4DQYB

Structure of human parp-1 bound to a dna double strand break
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
SKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly [ADP-ribose] polymerase 1
publication title Structural basis for DNA damage-dependent poly(ADP-ribosyl)ation by human PARP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 37
structure length 136
sequence length 136
chains with identical sequence E
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4dqyB01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dqyB02
2RIQA 4DQYB
chains in the Genus database with same CATH superfamily
2JA6I 1T3UA 2P28A 1AOIA 3G4S1 4H9SC 1N1JA 5B31C 3AZMB 4Z66B 1P34D 1VQ41 3S1QI 1KX3B 1EQZD 4AYBA 3CCQ1 3UTAB 3CCL1 3MGSD 3AZHC 1KX4B 3NQUB 3KUYD 4HGZA 3WTPD 1YIT1 3MVDA 4KGCB 2WB1A 1TWCI 1P3GB 1M1AD 3REIA 3AN2D 1ZB9A 4LD9C 5C4JI 4QLCC 2R93I 5G49A 3P5JB 3O62D 2FJ7A 2OTLZ 1KU5A 4XZQA 2CWEA 5BNXB 3AZKD 2F8NA 3RELD 3F3PC 4RVHA 2E2HI 3VH5A 4X23C 3X1SA 5B0ZB 4YM6A 3AZED 1BFMA 2GTIA 4NFRA 3J81b 2QA4Z 3AZIB 3AZNB 2AROB 3MNNB 1U35D 3FQMA 3GTLI 4BXXI 1PFTA 2V8KA 4H9NB 4Z5TA 1I50I 4R8PA 4S1TA 3I551 2QLVB 4JJNB 5B2JC 2JIRA 1Z01A 2DE6A 3HOYI 3LZ1A 3C1CA 2OTL1 1M19A 3MVDD 5GSUC 2V8IA 3H0RC 5AVBA 3REHA 3W96C 3KSYA 2BJOA 2Y2MA 3REID 2PK7A 2QRCB 2QA41 1Q811 3A1KA 3GTOI 1FDIA 5FUGA 3VH6T 5CPKB 2F8ND 5CHLB 5CP6B 5AV5B 1QF8A 2VPXA 5JA4A 1R9TI 4KHAA 1WWIA 5B24A 4YM6D 3X1SD 1P3FC 3LELA 5DNNC 1RNIA 3PO3I 4H9QA 5AV6B 3EPJA 1P3KC 1ZB8A 3W97B 4A3JI 1YI2Z 4CAYB 1NJI1 2PYOB 5BS7C 5E5AC 5KDMA 1WJ2A 5GT3A 4MH4A 3CCEZ 2Y2HA 3CC7Z 5B1LB 1VQNZ 4A3BI 4ZUXD 3AV1B 3C1CD 3AFAA 3X1TB 1KRLA 1VLAA 2BYKB 1M19D 2W03A 4HGYA 3S15I 4BBSI 1P9NA 5B0YA 3MGPA 1VQ9Z 4J8VC 3LZ0B 5A2Qf 3REHD 4XUJD 1NP6A 3TE5B 3VMGA 1QVGY 1KC81 3AZMA 4Z66A 3UTBB 1KX3A 2LFUA 3UTAA 1U35A 1YI21 4J8UC 3NQUA 1KX4A 3IX0A 1VQK1 4HGAC 4KGCA 3CCE1 3CC71 1VQN1 3AZFC 3AZLB 3AZGC 1X3ZA 1P3GA 3B0CT 4WJ3C 3J81f 1QVFZ 5B33C 5BNXA 5CPIC 1VQ91 4AWLC 5GT3D 1P3PC 2Y2PA 5B0ZA 1P3LC 1VQMZ 5F99B 2HIOC 2DF4C 3AFAD 3AZIA 3AZNA 3VH6W 3PO2I 2AROA 3MNNA 3B6FB 5B0YD 4MXUA 3MGPD 1P3OC 2NQBC 2K3RA 3B0BA 5AVCC 1H3OB 3KWQC 2F2AC 3TU4B 1USPB 4H9NA 4G92C 4Z66D 3AZMD 1Q9CA 2DQNC 5BT1D 4JJNA 4DQYB 3UT9C 1KX3D 3UTAD 3EERA 1F66D 3WKJB 3A1IA 2E2JI 4J8XC 2VPWA 2G5IC 4YS3D 4NBDA 4XX2A 1DL6A 3I56Z 5B31B 1P3GD 4E31A 1VQM1 1Y1WI 4J8WC 2NZDC 2E2II 3AV2B 1RO0A 3LJAB 1S72Z 3MGQB 3AZHB 5CPKA 5CP6A 3S16I 5AV5A 4NBAA 1WWSA 4WZSB 3CD6Z 3AZID 1P3BC 5AV6A 4LD9B 4H9PB 2AROD 3GTGI 3MNND 3W98B 3W97A 4CAYA 2O4HA 2PYOA 1WZNA 2J6AA 4X23B 2CV5D 3I07A 2Y2JA 3I561 5B1LA 4JJND 3B0CW 5FLMI 1Q812 4NB8A 3GTMS 3AV1A 3X1TA 1S721 2BYKA 4H9OB 1VQP1 3LZ0A 2RVQD 3QWUA 2IO5B 5T6BA 3CD61 5CPJB 1N8R1 1HQ3C 5B2JB 3UTBA 3REJC 3REKC 3PO3S 5CPKD 4BY1I 4DGLA 2VQRA 1B6WA 1TWFI 5GSUB 1M901 1NJI2 3NH8A 5B40C 3A6NB 3W96B 3AZLA 2JMOA 2VPZA 3GCFA 5AV6D 2AYDA 2K5RA 3TDHB 2F4OA 4KUDC 5IP7I 3W97D 1M18C 5C3IC 2VF1A 2PYOD 2W04A 4E44A 1Q7Y1 3AYWC 2E9HA 2JIQA 1P34C 4G91B 5B1LD 5BNVB 2O53A 3FKII 1EQZC 5F99A 1I6HI 3IFUA 3B6GB 3X1TD 1WCMI 3MGSC 1TWHI 1KC82 4A3DI 3KUYC 3CCRZ 3WAAB 1P3AD 3X1UD 4EO5C 3WTPC 3B6FA 3LZ0D 1H3OA 1USPA 3TU4A 5D1PA 3CC2Z 4WV4B 2KI7B 2QRDB 3UTBD 1Z02A 2NVYI 3O62C 3AZKC 3WKJA 3VB9A 4J8VB 3WA9D 1X3WA 3AZEC 2VPYA 3AZLD 1YJWZ 4H9SA 5B31A 4HH4A 2LY8A 2OTJZ 1BH9B 3AV2A 3W99B 1U35C 1QVFY 4WU8D 3LJAA 3OW2Y 2UWXA 3MGQA 3AZHA 2ZY5A 1YHQZ 5DNMC 2Y2QA 1YJ9Z 4HGAB 3CCVZ 3CC21 3AZFB 3AZGB 5JRGD 2JS4A 5F99D 4E45A 1SFOI 1VQ7Z 4LD9A 4QLCA 4H9PA 5B32C 5C3EI 3CCJZ 3W98A 1JJ2Z 3B6FD 3MVDC 5CPIB 3TU4D 4AWLB 1AOID 4X23A 1P3PB 3REIC 2RHBA 3S2HI 1F1EA 3F6TA 1P3LB 3HOXI 5AY8B 2HIOB 3G71Z 3CPWY 2OTJ1 3WKJD 2JIMA 1P3OB 2NQBB 3X1SC 2JSSA 4H9OA 1YJ91 3CCV1 4NFTA 3VMIA 3GTMI 5CPJA 3MGRC 1WIIA 5B2JA 3AV2D 4WU9C 1VQ71 3CCJ1 2Y2IA 3LJAD 3MGQD 3AZHD 2FJ7D 4XZQD 4QTUA 3HOWI 4J8XB 3CCSZ 4X6AI 1YJNZ 5GSUA 3NH5A 1VQ8Z 3W96A 3KXBB 4ZUXC 3A6NA 3MZLB 1S32C 4LD9D 1P3IC 3S14I 5B1MC 1TAFB 2HUEC 3W98D 2LEXA 1K9M2 3FQQA 3NFZA 1YIJZ 4XUJC 4X23D 2Y0SA 3S2DI 3EEDA 1KX5C 4Z5TD 4R8PD 1Z2CB 5BNVA 5AV9C 3X1VB 2JNYA 1N8R2 3LZ1D 3B6GA 2IZ4A 3WAAA 2PMZA 2YFWB 3CCS1 5BO0B 5AVBD 4Y52I 1M902 5CPJD 1VQ81 1VQ6Z 5B2JD 2QREB 3S17I 2RIQA 3CCMZ 5B2IC 3H0LC 2BG1A 4DRBA 5GSUD 5GT3C 5B24D 4J8VA 3LELD 3A6ND 3W96D 3IF8A 5GT0B 1Q7Y2 3GTJI 5IT9b 5C44I 4UPKA 3AFAC 1X0TA 1Y8CA 1BH9A 3CXCZ 3REJB 3REKB 1ID3C 3W99A 3MGPC 2JCHA 3B0DB 3EPHA 3OW2Z 3VH6A 1YUKA 2RPRA 2Q4ZA 5B40B 4A3FI 1VQ61 5BT1C 3AZFA 3AZGA 1KX3C 5B31G 5IP9I 2NVTI 3B6GD 2Y2LA 1F66C 2QR1B 3C1BC 1M18B 3WAAD 5B33A 5C3IB 4YS3C 4RS4A 3CCM1 5CPIA 3AYWB 4BBRI 1P3PA 3HOUI 1P3LA 1EQZB 2JA8I 1ZLAC 5AY8A 2HIOA 3CPWZ 3MGSB 5GXQB 2KPIA 4NBCA 1KQSZ 3KUYB 1KX4D 3AL0C 4EO5B 1P3OA 3J80b 2NQBA 5AVCA 4J8VD 4KGCD 1N2FA 2Q51A 3CQZI 2AROC 5AV8C 3MNNC 3W99D 1QYPA 2LIYA 2OZKA 2R6MA 3NDIA 3I4NI 2XD1A 1Z03A 4J8XA 3BG0B 