5SZTA 5IILA 1NOYA 2R8JA 2WTFA 2IAJA 4Q44A 3AO3A 4IG3A 4Q45A 4R63A 1JX4A 3DLKA 1JMSA 3SCXA 5J2JA 3NH2A 1MQ2A 5L9XA 4J9MA 1RDBA 2B6AA 5KFSA 4KKOA 4N47A 3IHQB 3RH4A 2VANA 4LZGA 3K57A 5KTQA 5J0OA 4CIFA 4DSJA 4FJ7A 4DS5A 4QWEA 4M3UA 5J2DA 3OHBA 3C1YA 2KW4A 4DF8A 4UB2A 3LP1A 3AA3A 4OGCA 3O3FA 4MEXA 1C1CA 3AUOA 3MXIA 5KFXA 3ZSYA 3MECA 3K75D 3GIJA 1RBSA 4E7KA 4JV2A 4B9MA 3TFRA 9ICWA 4QZ9A 9ICNA 1U49A 3DLBA 3LAMA 3E2EA 3Q8QB 4YVZA 3LAKA 1A76A 9ICHA 1CXQA 4Z6FA 1IXRA 4E7JA 4JLHA 4OKJA 1KLMA 4CF8A 3DRPA 2G8UA 4CERA 1D8LA 3NGZA 4CK3A 1DTTA 1IG9A 4RT3A 1LWFA 3G6XA 4F4YA 2IBKA 3B0YA 2KQ2A 2ATLA 3RMDA 5CB1A 1HYSA 2ZJ8A 4RG8A 5DMRA 2XO7A 4FLZA 4CJRA 1EX4A 3U3YA 3RRHA 4KLJA 2W9MA 4FJXA 1S9GA 5HMMA 4TUSA 1C0UA 1V9PA 1FK9A 4IRKA 4DQQA 4IFVA 3UIQA 1NK9A 4UAZA 1QTMA 4E3SA 1GOBA 4KTQA 3HVTA 4FZXC 4RT2A 4K8XA 1RBRA 4RPXA 1RDDA 8ICTA 1ZQEA 4DFJA 2YNFA 4I2AA 4FJKA 3DMJA 1SL1A 3C21A 3MR6A 3PO4A 4N76A 4RQ3A 3ZD8A 1REVA 1A5XA 3RJEA 2ASDA 2BCRA 3QZ8A 1XSPA 1NJXA 3VQAA 2R8IA 4C8MA 5FRNA 5KT5A 5EOZA
chains in the Genus database with same CATH superfamily
4LFAF 4MDBA 2KKHA 3CJBA 4HT5A 4PYAA 3V72A 4M5LA 2X6SA 2GTDA 4KHPK 4PZVA 3BQ1A 4DTMA 2Q6BA 4U9RA 4FYYB 4ZTJA 2Z56B 3OL7A 1JKHB 3CJ4A 2CA9A 3NCQA 3D28A 1IR0A 2D0AA 5AQUA 5A8KA 4C11A 4DUZK 4AXJA 2I6XA 4K4TA 3ID8A 1NH8A 3FBBA 3UB5A 3FFIA 3G8SA 3CD6S 3DHWC 4BGAA 1RYSA 2CNLB 1JB0C 2NRTA 3H5UA 1HYZA 3P1GA 5IIMA 5KFGA 2W9BB 3SQGB 1HUOA 5JVHL 4C3KA 4CZCA 4YB6A 4CGDA 3JXUA 3HRGA 3EO3A 1EXQA 1HQUB 2LHTA 1C0MA 4O5BA 1BDGA 3CC7N 3NFAA 2AH5A 3MEGB 3SCIE 2ZBPA 4B6JA 5IWAK 3TR8A 2ZBQA 1LKYA 4CJFA 1EARA 3NGYA 1TYQA 3VQQA 1OJ4A 5J0RA 5KFCA 2ZXHA 2BH1A 1JWWA 4DF4A 3PO5A 3BSOA 5C15A 1KC8O 4AHUA 4DB3A 1KDHA 3MFIA 4J9OA 3CCTA 1A5VA 2MPUA 1JLCA 8ICRA 4KV8B 1FRJA 1HW8A 3AAWB 1VQSA 5AR0A 5GAGP 2O8EB 4LF4K 3MWPA 2HEKA 3UNYA 5D0GA 3ZYYX 4J9RA 3U1NA 2E1MC 2D0CA 4ES2A 2PDAA 2RKIB 1SKUB 1VIXA 1SKRA 2AJ4A 8ICKA 2G2OA 3NF9A 4CEZA 4QPXA 4E98A 2EK6A 3PYEA 2BA9A 4KHPJ 2V7ZA 2Q0ZX 1GX6A 1Z00B 3OVAA 2BYCA 1S1WA 4X64J 3HK2A 2AT1B 4RQ1A 2A3VA 1S0NA 2DY1A 1N36F 3FFIB 4Y0WA 2F8HA 2PD1A 2H4YB 4PEOA 4Y1DA 1VQ7N 3W9IA 2ZJPQ 4Z6DA 4NXMF 2UVVA 2WF8A 4DSLA 1UETA 1RWWB 5IQ6A 4M5JA 1MMLA 3CI5A 2R7VA 1PVQA 3GG4A 2F1JA 3BS5B 3QUQA 4CNQA 2AP1A 1HARA 2Y0SF 2DGTA 2UUBF 1C2PA 4QYZJ 1NM2A 2YWKA 3CB4A 3BQTA 4ID5A 4OQJA 2ZM6F 3ITHB 5FROA 3IAYA 2IOFA 2VFTA 4NYNA 3QBXA 4F02A 1D0EA 2FQQB 1XTZA 1VHFA 5DKWA 2NZ4A 1K8KA 1B7FA 4FYDA 2LU2A 4ED7A 1YT3A 3D0GE 1Q7YO 1LNQA 3L2UA 4QWAA 3M8ZA 4IQMA 2ZGYA 2KKZA 4JRQA 4F3TA 1SKWA 3N4MB 3SUOA 2OO4A 4FW2A 3KMQA 2P9SB 4O3RA 3OXLA 3PYGA 1XERA 3CCWA 1X4HA 3AO1A 5T7BA 3VENA 2C2NA 1VSKA 3NCPA 2VKZG 3SCLE 3FZBA 4QZBA 4IRDA 3GL1A 4CFAA 3AAPA 1FRKA 3MPVA 2EH9A 2HNDB 4DBQA 3L2VA 3BS7A 2C42A 1BG3A 2KIVA 2WF9A 5K20B 1JLBB 3OYGA 4YS2A 4ZJQA 4WFAQ 3OXFA 3HYFA 3CDEA 1F6TA 2H3IA 2R7XA 3V5RA 1DK2A 4K4VA 1ZD3A 1Z4NA 1XQIA 3TR5A 2OPSA 3HHLA 4LR7A 1P8ZA 2FLLA 3SUQA 4KGZB 2QARB 3CPEA 1VJ5A 2RU9A 5HJYA 4JB3A 2A2CA 1ZQUA 4KTWA 1FJCA 1SUQA 2IIHA 2PN6A 2U2FA 3ENWA 3QJPA 4E89A 4RUBA 4JKEA 1RAIB 3OTOF 2W9CB 3D2QA 3ZZUA 1S72N 3C2KA 2HIYA 3GIIA 3NCIA 1WWVA 2WSFC 5J29A 5FP0A 1YAGA 1KLMB 3SDEA 5EX5A 4FYVB 2WAQC 4U7UD 4QYZK 5ALWA 1XMOK 2XY7A 1U1KA 5J2GA 4LBPA 2MZ1A 2ZIUB 5F0WA 4P0QB 1IR1A 4NWBA 2HVZA 3HKZD 2P9LB 3THPA 4WK1A 2UYTA 1UWAA 3BKFA 4LRAA 3R5BA 2EXUA 2Y0SC 4OVLA 3AD7C 2GO7A 4NM2A 3TAMA 1NHUA 1J2MA 2MSNA 2QA4G 2HS3A 1NRKA 3LP3A 2DHAA 5BOMA 1S10A 2B4PA 2YI1A 4AL5A 4PQUB 5AQNA 3UWTA 2K8CB 1TK0A 5JVGQ 2X3DA 4I2BA 2IDEA 2QFJA 4WJ3B 3K17A 4P72A 4OHZA 4QZFA 