4DQYB

Structure of human parp-1 bound to a dna double strand break
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'SKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly [ADP-ribose] polymerase 1
publication title Structural basis for DNA damage-dependent poly(ADP-ribosyl)ation by human PARP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 37
structure length 136
sequence length 136
chains with identical sequence E
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4dqyB01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dqyB02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
3AZJC 5BO0B 5B1MA 5G49B 3CCRZ 4XZQB 4Z66B 3VMHA 2PYOD 1VQPZ 3W98A 5D1OB 2OTLZ 2R93I 1PFTA 4WJ3C 2CV5C 5AV9B 3B0DC 2V45A 3NDIA 1P3AD 3LZ0D 3UT9C 2L5AA 4ZUXC 3KXBA 4KGCC 4KUDC 5B0YC 3X1VA 1FDIA 1X3WA 5FLMI 4Z5TB 2HUEB 3TU4A 1YJ91 4WNNB 3REIC 2R6MA 5T6BA 2W8SA 4KHAB 4YM6D 3A6NC 2FJ7C 3WAAB 1I3QI 1ZH1A 3WA9C 2HF1A 2O53A 2Y2NA 3CCMZ 4J8WC 3EG5B 2QA41 1ID3A 1ZLAA 3PO2I 3UTBB 1P3FA 4A3CI 3EPJA 3AZKA 2H85A 5AV6D 4QLCD 5B1LB 5B2JB 3X1UC 4J8UB 1Q9CA 1Q821 2NVTI 3A1IA 3C1CC 1VQOZ 5GT3C 1RO0A 3B6FB 5CPJB 1YHQ1 3WKJA 4Y7NI 2QA4Z 2YFVB 3Q87A 2Y0SA 2JMOA 2JIRA 3B6GD 3X1TD 2YU9I 2ZY2A 4M6BA 5B32A 1K732 3AFAD 3MGRC 2IZ3A 4E2YA 1P3LC 1P3OB 3MONA 3T4NB 4CAYB 1BH9A 1YHQZ 4J8XD 5G49A 4WU9D 3CC41 4Z66A 2JA8I 1B67A 2QEX1 4Y52I 2BG1A 3LELA 3LJAA 4AWLC 3RELD 1A7WA 1M19D 3LUSA 4NB8A 1M18B 5E5AC 3C1BC 2RPRA 3REJA 4S1TA 2AROD 5B0ZB 5B33C 1QXFA 2ZY4A 3EPKA 1S32D 5CP6C 2AYDA 3VB9A 4Z5TA 1P3PB 1F1EA 4HGAC 1M1AA 2G2KA 3AZID 3EPHA 2GTIA 2E2II 3CMA1 2BJOA 3CME1 1TWCI 3WAAA 2Y2JA 4NFTA 1Y1WI 3AZFD 5CPKC 4YS3A 1F66B 1P3BC 4H9NA 4LD9A 3NQJB 1AOID 5AV8A 3W98D 1JFIA 4X23A 3H0LC 3VH6W 3KWQB 2RBLA 1TZYD 5B40B 3AN2C 3MVDB 5B1MD 2NAPA 1KX4A 4NFRA 3G711 3H0RC 1NJI2 3LZ1C 5JA4B 3CXCY 3AV2A 4R8PA 2RT9A 1AA6A 3B6FA 1EQZC 4EO5C 4UUZA 3AZGB 5AV9C 3AZNB 5AV5B 3CCS1 3KXBD 1P3GA 3AZJB 3X1VD 3G71Z 1USPB 1M902 3TU4D 3GTGI 5GXQB 5B32G 1KX5B 2LFUA 2Q51A 1P3IA 3F3FC 3NH8A 2ZY5A 2VPXA 3S1QI 3AZHC 2CV5B 3B0DB 3S14I 4A93I 3NDJA 2WB1A 1ID3D 1ZLAD 4ZUXB 4H9RA 1M18A 1P3FD 3MGPA 4KGCB 4KUDB 2Y2GA 3AZKD 1N8R2 5B24C 3W96C 3REIB 5B1LC 2QRDB 4UPKA 1YUKA 4BBRI 1P3PA 2FJ7B 3A6NB 1WCMI 3MGQA 3NQUB 1TWGI 1KD11 3WA9B 3W99A 2JUBA 5C4XI 3J7A4 4J8WB 3IX0A 1VQM1 2JCHA 1I6HI 5B32D 4CSRB 3P5JB 3EERA 2BYKB 3X1UB 3KUYA 5D1PA 5IT9f 2OTJ1 5B40A 1P3OC 2R92I 3O62A 5GT3B 1N2FA 4Z66D 3J80b 1KRLA 3LELD 3FKII 3LJAD 1VQMZ 4J8VA 1SFOI 3PO3I 1WWSA 3MGRB 5DNNB 2V8KA 5B31C 3W97C 1B6WA 5B2IC 3AV1C 3IFUA 3CCE1 3REKA 3HOUI 