3G711 2CV5C 3AZEB 5B0ZD 1RO2A 5AN9F 2JE5A 3AZGD 1TZYC 3NQJB 3KXBA 2ZY3A 1I3QI 3AZND 4QLCB 2F8NH 1TAFA 4QTTA 1JJ2Y 4A93I 3EG5B 2OOYB 5DNMB 2RVQC 1P3PD 1AA6A 2Y2GA 1P3LD 1P3MC 5AY8D 2HIOD 4DRAA 5C4XI 5B32B 3X1VA 4MONA 1K9M1 4E33A 3R45B 3WTPE 3VTNA 1RO4A 2NQBD 2ZM5A 2YFWA 3AZJC 5BO0A 2JA5I 5AV6C 4Z2MH 5IT9f 4NE3A 4Z2MG 5CP6D 2PYOC 5AV5D 2NVQI 2Y2KA 5B1LC 3KXBD 2L5AA 5GT0A 1VQLZ 3MGRB 1HQ3A 1R4VA 1HTAA 4WU9B 3REJA 3REKA 1P3AC 3X1UC 4RV9A 2BYMB 5FLXb 3LZ0C 1M18D 3GKQA 4WNNB 1TWGI 1VQ5Z 1P3FB 5B40A 5DNNB 4ZUXB 3UTBC 1S32B 1P3IB 3X1VD 5B1MB 3AV1D 2ZAEB 1P3KB 2WAQA 5D1OB 1M18A 1WW9A 4NBGA 3WA9C 1W2BZ 4XUJB 3AYWA 5E5AB 1KX5B 2F8NK 2I3CA 3LUSA 1M1AC 3H3VJ 3AN2C 3H0GI 3J80f 5AV9B 1EQZA 4MD9A 4WU8C 3MGSA 5GXQA 3VH5T 3KUYA 4A3LI 3RELC 2JUBA 1VQ51 5JRGC 5F99C 5GT0D 3HOVI 3CXCY 3CCQZ 3D9XA 3REJD 3B6FC 2V3VA 3K7AI 3CCR1 5B2IB 4J8UB 2DE7A 1AOIC 3KFUG 2V45A 5B40D 3AZEA 5CM2M 2H85A 3NQJA 2YFVB 4BY7I 3HOZI 3ESWA 1ID3B 4NOZA 5B33B 1JWHC 2M48A 2Y2OA 5DNMA 3AYWD 2JIOA 3GTPI 4E2WA 1W2EA 1YJW1 3AV2C 5A2Qb 3LJAC 1F66B 3MGQC 5GXQD 5B32A 4XZQC 3C1BB 2FJ7C 3D2LA 2OOXB 3R45A 4E30A 4YS3B 2QEXZ 1LQLA 1YHQ1 5AVCB 4YM6C 3KWQB 2JA7I 3I55Z 5T67A 3D6WA 4E2ZA 5B31D 4G92B 3UT9B 3I4MI 1ZLAB 3W98C 1TWAI 3EPLA 3F3FC 4A3MI 1Q822 4Z5TC 4R8PC 1A7WA 3NDJA 3S1MI 5FLXf 4J8WB 5AV8B 4QLCD 3LZ1C 3MGRA 3EPKA 3C1CC 4WU9A 3VH5W 1M19C 2NZDB 2QKDA 1FDOA 2QEX1 1Q861 3CMAZ 2BYMA 5DNMD 2HF1A 3J7A4 5AVBC 3REHC 2IO5C 2CV5B 3MZKB 5CPJC 4WNNA 1P3FA 1TZYB 2YADA 5DNNA 4ZUXA 4RVFA 1S32A 1P3BB 1P3IA 5B32D 5B1MA 1YUAA 4NBBA 1P3KA 1JFIB 5D1OA 3G6EZ 3GTQI 3HKZA 5B24C 4ZBJC 1YJN1 3M4OI 3LELC 4XUJA 3A6NC 3S1RI 5BS7A 5E5AA 1KX5A 2IZ3A 4A3II 1P3MB 5AV9A 2NVXI 4E2XA 1KD11 4A3CI 3CMA1 3AZJB 3KIHA 4G91C 1Y1VI 1PZRA 3S1NI 3MGRD 3B6GC 1HQ3B 4WU9D 3CMEZ 4CSRB 1K8A1 3WAAC 5B0YC 3G6E1 4NBFA 1VQKZ 4H9RB 5B2IA 4J8UA 1P3FD 3AZMC 5DNND 4Z66C 3VMHA 2JR6A 1S32D 3V9RB 1P3ID 2YFVA 5B1MD 1BH8B 3UTAC 4KUDB 1P3KD 2G2KA 2RBLA 1ID3A 1KX4C 1P3AB 3X1UB 1W2BY 4KGCC 1K731 3FDDA 3RZOI 1RQFA 5E5AD 1KX5D 4M6BA 1P3GC 4NB9A 2IV2X 1P34B 2YU9I 5AV9D 3W99C 2AKLA 1F66A 5T64A 3C1BA 2E7ZA 3CME1 3U50C 2RT9A 3WTPB 4YS3A 3WA9B 4UUZB 5B0ZC 3KWQA 1M1K2 1Q16A 1M1AB 3NH4A 3AZIC 3AN2B 3AZNC 1SIWA 1TFIA 2W8SA 3UT9A 1ZLAA 3Q87A 4WU8B 3O62B 5B32G 2VUMI 4A3GI 3AZKB 4MRIA 5B2ID 4J8UD 3RELB 4NBEA 4E2YA 3JAMb 2XD5A 4A3KI 5JRGB 3AZFD 2ZY2A 4JJNC 5AY8C 2NAPA 2GU2A 4J8WA 5AV8A 2NZDA 1ID3D 1B67A 1U35B 1Q821 5B33D 2F8NG 2V8JA 3H0MC 3M3YI 5CPID 1AOIB 4CL1A 1YIJ1 3GTKI 1N1JB 2CV5A 1VQOZ 1L1OC 1TZYA 2DE5A 4NH1C 1P3BA 4NE6A 3KIFA 3C1BD 1KQSY 5CPKC 3T4NB 5CP6C 1ULYA 5AV5C 1JFIA 4TNUA 1P3OD 3MVDB 3IP4C 5AVCD 3KWQD 2GTHA 3CCUZ 3KXBC 3CC4Z 3REIB 1P3MA 3UT9D 5G49B 1ZLAD 2JIPA 1RLYA 3W97C 2VUGA 2FJ7B 4XZQB 2F8NB 3BG1B 4MD7A 4RVDA 4J8XD 2Y2NA 1K83I 1ZH1A 3X1SB 4YM6B 3RZDI 1VQPZ 3AZJA 1Q862 1VQO1 3X1VC 1NUIA 4J8WD 5AV8D 3AV1C 3X1TC 2NZDD 3IR7A 4CSRA 4H9RA 4Z5TB 3CCU1 4R8PB 3CC41 1TZYD 1P3BD 3V9RA 3LZ1B 3C1CB 1S7MA 1BH8A 2HUEB 1M19B 4KUDA 2M6NA 2PM9A 3MONA 1P3AA 3X1UA 1KD12 4NE5A 2ZY4A 5AVBB 3REHB 3AZLC 5GT0C 5LL6f 1QVGZ 1P3MD 1P34A 4Y7NI 5FUGB 1QXFA 1ML8A 1Y1VS 2HU9A 1VQL1 3B0DC 4A3EI 2R7ZI 1K8A2 5JA4B 4KHAB 4ZBJB 5B24B 3WTPA 3AZJD 3WA9A 4UUZA 3LELB 2F4MA 4NBHA 3G4SZ 4DK1A 4H9QB 1VQ4Z 2EGTA 1M1AA 3AN2A 1HQ3D 3JAMf 3CCLZ 4RVGA 2G5HC 4WU8A 3O62A 3REKD 4E32A 2FFFB 3AZKA 2P3YA 1YITZ 5KDMB 3RELA 3TU4C 1M1K1 5GT3B 2J8PA 4MD8A 1K732 5JRGA 4EWCA 2R92I 3AFAB 5GXQC 4KUDD 2B63I 3WKJC 5B0YB 3MGPB
chains in the Genus database with same CATH topology
2JA6I 1T3UA 2P28A 1AOIA 3G4S1 4H9SC 1N1JA 5B31C 3AZMB 4Z66B 1P34D 1VQ41 3S1QI 1KX3B 1EQZD 4AYBA 3CCQ1 3UTAB 3CCL1 3MGSD 3AZHC 1KX4B 3NQUB 3KUYD 4HGZA 3WTPD 1YIT1 3MVDA 4KGCB 2WB1A 1TWCI 1P3GB 1M1AD 3REIA 3AN2D 1ZB9A 4LD9C 5C4JI 4QLCC 2R93I 5G49A 3P5JB 3O62D 2FJ7A 2OTLZ 1KU5A 4XZQA 2CWEA 5BNXB 3AZKD 2F8NA 3RELD 3F3PC 4RVHA 2E2HI 3VH5A 4X23C 3X1SA 5B0ZB 4YM6A 3AZED 1BFMA 2GTIA 4NFRA 3J81b 2QA4Z 3AZIB 3AZNB 2AROB 3MNNB 1U35D 3FQMA 3GTLI 4BXXI 1PFTA 2V8KA 4H9NB 4Z5TA 1I50I 4R8PA 4S1TA 3I551 2QLVB 4JJNB 5B2JC 1Z01A 2DE6A 3HOYI 3LZ1A 3C1CA 2OTL1 1M19A 3MVDD 5GSUC 2V8IA 3H0RC 5AVBA 3REHA 3W96C 3KSYA 2BJOA 2Y2MA 3REID 2PK7A 2QRCB 2QA41 1Q811 3A1KA 3GTOI 5FUGA 3VH6T 5CPKB 2F8ND 5CHLB 5CP6B 5AV5B 1QF8A 5JA4A 1R9TI 4KHAA 1WWIA 5B24A 4YM6D 3X1SD 1P3FC 3LELA 5DNNC 1RNIA 3PO3I 4H9QA 5AV6B 3EPJA 1P3KC 1ZB8A 3W97B 4A3JI 1YI2Z 4CAYB 1NJI1 2PYOB 5BS7C 5E5AC 5KDMA 4MH4A 5GT3A 3CCEZ 3CC7Z 2Y2HA 1VQNZ 5B1LB 4A3BI 4ZUXD 3AV1B 3C1CD 3AFAA 3X1TB 1KRLA 1VLAA 2BYKB 1M19D 2W03A 4HGYA 3S15I 4BBSI 1P9NA 5B0YA 3MGPA 1VQ9Z 4J8VC 3LZ0B 5A2Qf 3REHD 4XUJD 1NP6A 3VMGA 1QVGY 1KC81 3AZMA 4Z66A 3UTBB 1KX3A 2LFUA 3UTAA 1U35A 1YI21 4J8UC 3NQUA 1KX4A 3IX0A 1VQK1 4HGAC 4KGCA 3CCE1 3CC71 1VQN1 3AZFC 3AZLB 3AZGC 1X3ZA 1P3GA 3B0CT 4WJ3C 3J81f 1QVFZ 5B33C 5BNXA 5CPIC 1VQ91 4AWLC 5GT3D 1P3PC 2Y2PA 5B0ZA 