4DQYB

Structure of human parp-1 bound to a dna double strand break
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
SKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly [ADP-ribose] polymerase 1
publication title Structural basis for DNA damage-dependent poly(ADP-ribosyl)ation by human PARP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 37
structure length 136
sequence length 136
chains with identical sequence E
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4dqyB01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dqyB02
2RIQA 4DQYB
chains in the Genus database with same CATH superfamily
4KHAB 3RELC 3AL0C 3EPHA 2V45A 3TU4B 3MGQD 1KX4D 4XZQD 3MZLB 5BS7A 2VPYA 1Z02A 2RVQC 3WTPD 1P3FD 3CCU1 3F3PC 1YJN1 4A3GI 3A1IA 3GKQA 1SFOI 3S1NI 3GTJI 1K9M1 4XUJD 1Q862 1BH8A 2P3YA 3FQMA 4E2ZA 3HOZI 5B2JB 1P3LD 3AYWC 1H3OB 1Z2CB 5E5AA 3LJAC 3AZJB 1M1AB 3MGRC 4TNUA 3G4S1 3MVDD 3CCS1 1W2BZ 2AROD 5B1MD 1SIWA 4G92B 3O62A 1M18D 1ULYA 2DF4C 1HTAA 4G91B 3WA9B 5B32A 1S32D 3W97C 4WU9B 2OOXB 5FLXf 3VH6A 2BYMB 1P3MA 5AVBC 3X1VB 4H9OB 5DNMA 3NQJB 5CPIA 1KX3B 4KUDD 1S72Z 1Y1VS 1VQNZ 2F8ND 3AV2B 3W96B 3EERA 2IO5C 4UUZA 2WAQA 5B0YD 2W8SA 1HQ3B 3C1CD 5CPJD 3AFAC 3W99B 2K3RA 3KXBB 2VF1A 4J8XA 4Z5TB 1M19B 4LD9B 3H0RC 3MNNC 2EGTA 5DNNB 3CCJ1 5B0ZA 5AV6D 3MGPA 5GXQA 3AZEA 2UWXA 3AZGB 1EQZB 3K7AI 3REJD 3PO2I 3VTNA 3A6NC 4Z66B 3TU4C 1JFIB 2E2II 3AZMA 3I56Z 4H9RB 2W03A 1NUIA 1P34C 5B24B 5B31D 3UTBA 5FLMI 4NFTA 1ZLAB 5AY8D 5AV8B 5CP6D 2NQBD 5C3EI 4CL1A 3WAAC 2BG1A 4JJNA 4RVHA 2Y2HA 4MD7A 5B2JC 1P3BB 5GT3C 1KD12 2YFWA 5B40D 3KUYA 3AZHD 3AV1D 1M1AC 3CCM1 1U35B 1F66A 3AZIA 3WKJC 2PYOD 1WCMI 5JA4B 1TZYC 5AVCD 5KDMA 3W98C 1YI2Z 4WU9C 1QVGY 2F4MA 5B1LA 3CCQ1 2Y2JA 2JS4A 1VQ81 2OTJZ 1NJI2 5G49B 1KX3C 4E31A 3OW2Y 3H3VJ 4J8VB 5BS7C 4YS3A 3MGQB 2Y2LA 1JJ2Y 5GT0A 3KWQC 3R45A 4XZQB 3RELA 1KX4B 2K5RA 3LUSA 1HQ3C 3WTPB 5GSUD 1P3FB 1QF8A 3CC21 1Y1VI 1BH9A 5AV5D 3AZFD 2V8JA 4Z5TC 4XUJB 1ID3C 3S15I 1VQL1 4NB9A 3GTKI 3O62C 1P3GD 1VQPZ 1NJI1 3J7A4 4Z66C 3NH4A 1R9TI 2VPXA 3MVDB 4QLCA 3AYWA 2AROB 5B1MB 5C4XI 5B2IA 3HOVI 1M18B 3CCLZ 3MGRA 2RT9A 2DE5A 2LFUA 5FLXb 2VQRA 1S32B 1USPB 3S2HI 5C3IB 4BBSI 2Y2MA 5AV8C 4NBAA 3W97A 2R6MA 3LZ0A 3T4NB 1VQ6Z 3C1BC 2Q4ZA 4KUDB 3CC4Z 4S1TA 1P3BC 1KX5D 3W96D 2VUGA 1M1K1 4Y52I 3REIA 5AVBA 3GTMS 3REHC 1YIJ1 1U35C 3B0CT 3P5JB 5B0YB 2R7ZI 3NDIA 3I07A 2M48A 2GTHA 4CSRB 5B0ZC 3AZEC 5GXQC 3C1CB 4NBBA 3CXCY 4A3KI 3LZ1D 4J8UA 2NVQI 5BT1C 3REKC 3AFAA 3UTAD 5AV6B 3AN2C 3VH5W 4J8VC 2JA8I 3REJB 3MNNA 2JA7I 2ZY3A 3HOUI 4UPKA 3LELD 4KGCD 3CPWY 4CAYB 1RNIA 4KHAA 4XZQC 3X1UB 3A6NA 1KX4C 2ZY4A 5BNVB 3TU4A 1TWHI 3G6EZ 3CME1 1P3FC 5B31B 3X1SB 1VQ91 3RZOI 5AY8B 5CP6B 2NQBB 2GU2A 1M901 1KQSY 4YM6B 2RIQA 1TAFB 4RV9A 4DK1A 3UT9D 5C44I 5F99D 2CV5D 1P3LC 4MD8A 5A2Qf 5B40B 2E7ZA 3B0BA 3AZHB 3AV1B 4Z2MG 1P3OD 5B2JA 4H9PB 3MVDC 2JMOA 3CD61 2AROC 2YU9I 2PYOB 4EO5B 1M1AA 1P3ID 1P3AD 1M18C 4MONA 1TWFI 3J81f 3CCEZ 3WKJA 3NH5A 5C3IC 5T6BA 1TZYA 3WA9A 3W98A 1N8R1 4WU9A 3B6GD 4KUDC 1QXFA 4RVGA 2BYMA 4AWLB 3X1VA 4H9OA 3NQJA 1KX3A 3S1RI 2DQNC 4WZSB 5B0YC 2BYKB 3AV2A 1Y8CA 5AV9D 2AYDA 2JIPA 5GSUB 3CCRZ 3KWQA 3CC7Z 3D2LA 5CPJC 3CCMZ 5B33D 2QA4Z 5AV5B 1P3KD 1HQ3A 3AZFB 3GTMI 4E2YA 4BXXI 2R93I 4QLCC 3W99A 2IZ4A 2M6NA 5B2IC 3KXBA 3BG0B 3U50C 4Z5TA 1ID3A 1P3GB 4LD9A 2LEXA 1YHQZ 5DNNA 2JR6A 3AZGA 3I4MI 1EQZA 2F8NH 2JA5I 3AZMD 4Z66A 4Y7NI 3LZ0C 1JFIA 1YUAA 1AOID 2JIQA 3G711 4RVDA 4H9RA 3VH5A 5AY8C 2NQBC 3REIC 3B0CW 5B24A 1ZLAA 1VQ7Z 2ZY2A 2QKDA 5AV8A 3I55Z 1M1K2 4NE5A 2JIMA 1KX5B 4NBGA 2KI7B 3CC2Z 2QLVB 5AN9F 3C1BA 3AV1C 3AZHC 2YADA 3H0LC 3JAMf 3HOXI 5JRGC 1P3BA 4J8UC 1VQMZ 3HOYI 4J8WD 3REHA 1F66D 1U35A 5AVCC 3X1TD 4NB8A 3LZ1B 5JA4A 5BO0B 2JCHA 3KSYA 4WU8C 1N2FA 4AYBA 2OTL1 3UTAB 2QEXZ 3AZND 3REKA 3CMA1 2F2AC 5G49A 3AN2A 3ESWA 3AZLD 1YIT1 3X1UD 1A7WA 3LELB 4J8VA 4KGCB 3H0MC 2ZAEB 3TE5B 3X1SD 5GT0D 3MGQA 3RELD 3KFUG 5GSUC 1N1JB 3HKZA 2LY8A 3B0DB 3IP4C 4XZQA 1KX4A 4X23D 4YM6D 5AV5C 1QVGZ 3WTPA 3AZFC 1P3FA 1VQO1 5BNXB 4ZUXD 2LIYA 4RVFA 3UT9B 5F99B 3FDDA 3AZJC 2CV5B 4XUJA 1P3GC 1TFIA 1VQKZ 1Q7Y2 3OW2Z 1P3PD 1P3OB 1P9NA 4G92C 1P3LA 3IFUA 4EWCA 1JWHC 3Q87A 4G91C 4XX2A 3WA9C 2E2JI 1P3AB 1P3IB 2VPZA 3LJAD 3MVDA 2AROA 3F6TA 5B1MA 3MGRD 2Y2PA 3B6FD 4ZBJB 4E2XA 5B32B 1M18A 1Q821 3X1VC 3NQUB 1X3WA 1S32A 1USPA 4M6BA 1K83I 3B6GB 2Y0SA 2QR1B 4MXUA 1Q811 3W96C 3AV2C 1KX5C 1KU5A 3VH6T 4QTUA 1YJ9Z 4KUDA 3J80f 1RO0A 5CPKD 2FJ7D 2F8NA 1WWSA 1RO4A 5AV9B 3EPLA 2O4HA 3D6WA 3GCFA 5C4JI 3W99C 4BBRI 3CCVZ 1YJWZ 1K9M2 3KXBC 5B0YA 1M19C 4LD9C 5B33B 3LZ1C 2WB1A 1P3KB 1K731 2Y2QA 5DNNC 1VQ4Z 1B67A 4CSRA 3AZGC 4H9SA 3C1CA 5CPJA 1EQZC 1I6HI 4RS4A 3V9RB 1F1EA 3VMHA 5AV6A 3MNND 3VMGA 3LELC 4KGCC 2NZDD 1YUKA 3REJA 2XD5A 3AZMB 2IZ3A 5B24C 1ZLAC 1AOIB 5IP9I 4CAYA 3B0DC 1Y1WI 3CXCZ 3S17I 4E2WA 5B31A 2RHBA 1P34D 1Z03A 3CCUZ 3AZKD 1YJNZ 