4DQYB

Structure of human parp-1 bound to a dna double strand break
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
SKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for DNA damage-dependent poly(ADP-ribosyl)ation by human PARP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords Poly [ADP-ribose] polymerase 1
total genus 37
structure length 136
sequence length 136
chains with identical sequence E
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4dqyB01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dqyB02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
4XZQB 4H9SA 1KRLA 5B40D 2BYMB 4JJNA 3AV2A 3W97D 1TZYB 1S32D 5DNNA 4E44A 4WU8B 5B33D 3MGRA 1ID3D 2Q4ZA 3REHD 3AZHB 3UT9A 1AOID 2Y0SA 1RNIA 1TAFA 3NDJA 1YIT1 1HQ3C 5CP6A 5T6BA 3HOWI 5T64A 3S15I 4WNNA 2PK7A 1KX5C 3RELC 5B0YC 4ZUXC 4XZQC 5AV5D 3AZGA 1P3KC 3ESWA 3WA9D 3WKJB 1N8R1 4A3BI 4X6AI 3REJC 3MGQC 1Q811 4XX2A 2Y2NA 3AZEC 3M3YI 1QYPA 4NE6A 3AZHC 3AV1D 1EQZC 2F4OA 4KGCD 5DNND 2NVXI 3I07A 4UUZA 1YJN1 4X23D 3UT9D 1PFTA 1RLYA 1SIWA 3BG0B 1VQ8Z 1QVGY 4TNUA 5JRGD 3F6TA 3CCR1 4J8WB 3WTPC 3NQJB 3CCRZ 1K8A2 4WV4B 3TU4C 1LQLA 3IF8A 4E2WA 1N1JA 2BJOA 3EPHA 5FLXb 2E2JI 1YI2Z 3AZFC 3B6FD 1QVGZ 1P3AB 4H9SC 2JUBA 3EG5B 4NBGA 3I551 2NQBC 4HGAB 3C1CD 3S1RI 1KX3A 1YJ91 2OZKA 2V8IA 4YS3A 3CCUZ 3CCLZ 3KWQA 2Y2GA 3AZJC 2V3VA 1P3OA 3JAMf 1KX4B 5A2Qb 5B0ZD 2YFVB 2YFWA 5AVCD 2RVQD 3VH6T 4Z66C 2CV5B 4BBRI 1P3PB 3I56Z 3I561 1WWSA 4HGAC 4QTTA 1ULYA 5GXQC 5B31G 1P3IA 3CCSZ 2HF1A 3NQUA 5B31C 5B2JC 2NZDC 3AZLD 3GKQA 3NH8A 3VTNA 5C4XI 4R8PA 2GTHA 3F3FC 3IFUA 2RT9A 1M1K2 4YS3D 2Y2IA 5FUGA 5CPID 2F8NB 1M19B 2CV5C 5AV8B 2YU9I 1R4VA 4JJNB 3WAAD 3AV2B 1Y8CA 5F99B 1TZYA 5AV9C 1Q862 3WTPA 1VQNZ 1VQM1 2Y2MA 3X1VD 1VQMZ 3LZ0C 3MGRB 3KUYD 1TWHI 2M48A 1P3ID 4E2ZA 3LELD 1TAFB 4J8XA 5CP6B 3B6GC 2QREB 5D1PA 1P34B 2E2II 2NQBA 1M19C 4YM6C 3AZGB 2RBLA 3C1BD 5A2Qf 3JAMb 3CCV1 2RHBA 4Y52I 3OW2Z 5B2ID 2Y2KA 2OOYB 3AN2C 3REKC 3F3PC 5AN9F 3HOXI 1BFMA 2EGTA 2OTL1 2LFUA 2F8NH 4H9QA 3IX0A 3LUSA 2I3CA 4DRBA 2HIOD 3BG1B 1H3OA 4WU8D 5DNMD 5CP6C 5B33B 3MNND 3KUYA 1M1AD 1U35D 2F8NG 2VF1A 1VQ6Z 5FLXf 2PMZA 3TDHB 3MGSC 4G92B 4XUJD 3AZIC 2IO5B 3NDIA 3GTJI 3UTAC 2NVQI 1N1JB 3WKJD 3MZLB 5B32G 1QVFZ 1Y1VS 2PYOC 1YIJ1 3NH5A 1YIJZ 2DF4C 4A3MI 5B33C 1JJ2Y 1WJ2A 3REHC 1AOIC 1P9NA 3CCS1 1KX3B 2YADA 2Y2OA 4NBCA 5DNMA 2IO5C 3MNNA 1U35A 1KX5D 1T3UA 4R8PC 5B0YD 4ZUXD 5AV5C 5B32A 4DRAA 3KWQB 1KX4A 3WA9C 2H85A 3AZMC 1M18A 4J8WD 1Q7Y1 2PYOB 2YFWB 2CV5A 1Y1WI 1P3PA 1W2BY 1VQN1 3I55Z 2NVYI 1EQZD 3W99B 1I50I 3TE5B 4KGCC 5DNNC 1YJ9Z 5C4JI 2ZY4A 3C1CB 4RVGA 4A3CI 4R8PB 2ZY3A 4QLCA 4J8XC 4EWCA 2F8NA 1KU5A 1VLAA 3VH6W 1M19A 3TU4D 5AV8A 4A3GI 3X1TB 4ZBJC 5B0ZB 5F99A 3AZFD 3CMEZ 5AVCB 1P3FB 3WTPB 2JIPA 3J80b 3KXBC 3S2HI 5AV6D 1YUAA 4KUDC 3CC41 3C1CC 3OW2Y 1YITZ 3S17I 4J8XB 1K8A1 2DQNC 1P3BC 3AZLB 1P34A 4J8VB 5CHLB 2NQBB 3REHA 3V9RB 2W03A 2LEXA 3MVDA 4A3EI 4MD8A 3REIC 3TU4A 5AVCC 2R7ZI 4WJ3C 2R93I 3AZJB 1HTAA 5GT0B 4JJND 2JSSA 1KQSZ 1S7MA 4H9QB 2W04A 5GXQD 2JCHA 2F8NK 4E2XA 3Q87A 3QWUA 1H3OB 2CWEA 5B31D 5B33A 5B2JD 3KUYB 2NZDD 4H9NB 5B1LA 4M6BA 1KQSY 5CPIC 1Q16A 4WU9B 3GTLI 4NH1C 2M6NA 4MD9A 3S14I 4A3DI 2KPIA 1M18C 3WAAC 5B2IB 3MGPC 5JRGA 5AV9D 1HQ3A 5CPJB 5AV8C 1ZB9A 3H0LC 3VH5A 4E45A 3LZ0D 3KUYC 1ZLAC 4H9PA 5GXQA 3LELC 3EPLA 1P3IC 1TFIA 4NBFA 2WB1A 3MNNB 5DNMB 3B6GD 2E2HI 1B6WA 1U35B 5FLMI 5B32B 4DQYB 3A6NB 3HKZA 3UTBD 1M18B 1TWGI 3G4S1 5B2IC 3MGPB 5C3IB 2PYOA 3AN2D 2JR6A 2BYKA 4YM6B 5CPKA 3CMA1 4E2YA 3GTQI 3W99A 3S1NI 2HIOC 2ZY5A 3CC4Z 4WU8C 3X1UD 4RVDA 3LZ0A 3LJAA 4MH4A 3C1CA 1U35C 1M1K1 1ZB8A 1KX3D 1M901 4QLCB 3MGSD 2FJ7B 3B6GA 3UTAD 2HU9A 3VH5T 5C3IC 3W96A 5C3EI 3X1TA 3WKJC 4J8UA 3H3VJ 5B0ZA 5CPIA 1W2EA 2PYOD 5AVCA 1P3FA 3I4MI 1USPA 5T67A 1YUKA 1K83I 3VMIA 1PZRA 1B67A 1P3OC 4A3II 2DE7A 2R92I 2UWXA 3AZLA 1WZNA 3X1VA 4J8VA 4R8PD 3AZNA 3REHB 3V9RA 3LELA 3AZMD 5E5AC 3MVDB 4J8WC 1RO4A 3TU4B 2OTLZ 3X1TD 3KWQC 3AZJA 3CME1 5GT0A 5BO0B 3C1BA 4LD9D 3J81f 3PO2I 4H9RB 1S721 2XD1A 4H9NA 5B1LB 2HUEB 1S72Z 1Q7Y2 4J8XD 4WU9A 1Q812 5B24A 4Z5TC 1WCMI 4MRIA 3CPWY 3G4SZ 5BT1D 5AVBC 4HH4A 4XUJA 5B2IA 5JRGB 3B0CW 1HQ3B 5CPJA 1VQ71 3KXBD 3VH5W 3U50C 3CC7Z 5AV6C 5KDMA 4KUDD 5CPKC 4H9PB 5GXQB 4E31A 3IP4C 3CPWZ 1P3FC 5B31B 1P3BD 1P3AD 4NFTA 3LJAC 4NBDA 3O62C 1VQOZ 2NAPA 3AZEB 4A3LI 3A6NA 2JNYA 2F2AC 4WU9D 5AVBB 3IR7A 3KSYA 3MGPA 3REID 1ZH1A 3W96C 2BYKB 5B1MA 5B0YA 2O4HA 4YM6A 4JJNC 1KX4D 5CPKB 2Y2PA 4NBAA 4A3FI 3LZ0B 3LJAB 1P3PD 4KHAB 5GT3C 3O62B 3AL0C 3WTPE 1WW9A 1VQ5Z 1P3MB 2JIMA 2FJ7A 4NBEA 2XD5A 3B6GB 3CCE1 1QF8A 2B63I 2P28A 2JA7I 1BH8A 4NE5A 1S32A 3W96B 2IZ3A 4G91B 1ID3A 4A93I 4J8UB 1M18D 3MGPD 3H0GI 5CPIB 2RPRA 5GSUC 1USPB 2DE5A 1F66C 2GU2A 5AV8D 3J80f 5AV5A 1YJW1 5GT3B 1ZLAD 2QEXZ 3WA9A 5BNXB 3AZFA 3D6WA 4A3JI 3X1UB 1YHQ1 1Q9CA 2QA41 3X1VB 2QA4Z 5AV6A 1X0TA 3CCVZ 