1P3LC 1VQMZ 5F99B 2HIOC 2DF4C 3AFAD 3AZIA 3AZNA 3VH6W 3PO2I 2AROA 3MNNA 3B6FB 5B0YD 4MXUA 3MGPD 1P3OC 2NQBC 2K3RA 3B0BA 5AVCC 1H3OB 3KWQC 2F2AC 3TU4B 1USPB 4H9NA 4G92C 4Z66D 3AZMD 1Q9CA 2DQNC 5BT1D 4JJNA 4DQYB 3UT9C 1KX3D 3UTAD 3EERA 1F66D 3WKJB 3A1IA 2E2JI 4J8XC 2G5IC 4YS3D 4NBDA 4XX2A 1DL6A 3I56Z 5B31B 1P3GD 4E31A 1VQM1 1Y1WI 4J8WC 2NZDC 2E2II 3AV2B 1RO0A 3LJAB 1S72Z 3MGQB 3AZHB 5CPKA 5CP6A 3S16I 5AV5A 4NBAA 1WWSA 4WZSB 3CD6Z 3AZID 1P3BC 5AV6A 4LD9B 4H9PB 2AROD 3GTGI 3MNND 3W98B 3W97A 4CAYA 2O4HA 2PYOA 2J6AA 4X23B 2CV5D 3I07A 2Y2JA 3I561 5B1LA 4JJND 3B0CW 5FLMI 1Q812 4NB8A 3GTMS 3AV1A 3X1TA 1S721 2BYKA 4H9OB 1VQP1 3LZ0A 2RVQD 3QWUA 2IO5B 5T6BA 3CD61 5CPJB 1N8R1 1HQ3C 5B2JB 3UTBA 3REJC 3REKC 3PO3S 5CPKD 4BY1I 4DGLA 2VQRA 1B6WA 1TWFI 5GSUB 1M901 1NJI2 3NH8A 5B40C 3A6NB 3W96B 3AZLA 2JMOA 3GCFA 5AV6D 2K5RA 3TDHB 2F4OA 4KUDC 5IP7I 3W97D 1M18C 5C3IC 2VF1A 2PYOD 2W04A 4E44A 1Q7Y1 3AYWC 2E9HA 1P34C 4G91B 5B1LD 5BNVB 2O53A 3FKII 1EQZC 5F99A 1I6HI 3IFUA 3B6GB 3X1TD 1WCMI 3MGSC 1TWHI 1KC82 4A3DI 3KUYC 3CCRZ 3WAAB 1P3AD 3X1UD 4EO5C 3WTPC 3B6FA 3LZ0D 1H3OA 1USPA 3TU4A 5D1PA 3CC2Z 4WV4B 2KI7B 2QRDB 3UTBD 1Z02A 2NVYI 3O62C 3AZKC 3WKJA 3VB9A 4J8VB 3WA9D 1X3WA 3AZEC 3AZLD 1YJWZ 4H9SA 5B31A 4HH4A 2LY8A 2OTJZ 1BH9B 3AV2A 3W99B 1U35C 1QVFY 4WU8D 3LJAA 3OW2Y 2UWXA 3MGQA 3AZHA 2ZY5A 1YHQZ 5DNMC 2Y2QA 1YJ9Z 4HGAB 3CCVZ 3CC21 3AZFB 3AZGB 5JRGD 2JS4A 5F99D 4E45A 1SFOI 1VQ7Z 4LD9A 4QLCA 4H9PA 5B32C 5C3EI 3CCJZ 3W98A 1JJ2Z 3B6FD 3MVDC 5CPIB 3TU4D 4AWLB 1AOID 4X23A 1P3PB 3REIC 2RHBA 3S2HI 1F1EA 3F6TA 1P3LB 3HOXI 5AY8B 2HIOB 3G71Z 3CPWY 2OTJ1 3WKJD 1P3OB 2NQBB 3X1SC 2JSSA 4H9OA 1YJ91 3CCV1 4NFTA 3VMIA 3GTMI 5CPJA 3MGRC 1WIIA 5B2JA 3AV2D 4WU9C 1VQ71 3CCJ1 2Y2IA 3LJAD 3MGQD 3AZHD 2FJ7D 4XZQD 4QTUA 3HOWI 4J8XB 3CCSZ 4X6AI 1YJNZ 5GSUA 3NH5A 1VQ8Z 3W96A 3KXBB 4ZUXC 3A6NA 3MZLB 1S32C 4LD9D 1P3IC 3S14I 5B1MC 1TAFB 2HUEC 3W98D 1K9M2 3FQQA 3NFZA 1YIJZ 4XUJC 4X23D 2Y0SA 3S2DI 3EEDA 1KX5C 4Z5TD 4R8PD 1Z2CB 5BNVA 5AV9C 3X1VB 2JNYA 1N8R2 3LZ1D 3B6GA 2IZ4A 3WAAA 2PMZA 2YFWB 3CCS1 5BO0B 5AVBD 4Y52I 1M902 5CPJD 1VQ81 1VQ6Z 5B2JD 2QREB 3S17I 2RIQA 3CCMZ 5B2IC 3H0LC 2BG1A 4DRBA 5GSUD 5GT3C 5B24D 4J8VA 3LELD 3A6ND 3W96D 3IF8A 5GT0B 1Q7Y2 3GTJI 5IT9b 5C44I 4UPKA 3AFAC 1X0TA 3CXCZ 1BH9A 3REJB 3REKB 1ID3C 3W99A 3MGPC 2JCHA 3B0DB 3EPHA 3OW2Z 3VH6A 1YUKA 2RPRA 2Q4ZA 5B40B 4A3FI 1VQ61 5BT1C 3AZFA 3AZGA 1KX3C 5B31G 5IP9I 2NVTI 3B6GD 2Y2LA 1F66C 2QR1B 3C1BC 1M18B 3WAAD 5B33A 5C3IB 4YS3C 4RS4A 3CCM1 5CPIA 3AYWB 4BBRI 1P3PA 3HOUI 1P3LA 1EQZB 2JA8I 1ZLAC 5AY8A 2HIOA 3CPWZ 3MGSB 5GXQB 2KPIA 4NBCA 1KQSZ 3KUYB 1KX4D 3AL0C 4EO5B 1P3OA 3J80b 2NQBA 5AVCA 4J8VD 4KGCD 1N2FA 2Q51A 3CQZI 2AROC 5AV8C 3MNNC 3W99D 1QYPA 2LIYA 2OZKA 2R6MA 3NDIA 3I4NI 2XD1A 1Z03A 4J8XA 3BG0B 3G711 2CV5C 3AZEB 5B0ZD 1RO2A 5AN9F 2JE5A 3AZGD 1TZYC 3NQJB 3KXBA 2ZY3A 1I3QI 3AZND 4QLCB 2F8NH 1TAFA 4QTTA 1JJ2Y 4A93I 3EG5B 2OOYB 5DNMB 2RVQC 1P3PD 2Y2GA 1P3LD 1P3MC 5AY8D 2HIOD 4DRAA 5C4XI 5B32B 3X1VA 4MONA 1K9M1 4E33A 3R45B 3WTPE 3VTNA 1RO4A 2NQBD 2ZM5A 2YFWA 3AZJC 5BO0A 2JA5I 5AV6C 4Z2MH 5IT9f 4NE3A 4Z2MG 5CP6D 2PYOC 5AV5D 2NVQI 2Y2KA 5B1LC 3KXBD 2L5AA 5GT0A 1VQLZ 3MGRB 1HQ3A 1R4VA 1HTAA 4WU9B 3REJA 3REKA 1P3AC 3X1UC 4RV9A 2BYMB 5FLXb 3LZ0C 1M18D 3GKQA 4WNNB 1TWGI 1VQ5Z 1P3FB 5B40A 5DNNB 4ZUXB 3UTBC 1S32B 1P3IB 3X1VD 5B1MB 3AV1D 2ZAEB 1P3KB 2WAQA 5D1OB 1M18A 1WW9A 4NBGA 3WA9C 1W2BZ 4XUJB 3AYWA 5E5AB 1KX5B 2F8NK 2I3CA 3LUSA 1M1AC 3H3VJ 3AN2C 3H0GI 3J80f 5AV9B 1EQZA 4MD9A 4WU8C 3MGSA 5GXQA 3VH5T 3KUYA 4A3LI 3RELC 2JUBA 1VQ51 5JRGC 5F99C 5GT0D 3HOVI 3CXCY 3CCQZ 3D9XA 3REJD 3B6FC 3K7AI 3CCR1 5B2IB 4J8UB 2DE7A 1AOIC 3KFUG 5CM2M 5B40D 3AZEA 2H85A 3NQJA 2YFVB 4BY7I 3HOZI 3ESWA 1ID3B 4NOZA 5B33B 1JWHC 2M48A 2Y2OA 5DNMA 3AYWD 3GTPI 4E2WA 1W2EA 1YJW1 3AV2C 5A2Qb 3LJAC 1F66B 3MGQC 5GXQD 5B32A 4XZQC 3C1BB 2FJ7C 4E30A 2OOXB 3R45A 2QEXZ 4YS3B 1LQLA 1YHQ1 5AVCB 4YM6C 3KWQB 2JA7I 3I55Z 5T67A 3D6WA 4E2ZA 5B31D 4G92B 3UT9B 3I4MI 1ZLAB 3W98C 1TWAI 3EPLA 3F3FC 4A3MI 1Q822 4Z5TC 4R8PC 1A7WA 3NDJA 3S1MI 5FLXf 4J8WB 5AV8B 4QLCD 3LZ1C 3MGRA 3EPKA 3C1CC 4WU9A 3VH5W 1M19C 2NZDB 2QKDA 3TE5B 2QEX1 1Q861 3CMAZ 2BYMA 5DNMD 2HF1A 3J7A4 5AVBC 3REHC 2IO5C 2CV5B 3MZKB 5CPJC 4WNNA 1P3FA 1TZYB 2YADA 5DNNA 4ZUXA 4RVFA 1S32A 1P3BB 1P3IA 5B32D 5B1MA 1YUAA 4NBBA 1P3KA 1JFIB 5D1OA 3G6EZ 3GTQI 3HKZA 5B24C 4ZBJC 1YJN1 3M4OI 3LELC 4XUJA 3A6NC 3S1RI 5BS7A 5E5AA 1KX5A 2IZ3A 4A3II 1P3MB 5AV9A 2NVXI 4E2XA 1KD11 4A3CI 3CMA1 3AZJB 3KIHA 4G91C 1Y1VI 1PZRA 3S1NI 3MGRD 3B6GC 1HQ3B 4WU9D 3CMEZ 4CSRB 1K8A1 3WAAC 5B0YC 3G6E1 4NBFA 1VQKZ 4H9RB 5B2IA 4J8UA 1P3FD 3AZMC 5DNND 4Z66C 3VMHA 2JR6A 1S32D 3V9RB 1P3ID 2YFVA 5B1MD 1BH8B 3UTAC 4KUDB 1P3KD 2G2KA 2RBLA 1ID3A 1KX4C 1P3AB 3X1UB 1W2BY 4KGCC 1K731 3FDDA 3RZOI 1RQFA 5E5AD 1KX5D 4M6BA 1P3GC 4NB9A 2YU9I 1P34B 5AV9D 3W99C 2AKLA 1F66A 5T64A 3C1BA 3CME1 3U50C 