3QEWA 2WAQF 5BRDA 1QVGM 2MY8A 1OH7A 3KJVB 5EX0A 1AYEA 4M3YA 3IWNC 1GXLA 1TKXB 5L1MA 1S12A 2OWOA 2AW0A 1T05A 3EZWA 4BJQA 1NZPA 4R79A 2ZJRQ 3VQBA 3OR1A 3BGUA 3KLEA 3FE1A 1J2VA 5B8HA 4LFCF 3U1MA 5C2FA 4FK2A 2YX8A 4USKA 3ZDDA 4C1NI 3AQEA 4RW7A 1TR0A 3C16B 4MT1A 2W4PA 2D1KA 5AKHA 3QAEA 4MDAA 3AU2A 5KFEA 2RQ5A 3UMCA 5E41A 2KLAA 3M6WA 2W4DA 3K58A 1FRMA 3JSRA 1SH2A 1DRGA 3TANA 4UUWA 1M6YA 5GTIU 4DR7J 3ZDAA 3MMBB 4PKHA 4QOTA 3MM6B 3ZETA 3VQCA 5GADU 1FJGJ 4PUOB 4EBCA 4JV5F 4AUKA 2EFPA 3R5JB 2VH7A 4YG2A 3K7RA 4K43A 1B22A 1RAAB 4LF9F 1Q9XA 2GFFA 2E1ZA 5EUHA 5DQIA 3C6HA 2VGNA 1ZQMA 2VU5A 5KFWA 2HFZA 1FX4A 1PO6A 3OYHA 1KOOA 1LB2B 3CCLN 4ZP9A 4M5MA 1UP1A 1SXEA 4RWWA 2ZIXB 2G8HA 3C14A 4O3PA 2D0OA 1WJ9A 2E2QA 3FR0A 1URNA 1RT1A 3AY0A 2OTJN 2CWXA 3QWUA 4UQTA 2MQ8A 3FC9A 3BBFA 3H2VE 4IEEA 2QA2A 2IVYA 3LZIA 3QMQA 5A0YB 2OZSA 1HKBA 5LSOA 4BC5A 2OXOA 1YF5L 4J9QA 3U9ZA 1JLBA 2GH1A 2LECA 4M3RA 1CULB 4NLVA 3NBPA 4Z2XA 1SZPA 2VA8A 2ES6A 2IM0A 4UB6U 4KR0B 5AJ3J 2CG4A 4ANDA 3DM2A 4IO1A 1KD1O 2UZAA 5F8HA 2UVRA 1SJRA 3AVGA 2WZ1A 4IUFA 3JQKA 3NY0A 2KHOA 4M45A 3ILJA 1VSFA 3EUNA 5J0PA 2KG0A 3RF9A 1LWXA 1YBUA 5ALLA 5D0EA 3LUYA 4DL6A 4FLXA 3FC4A 1PVPA 4CHZA 1FDNA 4V19J 4CI6A 2G1HA 4ECRA 1XR7A 2ZIVB 2DY9A 3PVXA 3BQ0A 1NDCA 1KD1T 2NPFA 3HI9A 5F8IA 1EO1A 1MDUB 4P0PB 3NOGA 2Y3YA 4C0BA 4B08A 4I2DA 1NEEA 4BG8A 4LF7F 3RMCA 5J1PA 3BKUA 3THTA 4NXNF 4AP9A 1DQAA 5KFBA 4FVMA 2YCHA 5J0XA 2ZE2A 1XMQF 3BY5A 3M8PB 2HMIA 2DGUA 4XEIA 2EW9A 3UFCX 4USHA 4L74A 4TVAB 3T1AA 1YJ9N 1U6BA 1S1WB 1VQPN 4EMDA 1A5WA 3OL8A 2AIRB 1HIWA 3E1YA 1HW9A 3NBPB 3H90A 2HQ3A 1X9MA 3EX7B 3HSTB 3QLHB 1JJ2M 4OI2A 4N56A 1MLAA 4LVOP 1HBUA 1IQTA 4JI0K 3OLBA 2BW2A 3EYZA 4F5OA 3THWA 5A8WA 4M9HA 5DBAA 2Q43A 2DPIA 4KLUA 1O8BA 4KH6A 2B21A 1RA6A 1RQ0A 3EZUA 1ZQBA 3W60A 2HOIA 5AJ3K 3KDOA 1RBUA 1S5JA 2ISOA 4MFFA 3PFEA 4NXMK 3PKMA 1XWLA 4QWBA 2AF6A 3HZGA 3OSPA 3SXLA 2JC1A 5F8LA 1UVKA 3L09A 4MFBA 1XMOJ 3B54A 4BR7A 4TYAA 2DIVA 1CJUA 2IVNA 4YQWA 4WFBL 5J2NA 2V2ZA 3UVJA 5J2PB 2O5DA 4P7TA 4UOGA 2YNGA 1K5OA 2KHCA 4ZVOB 1IKWA 2FSKA 4NLTA 4MYTA 4OYXA 1FXLA 4M94A 2C3MA 2FUG9 3KZBA 5KRSA 4PHAA 1OSCA 4NLOA 2VHGA 3HRDD 4B3RJ 4TY8B 1LFPA 2VCPA 5ETOA 2VJ4A 3MTKA 2DRBA 3ID6A 2GV9A 2GO8A 4ETXA 1RAFB 4RQ5A 1NXIA 1VBZA 2QWMA 2VOPA 4CEQA 1S1UA 1C6VA 4E7HA 1ZD4A 5KFLA 2QKKA 2GO9A 4HLBA 3DXKB 2ITGA 5A2QY 1XI1A 2FJAB 4FK4A 4ELVA 2A18A 2ZH9A 3DHXA 4OLAA 4C8LA 1N0VC 5IWAF 1QZ6A 3TO8A 1SJ4P 4B3RF 3LP0B 3ZZRA 2O8FA 3VQ4A 2FJBB 5FLXO 4OX9K 3A0HU 1G99A 3MGHA 3G86A 3EZ5A 3T19A 1SJ3P 3KBBA 3KKSA 4OYPA 5H2FU 1KHWA 1N5SA 7ICGA 4EFHA 1ZBLA 2EI5A 3MEKA 2UV8G 3A13A 3CNQP 4QZAA 2JRSA 5FRMA 1SV0A 3GP9A 2CNNB 1JLAA 1ZBIA 5MLCV 1UPMB 4TYBA 1RA7A 2MA1A 1L3TA 3QEAZ 4B3TJ 1HRHA 4LSLA 2IA6A 1B0XA 5LMNK 5J1EA 1KQGB 1KVAA 1GLAG 2XHWA 5F1XA 3ISCA 2HK2A 3UXOA 3AQFA 3CMEN 2GWSA 1ZZNA 2PYLA 3RVCA 9ICQA 3TVYA 4JI4K 1ROFA 4RNHA 9ICEA 7FD1A 3C23A 5HNKA 2D1CA 5CD4H 3PJ9A 5HP1B 3DN9A 4W5OA 3UN2A 3V9SA 4UB4A 1HLUA 3PJWA 2JZ5A 2CQPA 3A8JA 4IFVB 4KH5A 2W9CA 3K8WA 3CJ8A 5A8WB 2IHNA 4OI1A 2ATQA 1YX2A 3B0XA 3GQCA 2VA3A 3DGVA 1J9AA 2C28A 4L3KA 4AH9A 4KGVB 1VLOA 1N34J 3O9TA 4Q0BA 3M8QA 1PK1B 2ZNZA 8ICWA 3D1OA 3T9NA 2QB1A 4RU2A 1QQCA 1KN6A 3HL8A 2MGZA 3ZCMA 4BRQA 5BXIA 5GAHP 3CCVS 3PIPL 2R7UA 2H5JB 3MOJB 3CDUA 3KLGB 1W2BM 4F2SA 1T44A 3J7YP 1XNRK 1C0UB 3KD5E 3H8SA 1MWYA 2YV0X 2HLUA 4K4GA 3F44A 3S41A 2X78A 4P2HA 2ZUBA 2H5IB 2GIRA 1BQMB 1N34F 2I5HA 2YWHA 4LREA 1PAEX 4QIGA 1NK5A 4MFCA 4ZVGA 1UAXA 1I94F 2P35A 1R0AB 4MEYA 4NB4A 5DM6L 3HHLD 4MQ3A 1TP7A 4FCYA 5M2RA 4RLEA 3HT0A 2QI2A 