4Z5TD 4E2WA 1M1AD 5C44I 4AWLB 3TDHB 1HQ3C 3RELA 4BXXI 3WAAD 3CC71 3CXCZ 5BS7C 2HIOC 2Y2LA 5E5AB 5F99C 4YS3D 3C1BB 5B33B 4WU8C 1ML8A 2VF1A 4NBBA 1YJN1 3UT9A 4LD9D 1K9M2 5AV8D 3S2HI 4KGCA 5BNVB 5B0YA 4X23D 5AN9F 1S32A 3REHC 2PYOC 2BYMA 4HGAB 5GT0A 1KX4D 3VH5A 5JRGA 1YUAA 4ZBJC 2DE6A 3AV2D 4R8PD 2FJ7A 4RVDA 3B6FD 3I551 1JWHC 5CPKB 1U35C 1P3AC 2ZAEB 3K7AI 2PMZA 1NP6A 4MONA 3S1MI 2ZY3A 1X0TA 3KIFA 2F8NA 5BT1C 1P3GD 3MGSC 3AN2B 3H3VJ 1TZYA 2E7ZA 2BYKA 4YM6C 3X1UA 3LZ1B 4RVGA 5GXQC 3C1CA 2NZDC 2QRCB 1P3ID 1KX5C 3R45A 1Q7Y1 1N1JA 5AY8A 2V8IA 3VMGA 3WTPE 4EO5B 1EQZB 3S17I 1DL6A 4JJNA 3I55Z 5AV6C 1M18D 4QLCC 3MGPD 1W2BY 2YFWB 5C4JI 1P3LA 3VH5T 2W04A 4A3LI 2VPWA 5T67A 3AZLA 1YJW1 4H9SC 1P3PD 3MGQD 1KU5A 3B6GC 1Q822 3AZHB 3W99D 5BNXA 4NE3A 5FUGB 3AFAC 2GU2A 2Y2MA 2NQBA 3C1BA 3JAMf 1QVGY 3QWUA 1R9TI 5B24B 1WZNA 3W96B 4J8XC 3A1KA 4WU9C 3AZEA 4MD7A 1YJ9Z 5BNVA 3KUYD 2R7ZI 5CP6A 3MZKB 5KDMA 5B40D 5LL6f 3O62D 1S721 3WTPA 1M19C 4A3GI 4HGZA 4TNUA 3MZLB 2F4MA 4J8VD 4E45A 3CCL1 4XUJA 1P3BA 2P28A 2OOXB 2VPZA 3OW2Z 5DNNC 3GTQI 3AN2A 3REKD 3F3PC 5BO0A 3D9XA 1P34B 4A3JI 3S1RI 4XZQA 2F8NG 4NBAA 1RO4A 4A3MI 3CCLZ 5AVBC 1EQZA 5D1OA 1YIT1 2XD5A 5AVCC 5AV9A 5GSUC 5B31B 3UT9D 3X1SC 3W97B 4QTUA 5B2IB 3AV1B 4KGCD 5B0YD 1VQ41 3CC4Z 2YFWA 5GT0D 2QEXZ 1K83I 4WNNA 5JRGD 1HQ3B 2FJ7D 4KHAA 5F99B 2HIOB 4H9OB 4WU8B 3AZHA 4MD8A 3EPLA 3X1VC 2JA6I 3TU4C 3UTBA 4H9PB 2F8ND 3REHB 2PYOB 1VQL1 5B24A 1W2BZ 1W2EA 2V3VA 3X1UD 5B2JA 5B1LA 4J8UA 2QREB 3CMAZ 3C1CD 3CMEZ 4ZBJB 4E44A 5AY8D 3CCJ1 1TAFB 1U35B 5CPJA 2G5IC 1P3AB 1P3MC 1ID3C 1ZLAC 4JJND 2WAQA 2YFVA 5IT9b 1P3KC 3AZMC 1VQLZ 1JJ2Z 3MGSB 3V9RB 2F8NH 5FLXb 4BY7I 2RIQA 4YM6B 1QVGZ 1Y1VS 1P3LD 2NZDB 2DE7A 3GKQA 1P3OA 3WKJC 3CCJZ 1VQN1 4CAYA 3AZLD 1YI21 5CHLB 2G5HC 3AYWC 1KX3C 2YADA 5IP7I 3CCV1 2E2HI 1VQ61 3S15I 3G4S1 5B32C 3HOYI 3MNNC 2E9HA 5AV6B 2NQBD 4QLCB 3C1BD 3RZDI 1KD12 2QKDA 3G6E1 5DNMC 5B0ZA 3AZED 3AV1A 1YI2Z 5CP6D 3I4MI 3CCVZ 3CCU1 3LELC 2OZKA 3LJAC 1VQ6Z 3WTPD 3CC21 3GTPI 3B6GB 1M1K1 3KSYA 4E30A 4H9QB 3REJC 3AFAB 2IV2X 3I561 5BS7A 4H9OA 1KQSZ 1F66A 3TE5B 4XUJD 1P3BD 3VH5W 2EGTA 3UTAC 1ZB8A 4J8XB 4WU9B 3NQJA 2JS4A 4H9PA 1M1AC 1SIWA 3AN2D 4MH4A 3KWQA 2Y2HA 2B63I 2DQNC 3MVDA 1M19B 1P34C 2Y2QA 4XZQD 3ESWA 5FLXf 3FDDA 5JA4A 4YS3C 3I56Z 1VQ51 1RQFA 1U35A 1EQZD 1S7MA 3D2LA 3CCQ1 5AV8C 4G92C 4X23C 4DQYB 1WIIA 5AV9D 4Z2MH 3AZGA 2JIQA 3AZNA 2OTJZ 5AV5A 1KX4C 5CM2M 3V9RA 3AZJA 1K8A2 5CPIC 1Q812 2JNYA 3AV2C 4R8PC 3VH6A 1USPA 5GXQA 2NZDA 2JSSA 5A2Qb 1KX5A 4E2XA 5AVBB 1FDOA 4NBEA 1H3OB 3AZHD 3OW2Y 1Z02A 5AVCB 2CV5A 1P3GC 