3MGRD 3AZNB 3LELB 3X1SC 3UTBC 1Q861 3AV1A 3UTAB 1NJI1 1F1EA 5GSUB 1Z2CB 5BO0A 3C1BB 3D9XA 3FKII 3CC71 5BS7A 4H9RA 4RS4A 3X1UC 1AA6A 1KX3C 1VQO1 2G5HC 1P3LB 2HIOB 2G5IC 5AY8B 1M1AB 3B6FA 5B24B 3MGQA 1WIIA 1I3QI 3CCMZ 5BNVA 3MVDD 3GTOI 4XUJB 1Z03A 1P34C 1NP6A 5KDMB 3I4NI 3GCFA 1VQPZ 1P3OD 1KC81 3CD61 3CD6Z 1QVFY 3EEDA 5B31A 1VQ51 3J7A4 1VQLZ 5B1LD 2AROB 3B0DC 3AZEA 3CCEZ 4NOZA 3VB9A 4NBBA 5E5AD 2FFFB 5AVBA 3AZKC 3CC21 3RZOI 2VQRA 2JMOA 3GTMS 1KX5B 3X1TC 5B1MB 5B0YB 4ZBJB 3KWQD 2ZM5A 4AYBA 4BBSI 2P3YA 4BXXI 2ZY2A 3UTBA 4LD9C 3EERA 2R6MA 3AYWC 2QKDA 3CMAZ 1VQKZ 3R45A 3KXBB 2QRDB 2VPYA 5IT9f 1YJWZ 3GTMI 4KHAA 3O62A 4EO5B 2VPZA 1P3MA 3WAAA 2LY8A 1P3BB 1EQZB 2VUGA 1VQ9Z 1TZYD 3PO3I 3AZKB 4MD7A 5IT9b 1BH8B 4Z5TD 1S32B 1ID3B 5BT1C 2L5AA 4RVFA 5E5AA 5AVBD 1QXFA 2Y2QA 3REIB 2V8KA 3CXCZ 5AV5B 5CPKD 5GT3A 3HOUI 4EO5C 3AFAA 5BS7C 3WA9B 5BNXA 3AZFB 3LZ1A 1P3FD 3X1UA 3W98D 1P3AC 3LJAD 2E7ZA 2F4MA 3O62D 3K7AI 5AV6B 2DE6A 3HOVI 3HOYI 3G711 3H0MC 2BG1A 3AV1B 3UTAA 4WU9C 3W99C 4Z5TA 4CSRB 3MZKB 3W96D 5GSUA 4J8VD 2AKLA 4J8UD 2VUMI 4X23B 1KX4C 2G2KA 2ZAEB 1Q822 3GTGI 4HGYA 2QEX1 5C44I 1P3PC 5GT3D 1ZLAB 1YHQZ 1K9M2 3RELB 1P3KB 4CAYA 4LD9A 1VQ41 2K5RA 1P3LA 3B0CT 3W98A 1ML8A 2HIOA 5AY8A 3B6FB 1M1AA 3REJB 3G6EZ 5B2JB 3MGQB 2NZDB 3G6E1 3REKA 3S1QI 2Y2JA 5BNVB 1P3MC 5GSUD 3B0BA 1F66D 2IZ4A 3M4OI 4ZUXA 1I6HI 4AWLC 3AZIA 2E9HA 3FDDA 2AROA 3MGRC 4NE3A 5GT0C 4QTUA 4HGZA 3X1SD 5AY8D 3CCM1 4A3KI 1KX5A 3HOZI 1JFIA 5B32D 3AZNC 2VPWA 3A6ND 2OTJ1 3UTBB 1AOIA 1Y1VI 1VQP1 3R45B 3KXBA 1FDOA 4E33A 1L1OC 1TWFI 4MXUA 3AFAC 1VQL1 2NVTI 2JA6I 4Z2MH 3P5JB 3LZ1C 1EQZA 1P3BA 5F99D 3WAAB 4H9OA 1NUIA 4UPKA 3AZKA 5CPJC 4NBHA 3CXCY 2JIRA 3VH6A 4Z66B 3X1SA 4Y7NI 5E5AB 3MVDC 1P3LC 2FJ7D 1X3WA 2JIOA 3REIA 5D1OB 3VMGA 5B24C 5B1MD 4KGCA 1P34D 1P3GD 4E30A 1M902 1DL6A 3AZGD 3AFAB 3LZ1B 3EPKA 5B1LC 1VQ91 2HUEC 1NJI2 3VMHA 3AZKD 3AV2C 4CSRA 4Z5TB 1VQ61 2AROC 1RO0A 4RVHA 3T4NB 1KC82 4X23A 2KI7B 3AZMB 4QLCC 3AYWD 2QRCB 4NB8A 1SFOI 3S1MI 2JE5A 1P3GA 5IP9I 1YI21 1ZLAA 3RELA 1P3KA 4CAYB 4LD9B 3D2LA 3W98B 1TZYC 5AV9A 3REJA 3G71Z 5B2JA 2NZDA 1JJ2Z 3REKB 1FDIA 5B40C 4BY1I 1N8R2 3W97C 2QR1B 4E32A 1S32C 3FQMA 1ID3C 4ZUXB 3KIHA 1BH9B 3AYWA 3CQZI 5JA4B 5G49B 3AZIB 1HQ3D 1VQ4Z 3W98C 3AN2A 2J8PA 2QLVB 2Y2LA 3RELD 1P3KD 4KUDB 4XZQD 2OTJZ 3FQQA 1Z02A 5B40B 1JWHC 4NB9A 4S1TA 5IP7I 3REJD 3W97B 3W99D 3MGQD 3CC2Z 3S2DI 4J8VC 4G91C 2LIYA 1A7WA 4J8UC 1JFIB 3AZED 2K3RA 2V45A 2WAQA 3RZDI 1VQK1 3PO3S 3MGSA 3AV1C 3AZHD 1AOIB 3GTPI 1F66B 2JA8I 1RO2A 2JIQA 2IV2X 4X23C 3UT9C 4NFRA 1K731 5JRGC 4H9OB 1N2FA 3S16I 3WTPD 4XZQA 4Z66A 3X1SB 2V8JA 1P3MD 2BYMA 5D1OA 3B6FC 4KGCB 1RQFA 5DNNB 4WU8A 3KFUG 2NQBD 3NH4A 1R9TI 3AZHA 3UT9B 3A1KA 1VQ7Z 4WNNB 4DK1A 1X3ZA 3AZJD 2PM9A 5GT0D 4AWLB 2Y2HA 3WKJA 5AY8C 5B0ZC 4BY7I 2RVQC 4Z66D 1Q821 1KD12 5B32C 3AZND 3CCJ1 3A6NC 3CCJZ 3AZMA 2JA5I 2JS4A 1K9M1 2Q51A 1K732 1P3GB 1Z01A 3AZLC 1WWIA 4UUZB 1W2BZ 3AFAD 1TWAI 2VPXA 3CCQ1 3CCQZ 3LZ1D 1TWCI 4YS3C 5F99C 2J6AA 3EPJA 5AV9B 3CCU1 4J8WA 5CPJD 2RIQA 3NQJA 3NFZA 3B0DB 2CV5D 4RV9A 1P3LD 2FJ7C 5B24D 5B1MC 1P3AA 3GTKI 3X1VC 1P3GC 3KIFA 3A1IA 1BH9A 3AZGC 3AYWB 4DGLA 1YJNZ 5JA4A 5G49A 1VQ81 4YS3B 2F8ND 4WZSB 3AN2B 4Z2MG 4KUDA 1M19D 4YM6D 1P3OB 3C1BC 5B40A 3MONA 2W8SA 1KD11 3W97A 3AV2D 2YFVA 3REKD 2O53A 2AROD 2AYDA 4QLCD 3MGSB 4G92C 1P3IB 2GTIA 2OOXB 3J81b 1F66A 4MONA 1M1AC 3NQUB 5DNMC 5CP6D 3MNNC 4CL1A 3H0RC 3CCL1 5LL6f 3AZID 4XUJC 5CM2M 5FUGB
chains in the Genus database with same CATH topology
4XZQB 4H9SA 1KRLA 5B40D 2BYMB 4JJNA 3AV2A 3W97D 1TZYB 1S32D 5DNNA 4E44A 4WU8B 5B33D 3MGRA 1ID3D 2Q4ZA 3REHD 3AZHB 3UT9A 1AOID 2Y0SA 1RNIA 1TAFA 3NDJA 1YIT1 1HQ3C 5CP6A 5T6BA 3HOWI 5T64A 3S15I 4WNNA 2PK7A 1KX5C 3RELC 5B0YC 4ZUXC 4XZQC 5AV5D 3AZGA 1P3KC 3ESWA 3WA9D 3WKJB 1N8R1 4A3BI 4X6AI 3REJC 3MGQC 1Q811 4XX2A 2Y2NA 3AZEC 3M3YI 1QYPA 4NE6A 3AZHC 3AV1D 1EQZC 2F4OA 4KGCD 5DNND 2NVXI 3I07A 4UUZA 1YJN1 4X23D 3UT9D 1PFTA 1RLYA 3BG0B 1VQ8Z 1QVGY 4TNUA 5JRGD 3F6TA 3CCR1 4J8WB 3WTPC 3NQJB 3CCRZ 1K8A2 4WV4B 3TU4C 1LQLA 3IF8A 4E2WA 1N1JA 2BJOA 3EPHA 5FLXb 2E2JI 1YI2Z 3AZFC 3B6FD 1QVGZ 1P3AB 4H9SC 2JUBA 3EG5B 4NBGA 3I551 2NQBC 4HGAB 3C1CD 3S1RI 1KX3A 1YJ91 2OZKA 2V8IA 4YS3A 3CCUZ 3CCLZ 3KWQA 2Y2GA 3AZJC 1P3OA 3JAMf 1KX4B 5A2Qb 5B0ZD 2YFVB 2YFWA 5AVCD 2RVQD 3VH6T 4Z66C 2CV5B 4BBRI 1P3PB 3I56Z 3I561 1WWSA 4HGAC 4QTTA 1ULYA 5GXQC 5B31G 1P3IA 3CCSZ 2HF1A 3NQUA 5B31C 5B2JC 2NZDC 3AZLD 3GKQA 3NH8A 3VTNA 5C4XI 4R8PA 2GTHA 3F3FC 3IFUA 2RT9A 1M1K2 4YS3D 2Y2IA 5FUGA 5CPID 2F8NB 1M19B 2CV5C 5AV8B 2YU9I 1R4VA 4JJNB 3WAAD 3AV2B 5F99B 1TZYA 5AV9C 1Q862 3WTPA 1VQNZ 1VQM1 2Y2MA 3X1VD 1VQMZ 3LZ0C 3MGRB 3KUYD 1TWHI 2M48A 1P3ID 4E2ZA 3LELD 1TAFB 4J8XA 5CP6B 3B6GC 2QREB 5D1PA 1P34B 2E2II 2NQBA 1M19C 4YM6C 3AZGB 2RBLA 3C1BD 5A2Qf 3JAMb 3CCV1 2RHBA 4Y52I 3OW2Z 5B2ID 2Y2KA 2OOYB 3AN2C 3REKC 3F3PC 