4RBTA 4FM1A 3A5NC 4NOHA 3VEYA 4YOXA 4BE1A 2CADA 1X8DA 2VJUA 2CVIA 3NG8A 4ED4A 3CCQN 1ZQJA 5LMNJ 2AZ1A 3TW0A 5I42B 4JKCA 5RUBA 4LZDA 5L1JA 3IXQA 1KVJA 2F1FA 2GQ2A 5AIBA 3ZT3A 1TFRA 2DNOA 3PM9A 4O9MA 3KLIB 1UA1A 3N0VA 1UA0A 4NYZA 3AL0B 1H72C 2EAPA 3MUVP 3OYIA 4CZIA 1XSLA 3S3NA 4F72A 3R1HA 4QU7A 3PUFA 1Z00A 4NRUA 4NLBA 1KBUA 5ETQA 1XQSC 1MWKA 2CQ3A 1R7IA 2VBXA 2CG8A 2K3KA 3AMZA 1D09B 4K5SA 4KHQA 1VS3A 4UW9A 2IMOA 1QHTA 2GHVC 2PEHA 4X66F 2EQYA 1IBLF 2VDIA 1XSNA 3OPXA 5SWMA 3GFZA 2G1DA 8ICGA 4G6VB 3NVYA 2ADBA 3JPRA 3N7SC 4BWMA 2AYBA 3QU7A 3LDSA 4YY3F 1SWWA 4QZDA 5BJRA 3VETA 2JDJA 2NSBA 4DPWA 4NLQA 1NDPA 3V1OA 3RH5A 4KT0C 1TL7A 5HMZA 1ZQOA 3DRRA 2MRLA 1WHWA 3V6JA 3T5JA 5AKJA 4IQUA 1RHQB 5HMYA 1JLGB 4JP8A 1BCMA 2BJ9A 4QZCA 5GAHI 4CZHA 1GEHA 5AK4A 2ADCA 1I1GA 1CC7A 3LH2S 4DG1B 2EBEA 4OJRA 2QMUB 4I1TA 1IG8A 2P9CA 1BOTO 3O44A 1NJZA 4ZTFA 4UOHA 3V7LA 4ISFA 1FJEB 1WG4A 3THVA 3IAS9 1Z25A 2P9IA 4CNZA 1V3RA 4RW7B 1U1QA 3CQYA 4G1QA 1Z05A 3SBMA 4NYOA 1O08A 3RFAA 3TI0A 4ZIVA 3EWAA 2UU9F 2BZ2A 4I6AA 1ZQSA 4FZNA 2DITA 5D3GB 2A1JA 5B7WA 4CK1A 1KQSM 3T1YJ 2XMKA 3AARA 1WG1A 4IOAQ 4KAZA 4BR9A 3NHGA 1U26A 3WK4A 2XS7A 4NLPA 4Y28C 3H1VX 4OLPA 3GZ7A 2VFUA 2E5GA 4ED0A 2WVEA 5D77A 1TK5A 2FVQA 3MM8B 3NKYA 1GQEA 1ICEB 2FTRA 1YKWA 3CCRN 1HI8A 4UBBA 2OPPB 3Q8LA 1IKWB 2NZTA 2HLTA 4OFZA 1HBMB 2NO4A 3ALYA 4GLXA 1HHQA 3EGVA 4XAKA 4F5QA 1XS9D 1QSSA 1LWEB 4B9UA 2DNZA 2VUGA 5CAAA 1JLGA 2VDHA 4KO0A 3VCDA 1NLVA 1T6DA 1YJUA 2PFFB 3K89A 4KBOA 1RHKB 2COLA 4O8UA 3QT7A 1NGCA 4I28A 2YHWA 2KJ9A 5CRXA 4V19S 3Q89A 3WIUA 2O01C 5BPMA 2Y9HA 3ATUA 4H0PA 5IIKA 4CHQA 3ZTPA 1DGJA 2ZH7A 2CPRA 1JLEA 4UB5A 2UXCK 2HHPA 3J7YU 4F7VA 4CLUA 3GYXB 4HKQA 3BZQA 3AB2B 4M5HA 2KH9A 2ZJPL 1ZC6A 2Z58B 4CBXA 3I82A 1UEKA 4BROA 3AO2A 1ZQVA 4FS1A 3MK6A 4FZVA 2XICA 3TZZA 4DTRA 2VODA 2BVZA 2NRZA 1COKA 1G2EA 5ALXA 3HHLB 1UZHA 3ILLA 1HWJA 1ZAXA 5KFVA 2GLEA 2HHVA 2C2KB 2W04A 3DOMA 3EEQA 2GAGC 4DV1K 5EN1A 2ITMA 3HHDA 5KG3A 3K1ZA 4G3IA 4YHHF 2J6SA 2WMMA 5EOYA 3NS5A 2P9SA 3G6YA 1IBMK 2HFVA 3GDXA 2PGCA 2Z2ZA 3O9RA 2DD8S 3QJLA 5J2QA 3W3SA 1B92A 2PMZF 2M52A 4CEAA 1H3DA 3DMJB 3H0PA 4CHOA 4P4OA 1KEKA 2RNEA 2ZXIA 2XVTA 1PYOB 3L2RA 5FDLB 2IOCA 4LQ9A 1IKVA 4FBUA 2DR6A 3J7AP 2EPIA 2JLFA 3M6UA 1BUPA 3LPYA 4TQSA 3LO3A 2UU9K 4JI3J 5CD4A 1V5VA 3FZLA 3PIPQ 3CDBA 1S48A 4WP9A 4FDFA 3CJQA 4M95A 3WNFA 2ZOMA 1HNXJ 1F21A 3ETMA 1HFEL 4PG7A 1U09A 3ULEA 4A2AA 4CGGA 5BREA 1LW0B 2FPHX 2YKOA 2F7TA 3FSXA 4BGDA 3U3GA 2X1AA 1N36J 2R7QA 1Q7LB 4NE9C 4FNIA 3A8IA 4EYIB 2DUYA 2F4VK 3ULEB 3MDAA 4DUYJ 2AHOB 2PBDA 3CQ8A 2Q1NA 4H03B 2A6MA 5J8YA 2HSZA 2RKIA 5ALZA 3OYCA 4KHMA 5AM4A 1F9HA 4ERDA 1TGOA 2P6UA 3ENQA 4M9LA 1ZQKA 5E7OB 3QBCA 1U0HA 3M32B 2W41A 2V9WA 4YY3K 1IO2A 2OPQA 5AIAA 1SV5A 2CYYA 2Q0UA 5AKYA 3MOZA 2A6AA 2P5OA 3FEZA 4CJLA 2PMZC 2PFDA 1XO1A 5GIOA 1IBLK 2E5LK 2ZEJA 4OJHA 1IG6A 3AVJA 3QUTA 3UPQA 2MHEA 4FYXB 4DCPB 2DXEA 4C4TA 3D9BA 2XMUA 2VYPA 1OVYA 1Q53A 3IC1A 4BQLA 1RBAA 1VOMA 2MZJA 1EKRA 5T14A 4JI7J 4BRGA 3GOIA 2WC9A 3DGPB 4NMLA 4Y2CA 4TNOA 2FBYA 2I7PA 2GELA 1OMSA 3ZT1A 1HX1A 3FCHA 4C6AA 1PCAA 1JI7A 9ICBA 2HNDA 4K4ZA 2FGCA 5KFQA 4K8RA 1M1HA 3O9SA 2MXYA 3G4SS 1TK8A 2KB2A 1X40A 2HHSA 3SQGA 2M70A 2Z1GA 4JI8K 2DR8A 2ASPA 3WXLA 5KFRA 4CFCA 2Z2MA 1RWPB 2PC6A 4IDKA 4K0KJ 2PFPA 4Z6CA 3GJTB 1BQXA 3RJHA 4K8ZA 2DEIA 1HA1A 1QJHA 3NF8A 2FBTA 5CA5A 2BDPA 5IT9O 3NCRA 1NUEA 3HFKA 4YFKA 3DXSX 3TQ1A 1SPBP 4EFAC 1WAFA 4M3WA 2RPIA 5L38A 1QM9A 2XMAA 1NGIA 2XHCA 3L9ZA 3PX0A 5DGAA 4KGKA 3MWTA 3G4SN 2DTUA 4NWIA 3CCVN 3H5XA 1Q8KA 2RRAA 3DLEB 4M04A 3D5MA 2HOEA 