2RT9A 3WTPB 4YS3A 3WA9B 4UUZB 5B0ZC 3KWQA 1M1K2 3NH4A 1M1AB 3AZIC 3AN2B 3AZNC 1TFIA 2W8SA 3UT9A 1ZLAA 3Q87A 4WU8B 3O62B 5B32G 2VUMI 4A3GI 3AZKB 4MRIA 5B2ID 4J8UD 3RELB 4NBEA 4E2YA 3JAMb 2XD5A 4A3KI 5JRGB 3AZFD 2ZY2A 4JJNC 5AY8C 2GU2A 4J8WA 5AV8A 2NZDA 1ID3D 1B67A 1U35B 1Q821 5B33D 2F8NG 2V8JA 3H0MC 3M3YI 5CPID 1AOIB 4CL1A 1YIJ1 3GTKI 1N1JB 2CV5A 1VQOZ 1L1OC 1TZYA 2DE5A 4NH1C 1P3BA 4NE6A 3KIFA 3C1BD 1KQSY 5CPKC 3T4NB 5CP6C 1ULYA 5AV5C 1JFIA 4TNUA 1P3OD 3MVDB 3IP4C 5AVCD 3KWQD 2GTHA 3CCUZ 3KXBC 3CC4Z 3REIB 1P3MA 3UT9D 5G49B 1ZLAD 1RLYA 3W97C 2VUGA 2FJ7B 4XZQB 2F8NB 3BG1B 4MD7A 4RVDA 4J8XD 2Y2NA 1K83I 1ZH1A 3X1SB 4YM6B 3RZDI 1VQPZ 3AZJA 1Q862 1VQO1 3X1VC 1NUIA 4J8WD 5AV8D 3AV1C 3X1TC 2NZDD 4CSRA 4H9RA 4Z5TB 3CCU1 4R8PB 3CC41 1TZYD 1P3BD 3V9RA 3LZ1B 3C1CB 1S7MA 1BH8A 2HUEB 1M19B 4KUDA 2M6NA 2PM9A 3MONA 1P3AA 3X1UA 1KD12 4NE5A 2ZY4A 5AVBB 3REHB 3AZLC 5GT0C 5LL6f 1QVGZ 1P3MD 1P34A 4Y7NI 5FUGB 1VQL1 1ML8A 1Y1VS 2HU9A 3B0DC 4A3EI 2R7ZI 1K8A2 5JA4B 4KHAB 4ZBJB 5B24B 3WTPA 3AZJD 3WA9A 4UUZA 3LELB 2F4MA 4NBHA 3G4SZ 4DK1A 4H9QB 1VQ4Z 2EGTA 1M1AA 3AN2A 1HQ3D 3JAMf 3CCLZ 4RVGA 2G5HC 4WU8A 3O62A 3REKD 4E32A 2FFFB 3AZKA 2P3YA 1YITZ 5KDMB 3RELA 3TU4C 1M1K1 5GT3B 2J8PA 4MD8A 1K732 5JRGA 4EWCA 2R92I 3AFAB 5GXQC 4KUDD 2B63I 3WKJC 5B0YB 3MGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIQ A;  4DQY B; 
#chains in the Genus database with same CATH topology
 2JA6 I;  1T3U A;  2P28 A;  1AOI A;  3G4S 1;  4H9S C;  1N1J A;  5B31 C;  3AZM B;  4Z66 B;  1P34 D;  1VQ4 1;  3S1Q I;  1KX3 B;  1EQZ D;  4AYB A;  3CCQ 1;  3UTA B;  3CCL 1;  3MGS D;  3AZH C;  1KX4 B;  3NQU B;  3KUY D;  4HGZ A;  3WTP D;  1YIT 1;  3MVD A;  4KGC B;  2WB1 A;  1TWC I;  1P3G B;  1M1A D;  3REI A;  3AN2 D;  1ZB9 A;  4LD9 C;  5C4J I;  4QLC C;  2R93 I;  5G49 A;  3P5J B;  3O62 D;  2FJ7 A;  2OTL Z;  1KU5 A;  4XZQ A;  2CWE A;  5BNX B;  3AZK D;  2F8N A;  3REL D;  3F3P C;  4RVH A;  2E2H I;  3VH5 A;  4X23 C;  3X1S A;  5B0Z B;  4YM6 A;  3AZE D;  1BFM A;  2GTI A;  4NFR A;  3J81 b;  2QA4 Z;  3AZI B;  3AZN B;  2ARO B;  3MNN B;  1U35 D;  3FQM A;  3GTL I;  4BXX I;  1PFT A;  2V8K A;  4H9N B;  4Z5T A;  1I50 I;  4R8P A;  4S1T A;  3I55 1;  2QLV B;  4JJN B;  5B2J C;  2JIR A;  1Z01 A;  2DE6 A;  3HOY I;  3LZ1 A;  3C1C A;  2OTL 1;  1M19 A;  3MVD D;  5GSU C;  2V8I A;  3H0R C;  5AVB A;  3REH A;  3W96 C;  3KSY A;  2BJO A;  2Y2M A;  3REI D;  2PK7 A;  2QRC B;  2QA4 1;  1Q81 1;  3A1K A;  3GTO I;  1FDI A;  5FUG A;  3VH6 T;  5CPK B;  2F8N D;  5CHL B;  5CP6 B;  5AV5 B;  1QF8 A;  2VPX A;  5JA4 A;  1R9T I;  4KHA A;  1WWI A;  5B24 A;  4YM6 D;  3X1S D;  1P3F C;  3LEL A;  5DNN C;  1RNI A;  3PO3 I;  4H9Q A;  5AV6 B;  3EPJ A;  1P3K C;  1ZB8 A;  3W97 B;  4A3J I;  1YI2 Z;  4CAY B;  1NJI 1;  2PYO B;  5BS7 C;  5E5A C;  5KDM A;  1WJ2 A;  5GT3 A;  4MH4 A;  3CCE Z;  2Y2H A;  3CC7 Z;  5B1L B;  1VQN Z;  4A3B I;  4ZUX D;  3AV1 B;  3C1C D;  3AFA A;  3X1T B;  1KRL A;  1VLA A;  2BYK B;  1M19 D;  2W03 A;  4HGY A;  3S15 I;  4BBS I;  1P9N A;  5B0Y A;  3MGP A;  1VQ9 Z;  4J8V C;  3LZ0 B;  5A2Q f;  3REH D;  4XUJ D;  1NP6 A;  3TE5 B;  3VMG A;  1QVG Y;  1KC8 1;  3AZM A;  4Z66 A;  3UTB B;  1KX3 A;  2LFU A;  3UTA A;  1U35 A;  1YI2 1;  4J8U C;  3NQU A;  1KX4 A;  3IX0 A;  1VQK 1;  4HGA C;  4KGC A;  3CCE 1;  3CC7 1;  1VQN 1;  3AZF C;  3AZL B;  3AZG C;  1X3Z A;  1P3G A;  3B0C T;  4WJ3 C;  3J81 f;  1QVF Z;  5B33 C;  5BNX A;  5CPI C;  1VQ9 1;  4AWL C;  5GT3 D;  1P3P C;  2Y2P A;  5B0Z A;  1P3L C;  1VQM Z;  5F99 B;  2HIO C;  2DF4 C;  3AFA D;  3AZI A;  3AZN A;  3VH6 W;  3PO2 I;  2ARO A;  3MNN A;  3B6F B;  5B0Y D;  4MXU A;  3MGP D;  1P3O C;  2NQB C;  2K3R A;  3B0B A;  5AVC C;  1H3O B;  3KWQ C;  2F2A C;  3TU4 B;  1USP B;  4H9N A;  4G92 C;  4Z66 D;  3AZM D;  1Q9C A;  2DQN C;  5BT1 D;  4JJN A;  4DQY B;  3UT9 C;  1KX3 D;  3UTA D;  3EER A;  1F66 D;  3WKJ B;  3A1I A;  2E2J I;  4J8X C;  2VPW A;  2G5I C;  4YS3 D;  4NBD A;  4XX2 A;  1DL6 A;  3I56 Z;  5B31 B;  1P3G D;  4E31 A;  1VQM 1;  1Y1W I;  4J8W C;  2NZD C;  2E2I I;  3AV2 B;  1RO0 A;  3LJA B;  1S72 Z;  3MGQ B;  3AZH B;  5CPK A;  5CP6 A;  3S16 I;  5AV5 A;  4NBA A;  1WWS A;  4WZS B;  3CD6 Z;  3AZI D;  1P3B C;  5AV6 A;  4LD9 B;  4H9P B;  2ARO D;  3GTG I;  3MNN D;  3W98 B;  3W97 A;  4CAY A;  2O4H A;  2PYO A;  1WZN A;  2J6A A;  4X23 B;  2CV5 D;  3I07 A;  2Y2J A;  3I56 1;  5B1L A;  4JJN D;  3B0C W;  5FLM I;  1Q81 2;  4NB8 A;  3GTM S;  3AV1 A;  3X1T A;  1S72 1;  2BYK A;  4H9O B;  1VQP 1;  3LZ0 A;  2RVQ D;  3QWU A;  2IO5 B;  5T6B A;  3CD6 1;  5CPJ B;  1N8R 1;  1HQ3 C;  5B2J B;  3UTB A;  3REJ C;  3REK C;  3PO3 S;  5CPK D;  4BY1 I;  4DGL A;  2VQR A;  1B6W A;  1TWF I;  5GSU B;  1M90 1;  1NJI 2;  3NH8 A;  5B40 C;  3A6N B;  3W96 B;  3AZL A;  2JMO A;  2VPZ A;  3GCF A;  5AV6 D;  2AYD A;  2K5R A;  3TDH B;  2F4O A;  4KUD C;  5IP7 I;  3W97 D;  1M18 C;  