5AY8A 1S721 5CP6A 3UT9C 2NQBA 5F99C 4JJNB 1TWAI 2G2KA 3MGSD 1VQN1 2HIOD 4A3MI 1TAFA 3WAAD 2JA6I 1FDOA 2VPWA 3VMIA 4A3EI 3M3YI 2JIRA 5GT3D 5B40A 4J8WB 3AZHA 3AV1A 1P3AC 1F66B 3H0GI 4H9PA 5JRGA 4NFRA 3G4SZ 3CPWZ 3CCSZ 3X1TB 1QVFZ 2PYOA 2Y2OA 4ZBJC 4R8PD 5KDMB 1WZNA 4BY7I 4X6AI 3PO3I 5B1LB 5AVCA 1TZYD 5FUGB 3B6GC 3AZNB 3W98D 3GTQI 2J6AA 2JIOA 4WU8A 1AA6A 2E2HI 3MGQC 2HUEB 3VB9A 3I561 3AZLB 1RLYA 3EEDA 5D1OB 3WTPC 2AKLA 2I3CA 3GTGI 5GT0B 2L5AA 3R45B 5AV9C 3RELB 4HH4A 4A3LI 2BYKA 4WNNB 4E44A 4NE3A 4XUJC 4X23B 1P3KC 5GSUA 4E32A 4H9QB 4ZUXB 3BG1B 5AV5A 3AZFA 4H9NB 5E5AD 1P3PB 4A93I 1H3OA 5B1MC 3CCJZ 2J8PA 3AZJA 1P3GA 3O62D 5IT9f 1S32C 3LJAB 1AOIC 1YI21 5B32D 3A1KA 3MGRB 3B6FB 1Q822 2F8NK 3RZDI 1Q812 1P3MD 2OTJ1 5DNMD 5CPID 1Z01A 2JNYA 2R92I 1FDIA 4A3BI 3FQQA 1ZB9A 3S2DI 5CPKB 3C1BD 3W96A 1KX5A 2FJ7B 2PM9A 1VLAA 4H9SC 3C1CC 1VQ51 1K732 3X1TC 2IO5B 3FKII 1I3QI 2G5HC 4J8XD 5AV6C 1M19A 5B0ZD 2JE5A 3LZ1A 5GXQD 3MGPD 3REJC 5BO0A 3AZNC 3AZED 3CCQZ 1VQP1 1VQ8Z 2HUEC 4A3II 2NVTI 3GTLI 3NDJA 3MNNB 3X1UC 2NZDB 1KRLA 3I4NI 4MH4A 5B31C 3X1SC 3WTPE 1BFMA 5IP7I 3A6NB 4WV4B 3LELA 3UTBD 4KGCA 5CP6C 2YFVB 4X23C 4YM6C 1KC81 1N1JA 1X0TA 1VQ61 3S1MI 1P34B 4ZUXC 4JJND 3AZKB 3CC41 4E30A 2GTIA 5B40C 1PFTA 3MGSB 2HIOB 5BNXA 3KUYD 1P3PC 3WAAB 1VQLZ 3UT9A 2P28A 5F99A 2CV5A 2PYOC 4EO5C 3AZID 3MONA 4NBDA 5GT3B 2PK7A 1P3OA 3B6FC 1I50I 4R8PB 5B1LD 3WKJB 1P3IA 1P3AA 1TWCI 4NBFA 2OOYB 1TZYB 2F8NG 3W98B 4AWLC 3NQUA 1K8A1 4YS3D 3B6GA 5CPKC 2FJ7C 3CQZI 3G6E1 1W2BY 1M902 1WJ2A 1YIJZ 2JUBA 2V8IA 3NH8A 2RVQD 5AV9A 3KWQB 2W04A 5A2Qb 2DE7A 4NBCA 1BH8B 3GTPI 2OZKA 5B33A 1P3KA 3J81b 5E5AB 1ID3B 4HGZA 5IT9b 3V9RA 4QLCD 3AYWD 5B31G 2NZDC 5B2ID 1JJ2Z 3O62B 3CCE1 3IF8A 4MD9A 4DGLA 1N8R2 4HGAB 4DRAA 5D1PA 3EPKA 1X3ZA 1RO2A 4MRIA 1VQ9Z 1AOIA 3CMEZ 3W97D 1P3MB 3LZ0D 3D9XA 3NFZA 3IR7A 3M4OI 5DNMB 3VH5T 3AZKC 5CPIB 1QYPA 3KIFA 4NOZA 3MGSC 3REID 5AVBD 2HIOC 1RQFA 4UUZB 3C1BB 2ZY5A 3CD6Z 2HU9A 3CCR1 3REHB 2IV2X 3CC71 2QA41 5JRGD 4J8WA 4R8PC 4A3CI 4J8UD 1WWIA 4NBHA 3S16I 4J8XB 3UTAC 4A3DI 3X1TA 1R4VA 1B6WA 3AFAD 2QRDB 5B0ZB 3MGPB 3AZEB 5GXQB 1WW9A 1YHQ1 1ZB8A 3REKB 5FUGA 4WU8D 3AZNA 4NE6A 3AN2B 2O53A 3A6ND 2Q51A 4DRBA 3TU4D 3AZLA 5CM2M 3X1UA 3F3FC 3UTBB 5BNVA 4DQYB 1TWGI 5D1OA 4A3FI 1KC82 3X1SA 5CHLB 3EPJA 4WJ3C 2RBLA 2E9HA 2JSSA 4HGYA 3JAMb 2CV5C 1VQ71 1VQ5Z 4WNNA 4X23A 4YM6A 4NH1C 3I551 4H9QA 2YFWB 5E5AC 1P3OC 4ZUXA 2NVXI 3KUYB 1L1OC 4A3JI 5B2JD 1Q861 3AZIB 1VQM1 4H9NA 1P3IC 3EG5B 3AZJD 1P3LB 1P3PA 1M1AD 3WKJD 4HGAC 5B32C 3S14I 1Q16A 2H85A 3LJAA 3WA9D 3G71Z 1P3MC 1KQSZ 4WU9D 3B6FA 2QEX1 1K8A2 5DNMC 5CPIC 2Y2NA 2NVYI 3QWUA 4YS3B 4E33A 3X1VD 4QTTA 1KX3D 3CCL1 5T64A 3AV2D 1W2EA 2NAPA 4NBEA 5CPKA 4BY1I 2F8NB 2FJ7A 2Y2IA 3KWQD 5B33C 2RPRA 2Y2GA 1BH9B 3HOWI 2BJOA 1HQ3D 3S1QI 4J8XC 2HF1A 3TDHB 1PZRA 5T67A 1LQLA 4Z2MH 1S7MA 3W99D 2QREB 3MGPC 3IX0A 2FFFB 3KXBD 2CWEA 4Z5TD 5CPJB 1M19D 1ID3D 2Y2KA 4LD9D 2KPIA 1VQK1 5DNND 2PMZA 2OTLZ 3AZGD 3AZMC 1EQZD 4QLCB 2ZM5A 3AYWB 2DE6A 2V8KA 5B2IB 2VUMI 1WIIA 3CMAZ 3VH6W 4Z66D 2B63I 1DL6A 1YITZ 2NZDA 3UTBC 3PO3S 5LL6f 2QRCB 1QVFY 4E45A 5B24D 3W97B 3J80b 3LZ0B 1ZLAD 2YFVA 4JJNC 1Q9CA 1NP6A 5AV8D 2XD1A 5AVBB 3REIB 1P34A 3KUYC 3AZKA 1VQOZ 1YJ91 1P3BD 4J8WC 1F66C 3GTOI 3AZIC 3MGSA 2F4OA 2HIOA 3REHD 1KD11 3WAAA 1ML8A 5B32G 3CCV1 1YJW1 1U35D 3MZKB 1ZH1A 5JRGB 1T3UA 5GT3A 5B1LC 4J8UB 1Q7Y1 2V3VA 2G5IC 1VQ41 3AFAB 4R8PA 5AVCB 5BT1D 3UTAA 3REKD 4YS3C 3AZLC 3KIHA 4WU8B 3AN2D 4J8VD 5GT0C
chains in the Genus database with same CATH topology
4KHAB 3RELC 3AL0C 3EPHA 3TU4B 3MGQD 1KX4D 4XZQD 3MZLB 5BS7A 1Z02A 2RVQC 3WTPD 1P3FD 3CCU1 3F3PC 1YJN1 4A3GI 3A1IA 3GKQA 1SFOI 3S1NI 3GTJI 1K9M1 4XUJD 1Q862 1BH8A 2P3YA 3FQMA 4E2ZA 3HOZI 5B2JB 1P3LD 3AYWC 1H3OB 1Z2CB 5E5AA 3LJAC 3AZJB 1M1AB 3MGRC 4TNUA 3G4S1 3MVDD 3CCS1 1W2BZ 2AROD 5B1MD 4G92B 3O62A 1M18D 1ULYA 2DF4C 1HTAA 4G91B 3WA9B 5B32A 1S32D 3W97C 4WU9B 2OOXB 5FLXf 3VH6A 2BYMB 1P3MA 5AVBC 3X1VB 4H9OB 5DNMA 3NQJB 5CPIA 1KX3B 4KUDD 1S72Z 1Y1VS 1VQNZ 2F8ND 3AV2B 3W96B 3EERA 2IO5C 4UUZA 2WAQA 5B0YD 2W8SA 1HQ3B 3C1CD 5CPJD 3AFAC 3W99B 2K3RA 3KXBB 2VF1A 4J8XA 4Z5TB 1M19B 4LD9B 3H0RC 3MNNC 2EGTA 5DNNB 3CCJ1 5B0ZA 5AV6D 3MGPA 5GXQA 3AZEA 2UWXA 3AZGB 1EQZB 3K7AI 3REJD 3PO2I 3VTNA 3A6NC 4Z66B 3TU4C 1JFIB 2E2II 3AZMA 3I56Z 4H9RB 2W03A 1NUIA 1P34C 5B24B 5B31D 3UTBA 5FLMI 4NFTA 1ZLAB 5AY8D 5AV8B 5CP6D 2NQBD 5C3EI 4CL1A 3WAAC 2BG1A 4JJNA 4RVHA 2Y2HA 4MD7A 5B2JC 1P3BB 5GT3C 1KD12 2YFWA 5B40D 3KUYA 3AZHD 3AV1D 1M1AC 3CCM1 1U35B 1F66A 3AZIA 3WKJC 2PYOD 1WCMI 5JA4B 1TZYC 5AVCD 5KDMA 3W98C 1YI2Z 4WU9C 1QVGY 2F4MA 5B1LA 3CCQ1 2Y2JA 2JS4A 1VQ81 2OTJZ 1NJI2 5G49B 1KX3C 4E31A 3OW2Y 3H3VJ 4J8VB 5BS7C 4YS3A 3MGQB 2Y2LA 1JJ2Y 5GT0A 3KWQC 3R45A 4XZQB 3RELA 1KX4B 2K5RA 3LUSA 1HQ3C 3WTPB 5GSUD 1P3FB 1QF8A 3CC21 1Y1VI 1BH9A 5AV5D 3AZFD 2V8JA 4Z5TC 4XUJB 1ID3C 3S15I 1VQL1 4NB9A 3GTKI 