3QT5A 1X66A 5DK5A 2WFBA 2UXBK 2A40A 3CETA 4ZVSB 1K44A 2JNJA 3AXKA 1UWBA 4MTPA 4W92B 5GINA 3QATA 1V97A 2JL9A 4CM2A 1AT1B 1W2BR 1F0MA 3HP9A 1O0PA 3KKFA 3ZSVA 4FVUA 1U1PA 4CJEA 2WF7A 4O5KA 2IMWP 5ADXH 3M1YA 4A47A 2H3GX 1VRUB 3AA9A 3RJKA 2QL9B 2FDRA 1S4FA 4K4IA 4A8EA 2H3EB 3NNHA 4LH5A 2KVCA 2WSCC 3WK8A 1MA9B 3L0QA 3UN3A 5JJBA 2F96A 2QEXN 1VQ8N 4BRPA 4N41A 4I2CA 4OO1J 4YOTA 3BS9A 1RWKB 1LAWA 5CH7B 1ZQLA 2XLIA 2R7TA 3ZZ0A 4KLLA 2KT2A 5LL6d 4PGXA 1NKEA 4C3LA 1JROA 1A6LA 2HQFA 1LK7A 2YHBA 4KLDA 3G96A 2DBBA 3LZJA 7ICUA 2HHWA 3RW6A 2YPZA 1WSGA 1PSDA 5ETLA 1IBMJ 1GTHA 2ABYA 4LC9B 3MTJA 1RTIB 5BPLA 4LMZA 2CQ2A 2XMVA 3C6UB 4QZHA 4DEZA 4X5VA 4ZP7A 4C7YA 1TL7B 2FHJA 3MMCA 2OPPA 1NKBA 2VA2A 4FJGA 2GQQA 1BWFO 5KG4A 2QLWA 2UXBJ 4JK9A 1RDUA 4I6MB 1RU2A 2FPMA 3MZIA 4Y2TA 4UZBA 1RFQA 5K8PA 1SQGA 1Q86O 4DFKA 4G1IA 3FBFA 1UFWA 4WYBA 1DTQB 3BO3A 5KFAA 1EETA 4NZ0A 4ZVUB 4FLUA 4JEPA 1VQ5N 4CRXA 3OR2A 5CJ7A 4YXJA 5C10A 2APOA 4DWIA 5E3AA 4FF2A 4AL7A 1NSQA 1VQLN 3MGJA 1AUSL 1RT5A 4GY2B 2M5YA 3WKDA 1IJEB 3VF0B 5KGXA 4O5EA 3VR1A 3H08A 2VFRA 1HHTP 3FZHA 1FKPA 4CJ3A 4XO0A 2XULA 4FWPA 8ICCA 1L8OA 4CGFA 3C3LA 2EG1A 1FT8A 4XK8C 1T94A 4X2BA 4O3QA 2IM3A 4KY3A 1SS6A 3BDEA 2CGJA 5B09A 1VJQA 4RU9A 2J7UA 1VBXA 3M2VA 4PPZA 4NLSA 4P0QA 3ETRA 5J2EA 5HRRA 2AEMA 1DKGD 4LBIA 1R8PA 1YRXA 3TTDA 3UQ2A 3V6DB 3LTOA 3T9ZA 3BM7A 4YY3J 2VQEK 1WI8A 2HBJA 1PYTA 4DQSA 1L6NA 1UOCA 1U4BA 4L3NA 3R9KA 3DOKA 2CWKA 3S6EA 4IH6A 3DCAA 1RLDA 3T69A 4X84A 5D15A 1S6PA 4PABA 1VC6A 4PL1A 3MF5A 1VBYA 2HBQB 1YRTA 1Q3VA 4N8OA 2XC9A 1VRQC 1UHUA 3KK3B 2OSRA 5E79U 2KRBA 2F8SA 5DQHA 4BRAA 3WNHA 1M5PC 1CUKA 3M30A 3V9WA 1B64A 1RT3B 2ROEA 4ALZA 3DOKB 4L6V3 3WT0A 2IAJA 4IG3A 3AO3A 3NASA 4JN4A 4BUGA 2KL8A 1SVDA 3M1VB 2E1PA 3NRWA 2B6AA 5KFSA 2VC0A 3D6MB 3EL2A 5J0OA 4ZPAA 2RQCA 3RYLA 3C16A 3POTB 1CJTB 5J2DA 2OTJS 1ZRMA 3M1FA 4CF5A 4DF8A 3LP1A 3VGUA 3AA3A 4OGCA 3O3FA 4YOYA 1C1CA 3R5GA 3BGLA 2X1BA 2HBZB 4E7KA 4B9MA 3TFRA 2OPQB 2HFOA 4Z37A 2OKQA 2D3ZA 1A7GE 1JCGA 1P1TA 3VEXA 3HF5A 2HHHJ 1U0HB 1U49A 3LAMA 4BBYA 5ALYA 2VIHA 3E2EA 2OMOA 4PWWA 4JYAF 4EO6A 4OD0A 9ICHA 4IKAA 3BPDA 2XWXA 4K4WA 5JTIA 4AQYF 2ASOA 4E1JA 4FE3A 2OELA 4OKJA 2ZUAA 2IYIA 4BS2A 4A8WA 3S6JA 3WC0A 5AHXA 1SGGA 1FERA 2ZZTA 4CK3A 4YORA 4BR5A 4EI2A 4P71A 1KDNA 2K4PA 2GMHA 2KQ2A 5BR8F 2ZH1A 1FHTA 3W5YA 3AQPA 4L73A 2W7PA 4JKHA 3BH6B 2FJDB 2HSEB 3TTFA 1CS4B 4XDCA 4KLJA 2NXCA 3R97A 3OPKA 1OIAA 1UWBB 1RABB 2NYIA 5HMMA 1C0UA 2N4CA 2HYIB 1V9PA 2OJ3A 4YUDA 2F3JA 4DQQA 1HL6A 4P2MA 3GB0A 3EGWB 2CPDA 3RW7A 3UIQA 4KSEB 1NK9A 3W61A 3QSIA 3POTA 3WUHA 1ZZFA 4NJ8A 4WFAL 1ED1A 1JCEA 3J8AA 3WDOA 4W90B 4KMOB 1RBRA 1RDDA 2RQ4A 3F5TA 1UFLA 2O8EA 4O4GB 1RKJA 2J0QD 2DK2A 3DMJA 3S1TA 4DR4J 4OLOA 5AQMA 3QYYA 1CQNA 1JCFA 1X6IA 3GWCA 5F41A 1I51B 1A5XA 3RJEA 2XBPA 3QZ8A 3BREA 1AA1B 2YWWA 4H54A 3CC7S 3R2CJ 4MHVA 5EOZA 5GAGU 5CR4A 4DR2F 3UCZP 3PMNA 4IO9L 5D4PA 1U1NA 2NUUG 2RE1A 3GU3A 4ZVRB 5KG6A 3EMTA 1IIPA 2V34A 4XTTA 2DHGA 3WX4A 2DNPA 4JKGB 1QVGR 3WNGA 4HL9A 4UBCA 5J2NB 2VWKA 1MQ3A 3IAM9 4YCXA 1EWRA 4LFCK 4KHSA 3UKRA 2HVHA 2FLOA 5KL8B 4K41A 1T6CA 2ZDPA 2ZZNA 2VPZB 3OFFA 5BR8K 2DISA 3NLCA 4KLIA 3NE6A 3CJKB 1WEYA 2G4BA 4PG6A 3LGNA 2VG6A 4R25A 1BPDA 4QJVA 1JLEB 4DKWA 3DXBA 4JS5A 3TOQA 4ILJA 4DV0J 3NGSA 4Q43A 1IM4A 2RT3A 3AY9A 5C24A 4TKTA 2K1RB 3DKDA 1YRUA 2HF4A 2F9WA 1M5KC 5DETA 1S1XA 3ISNC 1TL1B 1J2NA 4Y2JA 1VAZA 3GONA 2QXLA 3TU5A 1HNIB 3AO4A 2GOLA 5AXKA 5L1IA 5K8OA 4LBHA 3NRZA 4BVOA 1Q5YA 4FM2A 3EE9A 4OHYA 4JKDA 1NU0A 5A8KB 2V94A 2V8GA 4RUHA 1REVB 1RT4B 2YVSA 3A8EA 3CGIA 2OP5A 