5C3I C;  2VF1 A;  2PYO D;  2W04 A;  4E44 A;  1Q7Y 1;  3AYW C;  2E9H A;  2JIQ A;  1P34 C;  4G91 B;  5B1L D;  5BNV B;  2O53 A;  3FKI I;  1EQZ C;  5F99 A;  1I6H I;  3IFU A;  3B6G B;  3X1T D;  1WCM I;  3MGS C;  1TWH I;  1KC8 2;  4A3D I;  3KUY C;  3CCR Z;  3WAA B;  1P3A D;  3X1U D;  4EO5 C;  3WTP C;  3B6F A;  3LZ0 D;  1H3O A;  1USP A;  3TU4 A;  5D1P A;  3CC2 Z;  4WV4 B;  2KI7 B;  2QRD B;  3UTB D;  1Z02 A;  2NVY I;  3O62 C;  3AZK C;  3WKJ A;  3VB9 A;  4J8V B;  3WA9 D;  1X3W A;  3AZE C;  2VPY A;  3AZL D;  1YJW Z;  4H9S A;  5B31 A;  4HH4 A;  2LY8 A;  2OTJ Z;  1BH9 B;  3AV2 A;  3W99 B;  1U35 C;  1QVF Y;  4WU8 D;  3LJA A;  3OW2 Y;  2UWX A;  3MGQ A;  3AZH A;  2ZY5 A;  1YHQ Z;  5DNM C;  2Y2Q A;  1YJ9 Z;  4HGA B;  3CCV Z;  3CC2 1;  3AZF B;  3AZG B;  5JRG D;  2JS4 A;  5F99 D;  4E45 A;  1SFO I;  1VQ7 Z;  4LD9 A;  4QLC A;  4H9P A;  5B32 C;  5C3E I;  3CCJ Z;  3W98 A;  1JJ2 Z;  3B6F D;  3MVD C;  5CPI B;  3TU4 D;  4AWL B;  1AOI D;  4X23 A;  1P3P B;  3REI C;  2RHB A;  3S2H I;  1F1E A;  3F6T A;  1P3L B;  3HOX I;  5AY8 B;  2HIO B;  3G71 Z;  3CPW Y;  2OTJ 1;  3WKJ D;  2JIM A;  1P3O B;  2NQB B;  3X1S C;  2JSS A;  4H9O A;  1YJ9 1;  3CCV 1;  4NFT A;  3VMI A;  3GTM I;  5CPJ A;  3MGR C;  1WII A;  5B2J A;  3AV2 D;  4WU9 C;  1VQ7 1;  3CCJ 1;  2Y2I A;  3LJA D;  3MGQ D;  3AZH D;  2FJ7 D;  4XZQ D;  4QTU A;  3HOW I;  4J8X B;  3CCS Z;  4X6A I;  1YJN Z;  5GSU A;  3NH5 A;  1VQ8 Z;  3W96 A;  3KXB B;  4ZUX C;  3A6N A;  3MZL B;  1S32 C;  4LD9 D;  1P3I C;  3S14 I;  5B1M C;  1TAF B;  2HUE C;  3W98 D;  2LEX A;  1K9M 2;  3FQQ A;  3NFZ A;  1YIJ Z;  4XUJ C;  4X23 D;  2Y0S A;  3S2D I;  3EED A;  1KX5 C;  4Z5T D;  4R8P D;  1Z2C B;  5BNV A;  5AV9 C;  3X1V B;  2JNY A;  1N8R 2;  3LZ1 D;  3B6G A;  2IZ4 A;  3WAA A;  2PMZ A;  2YFW B;  3CCS 1;  5BO0 B;  5AVB D;  4Y52 I;  1M90 2;  5CPJ D;  1VQ8 1;  1VQ6 Z;  5B2J D;  2QRE B;  3S17 I;  2RIQ A;  3CCM Z;  5B2I C;  3H0L C;  2BG1 A;  4DRB A;  5GSU D;  5GT3 C;  5B24 D;  4J8V A;  3LEL D;  3A6N D;  3W96 D;  3IF8 A;  5GT0 B;  1Q7Y 2;  3GTJ I;  5IT9 b;  5C44 I;  4UPK A;  3AFA C;  1X0T A;  1Y8C A;  1BH9 A;  3CXC Z;  3REJ B;  3REK B;  1ID3 C;  3W99 A;  3MGP C;  2JCH A;  3B0D B;  3EPH A;  3OW2 Z;  3VH6 A;  1YUK A;  2RPR A;  2Q4Z A;  5B40 B;  4A3F I;  1VQ6 1;  5BT1 C;  3AZF A;  3AZG A;  1KX3 C;  5B31 G;  5IP9 I;  2NVT I;  3B6G D;  2Y2L A;  1F66 C;  2QR1 B;  3C1B C;  1M18 B;  3WAA D;  5B33 A;  5C3I B;  4YS3 C;  4RS4 A;  3CCM 1;  5CPI A;  3AYW B;  4BBR I;  1P3P A;  3HOU I;  1P3L A;  1EQZ B;  2JA8 I;  1ZLA C;  5AY8 A;  2HIO A;  3CPW Z;  3MGS B;  5GXQ B;  2KPI A;  4NBC A;  1KQS Z;  3KUY B;  1KX4 D;  3AL0 C;  4EO5 B;  1P3O A;  3J80 b;  2NQB A;  5AVC A;  4J8V D;  4KGC D;  1N2F A;  2Q51 A;  3CQZ I;  2ARO C;  5AV8 C;  3MNN C;  3W99 D;  1QYP A;  2LIY A;  2OZK A;  2R6M A;  3NDI A;  3I4N I;  2XD1 A;  1Z03 A;  4J8X A;  3BG0 B;  3G71 1;  2CV5 C;  3AZE B;  5B0Z D;  1RO2 A;  5AN9 F;  2JE5 A;  3AZG D;  1TZY C;  3NQJ B;  3KXB A;  2ZY3 A;  1I3Q I;  3AZN D;  4QLC B;  2F8N H;  1TAF A;  4QTT A;  1JJ2 Y;  4A93 I;  3EG5 B;  2OOY B;  5DNM B;  2RVQ C;  1P3P D;  1AA6 A;  2Y2G A;  1P3L D;  1P3M C;  5AY8 D;  2HIO D;  4DRA A;  5C4X I;  5B32 B;  3X1V A;  4MON A;  1K9M 1;  4E33 A;  3R45 B;  3WTP E;  3VTN A;  1RO4 A;  2NQB D;  2ZM5 A;  2YFW A;  3AZJ C;  5BO0 A;  2JA5 I;  5AV6 C;  4Z2M H;  5IT9 f;  4NE3 A;  4Z2M G;  5CP6 D;  2PYO C;  5AV5 D;  2NVQ I;  2Y2K A;  5B1L C;  3KXB D;  2L5A A;  5GT0 A;  1VQL Z;  3MGR B;  1HQ3 A;  1R4V A;  1HTA A;  4WU9 B;  3REJ A;  3REK A;  1P3A C;  3X1U C;  4RV9 A;  2BYM B;  5FLX b;  3LZ0 C;  1M18 D;  3GKQ A;  4WNN B;  1TWG I;  1VQ5 Z;  1P3F B;  5B40 A;  5DNN B;  4ZUX B;  3UTB C;  1S32 B;  1P3I B;  3X1V D;  5B1M B;  3AV1 D;  2ZAE B;  1P3K B;  2WAQ A;  5D1O B;  1M18 A;  1WW9 A;  4NBG A;  3WA9 C;  1W2B Z;  4XUJ B;  3AYW A;  5E5A B;  1KX5 B;  2F8N K;  2I3C A;  3LUS A;  1M1A C;  3H3V J;  3AN2 C;  3H0G I;  3J80 f;  5AV9 B;  1EQZ A;  4MD9 A;  4WU8 C;  3MGS A;  5GXQ A;  3VH5 T;  3KUY A;  4A3L I;  3REL C;  2JUB A;  1VQ5 1;  5JRG C;  5F99 C;  5GT0 D;  3HOV I;  3CXC Y;  3CCQ Z;  3D9X A;  3REJ D;  3B6F C;  2V3V A;  3K7A I;  3CCR 1;  5B2I B;  4J8U B;  2DE7 A;  1AOI C;  3KFU G;  2V45 A;  5B40 D;  3AZE A;  5CM2 M;  2H85 A;  3NQJ A;  2YFV B;  4BY7 I;  3HOZ I;  3ESW A;  1ID3 B;  4NOZ A;  5B33 B;  1JWH C;  2M48 A;  2Y2O A;  5DNM A;  3AYW D;  2JIO A;  3GTP I;  4E2W A;  1W2E A;  1YJW 1;  3AV2 C;  5A2Q b;  3LJA C;  1F66 B;  3MGQ C;  5GXQ D;  5B32 A;  4XZQ C;  3C1B B;  2FJ7 C;  3D2L A;  2OOX B;  3R45 A;  4E30 A;  4YS3 B;  2QEX Z;  1LQL A;  1YHQ 1;  5AVC B;  4YM6 C;  3KWQ B;  2JA7 I;  3I55 Z;  5T67 A;  3D6W A;  4E2Z A;  5B31 D;  4G92 B;  3UT9 B;  3I4M I;  1ZLA B;  3W98 C;  1TWA I;  3EPL A;  3F3F C;  4A3M I;  1Q82 2;  4Z5T C;  4R8P C;  1A7W A;  3NDJ A;  3S1M I;  5FLX f;  4J8W B;  5AV8 B;  4QLC D;  