5GSUB 3X1SB 5B1MB 3NFZA 1K8A1 1Q811 2V8JA 4ZUXA 4KUDA 3UTBD 3NH4A 3CCEZ 2FFFB 5B24D 1P3IC 2JE5A 5B2JD 5B1LD 4J8UD 3REIA 2Y2OA 1QVFY 3RZOI 4H9SA 3CC7Z 3A6NA 5CPJD 3JAMb 1YJNZ 3NQUA 1KC81 1VQK1 3LZ0C 3WA9A 3MGPC 3X1VB 1Q7Y2 4J8WA 4A3KI 1VQ91 3B0CT 3TU4B 4G91C 2J6AA 4CSRA 2DE5A 1LQLA 1P3OD 1RLYA 2PM9A 1RNIA 3W99C 3F6TA 2Y2IA 5GT3A 2F8NK 2J8PA 1TWAI 3CQZI 1P3MB 1ID3B 1ZLAB 1P9NA 3D6WA 1VQ9Z 5A2Qf 4NE5A 3M4OI 4DRAA 3U50C 1P3KB 3AZMB 3S1NI 2PK7A 3KUYC 3MGRA 5DNNA 5B31D 5B0ZD 1Q16A 3O62C 4A3FI 2QR1B 3AV1D 4MD9A 3WKJB 2LIYA 2JA7I 3S2DI 4NBDA 4NBGA 3AYWB 1KX3B 4J8VC 2W03A 4E33A 3CD61 2Y2KA 5B32B 5AVBA 3MNNB 3X1TC 1JJ2Y 2CWEA 2K5RA 1F66D 5E5AA 5AVCA 5DNMB 5GSUA 5B33A 1BH9B 3X1SA 3REKC 5C3IC 4A3BI 3REHD 1YJWZ 3KWQD 3LELB 3LJAB 2DF4C 3MVDD 3RELC 1BFMA 2VUGA 3CD6Z 3J81f 1TWHI 3I4NI 1HTAA 3REJB 2IO5C 3S16I 2AROC 1U35D 3CCM1 5CPKA 4DRBA 2JR6A 3UTAB 3HOXI 1S32C 2RVQD 3AZGD 1WJ2A 3AZND 3FQQA 2JA5I 5AV5D 5BT1D 5GT0C 3MGSD 1M1AB 1QVFZ 5JRGC 3AZIC 3AZJD 1R4VA 2F4OA 2KPIA 4CL1A 4A3II 1S72Z 3GTKI 5GXQD 3LZ1A 2NZDD 1VQO1 4YS3B 1KX5D 3AZFC 2K3RA 2KI7B 4H9NB 1KQSY 1YIJ1 1BH8B 1P3MA 4LD9B 2IZ4A 5AV8B 4DK1A 1AOIC 4G92B 4X23B 1JFIB 2CV5D 3W98C 3BG1B 2NVQI 2Q4ZA 1TZYC 3AZMA 1P3KA 1KX4B 3H0MC 5B1MC 4ZUXD 4NE6A 4KUDD 2NVYI 1VQ71 3GTMI 5CPIB 3AV2B 4R8PB 3CPWY 5AY8C 3REID 1YIJZ 2OOYB 4UUZB 3HOWI 4JJNC 1YITZ 3AYWA 1KX3A 3A6ND 4E2ZA 2UWXA 4MRIA 5T64A 1P3GB 3WA9D 3MNNA 3KXBC 4J8WD 4A3EI 1VQ4Z 5FUGA 1VQ7Z 3PO3S 4MXUA 2F2AC 1WWIA 3B0BA 5DNMA 4NBFA 1P3IB 3AZLC 3W96A 3CCSZ 1Z03A 2NVXI 5GT3D 1K731 4A3DI 4H9RB 3LZ0B 2NQBC 3MGPB 3NH5A 3HOZI 1P3FC 2QLVB 2E2JI 3GTLI 3AZKC 3H0GI 1ULYA 4G91B 3AZEC 4HH4A 3UTAA 3MGRD 5DNND 3VMIA 3WTPC 3MGQB 4Z2MG 3W99B 1NUIA 3AL0C 1P34A 3B0CW 1X3ZA 4XUJC 5AVBD 3I07A 1BH8A 4XX2A 1M1K2 2I3CA 5E5AD 3KUYB 5AVCD 2JIMA 4RVHA 5GSUD 5B33D 3X1SD 3O62B 5B31A 4NH1C 3W97A 1VQNZ 2AKLA 5B2IA 4XZQC 4Z66C 3HOVI 5CPIA 1TFIA 4J8VB 4E32A 3G4SZ 5IP9I 2HU9A 1HQ3A 3X1TB 3BG0B 1Q862 1I50I 3G6EZ 5F99A 2HIOA 4WU8A 1PZRA 5CPKD 3GTJI 1NJI1 1Z01A 3REKB 4E31A 3GTOI 5C3IB 3IF8A 4Z5TC 2HUEC 4NOZA 3EEDA 4HGYA 3CCUZ 3REHA 2PYOA 3CC2Z 3RELB 1Q861 3WAAC 3LZ1D 2P3YA 3CPWZ 1L1OC 2IO5B 1WW9A 2AROB 2M6NA 1TAFA 3UT9B 1P3MD 1P3AA 3LZ0A 4LD9C 4NBCA 5B0YB 3UTBC 1TWFI 1M901 1S32B 2BYMB 2Y2PA 1P3KD 3AZMD 5GT0B 4NBHA 4RS4A 3HKZA 4EWCA 5B2JC 5JRGB 3MGSA 4J8UC 3AZIB 1RO2A 4YM6A 3WKJD 3B6FC 5CPJC 3AZFB 1VQ5Z 3GCFA 2VQRA 4DGLA 3AYWD 1KX3D 1QYPA 3CCQZ 1N8R1 1AOIB 3W98B 2F8NB 3IP4C 3MNND 4QTTA 1TZYB 1Z2CB 1KC82 5AV6A 4QLCA 5DNMD 3C1CB 3R45B 4BBSI 1N1JB 5AY8B 3W96D 2VUMI 1T3UA 3KIHA 3KFUG 