2YXLA 1FKPB 3Q8RB 3C1ZA 9ICCA 3OYNA 1T3NA 1EKEA 2V0NA 5AK3A 4S0MA 3EY1A 1M5SA 1CZAN 2XRIA 4H0TB 5J2QB 1BA1A 1BI4B 4CHPA 3AO5A 2OLWA 2XMJA 3D0IE 4DQIA 2BW7A 5F8GA 4K42A 5J2FA 5DB9A 3N4QA 2P1JA 3H40A 2AMCB 1S99A 1PJ7A 2J8SA 4PQUA 1XJWB 1K6YA 2B43A 3H2LA 2UUCJ 4CZMA 1GLLO 1IKVB 3ONQA 4OZ1A 5A0LA 2HPUA 2OYYA 4W5QA 4KLTA 2RIJA 3DLGA 3FMBA 4JOUA 4DX5A 4PG8A 1H73A 3CCUS 2PE8A 3KZXA 3K5MA 2G9OA 3TYTA 1P90A 2E2OA 4HDGA 4B3TK 1IQZA 4ILLA 1UJ6A 3AVIA 2R8KA 1NSKL 1P27B 5DB8A 3I55N 2HAIA 3MPWA 3W65A 2FJXA 2PA3A 3HHKA 3Q7BA 2RP5A 5KFIA 1N56A 5CWRA 4B9SA 4BG9A 3LDNA 2W3SA 5AXMA 2E9RX 3HKZC 8ICNA 3KHHA 4Z4GA 2G0AA 2DH7A 1NK4A 2R2SA 3MMAB 1S0VA 3O5BA 2MKCA 3MAQA 3OJUA 3W64A 5GAEU 1S72S 3ZDEA 2AEJA 5IM0B 4OJPA 1UT5A 2NLWA 4DPXA 4WIIA 3OSNA 1QE1A 1RWVB 4WKYA 2ZM6K 3C95A 3ISND 3EICA 2LDIA 3I0RB 1NMDA 3P4IA 7ICRA 5AQYA 2E7WA 2WB4A 3RUBL 2R8GA 3IS9A 3THYB 5ETKA 1PC4A 4LFBJ 1GNKA 3CM5A 1Q86T 2LEAA 5KFKA 2V2KA 3VQEA 2CH6A 4M9JA 3ITHA 2YNHA 8ICEA 3H8JA 1YK9A 5I9EB 5KPRA 5AM2A 2D3O1 1L7OA 4YMNA 1S4EA 2JR5A 4WFBQ 2ZTEA 4F91B 4YMMA 4ED2A 1JXBA 3CJCA 2LVWA 5LM7E 2DCUB 3I0SA 3OFHA 4MLEA 2P51A 3H20A 1PBAA 4F9OA 3UMBA 2V67A 5HMWA 3AA4A 4QR0A 4H4OA 3SCKE 3KLEB 5EE0A 3I55S 4BHQA 5BN9A 4DLEA 2AJ0A 1B0TA 1UZDA 9ATCB 4JI7K 3H25A 2RVJA 1HR0F 4U7BA 2O1PA 2UP1A 3LP1B 4LF4F 2P6TA 2JWLA 4H0VB 5IS2A 3CUNA 2DHXA 2PMWA 4Q2LA 1CJKA 4DSFA 3LP2B 2EKYA 5KOXA 2JX2A 4I7FA 2CDRB 4I2HA 3F0NA 4UAYA 4ICLA 4WYWA 2N82B 3RAQA 2C2OB 1BQMA 1VQMS 2LCWA 3A1YG 3OTCA 3VV2B 4F4XA 3JPQA 1IWAA 1R6VA 3SPZA 5AQZA 5DDQC 1MN8A 1DJ0A 4FJIA 4UOFA 4DOBA 1WACA 1FXXA 4LR9A 1WC0A 1T95A 2WB1C 2N1RA 1Q3UA 1WWHA 2GVDA 3FBCA 1SCJB 2F63A 5ELZA 3CC4S 4L76A 4LD0A 2Q3SA 1N52B 1RT2B 5C7PA 1SXLA 4P4MA 2H5EA 5AQOA 3SR6A 4TUPA 1BY9A 2CJQA 2VGMA 1PILA 4KO0B 2VPWB 1CJUB 1XMBA 4QIWF 2H51B 1X5SA 1ZYQA 2LEBA 3HHEA 4DUZF 2W25A 1UEVA 4EIAA 8ICVA 1JK9B 3V1QA 4KRWA 3OS2A 5DG7A 2ZJRL 3DC2A 1T9WA 2XZWA 1I5OB 4FWOA 4OJGA 3UE2A 5KAFU 1U6ZA 4AT1B 4FJ8A 4J90A 2JHDA 4A8KA 4JS4A 1UCVA 5E3PA 1OO0B 2E7XA 3QSYB 2ZH6A 5AI9A 5DDRC 4CESA 7ICLA 3FEYB 2GUIA 2QC3A 4AHRA 4I7FB 3MHYA 2HSTA 3TAEA 8ICMA 4UZCA 2ZJQQ 1RDCA 2NCKL 3H0RB 2HFNA 4BE2A 4A57A 4DV4F 3QZ7A 8AT1B 2IHMA 2J7WA 2Y8WA 5BR9A 2F3NA 2HBYB 3I76A 2FB0A 4PH5A 4N5SA 4OPAA 2YQ3A 1HI1A 2FPLA 4QZIA 2BHNA 2HDOA 1KCFA 1NSAA 2Z1JA 2KM8B 3CQXA 5F8MA 1CS4A 2NRVA 1RAGB 2BJ3A 1Z4OA 4TSXA 3CWJA 2LDYA 2KVQE 1W25A 4DFPA 7ICKA 4DG1A 3O3LA 3VA0A 2V4RA 1L7PA 4FJJA 1KFDA 1KVBA 3DLRA 4WF9L 5E2QA 4J2DA 2O4IA 3MCAB 4DTOA 1NOMA 1V3SA 4Y6IA 2QV6A 2XZTB 2XHBA 2DPNA 1T7PA 2W4CA 3TAPA 4QNLA 1OVQA 1ECWA 4M47A 2EDUA 4XPEA 4I2QB 1KRPA 4DN9A 4Z7YA 1S1UB 4CFDA 1VQ4N 4MFBB 3SDEB 4ACOA 4PHPA 5KGWA 5J0QA 4CO2A 3HSZA 3O9QA 4H5VA 4DQPA 2ZC4A 2AQ4A 1Y10A 2WB1F 3VERA 1IUJA 3VHQA 2H3VA 1GX5A 2HRTA 2P9LA 9ICJA 3MMVA 2RJZA 3A0IX 3C6UA 3J81Y 4FK0A 4RL1A 1X4BA 2OPSB 3KK2A 4DSKA 4NEZA 2D9OA 2HHXA 1I3OB 1T3VA 4AHTA 1EWQA 5IIIA 2BEFA 1Q4RA 4UAVA 2RHKA 4HH1A 1VR6A 2B5JA 4K2JA 2RS2A 4K59A 1DTTB 3VAIA 1K1QA 3G82A 3PR4A 1FEHA 4FF4A 4K2XA 2HBLA 8ICYA 2AJQA 3IR5B 3RRGA 4OYBA 1O1WA 3M1VA 3QWPA 3CTRA 3GCXP 4ZVTB 3HJFA 4Q2MA 2HBRB 1RT7A 2LEPA 3RBZA 4F67A 2BKNA 3NH0A 2IC3B 4LF6K 4OJ5A 4EAHD 4HVZA 4DHVA 5C25A 4EP4A 3SFGA 3LDLA 1HWIA 4J9SA 1TL3A 4UW2A 3PIOL 8ICPA 2MY7A 1DGSA 3K5NA 1U1RA 2GV1A 4USMA 3M05A 2ZVIA 4NXMJ 3IDWA 4FS2A 3P4UB 4CF4A 4RW4B 1WCNA 1FXRA 1QQ6A 2DNGA 4IWVA 4YB1P 2QM1A 4O0JA 5AICA 5DDYA 3TSPA 4F04B 3PW5A 4B3OB 3DLJA 2Q66A 3U02A 2DQNB 1S7IA 3BGOP 1HBMA 4F36A 2DGOA 3G6ES 2Z0GA 5AK6A 1TAQA 2V8VA 2YKQA 5E5NA 3V4MA 4YHHK 