3O62C 1P3GD 1VQPZ 1NJI1 3J7A4 4Z66C 3NH4A 1R9TI 3HOVI 3MVDB 4QLCA 3AYWA 2AROB 5B1MB 5C4XI 5B2IA 1M18B 3CCLZ 3MGRA 2RT9A 2DE5A 2LFUA 5FLXb 2VQRA 1S32B 1USPB 3S2HI 5C3IB 4BBSI 2Y2MA 5AV8C 4NBAA 3W97A 2R6MA 3LZ0A 3T4NB 1VQ6Z 3C1BC 2Q4ZA 4KUDB 3CC4Z 4S1TA 1P3BC 1KX5D 3W96D 2VUGA 1M1K1 4Y52I 3REIA 5AVBA 3GTMS 3REHC 1YIJ1 1U35C 3B0CT 3P5JB 5B0YB 2R7ZI 3NDIA 3I07A 2M48A 2GTHA 4CSRB 5B0ZC 3AZEC 5GXQC 3C1CB 4NBBA 3CXCY 4A3KI 3LZ1D 4J8UA 2NVQI 5BT1C 3REKC 3AFAA 3UTAD 5AV6B 3AN2C 3VH5W 4J8VC 2JA8I 3REJB 3MNNA 2JA7I 2ZY3A 3HOUI 4UPKA 3LELD 4KGCD 3CPWY 4CAYB 1RNIA 4KHAA 4XZQC 3X1UB 3A6NA 1KX4C 2ZY4A 5BNVB 3TU4A 1TWHI 3G6EZ 3CME1 1P3FC 5B31B 3X1SB 1VQ91 3RZOI 5AY8B 5CP6B 2NQBB 2GU2A 1M901 1KQSY 4YM6B 2RIQA 1TAFB 4RV9A 4DK1A 3UT9D 5C44I 5F99D 2CV5D 1P3LC 4MD8A 5A2Qf 5B40B 3HOYI 3B0BA 3AZHB 3AV1B 4Z2MG 1P3OD 5B2JA 4H9PB 3MVDC 2JMOA 3CD61 2AROC 2YU9I 2PYOB 4EO5B 1M1AA 1P3ID 1P3AD 1M18C 4MONA 1TWFI 3J81f 3CCEZ 3WKJA 3NH5A 5C3IC 5T6BA 1TZYA 3WA9A 3W98A 1N8R1 4WU9A 3B6GD 4KUDC 4RVGA 2BYMA 4AWLB 3X1VA 4H9OA 3NQJA 1KX3A 3S1RI 2DQNC 4WZSB 5B0YC 2BYKB 3AV2A 5AV9D 5GSUB 3CCRZ 3KWQA 3CC7Z 3CCMZ 5CPJC 2QA4Z 5B33D 5AV5B 1P3KD 1HQ3A 3AZFB 3GTMI 4E2YA 4BXXI 2R93I 4QLCC 3W99A 2IZ4A 2M6NA 5B2IC 3KXBA 3BG0B 3U50C 4Z5TA 1ID3A 1P3GB 4LD9A 1YHQZ 5DNNA 2JR6A 3AZGA 3I4MI 1EQZA 2F8NH 2JA5I 3AZMD 4Z66A 4Y7NI 3LZ0C 1JFIA 1YUAA 1AOID 3G711 4RVDA 4H9RA 3VH5A 5AY8C 2NQBC 3REIC 3B0CW 5B24A 1ZLAA 1VQ7Z 2ZY2A 2QKDA 5AV8A 3I55Z 1M1K2 4NE5A 4NBGA 1KX5B 3CC2Z 2KI7B 2QLVB 5AN9F 3C1BA 3AV1C 3AZHC 2YADA 3H0LC 3JAMf 3HOXI 5JRGC 1P3BA 4J8UC 1VQMZ 4J8WD 3REHA 1F66D 1U35A 5AVCC 3X1TD 4NB8A 3LZ1B 5JA4A 5BO0B 2JCHA 3KSYA 4WU8C 1N2FA 4AYBA 2OTL1 3UTAB 2QEXZ 3AZND 3REKA 3CMA1 2F2AC 5G49A 3AN2A 3ESWA 3AZLD 1YIT1 3X1UD 1A7WA 3LELB 4J8VA 4KGCB 3H0MC 2ZAEB 3TE5B 3X1SD 5GT0D 3MGQA 3RELD 3KFUG 5GSUC 1N1JB 3HKZA 2LY8A 3B0DB 3IP4C 4XZQA 1KX4A 4X23D 4YM6D 5AV5C 1QVGZ 3WTPA 3AZFC 1P3FA 1VQO1 5BNXB 4ZUXD 2LIYA 4RVFA 3UT9B 5F99B 3FDDA 3AZJC 2CV5B 4XUJA 1P3GC 1TFIA 1VQKZ 1Q7Y2 3OW2Z 1P3PD 1P3OB 1P9NA 4G92C 1P3LA 3IFUA 4EWCA 1JWHC 3Q87A 4G91C 4XX2A 3WA9C 2E2JI 1P3AB 1P3IB 3LJAD 3MVDA 2AROA 3F6TA 5B1MA 3MGRD 2Y2PA 3B6FD 4ZBJB 4E2XA 5B32B 1M18A 1Q821 3X1VC 3NQUB 1X3WA 1S32A 1USPA 4M6BA 1K83I 3B6GB 2Y0SA 2QR1B 4MXUA 1Q811 3W96C 3AV2C 1KX5C 1KU5A 3VH6T 4QTUA 1YJ9Z 4KUDA 3J80f 1RO0A 5CPKD 2FJ7D 2F8NA 1WWSA 1RO4A 5AV9B 3EPLA 2O4HA 3D6WA 3GCFA 5C4JI 3W99C 4BBRI 3CCVZ 1YJWZ 1K9M2 3KXBC 5B0YA 1M19C 4LD9C 5B33B 3LZ1C 2WB1A 1P3KB 1K731 2Y2QA 5DNNC 1VQ4Z 1B67A 4CSRA 3AZGC 4H9SA 3C1CA 5CPJA 1EQZC 1I6HI 4RS4A 3V9RB 1F1EA 3VMHA 5AV6A 3MNND 3VMGA 3LELC 4KGCC 2NZDD 1YUKA 3REJA 2XD5A 3AZMB 2IZ3A 5B24C 1ZLAC 1AOIB 5IP9I 4CAYA 3B0DC 1Y1WI 3CXCZ 3S17I 4E2WA 5B31A 2RHBA 1P34D 1Z03A 3CCUZ 3AZKD 1YJNZ 5AY8A 1S721 5CP6A 3UT9C 2NQBA 5F99C 4JJNB 1TWAI 2G2KA 3MGSD 1VQN1 2HIOD 4A3MI 1TAFA 3WAAD 2JA6I 4A3EI 3M3YI 3VMIA 5GT3D 5B40A 4J8WB 3AZHA 3AV1A 1P3AC 1F66B 3H0GI 4H9PA 5JRGA 4NFRA 3G4SZ 3CPWZ 3CCSZ 3X1TB 1QVFZ 2PYOA 2Y2OA 4ZBJC 4R8PD 5KDMB 4X6AI 4BY7I 3PO3I 5B1LB 5AVCA 1TZYD 5FUGB 3B6GC 3AZNB 3W98D 3GTQI 2J6AA 4WU8A 2E2HI 3MGQC 2HUEB 3VB9A 3I561 3AZLB 1RLYA 3EEDA 5D1OB 3WTPC 2AKLA 2I3CA 3GTGI 5GT0B 2L5AA 3R45B 5AV9C 3RELB 4HH4A 4A3LI 2BYKA 4WNNB 4E44A 4NE3A 4XUJC 4X23B 1P3KC 5GSUA 4E32A 4H9QB 4ZUXB 3BG1B 5AV5A 3AZFA 4H9NB 5E5AD 1P3PB 4A93I 1H3OA 5B1MC 3CCJZ 2J8PA 3AZJA 1P3GA 3O62D 5IT9f 1S32C 3LJAB 1AOIC 1YI21 5B32D 3A1KA 3MGRB 3B6FB 1Q822 2F8NK 3RZDI 1Q812 1P3MD 2OTJ1 5DNMD 5CPID 1Z01A 2JNYA 2R92I 4A3BI 3FQQA 1ZB9A 3S2DI 5CPKB 3C1BD 3W96A 1KX5A 2FJ7B 2PM9A 1VLAA 4H9SC 3C1CC 1VQ51 1K732 3X1TC 2IO5B 3FKII 1I3QI 2G5HC 4J8XD 5AV6C 1M19A 5B0ZD 2JE5A 3LZ1A 5GXQD 3MGPD 3REJC 5BO0A 3AZNC 3AZED 3CCQZ 1VQP1 1VQ8Z 2HUEC 4A3II 2NVTI 3GTLI 3NDJA 3MNNB 3X1UC 2NZDB 1KRLA 3I4NI 4MH4A 5B31C 3X1SC 3WTPE 1BFMA 5IP7I 3A6NB 4WV4B 3LELA 3UTBD 4KGCA 5CP6C 2YFVB 4X23C 4YM6C 1KC81 1N1JA 1X0TA 1VQ61 3S1MI 1P34B 4ZUXC 4JJND 3AZKB 3CC41 4E30A 2GTIA 5B40C 1PFTA 3MGSB 2HIOB 5BNXA 3KUYD 1P3PC 3WAAB 1VQLZ 3UT9A 2P28A 5F99A 2CV5A 2PYOC 4EO5C 3AZID 3MONA 4NBDA 5GT3B 2PK7A 1P3OA 3B6FC 1I50I 4R8PB 5B1LD 3WKJB 1P3IA 1P3AA 1TWCI 4NBFA 2OOYB 1TZYB 2F8NG 3W98B 4AWLC 3NQUA 1K8A1 4YS3D 3B6GA 5CPKC 2FJ7C 3CQZI 3G6E1 1W2BY 1M902 1YIJZ 2JUBA 2V8IA 3NH8A 2RVQD 5AV9A 3KWQB 2W04A 5A2Qb 2DE7A 4NBCA 1BH8B 3GTPI 2OZKA 5B33A 1P3KA 3J81b 5E5AB 1ID3B 4HGZA 5IT9b 3V9RA 4QLCD 3AYWD 5B31G 2NZDC 5B2ID 1JJ2Z 3O62B 3CCE1 3IF8A 4MD9A 4DGLA 1N8R2 4HGAB 4DRAA 5D1PA 3EPKA 1X3ZA 1RO2A 4MRIA 1VQ9Z 1AOIA 3CMEZ 3W97D 1P3MB 3LZ0D 3D9XA 3NFZA 3M4OI 5DNMB 3VH5T 3AZKC 5CPIB 1QYPA 3KIFA 4NOZA 3MGSC 3REID 5AVBD 2HIOC 1RQFA 4UUZB 3C1BB 2ZY5A 3CD6Z 2HU9A 3CCR1 3REHB 3CC71 2QA41 5JRGD 4J8WA 4R8PC 4A3CI 4J8UD 1WWIA 4NBHA 3S16I 4J8XB 3UTAC 4A3DI 3X1TA 1R4VA 1B6WA 3AFAD 2QRDB 5B0ZB 3MGPB 3AZEB 5GXQB 1WW9A 1YHQ1 1ZB8A 3REKB 5FUGA 