4JJNB 3VTNA 5B31G 3IR7A 2XD1A 4NB9A 3B6GA 5C3EI 3M3YI 3X1TA 3KXBB 3REJD 1M18C 4H9QA 2ZM5A 3AFAA 5B0ZC 1P3LB 1VQ81 2JIPA 3UTAD 3GTMS 3AZLB 3J81b 4J8XA 4WU9A 2O4HA 1P3PC 3VH6T 3MGQC 2LEXA 5BNXB 2M48A 1P34D 1VQKZ 4AYBA 4WZSB 1M19A 2NQBB 2LY8A 1P3FB 1F66C 1Y8CA 2AROA 2VPYA 3AZKB 1VQ8Z 4X6AI 4BY1I 3AZEB 1VLAA 5CP6B 1Y1VI 5KDMB 1ZB9A 3KWQC 2GTHA 5B40C 3MVDC 3WTPB 3W97D 5B2ID 3CCR1 3AZIA 5CPID 3FQMA 4RVFA 4RV9A 1VQP1 3AZFA 1K9M1 4XUJB 1HQ3D 1P3BB 2OTL1 3J80f 2RHBA 2RVQC 3AZGC 1AOIA 5F99D 1H3OA 2HIOD 5AV5C 4WV4B 3AZNC 4WU8D 1QF8A 2JIOA
chains in the Genus database with same CATH topology
3AZJC 5BO0B 5B1MA 5G49B 3CCRZ 4XZQB 4Z66B 3VMHA 2PYOD 1VQPZ 3W98A 5D1OB 2OTLZ 2R93I 1PFTA 4WJ3C 2CV5C 5AV9B 3B0DC 3NDIA 1P3AD 3LZ0D 3UT9C 2L5AA 4ZUXC 3KXBA 4KGCC 4KUDC 5B0YC 3X1VA 1X3WA 5FLMI 4Z5TB 2HUEB 3TU4A 1YJ91 4WNNB 3REIC 2R6MA 5T6BA 2W8SA 4KHAB 4YM6D 3A6NC 2FJ7C 3WAAB 1I3QI 1ZH1A 3WA9C 2HF1A 2O53A 2Y2NA 3CCMZ 4J8WC 3EG5B 2QA41 1ID3A 1ZLAA 3PO2I 3UTBB 1P3FA 4A3CI 3EPJA 3AZKA 2H85A 5AV6D 4QLCD 5B1LB 5B2JB 3X1UC 4J8UB 1Q9CA 1Q821 2NVTI 3A1IA 3C1CC 1VQOZ 5GT3C 1RO0A 3B6FB 5CPJB 1YHQ1 3WKJA 4Y7NI 2QA4Z 2YFVB 3Q87A 2Y0SA 2JMOA 3B6GD 3X1TD 2YU9I 2ZY2A 4M6BA 5B32A 1K732 3AFAD 3MGRC 2IZ3A 4E2YA 1P3LC 1P3OB 3MONA 3T4NB 4CAYB 1BH9A 1YHQZ 4J8XD 5G49A 4WU9D 3CC41 4Z66A 2JA8I 1B67A 2QEX1 4Y52I 2BG1A 3LELA 3LJAA 4AWLC 3RELD 1A7WA 1M19D 3LUSA 4NB8A 1M18B 5E5AC 3C1BC 2RPRA 3REJA 4S1TA 2AROD 5B0ZB 5B33C 2ZY4A 3EPKA 1S32D 5CP6C 3VB9A 4Z5TA 1P3PB 1F1EA 4HGAC 1M1AA 2G2KA 3AZID 3EPHA 2GTIA 2E2II 3CMA1 2BJOA 3CME1 1TWCI 3WAAA 2Y2JA 4NFTA 1Y1WI 3AZFD 5CPKC 4YS3A 1F66B 1P3BC 4H9NA 4LD9A 3NQJB 1AOID 5AV8A 3W98D 1JFIA 4X23A 3H0LC 3VH6W 3KWQB 2RBLA 1TZYD 5B40B 3AN2C 3MVDB 5B1MD 4NFRA 1KX4A 5IP9I 3G711 3H0RC 1NJI2 3LZ1C 5JA4B 3CXCY 3AV2A 4R8PA 2RT9A 3B6FA 1EQZC 4EO5C 4UUZA 3AZGB 5AV9C 3AZNB 5AV5B 3CCS1 3KXBD 1P3GA 3AZJB 3X1VD 3G71Z 1USPB 1M902 3TU4D 3GTGI 5GXQB 5B32G 1KX5B 2LFUA 2Q51A 1P3IA 3F3FC 3NH8A 2ZY5A 3S1QI 3AZHC 2CV5B 3B0DB 3S14I 4A93I 3NDJA 2WB1A 1ID3D 1ZLAD 4ZUXB 4H9RA 1M18A 1P3FD 3MGPA 4KGCB 4KUDB 2Y2GA 3AZKD 1N8R2 5B24C 3W96C 3REIB 5B1LC 2QRDB 4UPKA 1YUKA 4BBRI 1P3PA 2FJ7B 3A6NB 1WCMI 3MGQA 3NQUB 1TWGI 1KD11 3WA9B 3W99A 2JUBA 5C4XI 3J7A4 4J8WB 3IX0A 1VQM1 2JCHA 1I6HI 5B32D 4CSRB 3P5JB 3EERA 2BYKB 3X1UB 3KUYA 5D1PA 5IT9f 2OTJ1 5B40A 1P3OC 2R92I 3O62A 5GT3B 1N2FA 4Z66D 3J80b 1KRLA 3LELD 3FKII 3LJAD 1VQMZ 4J8VA 1SFOI 3PO3I 1WWSA 3MGRB 5DNNB 2V8KA 5B31C 3W97C 1B6WA 5B2IC 3AV1C 3IFUA 3CCE1 3REKA 3HOUI 4Z5TD 4E2WA 1M1AD 5C44I 4AWLB 3TDHB 1HQ3C 3RELA 4BXXI 3WAAD 