3MUMP 4KC5A 2EC0A 1TUYA 4PGQA 3H45C 3C6TA 5HQ8A 2HGLA 1UQVA 4RQ4A 3EPIA 1KP6A 2WONA 1RTZA 1UPPA 4B3MF 1DXSA 2OPRA 4P73A 3EKSA 5DLGA 1K8AT 5LJVA 1RJJA 4K0KF 1VDVA 2AJ2A 2MJNA 2PT0A 5HROA 4FJ5A 1Y88A 2HF3A 3CNHA 3C2LA 3SLCA 1F9FA 1N6QB 3VQ7A 4R0EA 3H0MB 3Q8PB 1WKJA 3MD1A 3CT9A 4FJLA 3T5KA 1KAYA 2DGQA 2P9GA 4DPOA 4M7XA 1URJA 4PPDA 3M2RB 1ZQIA 2YKMA 4DHYA 3HKWA 1QAIA 3WK7A 1KVCA 3L2QA 1ZQGA 3QAUA 2VONA 3RH6A 1VQYA 2D6FC 3BZKA 3O6QA 1O5JA 2E1EA 1WSIA 3N7PD 4L3QA 1BIUA 1ZA2B 2UVUA 1YSJA 3ZSWA 3C2PA 4CLZA 3CCSN 4FWMA 3IN5A 5BYSA 2OA8A 1UKUA 3TA2A 5F9LA 1QAYA 2LQBA 1FF2A 4C7ZA 4P52A 3U6FA 1OH5A 4XH5A 2P8IA 3D1HA 1L3VA 4I9LA 3Q86A 4JI8F 1JNRB 2EANA 2GUPA 2JGAA 4JUZA 3N6LA 3FGVA 4YOUA 2PI5A 3VAKA 1WC6A 2GMLA 5HVGA 5J2BA 2P9UB 1MWQA 3FBEA 3G71N 2B56A 1FKOA 1RT6A 3WXKA 3D7SB 3E0FA 1S9EB 1SIZA 4DR1F 4BR0A 4F3OA 1X60A 2ASJA 3R5DA 1LOUA 1RXVA 3OS0A 2CJYB 4MO4A 1T9XA 2FC0A 4FO0A 1KFTA 4C11B 4PGYA 4I6WA 4DZ6A 1WAJA 2KXHA 2BGGA 3Q8YA 2RILA 3ZETB 4I6YA 1X4DA 2CXYA 2AEFA 3G8QA 2CPZA 2QSWA 4MO5A 4PL8A 3C7NA 4QZ8A 3G9CA 1N32J 1OPIA 9ICVA 5KPTA 1VSLA 1JNZB 4ZJOA 4ETZA 1IBKK 2YMLA 5GAHU 3AVKA 1HNWK 2VQFJ 1K1SA 5J2MA 3H7IA 2D4WA 2XMTA 3HPHA 1C1AA 4P75A 1YJRA 3J7ZT 5B5EU 2X74A 4C48A 2N7YA 5AM3A 1F44A 2NYHA 5CP2A 3VEVA 4EYHB 3AN1A 1R6YA 2ASYA 3KFWX 4U8YA 5LSRA 1X31C 2E29A 2GHWA 1NGAA 3HVTB 4C1NK 3CJ5A 1RNHA 2FY1A 4UQGA 1WOOA 3AV9A 4J03A 4OHVA 4K7QA 3FK4A 4Z4IA 3IBPA 4MKBA 4C4RA 4XH1A 4FBTA 3VOVA 3OD2A 4JK8A 3OYDA 3D2FA 2JVOA 2K3IA 4TURA 1D9AA 4WWSA 1U6FA 1RPLA 2OI2A 2ZQBA 1B0PA 4X65J 4DV6K 4JKBA 3D6TB 3DYAA 4Y00A 2BE2A 1RWXB 4PKDB 3QEBZ 1TE2A 2IC3A 3HVAA 2AP6A 2LYHA 3GIRA 1HPZB 5D4LA 3D67A 2LQ5A 3HVWA 4LJXA 3A12A 1WOSA 2JEIA 1NLKL 3RJFA 5E3CA 3ENOA 3VEZA 2LU1A 2BOAA 3J81j 3ETLA 2FLPA 1W9HA 5GMKa 2QEXS 4D3GA 3I4PA 1DEJA 2Q4TA 1MSWD 3KLGA 2OIHA 2G8WA 4PXDA 4O3SA 4LVNP 2F9DA 9ICRA 1F0XA 4KBIA 1ZH5A 4CZGA 4AXIA 1VK0A 4DR6K 3G82B 1YGYA 4C9DA 2KSOB 1U2VB 2GBZA 4IL6U 1X9XA 2WCXA 3PRDA 1WEXA 1BMQB 4OYAA 2DY4A 4HR2A 5HHHA 4C98A 3T41A 3ZSZA 1M1KT 4BWJA 2ESEA 3ISDA 2PSZA 2WBRA 1HNWF 1JL2A 4AL6A 4OJ6A 3EPGA 3FQLA 1ZXIA 4NPOA 1RAEB 1RUSA 1KL9A 3EE3A 3PYDA 4CJTA 3SPYA 3CW2C 1BQNB 3RJMB 1JN3A 2WFAA 4AD6A 4DV0K 3BF1A 1N0UA 5CHCB 4RW9A 3SK3A 4Z4FA 3PCOB 5DBCA 3OS1A 4TU7A 2UXCF 4A5BA 3JYTB 3V6DA 3QNNA 4YHHJ 1P9YA 2QT7A 4KREA 3I32A 3HLUA 3TNVA 2ZUDA 2MZQA 4AHCA 1M1KO 4EGLA 1VQMN 4E1NA 2BE9B 3QPIA 1H7WA 3ZTRA 3ZTOA 3QBWA 2GWKA 1B3TA 2DBYA 1B9FA 4RWTA 4M1KA 2QGFB 1U2CA 1HNIA 1N5XA 2W11A 2VF3A 3KLFA 5DLFA 3TABA 4GO7X 3MGVA 1OYEA 2KVIA 3UW1A 2H48B 1RAHB 9ICKA 2CIMA 2VJVA 1G4CA 3PV8A 2XG8A 3KNGA 4PZNA 1CLFA 4CYUA 1U7LA 1Z6RA 5D46A 3DI6B 3UDCA 4DSEA 1ITGA 2AU0A 4Y2AA 3TSUA 3TEHB 2ZG6A 1V9OA 3MD3A 4ZVPB 3PW4A 2R7SA 1YHQS 3MC1A 4CHYA 3WK6A 3EE8A 2JZBA 2RRNA 2GAHC 1D8ZA 2UUBJ 4WFNQ 2QW9A 3KOOA 2KT5A 4N7TA 4IXCA 3O2IA 1S9EA 2ASMA 4LF8K 2WSEC 3Q8MA 2YMQA 4YD2A 4Z94A 1YTUA 1SQEA 2VZ9A 5KFPA 2LMIA 1G7CB 2MAXA 2GIQA 2C1EB 5IV3A 3TX0A 4C80A 2NO5A 2BRLA 2Q31A 3IUCA 4Y2SA 3MCSA 3HCXA 2WRMA 1EQ0A 2XI2A 4I2FA 2QKQA 3OYBA 3HHNB 5M1KA 2R4FA 3ZLJA 4A46A 4B3MK 2LFVA 2B4JA 1NNLA 4XQ8A 1KAZA 4B9NA 4HACB 2HOQA 2ZH3A 2HB5A 4ZCLA 4WQ4A 4GMKA 4DO9A 4RW6B 2V4JA 4X4SA 4ELTA 3HP6A 5ETSA 5J2KA 1LV5A 4Q7AA 4ANCA 4FWQA 2YKMB 4GKKK 2GQCA 2RRBA 4BC4A 1Y3KA 2V7YA 1NGJA 2C3YA 2HZCA 2XY8A 1LW0A 1AZSA 4CD1A 5DS7A 1F5AA 2I1RA 1RU1A 2XGPA 2GX8A 2GCFA 1N6QA 2PZSA 3KJQB 5KT3A 1KR4A 4B9VA 1OQ6A 3SSSA 4JRPA 4CK2A 4X4TA 1U02A 3KUEA 4CF3A 3VA3A 3NF7A 3D2NA 3U27A 1I3AA 3PX4A 3ZZPA 2EFOA 1P8GA 2W2MP 2QXFA 5I3UA 4HHTA 