3LZ1 C;  3MGR A;  3EPK A;  3C1C C;  4WU9 A;  3VH5 W;  1M19 C;  2NZD B;  2QKD A;  1FDO A;  2QEX 1;  1Q86 1;  3CMA Z;  2BYM A;  5DNM D;  2HF1 A;  3J7A 4;  5AVB C;  3REH C;  2IO5 C;  2CV5 B;  3MZK B;  5CPJ C;  4WNN A;  1P3F A;  1TZY B;  2YAD A;  5DNN A;  4ZUX A;  4RVF A;  1S32 A;  1P3B B;  1P3I A;  5B32 D;  5B1M A;  1YUA A;  4NBB A;  1P3K A;  1JFI B;  5D1O A;  3G6E Z;  3GTQ I;  3HKZ A;  5B24 C;  4ZBJ C;  1YJN 1;  3M4O I;  3LEL C;  4XUJ A;  3A6N C;  3S1R I;  5BS7 A;  5E5A A;  1KX5 A;  2IZ3 A;  4A3I I;  1P3M B;  5AV9 A;  2NVX I;  4E2X A;  1KD1 1;  4A3C I;  3CMA 1;  3AZJ B;  3KIH A;  4G91 C;  1Y1V I;  1PZR A;  3S1N I;  3MGR D;  3B6G C;  1HQ3 B;  4WU9 D;  3CME Z;  4CSR B;  1K8A 1;  3WAA C;  5B0Y C;  3G6E 1;  4NBF A;  1VQK Z;  4H9R B;  5B2I A;  4J8U A;  1P3F D;  3AZM C;  5DNN D;  4Z66 C;  3VMH A;  2JR6 A;  1S32 D;  3V9R B;  1P3I D;  2YFV A;  5B1M D;  1BH8 B;  3UTA C;  4KUD B;  1P3K D;  2G2K A;  2RBL A;  1ID3 A;  1KX4 C;  1P3A B;  3X1U B;  1W2B Y;  4KGC C;  1K73 1;  3FDD A;  3RZO I;  1RQF A;  5E5A D;  1KX5 D;  4M6B A;  1P3G C;  4NB9 A;  2IV2 X;  1P34 B;  2YU9 I;  5AV9 D;  3W99 C;  2AKL A;  1F66 A;  5T64 A;  3C1B A;  2E7Z A;  3CME 1;  3U50 C;  2RT9 A;  3WTP B;  4YS3 A;  3WA9 B;  4UUZ B;  5B0Z C;  3KWQ A;  1M1K 2;  1Q16 A;  1M1A B;  3NH4 A;  3AZI C;  3AN2 B;  3AZN C;  1SIW A;  1TFI A;  2W8S A;  3UT9 A;  1ZLA A;  3Q87 A;  4WU8 B;  3O62 B;  5B32 G;  2VUM I;  4A3G I;  3AZK B;  4MRI A;  5B2I D;  4J8U D;  3REL B;  4NBE A;  4E2Y A;  3JAM b;  2XD5 A;  4A3K I;  5JRG B;  3AZF D;  2ZY2 A;  4JJN C;  5AY8 C;  2NAP A;  2GU2 A;  4J8W A;  5AV8 A;  2NZD A;  1ID3 D;  1B67 A;  1U35 B;  1Q82 1;  5B33 D;  2F8N G;  2V8J A;  3H0M C;  3M3Y I;  5CPI D;  1AOI B;  4CL1 A;  1YIJ 1;  3GTK I;  1N1J B;  2CV5 A;  1VQO Z;  1L1O C;  1TZY A;  2DE5 A;  4NH1 C;  1P3B A;  4NE6 A;  3KIF A;  3C1B D;  1KQS Y;  5CPK C;  3T4N B;  5CP6 C;  1ULY A;  5AV5 C;  1JFI A;  4TNU A;  1P3O D;  3MVD B;  3IP4 C;  5AVC D;  3KWQ D;  2GTH A;  3CCU Z;  3KXB C;  3CC4 Z;  3REI B;  1P3M A;  3UT9 D;  5G49 B;  1ZLA D;  2JIP A;  1RLY A;  3W97 C;  2VUG A;  2FJ7 B;  4XZQ B;  2F8N B;  3BG1 B;  4MD7 A;  4RVD A;  4J8X D;  2Y2N A;  1K83 I;  1ZH1 A;  3X1S B;  4YM6 B;  3RZD I;  1VQP Z;  3AZJ A;  1Q86 2;  1VQO 1;  3X1V C;  1NUI A;  4J8W D;  5AV8 D;  3AV1 C;  3X1T C;  2NZD D;  3IR7 A;  4CSR A;  4H9R A;  4Z5T B;  3CCU 1;  4R8P B;  3CC4 1;  1TZY D;  1P3B D;  3V9R A;  3LZ1 B;  3C1C B;  1S7M A;  1BH8 A;  2HUE B;  1M19 B;  4KUD A;  2M6N A;  2PM9 A;  3MON A;  1P3A A;  3X1U A;  1KD1 2;  4NE5 A;  2ZY4 A;  5AVB B;  3REH B;  3AZL C;  5GT0 C;  5LL6 f;  1QVG Z;  1P3M D;  1P34 A;  4Y7N I;  5FUG B;  1QXF A;  1ML8 A;  1Y1V S;  2HU9 A;  1VQL 1;  3B0D C;  4A3E I;  2R7Z I;  1K8A 2;  5JA4 B;  4KHA B;  4ZBJ B;  5B24 B;  3WTP A;  3AZJ D;  3WA9 A;  4UUZ A;  3LEL B;  2F4M A;  4NBH A;  3G4S Z;  4DK1 A;  4H9Q B;  1VQ4 Z;  2EGT A;  1M1A A;  3AN2 A;  1HQ3 D;  3JAM f;  3CCL Z;  4RVG A;  2G5H C;  4WU8 A;  3O62 A;  3REK D;  4E32 A;  2FFF B;  3AZK A;  2P3Y A;  1YIT Z;  5KDM B;  3REL A;  3TU4 C;  1M1K 1;  5GT3 B;  2J8P A;  4MD8 A;  1K73 2;  5JRG A;  4EWC A;  2R92 I;  3AFA B;  5GXQ C;  4KUD D;  2B63 I;  3WKJ C;  5B0Y B;  3MGP B; 
#chains in the Genus database with same CATH homology
 2JA6 I;  1T3U A;  2P28 A;  1AOI A;  3G4S 1;  4H9S C;  1N1J A;  5B31 C;  3AZM B;  4Z66 B;  1P34 D;  1VQ4 1;  3S1Q I;  1KX3 B;  1EQZ D;  4AYB A;  3CCQ 1;  3UTA B;  3CCL 1;  3MGS D;  3AZH C;  1KX4 B;  3NQU B;  3KUY D;  4HGZ A;  3WTP D;  1YIT 1;  3MVD A;  4KGC B;  2WB1 A;  1TWC I;  1P3G B;  1M1A D;  3REI A;  3AN2 D;  1ZB9 A;  4LD9 C;  5C4J I;  4QLC C;  2R93 I;  5G49 A;  3P5J B;  3O62 D;  2FJ7 A;  2OTL Z;  1KU5 A;  4XZQ A;  2CWE A;  5BNX B;  3AZK D;  2F8N A;  3REL D;  3F3P C;  4RVH A;  2E2H I;  3VH5 A;  4X23 C;  3X1S A;  5B0Z B;  4YM6 A;  3AZE D;  1BFM A;  2GTI A;  4NFR A;  3J81 b;  2QA4 Z;  3AZI B;  3AZN B;  2ARO B;  3MNN B;  1U35 D;  3FQM A;  3GTL I;  4BXX I;  1PFT A;  2V8K A;  4H9N B;  4Z5T A;  1I50 I;  4R8P A;  4S1T A;  3I55 1;  2QLV B;  4JJN B;  5B2J C;  1Z01 A;  2DE6 A;  3HOY I;  3LZ1 A;  3C1C A;  2OTL 1;  1M19 A;  3MVD D;  5GSU C;  2V8I A;  3H0R C;  5AVB A;  3REH A;  3W96 C;  3KSY A;  2BJO A;  2Y2M A;  3REI D;  2PK7 A;  2QRC B;  2QA4 1;  1Q81 1;  3A1K A;  3GTO I;  5FUG A;  3VH6 T;  5CPK B;  2F8N D;  5CHL B;  5CP6 B;  5AV5 B;  1QF8 A;  5JA4 A;  1R9T I;  4KHA A;  1WWI A;  5B24 A;  4YM6 D;  3X1S D;  1P3F C;  3LEL A;  5DNN C;  1RNI A;  3PO3 I;  4H9Q A;  5AV6 B;  3EPJ A;  1P3K C;  1ZB8 A;  3W97 B;  4A3J I;  1YI2 Z;  4CAY B;  1NJI 1;  2PYO B;  5BS7 C;  5E5A C;  5KDM A;  4MH4 A;  5GT3 A;  3CCE Z;  3CC7 Z;  2Y2H A;  1VQN Z;  5B1L B;  4A3B I;  4ZUX D;  3AV1 B;  3C1C D;  3AFA A;  3X1T B;  1KRL A;  1VLA A;  2BYK B;  1M19 D;  2W03 A;  4HGY A;  3S15 I;  4BBS I;  1P9N A;  5B0Y A;  3MGP A;  1VQ9 Z;  