4WU8D 3AZNA 4NE6A 3AN2B 2O53A 3A6ND 2Q51A 4DRBA 3TU4D 3AZLA 5CM2M 3X1UA 3F3FC 3UTBB 5BNVA 4DQYB 1TWGI 5D1OA 4A3FI 1KC82 3X1SA 5CHLB 3EPJA 4WJ3C 2RBLA 2E9HA 2JSSA 4HGYA 3JAMb 2CV5C 1VQ71 1VQ5Z 4WNNA 4X23A 4YM6A 4NH1C 3I551 4H9QA 2YFWB 5E5AC 1P3OC 4ZUXA 2NVXI 3KUYB 1L1OC 4A3JI 5B2JD 1Q861 3AZIB 1VQM1 4H9NA 1P3IC 3EG5B 3AZJD 1P3LB 1P3PA 1M1AD 3WKJD 4HGAC 5B32C 3S14I 2H85A 3LJAA 3WA9D 3G71Z 1P3MC 1KQSZ 4WU9D 3B6FA 2QEX1 1K8A2 5DNMC 5CPIC 2Y2NA 2NVYI 3QWUA 4YS3B 4E33A 3X1VD 4QTTA 1KX3D 3CCL1 5T64A 3AV2D 1W2EA 4NBEA 5CPKA 4BY1I 2F8NB 2FJ7A 2Y2IA 3KWQD 5B33C 2RPRA 2Y2GA 1BH9B 3HOWI 2BJOA 1HQ3D 3S1QI 4J8XC 2HF1A 3TDHB 1PZRA 5T67A 1LQLA 4Z2MH 1S7MA 3W99D 2QREB 3MGPC 3IX0A 2FFFB 3KXBD 2CWEA 4Z5TD 5CPJB 1M19D 1ID3D 2Y2KA 4LD9D 2KPIA 1VQK1 5DNND 2PMZA 2OTLZ 3AZGD 3AZMC 1EQZD 4QLCB 2ZM5A 3AYWB 2DE6A 2V8KA 5B2IB 2VUMI 1WIIA 3CMAZ 3VH6W 4Z66D 2B63I 1DL6A 1YITZ 2NZDA 3UTBC 3PO3S 5LL6f 2QRCB 1QVFY 4E45A 5B24D 3W97B 3J80b 3LZ0B 1ZLAD 2YFVA 4JJNC 1Q9CA 1NP6A 5AV8D 2XD1A 5AVBB 3REIB 1P34A 3KUYC 3AZKA 1VQOZ 1YJ91 1P3BD 4J8WC 1F66C 3GTOI 3AZIC 3MGSA 2F4OA 2HIOA 3REHD 1KD11 3WAAA 1ML8A 5B32G 3CCV1 1YJW1 1U35D 3MZKB 1ZH1A 5JRGB 1T3UA 5GT3A 5B1LC 4J8UB 1Q7Y1 2G5IC 1VQ41 3AFAB 4R8PA 5AVCB 5BT1D 3UTAA 3REKD 4YS3C 3AZLC 3KIHA 4WU8B 3AN2D 4J8VD 5GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIQ A;  4DQY B; 
#chains in the Genus database with same CATH topology
 4KHA B;  3REL C;  3AL0 C;  3EPH A;  2V45 A;  3TU4 B;  3MGQ D;  1KX4 D;  4XZQ D;  3MZL B;  5BS7 A;  2VPY A;  1Z02 A;  2RVQ C;  3WTP D;  1P3F D;  3CCU 1;  3F3P C;  1YJN 1;  4A3G I;  3A1I A;  3GKQ A;  1SFO I;  3S1N I;  3GTJ I;  1K9M 1;  4XUJ D;  1Q86 2;  1BH8 A;  2P3Y A;  3FQM A;  4E2Z A;  3HOZ I;  5B2J B;  1P3L D;  3AYW C;  1H3O B;  1Z2C B;  5E5A A;  3LJA C;  3AZJ B;  1M1A B;  3MGR C;  4TNU A;  3G4S 1;  3MVD D;  3CCS 1;  1W2B Z;  2ARO D;  5B1M D;  1SIW A;  4G92 B;  3O62 A;  1M18 D;  1ULY A;  2DF4 C;  1HTA A;  4G91 B;  3WA9 B;  5B32 A;  1S32 D;  3W97 C;  4WU9 B;  2OOX B;  5FLX f;  3VH6 A;  2BYM B;  1P3M A;  5AVB C;  3X1V B;  4H9O B;  5DNM A;  3NQJ B;  5CPI A;  1KX3 B;  4KUD D;  1S72 Z;  1Y1V S;  1VQN Z;  2F8N D;  3AV2 B;  3W96 B;  3EER A;  2IO5 C;  4UUZ A;  2WAQ A;  5B0Y D;  2W8S A;  1HQ3 B;  3C1C D;  5CPJ D;  3AFA C;  3W99 B;  2K3R A;  3KXB B;  2VF1 A;  4J8X A;  4Z5T B;  1M19 B;  4LD9 B;  3H0R C;  3MNN C;  2EGT A;  5DNN B;  3CCJ 1;  5B0Z A;  5AV6 D;  3MGP A;  5GXQ A;  3AZE A;  2UWX A;  3AZG B;  1EQZ B;  3K7A I;  3REJ D;  3PO2 I;  3VTN A;  3A6N C;  4Z66 B;  3TU4 C;  1JFI B;  2E2I I;  3AZM A;  3I56 Z;  4H9R B;  2W03 A;  1NUI A;  1P34 C;  5B24 B;  5B31 D;  3UTB A;  5FLM I;  4NFT A;  1ZLA B;  5AY8 D;  5AV8 B;  5CP6 D;  2NQB D;  5C3E I;  4CL1 A;  3WAA C;  2BG1 A;  4JJN A;  4RVH A;  2Y2H A;  4MD7 A;  5B2J C;  1P3B B;  5GT3 C;  1KD1 2;  2YFW A;  5B40 D;  3KUY A;  3AZH D;  3AV1 D;  1M1A C;  3CCM 1;  1U35 B;  1F66 A;  3AZI A;  3WKJ C;  2PYO D;  1WCM I;  5JA4 B;  1TZY C;  5AVC D;  5KDM A;  3W98 C;  1YI2 Z;  4WU9 C;  1QVG Y;  2F4M A;  5B1L A;  3CCQ 1;  2Y2J A;  2JS4 A;  1VQ8 1;  2OTJ Z;  1NJI 2;  5G49 B;  1KX3 C;  4E31 A;  3OW2 Y;  3H3V J;  4J8V B;  5BS7 C;  4YS3 A;  3MGQ B;  2Y2L A;  1JJ2 Y;  5GT0 A;  3KWQ C;  3R45 A;  4XZQ B;  3REL A;  1KX4 B;  2K5R A;  3LUS A;  1HQ3 C;  3WTP B;  5GSU D;  1P3F B;  1QF8 A;  3CC2 1;  1Y1V I;  1BH9 A;  5AV5 D;  3AZF D;  2V8J A;  4Z5T C;  4XUJ B;  1ID3 C;  3S15 I;  1VQL 1;  4NB9 A;  3GTK I;  3O62 C;  1P3G D;  1VQP Z;  1NJI 1;  3J7A 4;  4Z66 C;  3NH4 A;  1R9T I;  2VPX A;  3MVD B;  4QLC A;  3AYW A;  2ARO B;  5B1M B;  5C4X I;  5B2I A;  3HOV I;  1M18 B;  3CCL Z;  3MGR A;  2RT9 A;  2DE5 A;  2LFU A;  5FLX b;  2VQR A;  1S32 B;  1USP B;  3S2H I;  5C3I B;  4BBS I;  2Y2M A;  5AV8 C;  4NBA A;  3W97 A;  2R6M A;  3LZ0 A;  3T4N B;  1VQ6 Z;  3C1B C;  2Q4Z A;  4KUD B;  3CC4 Z;  4S1T A;  1P3B C;  1KX5 D;  3W96 D;  2VUG A;  1M1K 1;  4Y52 I;  3REI A;  5AVB A;  3GTM S;  3REH C;  1YIJ 1;  1U35 C;  3B0C T;  3P5J B;  5B0Y B;  2R7Z I;  3NDI A;  3I07 A;  2M48 A;  2GTH A;  4CSR B;  5B0Z C;  3AZE C;  5GXQ C;  3C1C B;  4NBB A;  3CXC Y;  4A3K I;  3LZ1 D;  4J8U A;  2NVQ I;  5BT1 C;  3REK C;  3AFA A;  3UTA D;  5AV6 B;  3AN2 C;  3VH5 W;  4J8V C;  2JA8 I;  3REJ B;  3MNN A;  2JA7 I;  2ZY3 A;  3HOU I;  4UPK A;  3LEL D;  4KGC D;  3CPW Y;  4CAY B;  1RNI A;  4KHA A;  4XZQ C;  3X1U B;  3A6N A;  1KX4 C;  2ZY4 A;  5BNV B;  3TU4 A;  1TWH I;  3G6E Z;  3CME 1;  1P3F C;  5B31 B;  3X1S B;  1VQ9 1;  3RZO I;  5AY8 B;  5CP6 B;  2NQB B;  2GU2 A;  1M90 1;  1KQS Y;  4YM6 B;  2RIQ A;  1TAF B;  4RV9 A;  4DK1 A;  3UT9 D;  5C44 I;  5F99 D;  2CV5 D;  1P3L C;  4MD8 A;  5A2Q f;  5B40 B;  2E7Z A;  3B0B A;  3AZH B;  3AV1 B;  4Z2M G;  1P3O D;  5B2J A;  4H9P B;  3MVD C;  2JMO A;  3CD6 1;  2ARO C;  2YU9 I;  2PYO B;  4EO5 B;  1M1A A;  1P3I D;  1P3A D;  1M18 C;  