5AN9F 3HOXI 1BFMA 2EGTA 2OTL1 2LFUA 2F8NH 4H9QA 3IX0A 3LUSA 2I3CA 4DRBA 2HIOD 3BG1B 1H3OA 4WU8D 5DNMD 5CP6C 5B33B 3MNND 3KUYA 1M1AD 1U35D 2F8NG 2VF1A 1VQ6Z 5FLXf 2PMZA 3TDHB 3MGSC 4G92B 4XUJD 3AZIC 2IO5B 3NDIA 3GTJI 3UTAC 2NVQI 1N1JB 3WKJD 3MZLB 5B32G 1QVFZ 1Y1VS 2PYOC 1YIJ1 3NH5A 1YIJZ 2DF4C 4A3MI 5B33C 1JJ2Y 3REHC 1AOIC 1P9NA 3CCS1 1KX3B 2YADA 2Y2OA 4NBCA 5DNMA 2IO5C 3MNNA 1U35A 1KX5D 1T3UA 4R8PC 5B0YD 4ZUXD 5AV5C 5B32A 4DRAA 3KWQB 1KX4A 3WA9C 2H85A 3AZMC 1M18A 4J8WD 1Q7Y1 2PYOB 2YFWB 2CV5A 1Y1WI 1P3PA 1W2BY 1VQN1 3I55Z 2NVYI 1EQZD 3W99B 1I50I 3TE5B 4KGCC 5DNNC 1YJ9Z 5C4JI 2ZY4A 3C1CB 4RVGA 4A3CI 4R8PB 2ZY3A 4QLCA 4J8XC 4EWCA 2F8NA 1KU5A 1VLAA 3VH6W 1M19A 3TU4D 5AV8A 4A3GI 3X1TB 4ZBJC 5B0ZB 5F99A 3AZFD 3CMEZ 5AVCB 1P3FB 3WTPB 3J80b 3KXBC 3S2HI 5AV6D 1YUAA 4KUDC 3CC41 3C1CC 3OW2Y 1YITZ 3S17I 4J8XB 1K8A1 2DQNC 1P3BC 3AZLB 1P34A 4J8VB 5CHLB 2NQBB 3REHA 3V9RB 2W03A 3MVDA 4A3EI 4MD8A 3REIC 3TU4A 5AVCC 2R7ZI 4WJ3C 2R93I 3AZJB 1HTAA 5GT0B 4JJND 2JSSA 1KQSZ 1S7MA 4H9QB 2W04A 5GXQD 2JCHA 2F8NK 4E2XA 3Q87A 3QWUA 1H3OB 2CWEA 5B31D 5B33A 5B2JD 3KUYB 2NZDD 4H9NB 5B1LA 4M6BA 1KQSY 5CPIC 4WU9B 3GTLI 4NH1C 2M6NA 4MD9A 3S14I 4A3DI 2KPIA 1M18C 3WAAC 5B2IB 3MGPC 5JRGA 5AV9D 1HQ3A 5CPJB 5AV8C 1ZB9A 3H0LC 3VH5A 4E45A 3LZ0D 3KUYC 1ZLAC 4H9PA 5GXQA 3LELC 3EPLA 1P3IC 1TFIA 4NBFA 2WB1A 3MNNB 5DNMB 3B6GD 2E2HI 1B6WA 1U35B 5FLMI 5B32B 4DQYB 3A6NB 3HKZA 3UTBD 1M18B 1TWGI 3G4S1 5B2IC 3MGPB 5C3IB 2PYOA 3AN2D 2JR6A 2BYKA 4YM6B 5CPKA 3CMA1 4E2YA 3GTQI 3W99A 3S1NI 2HIOC 2ZY5A 3CC4Z 4WU8C 3X1UD 4RVDA 3LZ0A 3LJAA 4MH4A 3C1CA 1U35C 1M1K1 1ZB8A 1KX3D 1M901 4QLCB 3MGSD 2FJ7B 3B6GA 3UTAD 2HU9A 3VH5T 5C3IC 3W96A 5C3EI 3X1TA 3WKJC 4J8UA 3H3VJ 5B0ZA 5CPIA 1W2EA 2PYOD 5AVCA 1P3FA 3I4MI 1USPA 5T67A 1YUKA 1K83I 3VMIA 1PZRA 1B67A 1P3OC 4A3II 2DE7A 2R92I 2UWXA 3AZLA 3X1VA 4J8VA 4R8PD 3AZNA 3REHB 3V9RA 3LELA 3AZMD 5E5AC 3MVDB 4J8WC 1RO4A 3TU4B 2OTLZ 3X1TD 3KWQC 3AZJA 3CME1 5GT0A 5BO0B 3C1BA 4LD9D 3J81f 3PO2I 4H9RB 1S721 2XD1A 4H9NA 5B1LB 2HUEB 1S72Z 1Q7Y2 4J8XD 4WU9A 1Q812 5B24A 4Z5TC 1WCMI 4MRIA 3CPWY 3G4SZ 5BT1D 5AVBC 4HH4A 4XUJA 5B2IA 5JRGB 3B0CW 1HQ3B 5CPJA 1VQ71 3KXBD 3VH5W 3U50C 3CC7Z 5AV6C 5KDMA 4KUDD 5CPKC 4H9PB 5GXQB 4E31A 3IP4C 3CPWZ 1P3FC 5B31B 1P3BD 1P3AD 4NFTA 3LJAC 4NBDA 3O62C 1VQOZ 4A3LI 3AZEB 3A6NA 2JNYA 2F2AC 4WU9D 5AVBB 3KSYA 3MGPA 3REID 1ZH1A 3W96C 2BYKB 5B1MA 5B0YA 2O4HA 4YM6A 4JJNC 1KX4D 5CPKB 2Y2PA 4NBAA 4A3FI 3LZ0B 3LJAB 1P3PD 4KHAB 5GT3C 3O62B 3AL0C 3WTPE 1WW9A 1VQ5Z 1P3MB 2JA7I 2FJ7A 4NBEA 2XD5A 3B6GB 3CCE1 1QF8A 2B63I 2P28A 1BH8A 4NE5A 1S32A 3W96B 2IZ3A 4G91B 1ID3A 4A93I 4J8UB 1M18D 3MGPD 3H0GI 5CPIB 2RPRA 5GSUC 1USPB 2DE5A 1F66C 2GU2A 5AV8D 3J80f 5AV5A 1YJW1 5GT3B 1ZLAD 2QEXZ 3WA9A 5BNXB 3AZFA 3D6WA 4A3JI 3X1UB 1YHQ1 1Q9CA 2QA41 3X1VB 2QA4Z 5AV6A 1X0TA 3CCVZ 3MGRD 3AZNB 3LELB 3X1SC 3UTBC 1Q861 3AV1A 3UTAB 1NJI1 1F1EA 5GSUB 1Z2CB 5BO0A 3C1BB 3D9XA 3FKII 3CC71 5BS7A 4H9RA 4RS4A 3X1UC 1KX3C 1VQO1 2G5HC 1P3LB 2HIOB 2G5IC 5AY8B 1M1AB 3B6FA 5B24B 3MGQA 1WIIA 1I3QI 3CCMZ 5BNVA 3MVDD 3GTOI 4XUJB 1Z03A 1P34C 1NP6A 5KDMB 3I4NI 3GCFA 1VQPZ 1P3OD 1KC81 3CD61 3CD6Z 1QVFY 3EEDA 5B31A 1VQ51 3J7A4 1VQLZ 5B1LD 2AROB 3B0DC 3AZEA 3CCEZ 4NOZA 3VB9A 4NBBA 5E5AD 2FFFB 5AVBA 3AZKC 3CC21 3RZOI 2VQRA 2JMOA 3GTMS 1KX5B 3X1TC 5B1MB 5B0YB 4ZBJB 3KWQD 2ZM5A 4AYBA 4BBSI 2P3YA 4BXXI 2ZY2A 3UTBA 4LD9C 3EERA 2R6MA 3AYWC 2QKDA 3CMAZ 1VQKZ 3R45A 3KXBB 2QRDB 5IT9f 1YJWZ 3GTMI 4KHAA 3O62A 4EO5B 1P3MA 3WAAA 2LY8A 1P3BB 1EQZB 2VUGA 1VQ9Z 1TZYD 3PO3I 3AZKB 4MD7A 5IT9b 1BH8B 4Z5TD 1S32B 1ID3B 5BT1C 2L5AA 4RVFA 5E5AA 5AVBD 2Y2QA 3REIB 2V8KA 3CXCZ 5AV5B 5CPKD 5GT3A 3HOUI 4EO5C 3AFAA 5BS7C 3WA9B 5BNXA 3AZFB 3LZ1A 1P3FD 3X1UA 3W98D 1P3AC 3LJAD 2F4MA 3K7AI 3O62D 5AV6B 2DE6A 3HOVI 3HOYI 3G711 3H0MC 2BG1A 3AV1B 3UTAA 4WU9C 3W99C 4Z5TA 4CSRB 3MZKB 3W96D 5GSUA 4J8VD 2AKLA 4J8UD 2VUMI 4X23B 1KX4C 2G2KA 2ZAEB 1Q822 3GTGI 4HGYA 2QEX1 5C44I 1P3PC 5GT3D 1ZLAB 1YHQZ 1K9M2 3RELB 1P3KB 4CAYA 4LD9A 1VQ41 2K5RA 1P3LA 3B0CT 3W98A 1ML8A 2HIOA 5AY8A 3B6FB 1M1AA 3REJB 3G6EZ 5B2JB 3MGQB 2NZDB 3G6E1 3REKA 3S1QI 2Y2JA 5BNVB 1P3MC 5GSUD 3B0BA 1F66D 2IZ4A 3M4OI 4ZUXA 1I6HI 4AWLC 3AZIA 2E9HA 3FDDA 2AROA 3MGRC 4NE3A 5GT0C 4QTUA 4HGZA 3X1SD 5AY8D 3CCM1 4A3KI 1KX5A 3HOZI 1JFIA 5B32D 3AZNC 2OTJ1 3A6ND 3UTBB 1AOIA 1Y1VI 1VQP1 3R45B 3KXBA 4E33A 1L1OC 1TWFI 4MXUA 3AFAC 1VQL1 2NVTI 2JA6I 4Z2MH 3P5JB 3LZ1C 1EQZA 1P3BA 5F99D 3WAAB 4H9OA 1NUIA 4UPKA 3AZKA 5CPJC 4NBHA 3CXCY 3VH6A 4Z66B 3X1SA 4Y7NI 5E5AB 3MVDC 1P3LC 2FJ7D 1X3WA 5D1OB 3REIA 3VMGA 5B24C 5B1MD 4KGCA 1P34D 1P3GD 4E30A 1M902 1DL6A 3AZGD 3AFAB 3LZ1B 3EPKA 5B1LC 1VQ91 2HUEC 1NJI2 3VMHA 3AZKD 3AV2C 4CSRA 4Z5TB 1VQ61 2AROC 1RO0A 4RVHA 3T4NB 1KC82 4X23A 2KI7B 3AZMB 4QLCC 3AYWD 2QRCB 4NB8A 1SFOI 3S1MI 2JE5A 1P3GA 5IP9I 1YI21 1ZLAA 3RELA 1P3KA 4CAYB 4LD9B 3W98B 1TZYC 5AV9A 3REJA 3G71Z 