3CC71 3CXCZ 5BS7C 2HIOC 2Y2LA 5E5AB 5F99C 4YS3D 3C1BB 5B33B 4WU8C 1ML8A 2VF1A 4NBBA 1YJN1 3UT9A 4LD9D 1K9M2 5AV8D 3S2HI 4KGCA 5BNVB 5B0YA 4X23D 5AN9F 1S32A 3REHC 2PYOC 2BYMA 4HGAB 5GT0A 1KX4D 3VH5A 5JRGA 1YUAA 4ZBJC 2DE6A 3AV2D 4R8PD 2FJ7A 4RVDA 3B6FD 3I551 1JWHC 5CPKB 1U35C 1P3AC 2ZAEB 3K7AI 2PMZA 1NP6A 4MONA 3S1MI 2ZY3A 1X0TA 3KIFA 2F8NA 5BT1C 1P3GD 3MGSC 3AN2B 3H3VJ 1TZYA 2BYKA 4YM6C 3X1UA 3LZ1B 4RVGA 5GXQC 3C1CA 2NZDC 2QRCB 1P3ID 1KX5C 3R45A 1Q7Y1 1N1JA 5AY8A 2V8IA 3VMGA 3WTPE 4EO5B 1EQZB 3S17I 1DL6A 4JJNA 3I55Z 5AV6C 1M18D 4QLCC 3MGPD 1W2BY 2YFWB 5C4JI 1P3LA 3VH5T 2W04A 4A3LI 5T67A 3AZLA 1YJW1 4H9SC 1P3PD 3MGQD 1KU5A 3B6GC 1Q822 3AZHB 3W99D 5BNXA 4NE3A 5FUGB 3AFAC 2GU2A 2Y2MA 2NQBA 3C1BA 3JAMf 1QVGY 3QWUA 1R9TI 5B24B 4MD7A 3W96B 4J8XC 3A1KA 4WU9C 3AZEA 1YJ9Z 2R7ZI 5BNVA 3KUYD 5CP6A 3MZKB 5KDMA 5B40D 5LL6f 3O62D 1S721 3WTPA 1M19C 4A3GI 4HGZA 4TNUA 3MZLB 2F4MA 4J8VD 4E45A 3CCL1 4XUJA 1P3BA 2P28A 2OOXB 3OW2Z 5DNNC 3GTQI 3AN2A 3REKD 3F3PC 5BO0A 3D9XA 1P34B 4A3JI 3S1RI 4XZQA 2F8NG 4NBAA 1RO4A 4A3MI 3CCLZ 5AVBC 1EQZA 5D1OA 1YIT1 2XD5A 5AVCC 5AV9A 5GSUC 5B31B 3UT9D 3X1SC 3W97B 4QTUA 5B2IB 3AV1B 4KGCD 5B0YD 1VQ41 3CC4Z 2YFWA 5GT0D 2QEXZ 1K83I 4WNNA 5JRGD 1HQ3B 2FJ7D 4KHAA 5F99B 2HIOB 4H9OB 4WU8B 3AZHA 4MD8A 3EPLA 3X1VC 2JA6I 3TU4C 3UTBA 4H9PB 2F8ND 3REHB 2PYOB 1VQL1 5B24A 1W2BZ 1W2EA 3X1UD 5B2JA 5B1LA 4J8UA 2QREB 3CMAZ 3C1CD 3CMEZ 4ZBJB 4E44A 5AY8D 3CCJ1 1TAFB 1U35B 5CPJA 2G5IC 1P3AB 1P3MC 1ID3C 1ZLAC 4JJND 2WAQA 2YFVA 5IT9b 1P3KC 3AZMC 1VQLZ 1JJ2Z 3MGSB 3V9RB 2F8NH 5FLXb 4BY7I 2RIQA 4YM6B 1QVGZ 1Y1VS 1P3LD 2NZDB 2DE7A 3GKQA 1P3OA 3WKJC 3CCJZ 1VQN1 4CAYA 3AZLD 1YI21 5CHLB 2G5HC 3AYWC 1KX3C 2YADA 5IP7I 3CCV1 2E2HI 1VQ61 3S15I 3G4S1 5B32C 3HOYI 3MNNC 2E9HA 5AV6B 2NQBD 4QLCB 3C1BD 3RZDI 1KD12 2QKDA 3G6E1 5DNMC 5B0ZA 3AZED 3AV1A 1YI2Z 5CP6D 3I4MI 3CCVZ 3CCU1 3LELC 2OZKA 3LJAC 1VQ6Z 3WTPD 3CC21 3GTPI 3B6GB 1M1K1 3KSYA 4E30A 4H9QB 3REJC 3AFAB 3I561 5BS7A 4H9OA 1KQSZ 1F66A 3TE5B 4XUJD 1P3BD 3VH5W 2EGTA 3UTAC 1ZB8A 4J8XB 4WU9B 3NQJA 2JS4A 4H9PA 1M1AC 2B63I 3AN2D 4MH4A 3KWQA 2Y2HA 2DQNC 3MVDA 1M19B 1P34C 2Y2QA 4XZQD 3ESWA 5FLXf 3FDDA 5JA4A 4YS3C 3I56Z 1VQ51 1RQFA 1U35A 1EQZD 1S7MA 3CCQ1 5AV8C 4G92C 4X23C 4DQYB 1WIIA 5AV9D 4Z2MH 3AZGA 3AZNA 2OTJZ 5AV5A 1KX4C 5CM2M 3V9RA 3AZJA 1K8A2 5CPIC 1Q812 2JNYA 3AV2C 4R8PC 3VH6A 1USPA 5GXQA 2NZDA 2JSSA 5A2Qb 1KX5A 4E2XA 5AVBB 4NBEA 1H3OB 3AZHD 3OW2Y 1Z02A 5AVCB 2CV5A 1P3GC 5GSUB 3X1SB 5B1MB 3NFZA 1K8A1 1Q811 2V8JA 4ZUXA 4KUDA 3UTBD 3NH4A 3CCEZ 2FFFB 5B24D 1P3IC 2JE5A 5B2JD 5B1LD 4J8UD 3REIA 