4ZLNA 4WE1B 7ICFA 3FRZA 4DTXA 1U9LA 2GEMA 2EAOA 3AFGA 3OQ2A 1NG9A 4ED5A 2E88A 1GOAA 2KN4A 1SH3A 4P0PA 4LJMA 2HIQA 4LIWA 2RHFA 1NWKA 2W3RA 1FRIA 4DSIA 5LJWA 2ZIWB 3M9NB 4EX7A 3I56S 4DUYF 2K06A 3D45A 3I28A 1J97A 5AE2A 2YX7A 5IXUA 3RJJA 2WW8A 4WYLA 2ZJAA 4DPTA 3D6JA 4JI1J 1KXPA 4ID8A 1RBLA 3CYMA 4WPAA 3Q8UA 1RG6A 3CCJN 2JVRA 2XNQA 2IDOA 5ALHA 4DL7A 5KAIU 1IV8A 2KOBA 3BYPA 3ZT4A 2UV8A 4KI6A 4CEBA 3BGRB 4DR5F 3PW0A 3IWLA 1Q16B 1EZZB 1WHYA 4P9SA 3EUB2 5I4MA 2MQPA 3VGTA 4ECUA 5I3PA 1IWGA 2QB0A 3CG7A 4FXVA 2P9IB 1GFWB 3JS6A 5LJ3Y 1L8LA 4C8KA 3T1YK 4A8XA 5FLXY 1F5CA 2J9CA 3ZTSA 1HBOA 3C5GA 3DU5A 5DB6A 1S76D 3UD4P 3V7KA 3OJSA 4BE0A 1YZ7A 1GMWD 2Y0BB 3GFXA 1XMQK 4JV1A 5DG8A 5AE3A 3H98A 1XNRF 4JI5K 1RT2A 3SD7A 2MKJA 3HFZB 2HHHF 4CDIA 4YN4A 3FFKB 4O44A 3L4QA 2Z4PA 2LXUA 3THXA 1VSIA 3B82A 4C7QA 4YR0A 3WNEA 2HNYA 4IR9A 1FFWB 2MLXA 1WKKA 3C8YA 1RZMA 1BNOA 2V8DA 1YTYA 1IBLJ 2DCLA 3HSDA 2M8DB 5JRTA 3EXCX 3CMAS 1HKAA 2CVEA 2IM2A 7FDRA 1X4AA 2YB4A 1XUPO 5HK4A 4MF8A 2ZITA 1FWLA 1ASVA 4LSLB 4NLGA 4U7UK 3DI6A 2GJ2A 8ICBA 1DBDA 3GR1A 4PY5A 3PR5B 4BR4A 4I2JA 9ICAA 5AKIA 1GAOA 5ETRA 1Q0NA 3VAFA 3P5JA 1SI9A 1BLUA 4MIBA 4JHDB 1VQ9N 3I9ZA 3R6MA 4KX5A 5LMNF 3SI6A 4GVMA 2HQCA 3CCQS 4Y2XA 4I29A 5EDWA 4RNFA 3VALA 3MAAA 3JPNA 2YNIA 4WTOB 1VQNS 1HWLA 1PAUB 2PKEA 4DOAA 2EAMA 3D4JA 4H8KA 4TY8A 4KRFA 5IOLA 3FCWA 4GMJB 1QUVA 3AD8C 2IRYA 1I39A 1X42A 2V52B 2R42A 3DDKA 4HI2A 4KJIA 1J6ZA 4C23A 2E8MA 1QUPA 1LXJA 4RNMA 2F8MA 4JI5J 4LF6J 1CZ9A 4ECSA 3IM8A 4DR2J 3FQKA 1UCNA 3V81B 4G1QB 2UXDF 4CEEA 2K60A 1RKIA 1R0AA 2ZUGA 5EXWA 2KHQA 4O0NA 3R8EA 4RW8B 4DDFA 2DKZA 4BRDA 4A8QA 3JYTA 3UD3P 1KVIA 2CH5A 1X5TA 3IGVA 3K4GA 1GH8A 2A0FB 2FD2A 5TZVA 3MEGA 5J0WA 3WKEA 1KLNA 3UKRB 4DS4A 3TFSA 3CDWA 3NAIA 1SL0A 1ZM4A 3WXIA 3BJYA 1DARA 4ECWA 3J81U 3ENHA 2QG9B 4FL9A 3CF5Q 2RN2A 2KICA 4ZOHC 4J8FA 4WU3A 5LMUJ 2W1BA 4LF9J 1S7HA 3BGRA 4F4WA 1WCLA 2PI4A 2OD4A 3PRVA 4CLYA 5I3QA 3H5YA 2OTLN 1N32F 4NASA 2BPFA 5HLFB 2JFDA 1TZ0A 3THWB 1S1VA 4HAIA 3QDKA 3MECB 2KT3A 4CNYA 2QARA 3K5OA 5FJ4A 1CI4A 4UAWA 4DL0C 3TADC 4PHTX 1R3NA 4OZ3A 2FHMA 5M1FA 1QY7A 2PFOA 3Q8KA 4M2YA 3GFKB 2NRXA 2O4GA 5GMEA 1YJVA 2NQPA 1VQ6S 1C20A 4JI0F 2VQEJ 1GLCG 1MC8A 1N54B 1X4CA 5M1OA 2X51A 1FO1A 5DM6Q 2FVRA 1D9DA 3RU0A 4WKRA 1XIQA 3UD5A 3KLIA 1S6UA 4X65F 1XMOF 3WEEA 3GLJA 4A8OA 2OSQA 4B1XB 2JSXA 2BM0A 4ZVHA 4MIAA 4LF7K 2FJVA 8ICOA 2MSSA 1S6QB 5ALVA 5JVHQ 5KFZA 2F76X 2P9PA 1ATSA 3SBTA 3J81O 4DR7F 4XDDA 3BQ2A 1UVMA 4CHNA 3DWLA 5B0DA 4RPFA 2AZ3A 3HILA 4H5RA 7ICPA 3DXMB 1COOA 3OXGA 1SC3B 4BDPA 1S9FA 5DJBA 2K7JA 1GOCA 1QHAA 4E7IA 3NS1A 1S22A 1K0VA 2BE7D 5CHIA 5KFFA 2O3DA 4DTUA 3VF2A 4KHYA 3CCEN 2LI6A 5JUMA 1FKOB 4AFFA 4DV3F 1UTAA 4NXNJ 1SV4A 3T3FA 2FJWA 3D6HB 4ZKAA 3MN6A 3ZT0A 3CRXA 3AHPA 3DRYA 4RO0A 2F65A 4F5PA 3QNOA 1QQOA 3NF6A 4JKGA 5AQIA 5KFUA 3IKMA 3TP2A 2YWFA 1CJVA 3P3DA 5F3ZA 2J9EA 1WDTA 4GKJK 2XWYA 3MCOA 2MKKA 3ZXWA 1Y97A 1TKTA 5ALSA 2W9BA 2QTDA 1X9SA 2DFEA 4O0IA 2V51B 4NV0A 2V4JB 4MF2A 8ICFA 1U8WA 5ALTA 3DRSB 5CYMA 4X65K 2Q79A 3TWZA 4KQZA 3SMSA 2OFGX 1WSEA 2HAFA 2CZ9A 3M32A 4E0DA 2MKSA 4DI6A 2WF6A 4NO7A 3KG1A 3ZD9A 2ZOFA 1TYQB 3H3NO 2EWSA 2KO1A 3TVZA 4CO4A 3OW2M 4JV0A 4HCCA 3GZFA 5EVZA 3QEVA 2YKNB 3OYFA 4KB1A 3GG0A 1N62A 5K9FA 2Y1IA 2BQUA 4LH4A 4X62K 4FM0A 3B8AX 3B78A 1RK8A 3BR9A 1N5TA 3M8SA 3H6EA 3KHYA 8ICQA 1TVRA 2JOQA 5FPDA 2ATCB 5E26A 2L08A 2XSJA 4JV5K 5CZVA 3AT1B 3NVWA 3QGPA 3A5OC 3LDPA 2Y1LB 1VLBA 1KC8T 1VC5A 1IBKJ 2EFQA 1TUUA 4BXOB 4NLNA 3HZ6A 4B02A 4M6WA 1BISA 2E8OA 2RHSB 2BRKA 2I5JB 1HKCA 2P9NA 1Z1BA 4MK9A 4OKEA 