5B2JA 2NZDA 1JJ2Z 3REKB 5B40C 4BY1I 1N8R2 3W97C 2QR1B 4E32A 1S32C 3FQMA 1ID3C 4ZUXB 3KIHA 1BH9B 3AYWA 3CQZI 5JA4B 5G49B 3AZIB 1HQ3D 1VQ4Z 3W98C 3AN2A 2J8PA 2QLVB 2Y2LA 3RELD 1P3KD 4KUDB 4XZQD 2OTJZ 3FQQA 1Z02A 5B40B 1JWHC 4NB9A 4S1TA 5IP7I 3REJD 3W97B 3W99D 3MGQD 3CC2Z 3S2DI 4J8VC 4G91C 2LIYA 1A7WA 4J8UC 1JFIB 3AZED 2K3RA 3RZDI 2WAQA 3PO3S 1VQK1 3MGSA 3AV1C 3AZHD 1AOIB 3GTPI 1F66B 2JA8I 1RO2A 4X23C 3UT9C 4NFRA 1K731 5JRGC 4H9OB 1N2FA 3S16I 3WTPD 4XZQA 4Z66A 3X1SB 2V8JA 1P3MD 2BYMA 5D1OA 3B6FC 4KGCB 1RQFA 5DNNB 4WU8A 3KFUG 2NQBD 3NH4A 1R9TI 3AZHA 3UT9B 3A1KA 1VQ7Z 4WNNB 4DK1A 1X3ZA 3AZJD 2PM9A 5GT0D 4AWLB 2Y2HA 3WKJA 5AY8C 5B0ZC 4BY7I 2RVQC 4Z66D 1Q821 1KD12 5B32C 3AZND 3CCJ1 3A6NC 3CCJZ 3AZMA 2JA5I 2JS4A 1K9M1 2Q51A 1K732 1P3GB 1Z01A 3AZLC 1WWIA 4UUZB 1W2BZ 3AFAD 1TWAI 3CCQ1 3CCQZ 3LZ1D 1TWCI 4YS3C 5F99C 2J6AA 3EPJA 5AV9B 3CCU1 4J8WA 5CPJD 2RIQA 3NQJA 3NFZA 3B0DB 2CV5D 4RV9A 1P3LD 2FJ7C 5B24D 5B1MC 1P3AA 3GTKI 3X1VC 1P3GC 3KIFA 3A1IA 1BH9A 3AZGC 3AYWB 4DGLA 1YJNZ 5JA4A 5G49A 1VQ81 4YS3B 2F8ND 4WZSB 3AN2B 4Z2MG 4KUDA 1M19D 4YM6D 1P3OB 3C1BC 5B40A 3MONA 2W8SA 1KD11 3W97A 3AV2D 2YFVA 3REKD 2O53A 2AROD 4QLCD 3MGSB 4G92C 1P3IB 2GTIA 2OOXB 3J81b 1F66A 4MONA 1M1AC 3NQUB 5DNMC 5CP6D 3MNNC 4CL1A 3H0RC 3CCL1 5LL6f 3AZID 4XUJC 5CM2M 5FUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 4XZQ B;  4H9S A;  1KRL A;  5B40 D;  2BYM B;  4JJN A;  3AV2 A;  3W97 D;  1TZY B;  1S32 D;  5DNN A;  4E44 A;  4WU8 B;  5B33 D;  3MGR A;  1ID3 D;  2Q4Z A;  3REH D;  3AZH B;  3UT9 A;  1AOI D;  2Y0S A;  1RNI A;  1TAF A;  3NDJ A;  1YIT 1;  1HQ3 C;  5CP6 A;  5T6B A;  3HOW I;  5T64 A;  3S15 I;  4WNN A;  2PK7 A;  1KX5 C;  3REL C;  5B0Y C;  4ZUX C;  4XZQ C;  5AV5 D;  3AZG A;  1P3K C;  3ESW A;  3WA9 D;  3WKJ B;  1N8R 1;  4A3B I;  4X6A I;  3REJ C;  3MGQ C;  1Q81 1;  4XX2 A;  2Y2N A;  3AZE C;  3M3Y I;  1QYP A;  4NE6 A;  3AZH C;  3AV1 D;  1EQZ C;  2F4O A;  4KGC D;  5DNN D;  2NVX I;  3I07 A;  4UUZ A;  1YJN 1;  4X23 D;  3UT9 D;  1PFT A;  1RLY A;  1SIW A;  3BG0 B;  1VQ8 Z;  1QVG Y;  4TNU A;  5JRG D;  3F6T A;  3CCR 1;  4J8W B;  3WTP C;  3NQJ B;  3CCR Z;  1K8A 2;  4WV4 B;  3TU4 C;  1LQL A;  3IF8 A;  4E2W A;  1N1J A;  2BJO A;  3EPH A;  5FLX b;  2E2J I;  1YI2 Z;  3AZF C;  3B6F D;  1QVG Z;  1P3A B;  4H9S C;  2JUB A;  3EG5 B;  4NBG A;  3I55 1;  2NQB C;  4HGA B;  3C1C D;  3S1R I;  1KX3 A;  1YJ9 1;  2OZK A;  2V8I A;  4YS3 A;  3CCU Z;  3CCL Z;  3KWQ A;  2Y2G A;  3AZJ C;  2V3V A;  1P3O A;  3JAM f;  1KX4 B;  5A2Q b;  5B0Z D;  2YFV B;  2YFW A;  5AVC D;  2RVQ D;  3VH6 T;  4Z66 C;  2CV5 B;  4BBR I;  1P3P B;  3I56 Z;  3I56 1;  1WWS A;  4HGA C;  4QTT A;  1ULY A;  5GXQ C;  5B31 G;  1P3I A;  3CCS Z;  2HF1 A;  3NQU A;  5B31 C;  5B2J C;  2NZD C;  3AZL D;  3GKQ A;  3NH8 A;  3VTN A;  5C4X I;  4R8P A;  2GTH A;  3F3F C;  3IFU A;  2RT9 A;  1M1K 2;  4YS3 D;  2Y2I A;  5FUG A;  5CPI D;  2F8N B;  1M19 B;  2CV5 C;  5AV8 B;  2YU9 I;  1R4V A;  4JJN B;  3WAA D;  3AV2 B;  1Y8C A;  5F99 B;  1TZY A;  5AV9 C;  1Q86 2;  3WTP A;  1VQN Z;  1VQM 1;  2Y2M A;  3X1V D;  1VQM Z;  3LZ0 C;  3MGR B;  3KUY D;  1TWH I;  2M48 A;  1P3I D;  4E2Z A;  3LEL D;  1TAF B;  4J8X A;  5CP6 B;  3B6G C;  2QRE B;  5D1P A;  1P34 B;  2E2I I;  2NQB A;  1M19 C;  4YM6 C;  3AZG B;  2RBL A;  3C1B D;  5A2Q f;  3JAM b;  3CCV 1;  2RHB A;  4Y52 I;  3OW2 Z;  5B2I D;  2Y2K A;  2OOY B;  3AN2 C;  3REK C;  3F3P C;  5AN9 F;  3HOX I;  1BFM A;  2EGT A;  2OTL 1;  2LFU A;  2F8N H;  4H9Q A;  3IX0 A;  3LUS A;  2I3C A;  4DRB A;  2HIO D;  3BG1 B;  1H3O A;  4WU8 D;  5DNM D;  5CP6 C;  5B33 B;  3MNN D;  3KUY A;  1M1A D;  1U35 D;  2F8N G;  2VF1 A;  1VQ6 Z;  5FLX f;  2PMZ A;  3TDH B;  3MGS C;  4G92 B;  4XUJ D;  3AZI C;  2IO5 B;  3NDI A;  3GTJ I;  3UTA C;  2NVQ I;  1N1J B;  3WKJ D;  3MZL B;  5B32 G;  1QVF Z;  1Y1V S;  2PYO C;  1YIJ 1;  3NH5 A;  1YIJ Z;  2DF4 C;  4A3M I;  5B33 C;  1JJ2 Y;  1WJ2 A;  3REH C;  1AOI C;  1P9N A;  3CCS 1;  1KX3 B;  2YAD A;  2Y2O A;  4NBC A;  5DNM A;  2IO5 C;  3MNN A;  1U35 A;  1KX5 D;  1T3U A;  4R8P C;  5B0Y D;  4ZUX D;  5AV5 C;  5B32 A;  4DRA A;  3KWQ B;  1KX4 A;  3WA9 C;  2H85 A;  3AZM C;  1M18 A;  4J8W D;  1Q7Y 1;  2PYO B;  2YFW B;  2CV5 A;  1Y1W I;  1P3P A;  1W2B Y;  1VQN 1;  3I55 Z;  2NVY I;  1EQZ D;  3W99 B;  1I50 I;  3TE5 B;  4KGC C;  5DNN C;  1YJ9 Z;  5C4J I;  2ZY4 A;  3C1C B;  4RVG A;  4A3C I;  4R8P B;  2ZY3 A;  4QLC A;  4J8X C;  4EWC A;  2F8N A;  1KU5 A;  1VLA A;  3VH6 W;  1M19 A;  3TU4 D;  5AV8 A;  4A3G I;  3X1T B;  4ZBJ C;  5B0Z B;  5F99 A;  3AZF D;  3CME Z;  5AVC B;  1P3F B;  3WTP B;  2JIP A;  3J80 b;  3KXB C;  3S2H I;  5AV6 D;  1YUA A;  4KUD C;  3CC4 1;  3C1C C;  3OW2 Y;  1YIT Z;  3S17 I;  4J8X B;  1K8A 1;  2DQN C;  1P3B C;  3AZL B;  1P34 A;  4J8V B;  5CHL B;  2NQB B;  3REH A;  3V9R B;  2W03 A;  2LEX A;  3MVD A;  4A3E I;  4MD8 A;  3REI