2Y2OA 1QVFY 3RZOI 4H9SA 3CC7Z 3A6NA 5CPJD 3JAMb 1YJNZ 3NQUA 1KC81 1VQK1 3LZ0C 3WA9A 3MGPC 3X1VB 1Q7Y2 4J8WA 4A3KI 1VQ91 3B0CT 3TU4B 4G91C 2J6AA 4CSRA 2DE5A 1LQLA 1P3OD 1RLYA 2PM9A 1RNIA 3W99C 3F6TA 2Y2IA 5GT3A 2F8NK 2J8PA 1TWAI 3CQZI 1P3MB 1ID3B 1ZLAB 1P9NA 3D6WA 1VQ9Z 5A2Qf 4NE5A 3M4OI 4DRAA 3U50C 1P3KB 3AZMB 3S1NI 2PK7A 3KUYC 3MGRA 5DNNA 5B31D 5B0ZD 4A3FI 3O62C 2QR1B 3AV1D 4MD9A 3WKJB 2LIYA 2JA7I 3S2DI 4NBDA 4NBGA 3AYWB 1KX3B 4J8VC 2W03A 4E33A 3CD61 2Y2KA 5B32B 5AVBA 3MNNB 3X1TC 1JJ2Y 2CWEA 2K5RA 1F66D 5E5AA 5AVCA 5DNMB 5GSUA 5B33A 1BH9B 3X1SA 3REKC 5C3IC 4A3BI 3REHD 1YJWZ 3KWQD 3LELB 3LJAB 2DF4C 3MVDD 3RELC 1BFMA 2VUGA 3CD6Z 3J81f 1TWHI 3I4NI 1HTAA 3REJB 2IO5C 3S16I 2AROC 1U35D 3CCM1 5CPKA 4DRBA 2JR6A 3UTAB 3HOXI 1S32C 2RVQD 3AZGD 2JA5I 3AZND 3FQQA 1QVFZ 5AV5D 5BT1D 5GT0C 3MGSD 1M1AB 5JRGC 3AZIC 3AZJD 1R4VA 2F4OA 2KPIA 4CL1A 4A3II 1S72Z 3GTKI 5GXQD 3LZ1A 2NZDD 1VQO1 4YS3B 1KX5D 3AZFC 2K3RA 2KI7B 4H9NB 1KQSY 1YIJ1 1BH8B 1P3MA 4LD9B 2IZ4A 5AV8B 4DK1A 1AOIC 4G92B 4X23B 1JFIB 2CV5D 3W98C 3BG1B 2NVQI 2Q4ZA 1TZYC 3AZMA 1P3KA 1KX4B 3H0MC 5B1MC 4ZUXD 4NE6A 4KUDD 2NVYI 1VQ71 3GTMI 5CPIB 3AV2B 4R8PB 3CPWY 5AY8C 3REID 1YIJZ 2OOYB 4UUZB 3HOWI 4JJNC 1YITZ 3AYWA 1KX3A 3A6ND 4E2ZA 2UWXA 4MRIA 5T64A 1P3GB 3WA9D 3MNNA 3KXBC 4J8WD 4A3EI 1VQ4Z 5FUGA 1VQ7Z 3PO3S 4MXUA 2F2AC 1WWIA 3B0BA 5DNMA 4NBFA 1P3IB 3AZLC 3W96A 3CCSZ 1Z03A 2NVXI 5GT3D 1K731 4A3DI 4H9RB 3LZ0B 2NQBC 3MGPB 3NH5A 3HOZI 1P3FC 2QLVB 2E2JI 3GTLI 3AZKC 3H0GI 1ULYA 4G91B 3AZEC 4HH4A 3UTAA 3MGRD 5DNND 3VMIA 3WTPC 3MGQB 4Z2MG 3W99B 1NUIA 3AL0C 1P34A 3B0CW 1X3ZA 4XUJC 5AVBD 3I07A 1BH8A 4XX2A 1M1K2 2I3CA 5E5AD 3KUYB 5AVCD 4RVHA 5GSUD 5B33D 3X1SD 3O62B 5B31A 4NH1C 3W97A 1VQNZ 2AKLA 5B2IA 4XZQC 4Z66C 3HOVI 5CPIA 1TFIA 4J8VB 4E32A 3G4SZ 2HU9A 1HQ3A 3X1TB 3BG0B 1Q862 1I50I 3G6EZ 5F99A 2HIOA 4WU8A 1PZRA 5CPKD 3GTJI 1NJI1 1Z01A 3REKB 4E31A 3GTOI 5C3IB 3IF8A 4Z5TC 2HUEC 4NOZA 3EEDA 4HGYA 3CCUZ 3REHA 2PYOA 3CC2Z 3RELB 1Q861 3WAAC 3LZ1D 2P3YA 3CPWZ 1L1OC 2IO5B 1WW9A 2AROB 2M6NA 1TAFA 3UT9B 1P3MD 1P3AA 3LZ0A 4LD9C 4NBCA 5B0YB 3UTBC 1TWFI 1M901 1S32B 2BYMB 2Y2PA 1P3KD 3AZMD 5GT0B 4NBHA 4RS4A 3HKZA 4EWCA 5B2JC 5JRGB 3MGSA 4J8UC 3AZIB 1RO2A 4YM6A 3WKJD 3B6FC 5CPJC 3AZFB 1VQ5Z 3GCFA 2VQRA 4DGLA 3AYWD 1KX3D 1QYPA 3CCQZ 1N8R1 1AOIB 3W98B 2F8NB 3IP4C 3MNND 4QTTA 1TZYB 1Z2CB 1KC82 5AV6A 4QLCA 5DNMD 3C1CB 3R45B 4BBSI 1N1JB 5AY8B 3W96D 2VUMI 1T3UA 3KIHA 3KFUG 4JJNB 3VTNA 5B31G 4NB9A 2XD1A 3B6GA 5C3EI 3M3YI 3X1TA 3KXBB 3REJD 1M18C 4H9QA 2ZM5A 3AFAA 5B0ZC 1P3LB 1VQ81 3UTAD 3GTMS 3AZLB 3J81b 4J8XA 4WU9A 