4MON A;  1TWF I;  3J81 f;  3CCE Z;  3WKJ A;  3NH5 A;  5C3I C;  5T6B A;  1TZY A;  3WA9 A;  3W98 A;  1N8R 1;  4WU9 A;  3B6G D;  4KUD C;  1QXF A;  4RVG A;  2BYM A;  4AWL B;  3X1V A;  4H9O A;  3NQJ A;  1KX3 A;  3S1R I;  2DQN C;  4WZS B;  5B0Y C;  2BYK B;  3AV2 A;  1Y8C A;  5AV9 D;  2AYD A;  2JIP A;  5GSU B;  3CCR Z;  3KWQ A;  3CC7 Z;  3D2L A;  5CPJ C;  3CCM Z;  5B33 D;  2QA4 Z;  5AV5 B;  1P3K D;  1HQ3 A;  3AZF B;  3GTM I;  4E2Y A;  4BXX I;  2R93 I;  4QLC C;  3W99 A;  2IZ4 A;  2M6N A;  5B2I C;  3KXB A;  3BG0 B;  3U50 C;  4Z5T A;  1ID3 A;  1P3G B;  4LD9 A;  2LEX A;  1YHQ Z;  5DNN A;  2JR6 A;  3AZG A;  3I4M I;  1EQZ A;  2F8N H;  2JA5 I;  3AZM D;  4Z66 A;  4Y7N I;  3LZ0 C;  1JFI A;  1YUA A;  1AOI D;  2JIQ A;  3G71 1;  4RVD A;  4H9R A;  3VH5 A;  5AY8 C;  2NQB C;  3REI C;  3B0C W;  5B24 A;  1ZLA A;  1VQ7 Z;  2ZY2 A;  2QKD A;  5AV8 A;  3I55 Z;  1M1K 2;  4NE5 A;  2JIM A;  1KX5 B;  4NBG A;  2KI7 B;  3CC2 Z;  2QLV B;  5AN9 F;  3C1B A;  3AV1 C;  3AZH C;  2YAD A;  3H0L C;  3JAM f;  3HOX I;  5JRG C;  1P3B A;  4J8U C;  1VQM Z;  3HOY I;  4J8W D;  3REH A;  1F66 D;  1U35 A;  5AVC C;  3X1T D;  4NB8 A;  3LZ1 B;  5JA4 A;  5BO0 B;  2JCH A;  3KSY A;  4WU8 C;  1N2F A;  4AYB A;  2OTL 1;  3UTA B;  2QEX Z;  3AZN D;  3REK A;  3CMA 1;  2F2A C;  5G49 A;  3AN2 A;  3ESW A;  3AZL D;  1YIT 1;  3X1U D;  1A7W A;  3LEL B;  4J8V A;  4KGC B;  3H0M C;  2ZAE B;  3TE5 B;  3X1S D;  5GT0 D;  3MGQ A;  3REL D;  3KFU G;  5GSU C;  1N1J B;  3HKZ A;  2LY8 A;  3B0D B;  3IP4 C;  4XZQ A;  1KX4 A;  4X23 D;  4YM6 D;  5AV5 C;  1QVG Z;  3WTP A;  3AZF C;  1P3F A;  1VQO 1;  5BNX B;  4ZUX D;  2LIY A;  4RVF A;  3UT9 B;  5F99 B;  3FDD A;  3AZJ C;  2CV5 B;  4XUJ A;  1P3G C;  1TFI A;  1VQK Z;  1Q7Y 2;  3OW2 Z;  1P3P D;  1P3O B;  1P9N A;  4G92 C;  1P3L A;  3IFU A;  4EWC A;  1JWH C;  3Q87 A;  4G91 C;  4XX2 A;  3WA9 C;  2E2J I;  1P3A B;  1P3I B;  2VPZ A;  3LJA D;  3MVD A;  2ARO A;  3F6T A;  5B1M A;  3MGR D;  2Y2P A;  3B6F D;  4ZBJ B;  4E2X A;  5B32 B;  1M18 A;  1Q82 1;  3X1V C;  3NQU B;  1X3W A;  1S32 A;  1USP A;  4M6B A;  1K83 I;  3B6G B;  2Y0S A;  2QR1 B;  4MXU A;  1Q81 1;  3W96 C;  3AV2 C;  1KX5 C;  1KU5 A;  3VH6 T;  4QTU A;  1YJ9 Z;  4KUD A;  3J80 f;  1RO0 A;  5CPK D;  2FJ7 D;  2F8N A;  1WWS A;  1RO4 A;  5AV9 B;  3EPL A;  2O4H A;  3D6W A;  3GCF A;  5C4J I;  3W99 C;  4BBR I;  3CCV Z;  1YJW Z;  1K9M 2;  3KXB C;  5B0Y A;  1M19 C;  4LD9 C;  5B33 B;  3LZ1 C;  2WB1 A;  1P3K B;  1K73 1;  2Y2Q A;  5DNN C;  1VQ4 Z;  1B67 A;  4CSR A;  3AZG C;  4H9S A;  3C1C A;  5CPJ A;  1EQZ C;  1I6H I;  4RS4 A;  3V9R B;  1F1E A;  3VMH A;  5AV6 A;  3MNN D;  3VMG A;  3LEL C;  4KGC C;  2NZD D;  1YUK A;  3REJ A;  2XD5 A;  3AZM B;  2IZ3 A;  5B24 C;  1ZLA C;  1AOI B;  5IP9 I;  4CAY A;  3B0D C;  1Y1W I;  3CXC Z;  3S17 I;  4E2W A;  5B31 A;  2RHB A;  1P34 D;  1Z03 A;  3CCU Z;  3AZK D;  1YJN Z;  5AY8 A;  1S72 1;  5CP6 A;  3UT9 C;  2NQB A;  5F99 C;  4JJN B;  1TWA I;  2G2K A;  3MGS D;  1VQN 1;  2HIO D;  4A3M I;  1TAF A;  3WAA D;  2JA6 I;  1FDO A;  2VPW A;  3VMI A;  4A3E I;  3M3Y I;  2JIR A;  5GT3 D;  5B40 A;  4J8W B;  3AZH A;  3AV1 A;  1P3A C;  1F66 B;  3H0G I;  4H9P A;  5JRG A;  4NFR A;  3G4S Z;  3CPW Z;  3CCS Z;  3X1T B;  1QVF Z;  2PYO A;  2Y2O A;  4ZBJ C;  4R8P D;  5KDM B;  1WZN A;  4BY7 I;  4X6A I;  3PO3 I;  5B1L B;  5AVC A;  1TZY D;  5FUG B;  3B6G C;  3AZN B;  3W98 D;  3GTQ I;  2J6A A;  2JIO A;  4WU8 A;  1AA6 A;  2E2H I;  3MGQ C;  2HUE B;  3VB9 A;  3I56 1;  3AZL B;  1RLY A;  3EED A;  5D1O B;  3WTP C;  2AKL A;  2I3C A;  3GTG I;  5GT0 B;  2L5A A;  3R45 B;  5AV9 C;  3REL B;  4HH4 A;  4A3L I;  2BYK A;  4WNN B;  4E44 A;  4NE3 A;  4XUJ C;  4X23 B;  1P3K C;  5GSU A;  4E32 A;  4H9Q B;  4ZUX B;  3BG1 B;  5AV5 A;  3AZF A;  4H9N B;  5E5A D;  1P3P B;  4A93 I;  1H3O A;  5B1M C;  3CCJ Z;  2J8P A;  3AZJ A;  1P3G A;  3O62 D;  5IT9 f;  1S32 C;  3LJA B;  1AOI C;  1YI2 1;  5B32 D;  3A1K A;  3MGR B;  3B6F B;  1Q82 2;  2F8N K;  3RZD I;  1Q81 2;  1P3M D;  2OTJ 1;  5DNM D;  5CPI D;  1Z01 A;  2JNY A;  2R92 I;  1FDI A;  4A3B I;  3FQQ A;  1ZB9 A;  3S2D I;  5CPK B;  3C1B D;  3W96 A;  1KX5 A;  2FJ7 B;  2PM9 A;  1VLA A;  4H9S C;  3C1C C;  1VQ5 1;  1K73 2;  3X1T C;  2IO5 B;  3FKI I;  1I3Q I;  2G5H C;  4J8X D;  5AV6 C;  1M19 A;  5B0Z D;  2JE5 A;  3LZ1 A;  5GXQ D;  3MGP D;  3REJ C;  5BO0 A;  3AZN C;  3AZE D;  3CCQ Z;  1VQP 1;  1VQ8 Z;  2HUE C;  4A3I I;  2NVT I;  3GTL I;  3NDJ A;  3MNN B;  3X1U C;  2NZD B;  1KRL A;  3I4N I;  4MH4 A;  5B31 C;  3X1S C;  3WTP E;  1BFM A;  5IP7 I;  3A6N B;  4WV4 B;  3LEL A;  3UTB D;  4KGC A;  5CP6 C;  2YFV B;  4X23 C;  4YM6 C;  1KC8 1;  1N1J A;  1X0T A;  1VQ6 1;  3S1M I;  1P34 B;  4ZUX C;  4JJN D;  3AZK B;  3CC4 1;  4E30 A;  2GTI A;  5B40 C;  1PFT A;  3MGS B;  2HIO B;  5BNX A;  3KUY D;  1P3P C;  3WAA B;  1VQL Z;  3UT9 A;  2P28 A;  5F99 A;  2CV5 A;  