C;  3TU4 A;  5AVC C;  2R7Z I;  4WJ3 C;  2R93 I;  3AZJ B;  1HTA A;  5GT0 B;  4JJN D;  2JSS A;  1KQS Z;  1S7M A;  4H9Q B;  2W04 A;  5GXQ D;  2JCH A;  2F8N K;  4E2X A;  3Q87 A;  3QWU A;  1H3O B;  2CWE A;  5B31 D;  5B33 A;  5B2J D;  3KUY B;  2NZD D;  4H9N B;  5B1L A;  4M6B A;  1KQS Y;  5CPI C;  1Q16 A;  4WU9 B;  3GTL I;  4NH1 C;  2M6N A;  4MD9 A;  3S14 I;  4A3D I;  2KPI A;  1M18 C;  3WAA C;  5B2I B;  3MGP C;  5JRG A;  5AV9 D;  1HQ3 A;  5CPJ B;  5AV8 C;  1ZB9 A;  3H0L C;  3VH5 A;  4E45 A;  3LZ0 D;  3KUY C;  1ZLA C;  4H9P A;  5GXQ A;  3LEL C;  3EPL A;  1P3I C;  1TFI A;  4NBF A;  2WB1 A;  3MNN B;  5DNM B;  3B6G D;  2E2H I;  1B6W A;  1U35 B;  5FLM I;  5B32 B;  4DQY B;  3A6N B;  3HKZ A;  3UTB D;  1M18 B;  1TWG I;  3G4S 1;  5B2I C;  3MGP B;  5C3I B;  2PYO A;  3AN2 D;  2JR6 A;  2BYK A;  4YM6 B;  5CPK A;  3CMA 1;  4E2Y A;  3GTQ I;  3W99 A;  3S1N I;  2HIO C;  2ZY5 A;  3CC4 Z;  4WU8 C;  3X1U D;  4RVD A;  3LZ0 A;  3LJA A;  4MH4 A;  3C1C A;  1U35 C;  1M1K 1;  1ZB8 A;  1KX3 D;  1M90 1;  4QLC B;  3MGS D;  2FJ7 B;  3B6G A;  3UTA D;  2HU9 A;  3VH5 T;  5C3I C;  3W96 A;  5C3E I;  3X1T A;  3WKJ C;  4J8U A;  3H3V J;  5B0Z A;  5CPI A;  1W2E A;  2PYO D;  5AVC A;  1P3F A;  3I4M I;  1USP A;  5T67 A;  1YUK A;  1K83 I;  3VMI A;  1PZR A;  1B67 A;  1P3O C;  4A3I I;  2DE7 A;  2R92 I;  2UWX A;  3AZL A;  1WZN A;  3X1V A;  4J8V A;  4R8P D;  3AZN A;  3REH B;  3V9R A;  3LEL A;  3AZM D;  5E5A C;  3MVD B;  4J8W C;  1RO4 A;  3TU4 B;  2OTL Z;  3X1T D;  3KWQ C;  3AZJ A;  3CME 1;  5GT0 A;  5BO0 B;  3C1B A;  4LD9 D;  3J81 f;  3PO2 I;  4H9R B;  1S72 1;  2XD1 A;  4H9N A;  5B1L B;  2HUE B;  1S72 Z;  1Q7Y 2;  4J8X D;  4WU9 A;  1Q81 2;  5B24 A;  4Z5T C;  1WCM I;  4MRI A;  3CPW Y;  3G4S Z;  5BT1 D;  5AVB C;  4HH4 A;  4XUJ A;  5B2I A;  5JRG B;  3B0C W;  1HQ3 B;  5CPJ A;  1VQ7 1;  3KXB D;  3VH5 W;  3U50 C;  3CC7 Z;  5AV6 C;  5KDM A;  4KUD D;  5CPK C;  4H9P B;  5GXQ B;  4E31 A;  3IP4 C;  3CPW Z;  1P3F C;  5B31 B;  1P3B D;  1P3A D;  4NFT A;  3LJA C;  4NBD A;  3O62 C;  1VQO Z;  2NAP A;  3AZE B;  4A3L I;  3A6N A;  2JNY A;  2F2A C;  4WU9 D;  5AVB B;  3IR7 A;  3KSY A;  3MGP A;  3REI D;  1ZH1 A;  3W96 C;  2BYK B;  5B1M A;  5B0Y A;  2O4H A;  4YM6 A;  4JJN C;  1KX4 D;  5CPK B;  2Y2P A;  4NBA A;  4A3F I;  3LZ0 B;  3LJA B;  1P3P D;  4KHA B;  5GT3 C;  3O62 B;  3AL0 C;  3WTP E;  1WW9 A;  1VQ5 Z;  1P3M B;  2JIM A;  2FJ7 A;  4NBE A;  2XD5 A;  3B6G B;  3CCE 1;  1QF8 A;  2B63 I;  2P28 A;  2JA7 I;  1BH8 A;  4NE5 A;  1S32 A;  3W96 B;  2IZ3 A;  4G91 B;  1ID3 A;  4A93 I;  4J8U B;  1M18 D;  3MGP D;  3H0G I;  5CPI B;  2RPR A;  5GSU C;  1USP B;  2DE5 A;  1F66 C;  2GU2 A;  5AV8 D;  3J80 f;  5AV5 A;  1YJW 1;  5GT3 B;  1ZLA D;  2QEX Z;  3WA9 A;  5BNX B;  3AZF A;  3D6W A;  4A3J I;  3X1U B;  1YHQ 1;  1Q9C A;  2QA4 1;  3X1V B;  2QA4 Z;  5AV6 A;  1X0T A;  3CCV Z;  3MGR D;  3AZN B;  3LEL B;  3X1S C;  3UTB C;  1Q86 1;  3AV1 A;  3UTA B;  1NJI 1;  1F1E A;  5GSU B;  1Z2C B;  5BO0 A;  3C1B B;  3D9X A;  3FKI I;  3CC7 1;  5BS7 A;  4H9R A;  4RS4 A;  3X1U C;  1AA6 A;  1KX3 C;  1VQO 1;  2G5H C;  1P3L B;  2HIO B;  2G5I C;  5AY8 B;  1M1A B;  3B6F A;  5B24 B;  3MGQ A;  1WII A;  1I3Q I;  3CCM Z;  5BNV A;  3MVD D;  3GTO I;  4XUJ B;  1Z03 A;  1P34 C;  1NP6 A;  5KDM B;  3I4N I;  3GCF A;  1VQP Z;  1P3O D;  1KC8 1;  3CD6 1;  3CD6 Z;  1QVF Y;  3EED A;  5B31 A;  1VQ5 1;  3J7A 4;  1VQL Z;  5B1L D;  2ARO B;  3B0D C;  3AZE A;  3CCE Z;  4NOZ A;  3VB9 A;  4NBB A;  5E5A D;  2FFF B;  5AVB A;  3AZK C;  3CC2 1;  3RZO I;  2VQR A;  2JMO A;  3GTM S;  1KX5 B;  3X1T C;  5B1M B;  5B0Y B;  4ZBJ B;  3KWQ D;  2ZM5 A;  4AYB A;  4BBS I;  2P3Y A;  4BXX I;  2ZY2 A;  3UTB A;  4LD9 C;  3EER A;  2R6M A;  3AYW C;  2QKD A;  3CMA Z;  1VQK Z;  3R45 A;  3KXB B;  2QRD B;  2VPY A;  5IT9 f;  1YJW Z;  3GTM I;  4KHA A;  3O62 A;  4EO5 B;  2VPZ A;  1P3M A;  3WAA A;  2LY8 A;  1P3B B;  1EQZ B;  2VUG A;  1VQ9 Z;  1TZY D;  3PO3 I;  3AZK B;  4MD7 A;  5IT9 b;  1BH8 B;  4Z5T D;  1S32 B;  1ID3 B;  5BT1 C;  2L5A A;  4RVF A;  5E5A A;  5AVB D;  1QXF A;  2Y2Q A;  3REI B;  2V8K A;  3CXC Z;  5AV5 B;  5CPK D;  5GT3 A;  3HOU I;  4EO5 C;  3AFA A;  5BS7 C;  3WA9 B;  5BNX A;  3AZF B;  3LZ1 A;  1P3F D;  3X1U A;  3W98 D;  1P3A C;  3LJA D;  2E7Z A;  2F4M A;  3O62 D;  3K7A I;  5AV6 B;  2DE6 A;  3HOV I;  3HOY I;  3G71 1;  3H0M C;  2BG1 A;  3AV1 B;  3UTA A;  4WU9 C;  3W99 C;  4Z5T A;  4CSR B;  3MZK B;  3W96 D;  5GSU A;  4J8V D;  2AKL A;  4J8U D;  2VUM I;  4X23 B;  1KX4 C;  2G2K A;  2ZAE B;  1Q82 2;  3GTG I;  4HGY A;  2QEX 1;  5C44 I;  1P3P C;  5GT3 D;  1ZLA B;  1YHQ Z;  1K9M 2;  3REL B;  1P3K B;  4CAY A;  4LD9 A;  1VQ4 1;  2K5R A;  1P3L A;  3B0C T;  3W98 A;  1ML8 A;  2HIO A;  5AY8 A;  3B6F B;  1M1A A;  3REJ B;  3G6E Z;  5B2J B;  3MGQ B;  2NZD B;  3G6E 1;  3REK A;  3S1Q I;  2Y2J A;  5BNV B;  1P3M C;  5GSU