2O4HA 1P3PC 3VH6T 3MGQC 5BNXB 2M48A 1P34D 1VQKZ 4AYBA 4WZSB 1M19A 2NQBB 2LY8A 1P3FB 1F66C 2AROA 1VQ8Z 3AZKB 4X6AI 4BY1I 3AZEB 1VLAA 5CP6B 1Y1VI 5KDMB 1ZB9A 3KWQC 2GTHA 5B40C 3MVDC 3WTPB 3W97D 5B2ID 3CCR1 3AZIA 5CPID 3FQMA 4RVFA 4RV9A 1VQP1 3AZFA 1K9M1 4XUJB 1HQ3D 1P3BB 2OTL1 3J80f 2RHBA 2RVQC 3AZGC 1AOIA 5F99D 1H3OA 2HIOD 5AV5C 4WV4B 3AZNC 4WU8D 1QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 3AZJ C;  5BO0 B;  5B1M A;  5G49 B;  3CCR Z;  4XZQ B;  4Z66 B;  3VMH A;  2PYO D;  1VQP Z;  3W98 A;  5D1O B;  2OTL Z;  2R93 I;  1PFT A;  4WJ3 C;  2CV5 C;  5AV9 B;  3B0D C;  2V45 A;  3NDI A;  1P3A D;  3LZ0 D;  3UT9 C;  2L5A A;  4ZUX C;  3KXB A;  4KGC C;  4KUD C;  5B0Y C;  3X1V A;  1FDI A;  1X3W A;  5FLM I;  4Z5T B;  2HUE B;  3TU4 A;  1YJ9 1;  4WNN B;  3REI C;  2R6M A;  5T6B A;  2W8S A;  4KHA B;  4YM6 D;  3A6N C;  2FJ7 C;  3WAA B;  1I3Q I;  1ZH1 A;  3WA9 C;  2HF1 A;  2O53 A;  2Y2N A;  3CCM Z;  4J8W C;  3EG5 B;  2QA4 1;  1ID3 A;  1ZLA A;  3PO2 I;  3UTB B;  1P3F A;  4A3C I;  3EPJ A;  3AZK A;  2H85 A;  5AV6 D;  4QLC D;  5B1L B;  5B2J B;  3X1U C;  4J8U B;  1Q9C A;  1Q82 1;  2NVT I;  3A1I A;  3C1C C;  1VQO Z;  5GT3 C;  1RO0 A;  3B6F B;  5CPJ B;  1YHQ 1;  3WKJ A;  4Y7N I;  2QA4 Z;  2YFV B;  3Q87 A;  2Y0S A;  2JMO A;  2JIR A;  3B6G D;  3X1T D;  2YU9 I;  2ZY2 A;  4M6B A;  5B32 A;  1K73 2;  3AFA D;  3MGR C;  2IZ3 A;  4E2Y A;  1P3L C;  1P3O B;  3MON A;  3T4N B;  4CAY B;  1BH9 A;  1YHQ Z;  4J8X D;  5G49 A;  4WU9 D;  3CC4 1;  4Z66 A;  2JA8 I;  1B67 A;  2QEX 1;  4Y52 I;  2BG1 A;  3LEL A;  3LJA A;  4AWL C;  3REL D;  1A7W A;  1M19 D;  3LUS A;  4NB8 A;  1M18 B;  5E5A C;  3C1B C;  2RPR A;  3REJ A;  4S1T A;  2ARO D;  5B0Z B;  5B33 C;  1QXF A;  2ZY4 A;  3EPK A;  1S32 D;  5CP6 C;  2AYD A;  3VB9 A;  4Z5T A;  1P3P B;  1F1E A;  4HGA C;  1M1A A;  2G2K A;  3AZI D;  3EPH A;  2GTI A;  2E2I I;  3CMA 1;  2BJO A;  3CME 1;  1TWC I;  3WAA A;  2Y2J A;  4NFT A;  1Y1W I;  3AZF D;  5CPK C;  4YS3 A;  1F66 B;  1P3B C;  4H9N A;  4LD9 A;  3NQJ B;  1AOI D;  5AV8 A;  3W98 D;  1JFI A;  4X23 A;  3H0L C;  3VH6 W;  3KWQ B;  2RBL A;  1TZY D;  5B40 B;  3AN2 C;  3MVD B;  5B1M D;  2NAP A;  1KX4 A;  4NFR A;  3G71 1;  3H0R C;  1NJI 2;  3LZ1 C;  5JA4 B;  3CXC Y;  3AV2 A;  4R8P A;  2RT9 A;  1AA6 A;  3B6F A;  1EQZ C;  4EO5 C;  4UUZ A;  3AZG B;  5AV9 C;  3AZN B;  5AV5 B;  3CCS 1;  3KXB D;  1P3G A;  3AZJ B;  3X1V D;  3G71 Z;  1USP B;  1M90 2;  3TU4 D;  3GTG I;  5GXQ B;  5B32 G;  1KX5 B;  2LFU A;  2Q51 A;  1P3I A;  3F3F C;  3NH8 A;  2ZY5 A;  2VPX A;  3S1Q I;  3AZH C;  2CV5 B;  3B0D B;  