2PYO C;  4EO5 C;  3AZI D;  3MON A;  4NBD A;  5GT3 B;  2PK7 A;  1P3O A;  3B6F C;  1I50 I;  4R8P B;  5B1L D;  3WKJ B;  1P3I A;  1P3A A;  1TWC I;  4NBF A;  2OOY B;  1TZY B;  2F8N G;  3W98 B;  4AWL C;  3NQU A;  1K8A 1;  4YS3 D;  3B6G A;  5CPK C;  2FJ7 C;  3CQZ I;  3G6E 1;  1W2B Y;  1M90 2;  1WJ2 A;  1YIJ Z;  2JUB A;  2V8I A;  3NH8 A;  2RVQ D;  5AV9 A;  3KWQ B;  2W04 A;  5A2Q b;  2DE7 A;  4NBC A;  1BH8 B;  3GTP I;  2OZK A;  5B33 A;  1P3K A;  3J81 b;  5E5A B;  1ID3 B;  4HGZ A;  5IT9 b;  3V9R A;  4QLC D;  3AYW D;  5B31 G;  2NZD C;  5B2I D;  1JJ2 Z;  3O62 B;  3CCE 1;  3IF8 A;  4MD9 A;  4DGL A;  1N8R 2;  4HGA B;  4DRA A;  5D1P A;  3EPK A;  1X3Z A;  1RO2 A;  4MRI A;  1VQ9 Z;  1AOI A;  3CME Z;  3W97 D;  1P3M B;  3LZ0 D;  3D9X A;  3NFZ A;  3IR7 A;  3M4O I;  5DNM B;  3VH5 T;  3AZK C;  5CPI B;  1QYP A;  3KIF A;  4NOZ A;  3MGS C;  3REI D;  5AVB D;  2HIO C;  1RQF A;  4UUZ B;  3C1B B;  2ZY5 A;  3CD6 Z;  2HU9 A;  3CCR 1;  3REH B;  2IV2 X;  3CC7 1;  2QA4 1;  5JRG D;  4J8W A;  4R8P C;  4A3C I;  4J8U D;  1WWI A;  4NBH A;  3S16 I;  4J8X B;  3UTA C;  4A3D I;  3X1T A;  1R4V A;  1B6W A;  3AFA D;  2QRD B;  5B0Z B;  3MGP B;  3AZE B;  5GXQ B;  1WW9 A;  1YHQ 1;  1ZB8 A;  3REK B;  5FUG A;  4WU8 D;  3AZN A;  4NE6 A;  3AN2 B;  2O53 A;  3A6N D;  2Q51 A;  4DRB A;  3TU4 D;  3AZL A;  5CM2 M;  3X1U A;  3F3F C;  3UTB B;  5BNV A;  4DQY B;  1TWG I;  5D1O A;  4A3F I;  1KC8 2;  3X1S A;  5CHL B;  3EPJ A;  4WJ3 C;  2RBL A;  2E9H A;  2JSS A;  4HGY A;  3JAM b;  2CV5 C;  1VQ7 1;  1VQ5 Z;  4WNN A;  4X23 A;  4YM6 A;  4NH1 C;  3I55 1;  4H9Q A;  2YFW B;  5E5A C;  1P3O C;  4ZUX A;  2NVX I;  3KUY B;  1L1O C;  4A3J I;  5B2J D;  1Q86 1;  3AZI B;  1VQM 1;  4H9N A;  1P3I C;  3EG5 B;  3AZJ D;  1P3L B;  1P3P A;  1M1A D;  3WKJ D;  4HGA C;  5B32 C;  3S14 I;  1Q16 A;  2H85 A;  3LJA A;  3WA9 D;  3G71 Z;  1P3M C;  1KQS Z;  4WU9 D;  3B6F A;  2QEX 1;  1K8A 2;  5DNM C;  5CPI C;  2Y2N A;  2NVY I;  3QWU A;  4YS3 B;  4E33 A;  3X1V D;  4QTT A;  1KX3 D;  3CCL 1;  5T64 A;  3AV2 D;  1W2E A;  2NAP A;  4NBE A;  5CPK A;  4BY1 I;  2F8N B;  2FJ7 A;  2Y2I A;  3KWQ D;  5B33 C;  2RPR A;  2Y2G A;  1BH9 B;  3HOW I;  2BJO A;  1HQ3 D;  3S1Q I;  4J8X C;  2HF1 A;  3TDH B;  1PZR A;  5T67 A;  1LQL A;  4Z2M H;  1S7M A;  3W99 D;  2QRE B;  3MGP C;  3IX0 A;  2FFF B;  3KXB D;  2CWE A;  4Z5T D;  5CPJ B;  1M19 D;  1ID3 D;  2Y2K A;  4LD9 D;  2KPI A;  1VQK 1;  5DNN D;  2PMZ A;  2OTL Z;  3AZG D;  3AZM C;  1EQZ D;  4QLC B;  2ZM5 A;  3AYW B;  2DE6 A;  2V8K A;  5B2I B;  2VUM I;  1WII A;  3CMA Z;  3VH6 W;  4Z66 D;  2B63 I;  1DL6 A;  1YIT Z;  2NZD A;  3UTB C;  3PO3 S;  5LL6 f;  2QRC B;  1QVF Y;  4E45 A;  5B24 D;  3W97 B;  3J80 b;  3LZ0 B;  1ZLA D;  2YFV A;  4JJN C;  1Q9C A;  1NP6 A;  5AV8 D;  2XD1 A;  5AVB B;  3REI B;  1P34 A;  3KUY C;  3AZK A;  1VQO Z;  1YJ9 1;  1P3B D;  4J8W C;  1F66 C;  3GTO I;  3AZI C;  3MGS A;  2F4O A;  2HIO A;  3REH D;  1KD1 1;  3WAA A;  1ML8 A;  5B32 G;  3CCV 1;  1YJW 1;  1U35 D;  3MZK B;  1ZH1 A;  5JRG B;  1T3U A;  5GT3 A;  5B1L C;  4J8U B;  1Q7Y 1;  2V3V A;  2G5I C;  1VQ4 1;  3AFA B;  4R8P A;  5AVC B;  5BT1 D;  3UTA A;  3REK D;  4YS3 C;  3AZL C;  3KIH A;  4WU8 B;  3AN2 D;  4J8V D;  5GT0 C; 
#chains in the Genus database with same CATH homology
 4KHA B;  3REL C;  3AL0 C;  3EPH A;  3TU4 B;  3MGQ D;  1KX4 D;  4XZQ D;  3MZL B;  5BS7 A;  1Z02 A;  2RVQ C;  3WTP D;  1P3F D;  3CCU 1;  3F3P C;  1YJN 1;  4A3G I;  3A1I A;  3GKQ A;  1SFO I;  3S1N I;  3GTJ I;  1K9M 1;  4XUJ D;  1Q86 2;  1BH8 A;  2P3Y A;  3FQM A;  4E2Z A;  3HOZ I;  5B2J B;  1P3L D;  3AYW C;  1H3O B;  1Z2C B;  5E5A A;  3LJA C;  3AZJ B;  1M1A B;  3MGR C;  4TNU A;  3G4S 1;  3MVD D;  3CCS 1;  1W2B Z;  2ARO D;  5B1M D;  4G92 B;  3O62 A;  1M18 D;  1ULY A;  2DF4 C;  1HTA A;  4G91 B;  3WA9 B;  5B32 A;  1S32 D;  3W97 C;  4WU9 B;  2OOX B;  5FLX f;  3VH6 A;  2BYM B;  1P3M A;  5AVB C;  3X1V B;  4H9O B;  5DNM A;  3NQJ B;  5CPI A;  1KX3 B;  4KUD D;  1S72 Z;  1Y1V S;  1VQN Z;  2F8N D;  3AV2 B;  3W96 B;  3EER A;  2IO5 C;  4UUZ A;  2WAQ A;  5B0Y D;  2W8S A;  1HQ3 B;  3C1C D;  5CPJ D;  3AFA C;  3W99 B;  2K3R A;  3KXB B;  2VF1 A;  4J8X A;  4Z5T B;  1M19 B;  4LD9 B;  3H0R C;  3MNN C;  2EGT A;  5DNN B;  3CCJ 1;  5B0Z A;  5AV6 D;  3MGP A;  5GXQ A;  3AZE A;  2UWX A;  3AZG B;  1EQZ B;  3K7A I;  3REJ D;  3PO2 I;  3VTN A;  3A6N C;  4Z66 B;  3TU4 C;  1JFI B;  2E2I I;  3AZM A;  3I56 Z;  4H9R B;  2W03 A;  1NUI A;  1P34 C;  5B24 B;  5B31 D;  3UTB A;  5FLM I;  4NFT A;  1ZLA B;  5AY8 D;  5AV8 B;  5CP6 D;  2NQB D;  5C3E I;  4CL1 A;  3WAA C;  2BG1 A;  4JJN A;  4RVH A;  2Y2H A;  4MD7 A;  5B2J C;  1P3B B;  5GT3 C;  1KD1 2;  2YFW A;  5B40 D;  3KUY A;  3AZH D;  3AV1 D;  1M1A C;  3CCM 1;  1U35 B;  1F66 A;  3AZI A;  3WKJ C;  2PYO D;  1WCM I;  5JA4 B;  1TZY C;  5AVC D;  5KDM A;  3W98 C;  1YI2 Z;  4WU9 C;  1QVG Y;  