D;  3B0B A;  1F66 D;  2IZ4 A;  3M4O I;  4ZUX A;  1I6H I;  4AWL C;  3AZI A;  2E9H A;  3FDD A;  2ARO A;  3MGR C;  4NE3 A;  5GT0 C;  4QTU A;  4HGZ A;  3X1S D;  5AY8 D;  3CCM 1;  4A3K I;  1KX5 A;  3HOZ I;  1JFI A;  5B32 D;  3AZN C;  2VPW A;  3A6N D;  2OTJ 1;  3UTB B;  1AOI A;  1Y1V I;  1VQP 1;  3R45 B;  3KXB A;  1FDO A;  4E33 A;  1L1O C;  1TWF I;  4MXU A;  3AFA C;  1VQL 1;  2NVT I;  2JA6 I;  4Z2M H;  3P5J B;  3LZ1 C;  1EQZ A;  1P3B A;  5F99 D;  3WAA B;  4H9O A;  1NUI A;  4UPK A;  3AZK A;  5CPJ C;  4NBH A;  3CXC Y;  2JIR A;  3VH6 A;  4Z66 B;  3X1S A;  4Y7N I;  5E5A B;  3MVD C;  1P3L C;  2FJ7 D;  1X3W A;  2JIO A;  3REI A;  5D1O B;  3VMG A;  5B24 C;  5B1M D;  4KGC A;  1P34 D;  1P3G D;  4E30 A;  1M90 2;  1DL6 A;  3AZG D;  3AFA B;  3LZ1 B;  3EPK A;  5B1L C;  1VQ9 1;  2HUE C;  1NJI 2;  3VMH A;  3AZK D;  3AV2 C;  4CSR A;  4Z5T B;  1VQ6 1;  2ARO C;  1RO0 A;  4RVH A;  3T4N B;  1KC8 2;  4X23 A;  2KI7 B;  3AZM B;  4QLC C;  3AYW D;  2QRC B;  4NB8 A;  1SFO I;  3S1M I;  2JE5 A;  1P3G A;  5IP9 I;  1YI2 1;  1ZLA A;  3REL A;  1P3K A;  4CAY B;  4LD9 B;  3D2L A;  3W98 B;  1TZY C;  5AV9 A;  3REJ A;  3G71 Z;  5B2J A;  2NZD A;  1JJ2 Z;  3REK B;  1FDI A;  5B40 C;  4BY1 I;  1N8R 2;  3W97 C;  2QR1 B;  4E32 A;  1S32 C;  3FQM A;  1ID3 C;  4ZUX B;  3KIH A;  1BH9 B;  3AYW A;  3CQZ I;  5JA4 B;  5G49 B;  3AZI B;  1HQ3 D;  1VQ4 Z;  3W98 C;  3AN2 A;  2J8P A;  2QLV B;  2Y2L A;  3REL D;  1P3K D;  4KUD B;  4XZQ D;  2OTJ Z;  3FQQ A;  1Z02 A;  5B40 B;  1JWH C;  4NB9 A;  4S1T A;  5IP7 I;  3REJ D;  3W97 B;  3W99 D;  3MGQ D;  3CC2 Z;  3S2D I;  4J8V C;  4G91 C;  2LIY A;  1A7W A;  4J8U C;  1JFI B;  3AZE D;  2K3R A;  2V45 A;  2WAQ A;  3RZD I;  1VQK 1;  3PO3 S;  3MGS A;  3AV1 C;  3AZH D;  1AOI B;  3GTP I;  1F66 B;  2JA8 I;  1RO2 A;  2JIQ A;  2IV2 X;  4X23 C;  3UT9 C;  4NFR A;  1K73 1;  5JRG C;  4H9O B;  1N2F A;  3S16 I;  3WTP D;  4XZQ A;  4Z66 A;  3X1S B;  2V8J A;  1P3M D;  2BYM A;  5D1O A;  3B6F C;  4KGC B;  1RQF A;  5DNN B;  4WU8 A;  3KFU G;  2NQB D;  3NH4 A;  1R9T I;  3AZH A;  3UT9 B;  3A1K A;  1VQ7 Z;  4WNN B;  4DK1 A;  1X3Z A;  3AZJ D;  2PM9 A;  5GT0 D;  4AWL B;  2Y2H A;  3WKJ A;  5AY8 C;  5B0Z C;  4BY7 I;  2RVQ C;  4Z66 D;  1Q82 1;  1KD1 2;  5B32 C;  3AZN D;  3CCJ 1;  3A6N C;  3CCJ Z;  3AZM A;  2JA5 I;  2JS4 A;  1K9M 1;  2Q51 A;  1K73 2;  1P3G B;  1Z01 A;  3AZL C;  1WWI A;  4UUZ B;  1W2B Z;  3AFA D;  1TWA I;  2VPX A;  3CCQ 1;  3CCQ Z;  3LZ1 D;  1TWC I;  4YS3 C;  5F99 C;  2J6A A;  3EPJ A;  5AV9 B;  3CCU 1;  4J8W A;  5CPJ D;  2RIQ A;  3NQJ A;  3NFZ A;  3B0D B;  2CV5 D;  4RV9 A;  1P3L D;  2FJ7 C;  5B24 D;  5B1M C;  1P3A A;  3GTK I;  3X1V C;  1P3G C;  3KIF A;  3A1I A;  1BH9 A;  3AZG C;  3AYW B;  4DGL A;  1YJN Z;  5JA4 A;  5G49 A;  1VQ8 1;  4YS3 B;  2F8N D;  4WZS B;  3AN2 B;  4Z2M G;  4KUD A;  1M19 D;  4YM6 D;  1P3O B;  3C1B C;  5B40 A;  3MON A;  2W8S A;  1KD1 1;  3W97 A;  3AV2 D;  2YFV A;  3REK D;  2O53 A;  2ARO D;  2AYD A;  4QLC D;  3MGS B;  4G92 C;  1P3I B;  2GTI A;  2OOX B;  3J81 b;  1F66 A;  4MON A;  1M1A C;  3NQU B;  5DNM C;  5CP6 D;  3MNN C;  4CL1 A;  3H0R C;  3CCL 1;  5LL6 f;  3AZI D;  4XUJ C;  5CM2 M;  5FUG B; 
#chains in the Genus database with same CATH homology
 4XZQ B;  4H9S A;  1KRL A;  5B40 D;  2BYM B;  4JJN A;  3AV2 A;  3W97 D;  1TZY B;  1S32 D;  5DNN A;  4E44 A;  4WU8 B;  5B33 D;  3MGR A;  1ID3 D;  2Q4Z A;  3REH D;  3AZH B;  3UT9 A;  1AOI D;  2Y0S A;  1RNI A;  1TAF A;  3NDJ A;  1YIT 1;  1HQ3 C;  5CP6 A;  5T6B A;  3HOW I;  5T64 A;  3S15 I;  4WNN A;  2PK7 A;  1KX5 C;  3REL C;  5B0Y C;  4ZUX C;  4XZQ C;  5AV5 D;  3AZG A;  1P3K C;  3ESW A;  3WA9 D;  3WKJ B;  1N8R 1;  4A3B I;  4X6A I;  3REJ C;  3MGQ C;  1Q81 1;  4XX2 A;  2Y2N A;  3AZE C;  3M3Y I;  1QYP A;  4NE6 A;  3AZH C;  3AV1 D;  1EQZ C;  2F4O A;  4KGC D;  5DNN D;  2NVX I;  3I07 A;  4UUZ A;  1YJN 1;  4X23 D;  3UT9 D;  1PFT A;  1RLY A;  3BG0 B;  1VQ8 Z;  1QVG Y;  4TNU A;  5JRG D;  3F6T A;  3CCR 1;  4J8W B;  3WTP C;  3NQJ B;  3CCR Z;  1K8A 2;  4WV4 B;  3TU4 C;  1LQL A;  3IF8 A;  4E2W A;  1N1J A;  2BJO A;  3EPH A;  5FLX b;  2E2J I;  1YI2 Z;  3AZF C;  3B6F D;  1QVG Z;  1P3A B;  4H9S C;  2JUB A;  3EG5 B;  4NBG A;  3I55 1;  2NQB C;  4HGA B;  3C1C D;  3S1R I;  1KX3 A;  1YJ9 1;  2OZK A;  2V8I A;  4YS3 A;  3CCU Z;  3CCL Z;  3KWQ A;  2Y2G A;  3AZJ C;  1P3O A;  3JAM f;  1KX4 B;  5A2Q b;  5B0Z D;  2YFV B;  2YFW A;  5AVC D;  2RVQ D;  3VH6 T;  4Z66 C;  2CV5 B;  4BBR I;  1P3P B;  3I56 Z;  3I56 1;  1WWS A;  4HGA C;  4QTT A;  1ULY A;  5GXQ C;  5B31 G;  1P3I A;  3CCS Z;  2HF1 A;  3NQU A;  5B31 C;  5B2J C;  2NZD C;  3AZL D;  3GKQ A;  3NH8 A;  3VTN A;  5C4X I;  4R8P A;  2GTH A;  3F3F C;  3IFU A;  2RT9 A;  1M1K 2;  4YS3 D;  2Y2I A;  5FUG A;  5CPI D;  2F8N B;  1M19 B;  2CV5 C;  5AV8 B;  2YU9 I;  1R4V A;  4JJN B;  3WAA D;  3AV2 B;  5F99 B;  