4A61A 5SZTA 5IILA 3AJ1A 1ESVA 5GTHU 3BZCA 1B70B 2WTFA 2B9EA 2KYZA 1WOPA 4R63A 1JX4A 1NNEA 1FJ7A 3HX9A 4Y2QA 4W98A 2G06A 3NH2A 1T9UA 2G2ZA 2Z7JA 1RE1B 2UUAF 2R2UA 1MROB 1WC3A 3AGKA 4KKOA 1CSJA 4DR6J 2VANA 2POKA 4DR2K 4DS5A 1H74A 4QWEA 2EVZA 4M3UA 2W2OP 2DH9A 2P2CB 1L7MA 2DB1A 4UB2A 2D3OR 4MEXA 2O8BA 2FF3B 3JXOA 4K50A 1LVHA 2JHEA 1B0VA 3VVTA 3ZSYA 2CNOB 2GC8A 1RBSA 3MX2A 4JV2A 2V2VA 2F2AB 9ICWA 3VAGA 1RHJB 4QZ9A 3NXZA 1BC6A 4Y2UA 3I5BA 4PL7A 1HI0P 1YDLA 4U67L 1A76A 4Z6FA 4CIOA 1RCOB 4J9UE 2BUPA 1KLMA 4CF8A 2G8UA 1NGEA 1D8LA 4NLWA 3NGZA 2B6AB 1DTTA 2G0IA 4RT3A 2MYFA 4YOWA 1LWFA 3G6XA 1WOQA 2VG5B 3B0YA 4H0XB 5MLCQ 1FFVA 4HWIA 5AQSA 5CB1A 2Z57B 3CCJS 1K8AO 2FF6A 4LUBA 1FRXA 2XO7A 4CJRA 1HPMA 3U3YA 4JYAJ 4JBCA 1UJ5A 2W9MA 1HMVB 1UFKA 2E66A 1C1BB 4M5GA 1DQ9A 2NRRA 1R8CA 3W2WA 3DLGB 1FK9A 4OJ1A 4A8MP 3CSKA 4M5NA 5H9EJ 1QTMA 4QQBA 2XB2D 3C28A 3QRQA 3VEWA 4M5DA 4KTQA 3F56A 4IS7A 5ETVA 3A5MC 1XNRJ 1TL5A 4K8XA 3KK2B 3CMAN 1HNXF 1KN5A 4H4OB 4DFJA 2B7BB 4OYWA 2G0JA 4FJKA 2RDDA 1SL1A 4U6PA 4N76A 2MMYA 3Q2TC 2DEJA 4DJBA 2JJ4D 3CERA 3ZEUA 1NAQA 4MYUA 3QMLA 4FOIA 1NI3A 5CYQB 2ASDA 2NREA 5AI4A 2FJ6A 3OFEA 3TUIC 5ALMA 1RB0A 1K73O 5J1NA 2ZKUA 3IMQJ 3KKRA 3KLHA 4FWRA 2J76E 3PW7A 1S1TB 1HBNB 2DIUA 1Y5NB 4DR5J 2KEYA 1MU2B 4RZRA 2PIIA 1OY6A 3VGVA 3IMXA 1VQON 3FYHA 3I0RA 4HVJA 5ADXA 4DR4F 4NMXA 5IINA 3SAHA 3LPEA 1VIOA 2QWPA 2C2DA 2KN7A 1HKGA 5A2QU 1D1UA 4DFMA 4P74A 3SCJE 3LVVA 5THWA 3T1YF 4DU4A 4B3SJ 3QERA 2ASLA 2UUBK 4M6WB 3T79A 3QGHA 1QS4A 2E8PA 1JLCB 5ALJA 3C29A 4ED3A 3AEVA 4XIUA 9ICIA 5CYMB 1NM1A 1OPZA 1RGIA 1TMJA 2G8FA 3OVSA 1LXNA 2OH2A 1YBAA 5DM7Q 2RF2A 4RPZA 2VWJA 4DUTA 2WUSA 3NNAA 2VWBA 3HSJA 5KFMA 1WORA 4O4RA 1OH8A 3VAJA 4NM1A 5JMVA 4WTYA 4P7VA 3J7ZO 1WC1A 1U1LA 2EBGA 4KLMA 2FGOA 1AZSB 1O51A 1YTAA 2ZNYA 1R43A 3E66A 4ITSA 4L72B 2BKEA 1JMTA 2A1BA 3DJCA 3TZWA 1LOTB 1RWNB 1DAXA 4KLEA 3G8TA 5ETTA 4ZVEA 2YX4A 2BANA 2M2BA 1NGDA 4CW7B 1FJGF 4EBDA 3QEXA 3ZSQA 3QFHA 3R1LA 2XYGB 1ZBFA 5F2RA 3LDQA 2CJXB 3M9MB 5IC4B 4OX7A 3E01B 4QS7A 4P10A 4XRHA 3SNNA 3GJRB 3NWRA 4GXKA 2OTLS 4IOAL 3TJ9A 4NA2A 2DKXA 2NV3A 2GVDB 4A8SA 3VQSA 3WK5A 3I9V9 5HRSA 2RF2B 5E3RA 3HVRA 4YMEA 1E4FT 3DNCA 2QO3A 4FF1A 1KHVA 3NAHA 2IJRA 5GAGI 1WBBA 2WONB 2A10A 4O3NA 1C4AA 4BDZA 3FDSA 2HNZA 2PMZD 4ZPWR 2XI9A 4GW6A 1UL3A 1K47A 2V50A 1TKXA 2KU7A 1TVAA 2QMWA 3IBWA 4Y34A 2V6AA 3C15A 3CFOA 2K89A 1IH7A 3J7YI 1XC3A 2N4DA 2YNFB 1S8OA 3BBCA 3RB4A 3R7BB 5T7LB 3AVBA 2EFNA 4CRJA 1KS2A 4F71A 2RLTA 4RW9B 2F8KA 2HKEA 1LAVA 2A3JA 3JSYA 4KHNA 3CCRS 4DCOB 5FDLA 2YWEA 4F25A 5KAKA 4Q8FA 2OGUA 2ZH5A 2VPYB 4DV7J 1J5EK 4FKYA 3HX0A 4CJVA 1ATRA 1FD2A 4C8OA 3J80U 5AZJA 4KHPF 2KDOA 2VG6B 4CDGA 3UDLA 2QMXA 4H0OA 4KN7A 3W66A 4LF8F 3K59A 2MSTA 4LRDA 1Y4ZB 1FEEA 4Y2RA 3M4XA 5DGBA 3O8WA 1WUDA 2NSCA 4ILHA 3JAMY 3SEOA 2G2YA 2Q2RA 4CEFA 4ZHRA 3DV9A 4V19X 4JI3F 3WQUA 1YHQN 2QA1A 4J2BA 2MGZB 3GYNA 1HNVA 2JGUA 4QZVB 3CD7A 1HD0A 2FY8A 4M5DB 4K4YA 1PJ6A 2IIRA 3CC2S 1XNSA 3RZAA 3IGNA 2YBVA 3OUYB 5F0UA 2HWTA 4I67A 5KFTA 2LYBA 1NPPA 1FE0A 3FLCO 1S9GB 1VSMA 2VD3A 2YQEA 1HYVA 4UB3A 1FTRA 2UXBF 1VLYA 3OA9A 3M8RA 1FA0A 2QJ3A 2DNLA 2QYCA 4C0OC 3OHAA 1NGGA 1J54A 3O8MA 1FFGB 1TELA 1WLJA 4YD1A 1ZQDA 1DURA 2B9XA 2P9PB 4IQVA 4CO0A 4BC7A 5A76A 2BACA 4NYPA 2JH7A 2K8GA 1BU6O 1LKZA 1CC8A 3QGGA 3UNGC 4LIRA 5U47A 1VSHA 1Y0HA 1N33K 1AQ6A 2K4HA 2ZWOA 1QSYA 4CE6A 1JXVA 2FC9A 2G13A 4AYBC 3SFUA 1FTCA 5AKLA 3WEEB 1RCHA 4NCBA 4USIA 1ZXOA 5CCLA 2YKPA 3SQ0A 3I5AA 2DPJA 4IOXA 1RT4A 1UT8A 1RISA 3ISZA 3DLLQ 2KMDA 2F44A 4BX9C 1RTHA 2R9LA 1CG2A 4QIVA 3PW2A