4J8V C;  3LZ0 B;  5A2Q f;  3REH D;  4XUJ D;  1NP6 A;  3VMG A;  1QVG Y;  1KC8 1;  3AZM A;  4Z66 A;  3UTB B;  1KX3 A;  2LFU A;  3UTA A;  1U35 A;  1YI2 1;  4J8U C;  3NQU A;  1KX4 A;  3IX0 A;  1VQK 1;  4HGA C;  4KGC A;  3CCE 1;  3CC7 1;  1VQN 1;  3AZF C;  3AZL B;  3AZG C;  1X3Z A;  1P3G A;  3B0C T;  4WJ3 C;  3J81 f;  1QVF Z;  5B33 C;  5BNX A;  5CPI C;  1VQ9 1;  4AWL C;  5GT3 D;  1P3P C;  2Y2P A;  5B0Z A;  1P3L C;  1VQM Z;  5F99 B;  2HIO C;  2DF4 C;  3AFA D;  3AZI A;  3AZN A;  3VH6 W;  3PO2 I;  2ARO A;  3MNN A;  3B6F B;  5B0Y D;  4MXU A;  3MGP D;  1P3O C;  2NQB C;  2K3R A;  3B0B A;  5AVC C;  1H3O B;  3KWQ C;  2F2A C;  3TU4 B;  1USP B;  4H9N A;  4G92 C;  4Z66 D;  3AZM D;  1Q9C A;  2DQN C;  5BT1 D;  4JJN A;  4DQY B;  3UT9 C;  1KX3 D;  3UTA D;  3EER A;  1F66 D;  3WKJ B;  3A1I A;  2E2J I;  4J8X C;  2G5I C;  4YS3 D;  4NBD A;  4XX2 A;  1DL6 A;  3I56 Z;  5B31 B;  1P3G D;  4E31 A;  1VQM 1;  1Y1W I;  4J8W C;  2NZD C;  2E2I I;  3AV2 B;  1RO0 A;  3LJA B;  1S72 Z;  3MGQ B;  3AZH B;  5CPK A;  5CP6 A;  3S16 I;  5AV5 A;  4NBA A;  1WWS A;  4WZS B;  3CD6 Z;  3AZI D;  1P3B C;  5AV6 A;  4LD9 B;  4H9P B;  2ARO D;  3GTG I;  3MNN D;  3W98 B;  3W97 A;  4CAY A;  2O4H A;  2PYO A;  2J6A A;  4X23 B;  2CV5 D;  3I07 A;  2Y2J A;  3I56 1;  5B1L A;  4JJN D;  3B0C W;  5FLM I;  1Q81 2;  4NB8 A;  3GTM S;  3AV1 A;  3X1T A;  1S72 1;  2BYK A;  4H9O B;  1VQP 1;  3LZ0 A;  2RVQ D;  3QWU A;  2IO5 B;  5T6B A;  3CD6 1;  5CPJ B;  1N8R 1;  1HQ3 C;  5B2J B;  3UTB A;  3REJ C;  3REK C;  3PO3 S;  5CPK D;  4BY1 I;  4DGL A;  2VQR A;  1B6W A;  1TWF I;  5GSU B;  1M90 1;  1NJI 2;  3NH8 A;  5B40 C;  3A6N B;  3W96 B;  3AZL A;  2JMO A;  3GCF A;  5AV6 D;  2K5R A;  3TDH B;  2F4O A;  4KUD C;  5IP7 I;  3W97 D;  1M18 C;  5C3I C;  2VF1 A;  2PYO D;  2W04 A;  4E44 A;  1Q7Y 1;  3AYW C;  2E9H A;  1P34 C;  4G91 B;  5B1L D;  5BNV B;  2O53 A;  3FKI I;  1EQZ C;  5F99 A;  1I6H I;  3IFU A;  3B6G B;  3X1T D;  1WCM I;  3MGS C;  1TWH I;  1KC8 2;  4A3D I;  3KUY C;  3CCR Z;  3WAA B;  1P3A D;  3X1U D;  4EO5 C;  3WTP C;  3B6F A;  3LZ0 D;  1H3O A;  1USP A;  3TU4 A;  5D1P A;  3CC2 Z;  4WV4 B;  2KI7 B;  2QRD B;  3UTB D;  1Z02 A;  2NVY I;  3O62 C;  3AZK C;  3WKJ A;  3VB9 A;  4J8V B;  3WA9 D;  1X3W A;  3AZE C;  3AZL D;  1YJW Z;  4H9S A;  5B31 A;  4HH4 A;  2LY8 A;  2OTJ Z;  1BH9 B;  3AV2 A;  3W99 B;  1U35 C;  1QVF Y;  4WU8 D;  3LJA A;  3OW2 Y;  2UWX A;  3MGQ A;  3AZH A;  2ZY5 A;  1YHQ Z;  5DNM C;  2Y2Q A;  1YJ9 Z;  4HGA B;  3CCV Z;  3CC2 1;  3AZF B;  3AZG B;  5JRG D;  2JS4 A;  5F99 D;  4E45 A;  1SFO I;  1VQ7 Z;  4LD9 A;  4QLC A;  4H9P A;  5B32 C;  5C3E I;  3CCJ Z;  3W98 A;  1JJ2 Z;  3B6F D;  3MVD C;  5CPI B;  3TU4 D;  4AWL B;  1AOI D;  4X23 A;  1P3P B;  3REI C;  2RHB A;  3S2H I;  1F1E A;  3F6T A;  1P3L B;  3HOX I;  5AY8 B;  2HIO B;  3G71 Z;  3CPW Y;  2OTJ 1;  3WKJ D;  1P3O B;  2NQB B;  3X1S C;  2JSS A;  4H9O A;  1YJ9 1;  3CCV 1;  4NFT A;  3VMI A;  3GTM I;  5CPJ A;  3MGR C;  1WII A;  5B2J A;  3AV2 D;  4WU9 C;  1VQ7 1;  3CCJ 1;  2Y2I A;  3LJA D;  3MGQ D;  3AZH D;  2FJ7 D;  4XZQ D;  4QTU A;  3HOW I;  4J8X B;  3CCS Z;  4X6A I;  1YJN Z;  5GSU A;  3NH5 A;  1VQ8 Z;  3W96 A;  3KXB B;  4ZUX C;  3A6N A;  3MZL B;  1S32 C;  4LD9 D;  1P3I C;  3S14 I;  5B1M C;  1TAF B;  2HUE C;  3W98 D;  1K9M 2;  3FQQ A;  3NFZ A;  1YIJ Z;  4XUJ C;  4X23 D;  2Y0S A;  3S2D I;  3EED A;  1KX5 C;  4Z5T D;  4R8P D;  1Z2C B;  5BNV A;  5AV9 C;  3X1V B;  2JNY A;  1N8R 2;  3LZ1 D;  3B6G A;  2IZ4 A;  3WAA A;  2PMZ A;  2YFW B;  3CCS 1;  5BO0 B;  5AVB D;  4Y52 I;  1M90 2;  5CPJ D;  1VQ8 1;  1VQ6 Z;  5B2J D;  2QRE B;  3S17 I;  2RIQ A;  3CCM Z;  5B2I C;  3H0L C;  2BG1 A;  4DRB A;  5GSU D;  5GT3 C;  5B24 D;  4J8V A;  3LEL D;  3A6N D;  3W96 D;  3IF8 A;  5GT0 B;  1Q7Y 2;  3GTJ I;  5IT9 b;  5C44 I;  4UPK A;  3AFA C;  1X0T A;  3CXC Z;  1BH9 A;  3REJ B;  3REK B;  1ID3 C;  3W99 A;  3MGP C;  2JCH A;  3B0D B;  3EPH A;  3OW2 Z;  3VH6 A;  1YUK A;  2RPR A;  2Q4Z A;  5B40 B;  4A3F I;  1VQ6 1;  5BT1 C;  3AZF A;  3AZG A;  1KX3 C;  5B31 G;  5IP9 I;  2NVT I;  3B6G D;  2Y2L A;  1F66 C;  2QR1 B;  3C1B C;  1M18 B;  3WAA D;  5B33 A;  5C3I B;  4YS3 C;  4RS4 A;  3CCM 1;  5CPI A;  3AYW B;  4BBR I;  1P3P A;  3HOU I;  1P3L A;  1EQZ B;  2JA8 I;  1ZLA C;  5AY8 A;  2HIO A;  3CPW Z;  3MGS B;  5GXQ B;  2KPI A;  4NBC A;  1KQS Z;  3KUY B;  1KX4 D;  3AL0 C;  4EO5 B;  1P3O A;  3J80 b;  2NQB A;  5AVC A;  4J8V D;  4KGC D;  1N2F A;  2Q51 A;  3CQZ I;  2ARO C;  5AV8 C;  3MNN C;  3W99 D;  1QYP A;  2LIY A;  2OZK A;  2R6M A;  3NDI A;  3I4N I;  2XD1 A;  1Z03 A;  4J8X A;  3BG0 B;  3G71 1;  2CV5 C;  3AZE B;  5B0Z D;  1RO2 A;  5AN9 F;  2JE5 A;  3AZG D;  1TZY C;  3NQJ B;  3KXB A;  2ZY3 A;  1I3Q I;  3AZN D;  4QLC B;  2F8N H;  1TAF A;  4QTT A;  1JJ2 Y;  4A93 I;  3EG5 B;  2OOY B;  5DNM B;  2RVQ C;  1P3P D;  2Y2G A;  1P3L D;  1P3M C;  5AY8 