2F4M A;  5B1L A;  3CCQ 1;  2Y2J A;  2JS4 A;  1VQ8 1;  2OTJ Z;  1NJI 2;  5G49 B;  1KX3 C;  4E31 A;  3OW2 Y;  3H3V J;  4J8V B;  5BS7 C;  4YS3 A;  3MGQ B;  2Y2L A;  1JJ2 Y;  5GT0 A;  3KWQ C;  3R45 A;  4XZQ B;  3REL A;  1KX4 B;  2K5R A;  3LUS A;  1HQ3 C;  3WTP B;  5GSU D;  1P3F B;  1QF8 A;  3CC2 1;  1Y1V I;  1BH9 A;  5AV5 D;  3AZF D;  2V8J A;  4Z5T C;  4XUJ B;  1ID3 C;  3S15 I;  1VQL 1;  4NB9 A;  3GTK I;  3O62 C;  1P3G D;  1VQP Z;  1NJI 1;  3J7A 4;  4Z66 C;  3NH4 A;  1R9T I;  3HOV I;  3MVD B;  4QLC A;  3AYW A;  2ARO B;  5B1M B;  5C4X I;  5B2I A;  1M18 B;  3CCL Z;  3MGR A;  2RT9 A;  2DE5 A;  2LFU A;  5FLX b;  2VQR A;  1S32 B;  1USP B;  3S2H I;  5C3I B;  4BBS I;  2Y2M A;  5AV8 C;  4NBA A;  3W97 A;  2R6M A;  3LZ0 A;  3T4N B;  1VQ6 Z;  3C1B C;  2Q4Z A;  4KUD B;  3CC4 Z;  4S1T A;  1P3B C;  1KX5 D;  3W96 D;  2VUG A;  1M1K 1;  4Y52 I;  3REI A;  5AVB A;  3GTM S;  3REH C;  1YIJ 1;  1U35 C;  3B0C T;  3P5J B;  5B0Y B;  2R7Z I;  3NDI A;  3I07 A;  2M48 A;  2GTH A;  4CSR B;  5B0Z C;  3AZE C;  5GXQ C;  3C1C B;  4NBB A;  3CXC Y;  4A3K I;  3LZ1 D;  4J8U A;  2NVQ I;  5BT1 C;  3REK C;  3AFA A;  3UTA D;  5AV6 B;  3AN2 C;  3VH5 W;  4J8V C;  2JA8 I;  3REJ B;  3MNN A;  2JA7 I;  2ZY3 A;  3HOU I;  4UPK A;  3LEL D;  4KGC D;  3CPW Y;  4CAY B;  1RNI A;  4KHA A;  4XZQ C;  3X1U B;  3A6N A;  1KX4 C;  2ZY4 A;  5BNV B;  3TU4 A;  1TWH I;  3G6E Z;  3CME 1;  1P3F C;  5B31 B;  3X1S B;  1VQ9 1;  3RZO I;  5AY8 B;  5CP6 B;  2NQB B;  2GU2 A;  1M90 1;  1KQS Y;  4YM6 B;  2RIQ A;  1TAF B;  4RV9 A;  4DK1 A;  3UT9 D;  5C44 I;  5F99 D;  2CV5 D;  1P3L C;  4MD8 A;  5A2Q f;  5B40 B;  3HOY I;  3B0B A;  3AZH B;  3AV1 B;  4Z2M G;  1P3O D;  5B2J A;  4H9P B;  3MVD C;  2JMO A;  3CD6 1;  2ARO C;  2YU9 I;  2PYO B;  4EO5 B;  1M1A A;  1P3I D;  1P3A D;  1M18 C;  4MON A;  1TWF I;  3J81 f;  3CCE Z;  3WKJ A;  3NH5 A;  5C3I C;  5T6B A;  1TZY A;  3WA9 A;  3W98 A;  1N8R 1;  4WU9 A;  3B6G D;  4KUD C;  4RVG A;  2BYM A;  4AWL B;  3X1V A;  4H9O A;  3NQJ A;  1KX3 A;  3S1R I;  2DQN C;  4WZS B;  5B0Y C;  2BYK B;  3AV2 A;  5AV9 D;  5GSU B;  3CCR Z;  3KWQ A;  3CC7 Z;  3CCM Z;  5CPJ C;  2QA4 Z;  5B33 D;  5AV5 B;  1P3K D;  1HQ3 A;  3AZF B;  3GTM I;  4E2Y A;  4BXX I;  2R93 I;  4QLC C;  3W99 A;  2IZ4 A;  2M6N A;  5B2I C;  3KXB A;  3BG0 B;  3U50 C;  4Z5T A;  1ID3 A;  1P3G B;  4LD9 A;  1YHQ Z;  5DNN A;  2JR6 A;  3AZG A;  3I4M I;  1EQZ A;  2F8N H;  2JA5 I;  3AZM D;  4Z66 A;  4Y7N I;  3LZ0 C;  1JFI A;  1YUA A;  1AOI D;  3G71 1;  4RVD A;  4H9R A;  3VH5 A;  5AY8 C;  2NQB C;  3REI C;  3B0C W;  5B24 A;  1ZLA A;  1VQ7 Z;  2ZY2 A;  2QKD A;  5AV8 A;  3I55 Z;  1M1K 2;  4NE5 A;  4NBG A;  1KX5 B;  3CC2 Z;  2KI7 B;  2QLV B;  5AN9 F;  3C1B A;  3AV1 C;  3AZH C;  2YAD A;  3H0L C;  3JAM f;  3HOX I;  5JRG C;  1P3B A;  4J8U C;  1VQM Z;  4J8W D;  3REH A;  1F66 D;  1U35 A;  5AVC C;  3X1T D;  4NB8 A;  3LZ1 B;  5JA4 A;  5BO0 B;  2JCH A;  3KSY A;  4WU8 C;  1N2F A;  4AYB A;  2OTL 1;  3UTA B;  2QEX Z;  3AZN D;  3REK A;  3CMA 1;  2F2A C;  5G49 A;  3AN2 A;  3ESW A;  3AZL D;  1YIT 1;  3X1U D;  1A7W A;  3LEL B;  4J8V A;  4KGC B;  3H0M C;  2ZAE B;  3TE5 B;  3X1S D;  5GT0 D;  3MGQ A;  3REL D;  3KFU G;  5GSU C;  1N1J B;  3HKZ A;  2LY8 A;  3B0D B;  3IP4 C;  4XZQ A;  1KX4 A;  4X23 D;  4YM6 D;  5AV5 C;  1QVG Z;  3WTP A;  3AZF C;  1P3F A;  1VQO 1;  5BNX B;  4ZUX D;  2LIY A;  4RVF A;  3UT9 B;  5F99 B;  3FDD A;  3AZJ C;  2CV5 B;  4XUJ A;  1P3G C;  1TFI A;  1VQK Z;  1Q7Y 2;  3OW2 Z;  1P3P D;  1P3O B;  1P9N A;  4G92 C;  1P3L A;  3IFU A;  4EWC A;  1JWH C;  3Q87 A;  4G91 C;  4XX2 A;  3WA9 C;  2E2J I;  1P3A B;  1P3I B;  3LJA D;  3MVD A;  2ARO A;  3F6T A;  5B1M A;  3MGR D;  2Y2P A;  3B6F D;  4ZBJ B;  4E2X A;  5B32 B;  1M18 A;  1Q82 1;  3X1V C;  3NQU B;  1X3W A;  1S32 A;  1USP A;  4M6B A;  1K83 I;  3B6G B;  2Y0S A;  2QR1 B;  4MXU A;  1Q81 1;  3W96 C;  3AV2 C;  1KX5 C;  1KU5 A;  3VH6 T;  4QTU A;  1YJ9 Z;  4KUD A;  3J80 f;  1RO0 A;  5CPK D;  2FJ7 D;  2F8N A;  1WWS A;  1RO4 A;  5AV9 B;  3EPL A;  2O4H A;  3D6W A;  3GCF A;  5C4J I;  3W99 C;  4BBR I;  3CCV Z;  1YJW Z;  1K9M 2;  3KXB C;  5B0Y A;  1M19 C;  4LD9 C;  5B33 B;  3LZ1 C;  2WB1 A;  1P3K B;  1K73 1;  2Y2Q A;  5DNN C;  1VQ4 Z;  1B67 A;  4CSR A;  3AZG C;  4H9S A;  3C1C A;  5CPJ A;  1EQZ C;  1I6H I;  4RS4 A;  3V9R B;  1F1E A;  3VMH A;  5AV6 A;  3MNN D;  3VMG A;  3LEL C;  4KGC C;  2NZD D;  1YUK A;  3REJ A;  2XD5 A;  3AZM B;  2IZ3 A;  5B24 C;  1ZLA C;  1AOI B;  5IP9 I;  4CAY A;  3B0D C;  1Y1W I;  3CXC Z;  3S17 I;  4E2W A;  5B31 A;  2RHB A;  1P34 D;  1Z03 A;  3CCU Z;  3AZK D;  1YJN Z;  5AY8 A;  1S72 1;  5CP6 A;  3UT9 C;  2NQB A;  5F99 C;  4JJN B;  1TWA I;  2G2K A;  3MGS D;  1VQN 1;  2HIO D;  4A3M I;  1TAF A;  3WAA D;  2JA6 I;  4A3E I;  3M3Y I;  3VMI A;  5GT3 D;  5B40 A;  4J8W B;  3AZH A;  3AV1 A;  1P3A C;  1F66 B;  3H0G I;  4H9P A;  