1TZY A;  5AV9 C;  1Q86 2;  3WTP A;  1VQN Z;  1VQM 1;  2Y2M A;  3X1V D;  1VQM Z;  3LZ0 C;  3MGR B;  3KUY D;  1TWH I;  2M48 A;  1P3I D;  4E2Z A;  3LEL D;  1TAF B;  4J8X A;  5CP6 B;  3B6G C;  2QRE B;  5D1P A;  1P34 B;  2E2I I;  2NQB A;  1M19 C;  4YM6 C;  3AZG B;  2RBL A;  3C1B D;  5A2Q f;  3JAM b;  3CCV 1;  2RHB A;  4Y52 I;  3OW2 Z;  5B2I D;  2Y2K A;  2OOY B;  3AN2 C;  3REK C;  3F3P C;  5AN9 F;  3HOX I;  1BFM A;  2EGT A;  2OTL 1;  2LFU A;  2F8N H;  4H9Q A;  3IX0 A;  3LUS A;  2I3C A;  4DRB A;  2HIO D;  3BG1 B;  1H3O A;  4WU8 D;  5DNM D;  5CP6 C;  5B33 B;  3MNN D;  3KUY A;  1M1A D;  1U35 D;  2F8N G;  2VF1 A;  1VQ6 Z;  5FLX f;  2PMZ A;  3TDH B;  3MGS C;  4G92 B;  4XUJ D;  3AZI C;  2IO5 B;  3NDI A;  3GTJ I;  3UTA C;  2NVQ I;  1N1J B;  3WKJ D;  3MZL B;  5B32 G;  1QVF Z;  1Y1V S;  2PYO C;  1YIJ 1;  3NH5 A;  1YIJ Z;  2DF4 C;  4A3M I;  5B33 C;  1JJ2 Y;  3REH C;  1AOI C;  1P9N A;  3CCS 1;  1KX3 B;  2YAD A;  2Y2O A;  4NBC A;  5DNM A;  2IO5 C;  3MNN A;  1U35 A;  1KX5 D;  1T3U A;  4R8P C;  5B0Y D;  4ZUX D;  5AV5 C;  5B32 A;  4DRA A;  3KWQ B;  1KX4 A;  3WA9 C;  2H85 A;  3AZM C;  1M18 A;  4J8W D;  1Q7Y 1;  2PYO B;  2YFW B;  2CV5 A;  1Y1W I;  1P3P A;  1W2B Y;  1VQN 1;  3I55 Z;  2NVY I;  1EQZ D;  3W99 B;  1I50 I;  3TE5 B;  4KGC C;  5DNN C;  1YJ9 Z;  5C4J I;  2ZY4 A;  3C1C B;  4RVG A;  4A3C I;  4R8P B;  2ZY3 A;  4QLC A;  4J8X C;  4EWC A;  2F8N A;  1KU5 A;  1VLA A;  3VH6 W;  1M19 A;  3TU4 D;  5AV8 A;  4A3G I;  3X1T B;  4ZBJ C;  5B0Z B;  5F99 A;  3AZF D;  3CME Z;  5AVC B;  1P3F B;  3WTP B;  3J80 b;  3KXB C;  3S2H I;  5AV6 D;  1YUA A;  4KUD C;  3CC4 1;  3C1C C;  3OW2 Y;  1YIT Z;  3S17 I;  4J8X B;  1K8A 1;  2DQN C;  1P3B C;  3AZL B;  1P34 A;  4J8V B;  5CHL B;  2NQB B;  3REH A;  3V9R B;  2W03 A;  3MVD A;  4A3E I;  4MD8 A;  3REI C;  3TU4 A;  5AVC C;  2R7Z I;  4WJ3 C;  2R93 I;  3AZJ B;  1HTA A;  5GT0 B;  4JJN D;  2JSS A;  1KQS Z;  1S7M A;  4H9Q B;  2W04 A;  5GXQ D;  2JCH A;  2F8N K;  4E2X A;  3Q87 A;  3QWU A;  1H3O B;  2CWE A;  5B31 D;  5B33 A;  5B2J D;  3KUY B;  2NZD D;  4H9N B;  5B1L A;  4M6B A;  1KQS Y;  5CPI C;  4WU9 B;  3GTL I;  4NH1 C;  2M6N A;  4MD9 A;  3S14 I;  4A3D I;  2KPI A;  1M18 C;  3WAA C;  5B2I B;  3MGP C;  5JRG A;  5AV9 D;  1HQ3 A;  5CPJ B;  5AV8 C;  1ZB9 A;  3H0L C;  3VH5 A;  4E45 A;  3LZ0 D;  3KUY C;  1ZLA C;  4H9P A;  5GXQ A;  3LEL C;  3EPL A;  1P3I C;  1TFI A;  4NBF A;  2WB1 A;  3MNN B;  5DNM B;  3B6G D;  2E2H I;  1B6W A;  1U35 B;  5FLM I;  5B32 B;  4DQY B;  3A6N B;  3HKZ A;  3UTB D;  1M18 B;  1TWG I;  3G4S 1;  5B2I C;  3MGP B;  5C3I B;  2PYO A;  3AN2 D;  2JR6 A;  2BYK A;  4YM6 B;  5CPK A;  3CMA 1;  4E2Y A;  3GTQ I;  3W99 A;  3S1N I;  2HIO C;  2ZY5 A;  3CC4 Z;  4WU8 C;  3X1U D;  4RVD A;  3LZ0 A;  3LJA A;  4MH4 A;  3C1C A;  1U35 C;  1M1K 1;  1ZB8 A;  1KX3 D;  1M90 1;  4QLC B;  3MGS D;  2FJ7 B;  3B6G A;  3UTA D;  2HU9 A;  3VH5 T;  5C3I C;  3W96 A;  5C3E I;  3X1T A;  3WKJ C;  4J8U A;  3H3V J;  5B0Z A;  5CPI A;  1W2E A;  2PYO D;  5AVC A;  1P3F A;  3I4M I;  1USP A;  5T67 A;  1YUK A;  1K83 I;  3VMI A;  1PZR A;  1B67 A;  1P3O C;  4A3I I;  2DE7 A;  2R92 I;  2UWX A;  3AZL A;  3X1V A;  4J8V A;  4R8P D;  3AZN A;  3REH B;  3V9R A;  3LEL A;  3AZM D;  5E5A C;  3MVD B;  4J8W C;  1RO4 A;  3TU4 B;  2OTL Z;  3X1T D;  3KWQ C;  3AZJ A;  3CME 1;  5GT0 A;  5BO0 B;  3C1B A;  4LD9 D;  3J81 f;  3PO2 I;  4H9R B;  1S72 1;  2XD1 A;  4H9N A;  5B1L B;  2HUE B;  1S72 Z;  1Q7Y 2;  4J8X D;  4WU9 A;  1Q81 2;  5B24 A;  4Z5T C;  1WCM I;  4MRI A;  3CPW Y;  3G4S Z;  5BT1 D;  5AVB C;  4HH4 A;  4XUJ A;  5B2I A;  5JRG B;  3B0C W;  1HQ3 B;  5CPJ A;  1VQ7 1;  3KXB D;  3VH5 W;  3U50 C;  3CC7 Z;  5AV6 C;  5KDM A;  4KUD D;  5CPK C;  4H9P B;  5GXQ B;  4E31 A;  3IP4 C;  3CPW Z;  1P3F C;  5B31 B;  1P3B D;  1P3A D;  4NFT A;  3LJA C;  4NBD A;  3O62 C;  1VQO Z;  4A3L I;  3AZE B;  3A6N A;  2JNY A;  2F2A C;  4WU9 D;  5AVB B;  3KSY A;  3MGP A;  3REI D;  1ZH1 A;  3W96 C;  2BYK B;  5B1M A;  5B0Y A;  2O4H A;  4YM6 A;  4JJN C;  1KX4 D;  5CPK B;  2Y2P A;  4NBA A;  4A3F I;  3LZ0 B;  3LJA B;  1P3P D;  4KHA B;  5GT3 C;  3O62 B;  3AL0 C;  3WTP E;  1WW9 A;  1VQ5 Z;  1P3M B;  2JA7 I;  2FJ7 A;  4NBE A;  2XD5 A;  3B6G B;  3CCE 1;  1QF8 A;  2B63 I;  2P28 A;  1BH8 A;  4NE5 A;  1S32 A;  3W96 B;  2IZ3 A;  4G91 B;  1ID3 A;  4A93 I;  4J8U B;  1M18 D;  3MGP D;  3H0G I;  5CPI B;  2RPR A;  5GSU C;  1USP B;  2DE5 A;  1F66 C;  2GU2 A;  5AV8 D;  3J80 f;  5AV5 A;  1YJW 1;  5GT3 B;  1ZLA D;  2QEX Z;  3WA9 A;  5BNX B;  3AZF A;  3D6W A;  4A3J I;  3X1U B;  1YHQ 1;  1Q9C A;  2QA4 1;  3X1V B;  2QA4 Z;  5AV6 A;  1X0T A;  3CCV Z;  3MGR D;  3AZN B;  3LEL B;  3X1S C;  3UTB C;  1Q86 1;  3AV1 A;  3UTA B;  1NJI 1;  1F1E A;  5GSU B;  1Z2C B;  5BO0 A;  3C1B B;  3D9X A;  3FKI I;  3CC7 1;  5BS7 A;  4H9R A;  4RS4 A;  3X1U C;  1KX3 C;  1VQO 