D;  2HIO D;  4DRA A;  5C4X I;  5B32 B;  3X1V A;  4MON A;  1K9M 1;  4E33 A;  3R45 B;  3WTP E;  3VTN A;  1RO4 A;  2NQB D;  2ZM5 A;  2YFW A;  3AZJ C;  5BO0 A;  2JA5 I;  5AV6 C;  4Z2M H;  5IT9 f;  4NE3 A;  4Z2M G;  5CP6 D;  2PYO C;  5AV5 D;  2NVQ I;  2Y2K A;  5B1L C;  3KXB D;  2L5A A;  5GT0 A;  1VQL Z;  3MGR B;  1HQ3 A;  1R4V A;  1HTA A;  4WU9 B;  3REJ A;  3REK A;  1P3A C;  3X1U C;  4RV9 A;  2BYM B;  5FLX b;  3LZ0 C;  1M18 D;  3GKQ A;  4WNN B;  1TWG I;  1VQ5 Z;  1P3F B;  5B40 A;  5DNN B;  4ZUX B;  3UTB C;  1S32 B;  1P3I B;  3X1V D;  5B1M B;  3AV1 D;  2ZAE B;  1P3K B;  2WAQ A;  5D1O B;  1M18 A;  1WW9 A;  4NBG A;  3WA9 C;  1W2B Z;  4XUJ B;  3AYW A;  5E5A B;  1KX5 B;  2F8N K;  2I3C A;  3LUS A;  1M1A C;  3H3V J;  3AN2 C;  3H0G I;  3J80 f;  5AV9 B;  1EQZ A;  4MD9 A;  4WU8 C;  3MGS A;  5GXQ A;  3VH5 T;  3KUY A;  4A3L I;  3REL C;  2JUB A;  1VQ5 1;  5JRG C;  5F99 C;  5GT0 D;  3HOV I;  3CXC Y;  3CCQ Z;  3D9X A;  3REJ D;  3B6F C;  3K7A I;  3CCR 1;  5B2I B;  4J8U B;  2DE7 A;  1AOI C;  3KFU G;  5CM2 M;  5B40 D;  3AZE A;  2H85 A;  3NQJ A;  2YFV B;  4BY7 I;  3HOZ I;  3ESW A;  1ID3 B;  4NOZ A;  5B33 B;  1JWH C;  2M48 A;  2Y2O A;  5DNM A;  3AYW D;  3GTP I;  4E2W A;  1W2E A;  1YJW 1;  3AV2 C;  5A2Q b;  3LJA C;  1F66 B;  3MGQ C;  5GXQ D;  5B32 A;  4XZQ C;  3C1B B;  2FJ7 C;  4E30 A;  2OOX B;  3R45 A;  2QEX Z;  4YS3 B;  1LQL A;  1YHQ 1;  5AVC B;  4YM6 C;  3KWQ B;  2JA7 I;  3I55 Z;  5T67 A;  3D6W A;  4E2Z A;  5B31 D;  4G92 B;  3UT9 B;  3I4M I;  1ZLA B;  3W98 C;  1TWA I;  3EPL A;  3F3F C;  4A3M I;  1Q82 2;  4Z5T C;  4R8P C;  1A7W A;  3NDJ A;  3S1M I;  5FLX f;  4J8W B;  5AV8 B;  4QLC D;  3LZ1 C;  3MGR A;  3EPK A;  3C1C C;  4WU9 A;  3VH5 W;  1M19 C;  2NZD B;  2QKD A;  3TE5 B;  2QEX 1;  1Q86 1;  3CMA Z;  2BYM A;  5DNM D;  2HF1 A;  3J7A 4;  5AVB C;  3REH C;  2IO5 C;  2CV5 B;  3MZK B;  5CPJ C;  4WNN A;  1P3F A;  1TZY B;  2YAD A;  5DNN A;  4ZUX A;  4RVF A;  1S32 A;  1P3B B;  1P3I A;  5B32 D;  5B1M A;  1YUA A;  4NBB A;  1P3K A;  1JFI B;  5D1O A;  3G6E Z;  3GTQ I;  3HKZ A;  5B24 C;  4ZBJ C;  1YJN 1;  3M4O I;  3LEL C;  4XUJ A;  3A6N C;  3S1R I;  5BS7 A;  5E5A A;  1KX5 A;  2IZ3 A;  4A3I I;  1P3M B;  5AV9 A;  2NVX I;  4E2X A;  1KD1 1;  4A3C I;  3CMA 1;  3AZJ B;  3KIH A;  4G91 C;  1Y1V I;  1PZR A;  3S1N I;  3MGR D;  3B6G C;  1HQ3 B;  4WU9 D;  3CME Z;  4CSR B;  1K8A 1;  3WAA C;  5B0Y C;  3G6E 1;  4NBF A;  1VQK Z;  4H9R B;  5B2I A;  4J8U A;  1P3F D;  3AZM C;  5DNN D;  4Z66 C;  3VMH A;  2JR6 A;  1S32 D;  3V9R B;  1P3I D;  2YFV A;  5B1M D;  1BH8 B;  3UTA C;  4KUD B;  1P3K D;  2G2K A;  2RBL A;  1ID3 A;  1KX4 C;  1P3A B;  3X1U B;  1W2B Y;  4KGC C;  1K73 1;  3FDD A;  3RZO I;  1RQF A;  5E5A D;  1KX5 D;  4M6B A;  1P3G C;  4NB9 A;  2YU9 I;  1P34 B;  5AV9 D;  3W99 C;  2AKL A;  1F66 A;  5T64 A;  3C1B A;  3CME 1;  3U50 C;  2RT9 A;  3WTP B;  4YS3 A;  3WA9 B;  4UUZ B;  5B0Z C;  3KWQ A;  1M1K 2;  3NH4 A;  1M1A B;  3AZI C;  3AN2 B;  3AZN C;  1TFI A;  2W8S A;  3UT9 A;  1ZLA A;  3Q87 A;  4WU8 B;  3O62 B;  5B32 G;  2VUM I;  4A3G I;  3AZK B;  4MRI A;  5B2I D;  4J8U D;  3REL B;  4NBE A;  4E2Y A;  3JAM b;  2XD5 A;  4A3K I;  5JRG B;  3AZF D;  2ZY2 A;  4JJN C;  5AY8 C;  2GU2 A;  4J8W A;  5AV8 A;  2NZD A;  1ID3 D;  1B67 A;  1U35 B;  1Q82 1;  5B33 D;  2F8N G;  2V8J A;  3H0M C;  3M3Y I;  5CPI D;  1AOI B;  4CL1 A;  1YIJ 1;  3GTK I;  1N1J B;  2CV5 A;  1VQO Z;  1L1O C;  1TZY A;  2DE5 A;  4NH1 C;  1P3B A;  4NE6 A;  3KIF A;  3C1B D;  1KQS Y;  5CPK C;  3T4N B;  5CP6 C;  1ULY A;  5AV5 C;  1JFI A;  4TNU A;  1P3O D;  3MVD B;  3IP4 C;  5AVC D;  3KWQ D;  2GTH A;  3CCU Z;  3KXB C;  3CC4 Z;  3REI B;  1P3M A;  3UT9 D;  5G49 B;  1ZLA D;  1RLY A;  3W97 C;  2VUG A;  2FJ7 B;  4XZQ B;  2F8N B;  3BG1 B;  4MD7 A;  4RVD A;  4J8X D;  2Y2N A;  1K83 I;  1ZH1 A;  3X1S B;  4YM6 B;  3RZD I;  1VQP Z;  3AZJ A;  1Q86 2;  1VQO 1;  3X1V C;  1NUI A;  4J8W D;  5AV8 D;  3AV1 C;  3X1T C;  2NZD D;  4CSR A;  4H9R A;  4Z5T B;  3CCU 1;  4R8P B;  3CC4 1;  1TZY D;  1P3B D;  3V9R A;  3LZ1 B;  3C1C B;  1S7M A;  1BH8 A;  2HUE B;  1M19 B;  4KUD A;  2M6N A;  2PM9 A;  3MON A;  1P3A A;  3X1U A;  1KD1 2;  4NE5 A;  2ZY4 A;  5AVB B;  3REH B;  3AZL C;  5GT0 C;  5LL6 f;  1QVG Z;  1P3M D;  1P34 A;  4Y7N I;  5FUG B;  1VQL 1;  1ML8 A;  1Y1V S;  2HU9 A;  3B0D C;  4A3E I;  2R7Z I;  1K8A 2;  5JA4 B;  4KHA B;  4ZBJ B;  5B24 B;  3WTP A;  3AZJ D;  3WA9 A;  4UUZ A;  3LEL B;  2F4M A;  4NBH A;  3G4S Z;  4DK1 A;  4H9Q B;  1VQ4 Z;  2EGT A;  1M1A A;  3AN2 A;  1HQ3 D;  3JAM f;  3CCL Z;  4RVG A;  2G5H C;  4WU8 A;  3O62 A;  3REK D;  4E32 A;  2FFF B;  3AZK A;  2P3Y A;  1YIT Z;  5KDM B;  3REL A;  3TU4 C;  1M1K 1;  5GT3 B;  2J8P A;  4MD8 A;  1K73 2;  5JRG A;  4EWC A;  2R92 I;  3AFA B;  5GXQ C;  4KUD D;  2B63 I;  3WKJ C;  5B0Y B;  3MGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...