5JRG A;  4NFR A;  3G4S Z;  3CPW Z;  3CCS Z;  3X1T B;  1QVF Z;  2PYO A;  2Y2O A;  4ZBJ C;  4R8P D;  5KDM B;  4X6A I;  4BY7 I;  3PO3 I;  5B1L B;  5AVC A;  1TZY D;  5FUG B;  3B6G C;  3AZN B;  3W98 D;  3GTQ I;  2J6A A;  4WU8 A;  2E2H I;  3MGQ C;  2HUE B;  3VB9 A;  3I56 1;  3AZL B;  1RLY A;  3EED A;  5D1O B;  3WTP C;  2AKL A;  2I3C A;  3GTG I;  5GT0 B;  2L5A A;  3R45 B;  5AV9 C;  3REL B;  4HH4 A;  4A3L I;  2BYK A;  4WNN B;  4E44 A;  4NE3 A;  4XUJ C;  4X23 B;  1P3K C;  5GSU A;  4E32 A;  4H9Q B;  4ZUX B;  3BG1 B;  5AV5 A;  3AZF A;  4H9N B;  5E5A D;  1P3P B;  4A93 I;  1H3O A;  5B1M C;  3CCJ Z;  2J8P A;  3AZJ A;  1P3G A;  3O62 D;  5IT9 f;  1S32 C;  3LJA B;  1AOI C;  1YI2 1;  5B32 D;  3A1K A;  3MGR B;  3B6F B;  1Q82 2;  2F8N K;  3RZD I;  1Q81 2;  1P3M D;  2OTJ 1;  5DNM D;  5CPI D;  1Z01 A;  2JNY A;  2R92 I;  4A3B I;  3FQQ A;  1ZB9 A;  3S2D I;  5CPK B;  3C1B D;  3W96 A;  1KX5 A;  2FJ7 B;  2PM9 A;  1VLA A;  4H9S C;  3C1C C;  1VQ5 1;  1K73 2;  3X1T C;  2IO5 B;  3FKI I;  1I3Q I;  2G5H C;  4J8X D;  5AV6 C;  1M19 A;  5B0Z D;  2JE5 A;  3LZ1 A;  5GXQ D;  3MGP D;  3REJ C;  5BO0 A;  3AZN C;  3AZE D;  3CCQ Z;  1VQP 1;  1VQ8 Z;  2HUE C;  4A3I I;  2NVT I;  3GTL I;  3NDJ A;  3MNN B;  3X1U C;  2NZD B;  1KRL A;  3I4N I;  4MH4 A;  5B31 C;  3X1S C;  3WTP E;  1BFM A;  5IP7 I;  3A6N B;  4WV4 B;  3LEL A;  3UTB D;  4KGC A;  5CP6 C;  2YFV B;  4X23 C;  4YM6 C;  1KC8 1;  1N1J A;  1X0T A;  1VQ6 1;  3S1M I;  1P34 B;  4ZUX C;  4JJN D;  3AZK B;  3CC4 1;  4E30 A;  2GTI A;  5B40 C;  1PFT A;  3MGS B;  2HIO B;  5BNX A;  3KUY D;  1P3P C;  3WAA B;  1VQL Z;  3UT9 A;  2P28 A;  5F99 A;  2CV5 A;  2PYO C;  4EO5 C;  3AZI D;  3MON A;  4NBD A;  5GT3 B;  2PK7 A;  1P3O A;  3B6F C;  1I50 I;  4R8P B;  5B1L D;  3WKJ B;  1P3I A;  1P3A A;  1TWC I;  4NBF A;  2OOY B;  1TZY B;  2F8N G;  3W98 B;  4AWL C;  3NQU A;  1K8A 1;  4YS3 D;  3B6G A;  5CPK C;  2FJ7 C;  3CQZ I;  3G6E 1;  1W2B Y;  1M90 2;  1YIJ Z;  2JUB A;  2V8I A;  3NH8 A;  2RVQ D;  5AV9 A;  3KWQ B;  2W04 A;  5A2Q b;  2DE7 A;  4NBC A;  1BH8 B;  3GTP I;  2OZK A;  5B33 A;  1P3K A;  3J81 b;  5E5A B;  1ID3 B;  4HGZ A;  5IT9 b;  3V9R A;  4QLC D;  3AYW D;  5B31 G;  2NZD C;  5B2I D;  1JJ2 Z;  3O62 B;  3CCE 1;  3IF8 A;  4MD9 A;  4DGL A;  1N8R 2;  4HGA B;  4DRA A;  5D1P A;  3EPK A;  1X3Z A;  1RO2 A;  4MRI A;  1VQ9 Z;  1AOI A;  3CME Z;  3W97 D;  1P3M B;  3LZ0 D;  3D9X A;  3NFZ A;  3M4O I;  5DNM B;  3VH5 T;  3AZK C;  5CPI B;  1QYP A;  3KIF A;  4NOZ A;  3MGS C;  3REI D;  5AVB D;  2HIO C;  1RQF A;  4UUZ B;  3C1B B;  2ZY5 A;  3CD6 Z;  2HU9 A;  3CCR 1;  3REH B;  3CC7 1;  2QA4 1;  5JRG D;  4J8W A;  4R8P C;  4A3C I;  4J8U D;  1WWI A;  4NBH A;  3S16 I;  4J8X B;  3UTA C;  4A3D I;  3X1T A;  1R4V A;  1B6W A;  3AFA D;  2QRD B;  5B0Z B;  3MGP B;  3AZE B;  5GXQ B;  1WW9 A;  1YHQ 1;  1ZB8 A;  3REK B;  5FUG A;  4WU8 D;  3AZN A;  4NE6 A;  3AN2 B;  2O53 A;  3A6N D;  2Q51 A;  4DRB A;  3TU4 D;  3AZL A;  5CM2 M;  3X1U A;  3F3F C;  3UTB B;  5BNV A;  4DQY B;  1TWG I;  5D1O A;  4A3F I;  1KC8 2;  3X1S A;  5CHL B;  3EPJ A;  4WJ3 C;  2RBL A;  2E9H A;  2JSS A;  4HGY A;  3JAM b;  2CV5 C;  1VQ7 1;  1VQ5 Z;  4WNN A;  4X23 A;  4YM6 A;  4NH1 C;  3I55 1;  4H9Q A;  2YFW B;  5E5A C;  1P3O C;  4ZUX A;  2NVX I;  3KUY B;  1L1O C;  4A3J I;  5B2J D;  1Q86 1;  3AZI B;  1VQM 1;  4H9N A;  1P3I C;  3EG5 B;  3AZJ D;  1P3L B;  1P3P A;  1M1A D;  3WKJ D;  4HGA C;  5B32 C;  3S14 I;  2H85 A;  3LJA A;  3WA9 D;  3G71 Z;  1P3M C;  1KQS Z;  4WU9 D;  3B6F A;  2QEX 1;  1K8A 2;  5DNM C;  5CPI C;  2Y2N A;  2NVY I;  3QWU A;  4YS3 B;  4E33 A;  3X1V D;  4QTT A;  1KX3 D;  3CCL 1;  5T64 A;  3AV2 D;  1W2E A;  4NBE A;  5CPK A;  4BY1 I;  2F8N B;  2FJ7 A;  2Y2I A;  3KWQ D;  5B33 C;  2RPR A;  2Y2G A;  1BH9 B;  3HOW I;  2BJO A;  1HQ3 D;  3S1Q I;  4J8X C;  2HF1 A;  3TDH B;  1PZR A;  5T67 A;  1LQL A;  4Z2M H;  1S7M A;  3W99 D;  2QRE B;  3MGP C;  3IX0 A;  2FFF B;  3KXB D;  2CWE A;  4Z5T D;  5CPJ B;  1M19 D;  1ID3 D;  2Y2K A;  4LD9 D;  2KPI A;  1VQK 1;  5DNN D;  2PMZ A;  2OTL Z;  3AZG D;  3AZM C;  1EQZ D;  4QLC B;  2ZM5 A;  3AYW B;  2DE6 A;  2V8K A;  5B2I B;  2VUM I;  1WII A;  3CMA Z;  3VH6 W;  4Z66 D;  2B63 I;  1DL6 A;  1YIT Z;  2NZD A;  3UTB C;  3PO3 S;  5LL6 f;  2QRC B;  1QVF Y;  4E45 A;  5B24 D;  3W97 B;  3J80 b;  3LZ0 B;  1ZLA D;  2YFV A;  4JJN C;  1Q9C A;  1NP6 A;  5AV8 D;  2XD1 A;  5AVB B;  3REI B;  1P34 A;  3KUY C;  3AZK A;  1VQO Z;  1YJ9 1;  1P3B D;  4J8W C;  1F66 C;  3GTO I;  3AZI C;  3MGS A;  2F4O A;  2HIO A;  3REH D;  1KD1 1;  3WAA A;  1ML8 A;  5B32 G;  3CCV 1;  1YJW 1;  1U35 D;  3MZK B;  1ZH1 A;  5JRG B;  1T3U A;  5GT3 A;  5B1L C;  4J8U B;  1Q7Y 1;  2G5I C;  1VQ4 1;  3AFA B;  4R8P A;  5AVC B;  5BT1 D;  3UTA A;  3REK D;  4YS3 C;  3AZL C;  3KIH A;  4WU8 B;  3AN2 D;  4J8V D;  5GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...