1;  2G5H C;  1P3L B;  2HIO B;  2G5I C;  5AY8 B;  1M1A B;  3B6F A;  5B24 B;  3MGQ A;  1WII A;  1I3Q I;  3CCM Z;  5BNV A;  3MVD D;  3GTO I;  4XUJ B;  1Z03 A;  1P34 C;  1NP6 A;  5KDM B;  3I4N I;  3GCF A;  1VQP Z;  1P3O D;  1KC8 1;  3CD6 1;  3CD6 Z;  1QVF Y;  3EED A;  5B31 A;  1VQ5 1;  3J7A 4;  1VQL Z;  5B1L D;  2ARO B;  3B0D C;  3AZE A;  3CCE Z;  4NOZ A;  3VB9 A;  4NBB A;  5E5A D;  2FFF B;  5AVB A;  3AZK C;  3CC2 1;  3RZO I;  2VQR A;  2JMO A;  3GTM S;  1KX5 B;  3X1T C;  5B1M B;  5B0Y B;  4ZBJ B;  3KWQ D;  2ZM5 A;  4AYB A;  4BBS I;  2P3Y A;  4BXX I;  2ZY2 A;  3UTB A;  4LD9 C;  3EER A;  2R6M A;  3AYW C;  2QKD A;  3CMA Z;  1VQK Z;  3R45 A;  3KXB B;  2QRD B;  5IT9 f;  1YJW Z;  3GTM I;  4KHA A;  3O62 A;  4EO5 B;  1P3M A;  3WAA A;  2LY8 A;  1P3B B;  1EQZ B;  2VUG A;  1VQ9 Z;  1TZY D;  3PO3 I;  3AZK B;  4MD7 A;  5IT9 b;  1BH8 B;  4Z5T D;  1S32 B;  1ID3 B;  5BT1 C;  2L5A A;  4RVF A;  5E5A A;  5AVB D;  2Y2Q A;  3REI B;  2V8K A;  3CXC Z;  5AV5 B;  5CPK D;  5GT3 A;  3HOU I;  4EO5 C;  3AFA A;  5BS7 C;  3WA9 B;  5BNX A;  3AZF B;  3LZ1 A;  1P3F D;  3X1U A;  3W98 D;  1P3A C;  3LJA D;  2F4M A;  3K7A I;  3O62 D;  5AV6 B;  2DE6 A;  3HOV I;  3HOY I;  3G71 1;  3H0M C;  2BG1 A;  3AV1 B;  3UTA A;  4WU9 C;  3W99 C;  4Z5T A;  4CSR B;  3MZK B;  3W96 D;  5GSU A;  4J8V D;  2AKL A;  4J8U D;  2VUM I;  4X23 B;  1KX4 C;  2G2K A;  2ZAE B;  1Q82 2;  3GTG I;  4HGY A;  2QEX 1;  5C44 I;  1P3P C;  5GT3 D;  1ZLA B;  1YHQ Z;  1K9M 2;  3REL B;  1P3K B;  4CAY A;  4LD9 A;  1VQ4 1;  2K5R A;  1P3L A;  3B0C T;  3W98 A;  1ML8 A;  2HIO A;  5AY8 A;  3B6F B;  1M1A A;  3REJ B;  3G6E Z;  5B2J B;  3MGQ B;  2NZD B;  3G6E 1;  3REK A;  3S1Q I;  2Y2J A;  5BNV B;  1P3M C;  5GSU D;  3B0B A;  1F66 D;  2IZ4 A;  3M4O I;  4ZUX A;  1I6H I;  4AWL C;  3AZI A;  2E9H A;  3FDD A;  2ARO A;  3MGR C;  4NE3 A;  5GT0 C;  4QTU A;  4HGZ A;  3X1S D;  5AY8 D;  3CCM 1;  4A3K I;  1KX5 A;  3HOZ I;  1JFI A;  5B32 D;  3AZN C;  2OTJ 1;  3A6N D;  3UTB B;  1AOI A;  1Y1V I;  1VQP 1;  3R45 B;  3KXB A;  4E33 A;  1L1O C;  1TWF I;  4MXU A;  3AFA C;  1VQL 1;  2NVT I;  2JA6 I;  4Z2M H;  3P5J B;  3LZ1 C;  1EQZ A;  1P3B A;  5F99 D;  3WAA B;  4H9O A;  1NUI A;  4UPK A;  3AZK A;  5CPJ C;  4NBH A;  3CXC Y;  3VH6 A;  4Z66 B;  3X1S A;  4Y7N I;  5E5A B;  3MVD C;  1P3L C;  2FJ7 D;  1X3W A;  5D1O B;  3REI A;  3VMG A;  5B24 C;  5B1M D;  4KGC A;  1P34 D;  1P3G D;  4E30 A;  1M90 2;  1DL6 A;  3AZG D;  3AFA B;  3LZ1 B;  3EPK A;  5B1L C;  1VQ9 1;  2HUE C;  1NJI 2;  3VMH A;  3AZK D;  3AV2 C;  4CSR A;  4Z5T B;  1VQ6 1;  2ARO C;  1RO0 A;  4RVH A;  3T4N B;  1KC8 2;  4X23 A;  2KI7 B;  3AZM B;  4QLC C;  3AYW D;  2QRC B;  4NB8 A;  1SFO I;  3S1M I;  2JE5 A;  1P3G A;  5IP9 I;  1YI2 1;  1ZLA A;  3REL A;  1P3K A;  4CAY B;  4LD9 B;  3W98 B;  1TZY C;  5AV9 A;  3REJ A;  3G71 Z;  5B2J A;  2NZD A;  1JJ2 Z;  3REK B;  5B40 C;  4BY1 I;  1N8R 2;  3W97 C;  2QR1 B;  4E32 A;  1S32 C;  3FQM A;  1ID3 C;  4ZUX B;  3KIH A;  1BH9 B;  3AYW A;  3CQZ I;  5JA4 B;  5G49 B;  3AZI B;  1HQ3 D;  1VQ4 Z;  3W98 C;  3AN2 A;  2J8P A;  2QLV B;  2Y2L A;  3REL D;  1P3K D;  4KUD B;  4XZQ D;  2OTJ Z;  3FQQ A;  1Z02 A;  5B40 B;  1JWH C;  4NB9 A;  4S1T A;  5IP7 I;  3REJ D;  3W97 B;  3W99 D;  3MGQ D;  3CC2 Z;  3S2D I;  4J8V C;  4G91 C;  2LIY A;  1A7W A;  4J8U C;  1JFI B;  3AZE D;  2K3R A;  3RZD I;  2WAQ A;  3PO3 S;  1VQK 1;  3MGS A;  3AV1 C;  3AZH D;  1AOI B;  3GTP I;  1F66 B;  2JA8 I;  1RO2 A;  4X23 C;  3UT9 C;  4NFR A;  1K73 1;  5JRG C;  4H9O B;  1N2F A;  3S16 I;  3WTP D;  4XZQ A;  4Z66 A;  3X1S B;  2V8J A;  1P3M D;  2BYM A;  5D1O A;  3B6F C;  4KGC B;  1RQF A;  5DNN B;  4WU8 A;  3KFU G;  2NQB D;  3NH4 A;  1R9T I;  3AZH A;  3UT9 B;  3A1K A;  1VQ7 Z;  4WNN B;  4DK1 A;  1X3Z A;  3AZJ D;  2PM9 A;  5GT0 D;  4AWL B;  2Y2H A;  3WKJ A;  5AY8 C;  5B0Z C;  4BY7 I;  2RVQ C;  4Z66 D;  1Q82 1;  1KD1 2;  5B32 C;  3AZN D;  3CCJ 1;  3A6N C;  3CCJ Z;  3AZM A;  2JA5 I;  2JS4 A;  1K9M 1;  2Q51 A;  1K73 2;  1P3G B;  1Z01 A;  3AZL C;  1WWI A;  4UUZ B;  1W2B Z;  3AFA D;  1TWA I;  3CCQ 1;  3CCQ Z;  3LZ1 D;  1TWC I;  4YS3 C;  5F99 C;  2J6A A;  3EPJ A;  5AV9 B;  3CCU 1;  4J8W A;  5CPJ D;  2RIQ A;  3NQJ A;  3NFZ A;  3B0D B;  2CV5 D;  4RV9 A;  1P3L D;  2FJ7 C;  5B24 D;  5B1M C;  1P3A A;  3GTK I;  3X1V C;  1P3G C;  3KIF A;  3A1I A;  1BH9 A;  3AZG C;  3AYW B;  4DGL A;  1YJN Z;  5JA4 A;  5G49 A;  1VQ8 1;  4YS3 B;  2F8N D;  4WZS B;  3AN2 B;  4Z2M G;  4KUD A;  1M19 D;  4YM6 D;  1P3O B;  3C1B C;  5B40 A;  3MON A;  2W8S A;  1KD1 1;  3W97 A;  3AV2 D;  2YFV A;  3REK D;  2O53 A;  2ARO D;  4QLC D;  3MGS B;  4G92 C;  1P3I B;  2GTI A;  2OOX B;  3J81 b;  1F66 A;  4MON A;  1M1A C;  3NQU B;  5DNM C;  5CP6 D;  3MNN C;  4CL1 A;  3H0R C;  3CCL 1;  5LL6 f;  3AZI D;  4XUJ C;  5CM2 M;  5FUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...