3S14 I;  4A93 I;  3NDJ A;  2WB1 A;  1ID3 D;  1ZLA D;  4ZUX B;  4H9R A;  1M18 A;  1P3F D;  3MGP A;  4KGC B;  4KUD B;  2Y2G A;  3AZK D;  1N8R 2;  5B24 C;  3W96 C;  3REI B;  5B1L C;  2QRD B;  4UPK A;  1YUK A;  4BBR I;  1P3P A;  2FJ7 B;  3A6N B;  1WCM I;  3MGQ A;  3NQU B;  1TWG I;  1KD1 1;  3WA9 B;  3W99 A;  2JUB A;  5C4X I;  3J7A 4;  4J8W B;  3IX0 A;  1VQM 1;  2JCH A;  1I6H I;  5B32 D;  4CSR B;  3P5J B;  3EER A;  2BYK B;  3X1U B;  3KUY A;  5D1P A;  5IT9 f;  2OTJ 1;  5B40 A;  1P3O C;  2R92 I;  3O62 A;  5GT3 B;  1N2F A;  4Z66 D;  3J80 b;  1KRL A;  3LEL D;  3FKI I;  3LJA D;  1VQM Z;  4J8V A;  1SFO I;  3PO3 I;  1WWS A;  3MGR B;  5DNN B;  2V8K A;  5B31 C;  3W97 C;  1B6W A;  5B2I C;  3AV1 C;  3IFU A;  3CCE 1;  3REK A;  3HOU I;  4Z5T D;  4E2W A;  1M1A D;  5C44 I;  4AWL B;  3TDH B;  1HQ3 C;  3REL A;  4BXX I;  3WAA D;  3CC7 1;  3CXC Z;  5BS7 C;  2HIO C;  2Y2L A;  5E5A B;  5F99 C;  4YS3 D;  3C1B B;  5B33 B;  4WU8 C;  1ML8 A;  2VF1 A;  4NBB A;  1YJN 1;  3UT9 A;  4LD9 D;  1K9M 2;  5AV8 D;  3S2H I;  4KGC A;  5BNV B;  5B0Y A;  4X23 D;  5AN9 F;  1S32 A;  3REH C;  2PYO C;  2BYM A;  4HGA B;  5GT0 A;  1KX4 D;  3VH5 A;  5JRG A;  1YUA A;  4ZBJ C;  2DE6 A;  3AV2 D;  4R8P D;  2FJ7 A;  4RVD A;  3B6F D;  3I55 1;  1JWH C;  5CPK B;  1U35 C;  1P3A C;  2ZAE B;  3K7A I;  2PMZ A;  1NP6 A;  4MON A;  3S1M I;  2ZY3 A;  1X0T A;  3KIF A;  2F8N A;  5BT1 C;  1P3G D;  3MGS C;  3AN2 B;  3H3V J;  1TZY A;  2E7Z A;  2BYK A;  4YM6 C;  3X1U A;  3LZ1 B;  4RVG A;  5GXQ C;  3C1C A;  2NZD C;  2QRC B;  1P3I D;  1KX5 C;  3R45 A;  1Q7Y 1;  1N1J A;  5AY8 A;  2V8I A;  3VMG A;  3WTP E;  4EO5 B;  1EQZ B;  3S17 I;  1DL6 A;  4JJN A;  3I55 Z;  5AV6 C;  1M18 D;  4QLC C;  3MGP D;  1W2B Y;  2YFW B;  5C4J I;  1P3L A;  3VH5 T;  2W04 A;  4A3L I;  2VPW A;  5T67 A;  3AZL A;  1YJW 1;  4H9S C;  1P3P D;  3MGQ D;  1KU5 A;  3B6G C;  1Q82 2;  3AZH B;  3W99 D;  5BNX A;  4NE3 A;  5FUG B;  3AFA C;  2GU2 A;  2Y2M A;  2NQB A;  3C1B A;  3JAM f;  1QVG Y;  3QWU A;  1R9T I;  5B24 B;  1WZN A;  3W96 B;  4J8X C;  3A1K A;  4WU9 C;  3AZE A;  4MD7 A;  1YJ9 Z;  5BNV A;  3KUY D;  2R7Z I;  5CP6 A;  3MZK B;  5KDM A;  5B40 D;  5LL6 f;  3O62 D;  1S72 1;  3WTP A;  1M19 C;  4A3G I;  4HGZ A;  4TNU A;  3MZL B;  2F4M A;  4J8V D;  4E45 A;  3CCL 1;  4XUJ A;  1P3B A;  2P28 A;  2OOX B;  2VPZ A;  3OW2 Z;  5DNN C;  3GTQ I;  3AN2 A;  3REK D;  3F3P C;  5BO0 A;  3D9X A;  1P34 B;  4A3J I;  3S1R I;  4XZQ A;  2F8N G;  4NBA A;  1RO4 A;  4A3M I;  3CCL Z;  5AVB C;  1EQZ A;  5D1O A;  1YIT 1;  2XD5 A;  5AVC C;  5AV9 A;  5GSU C;  5B31 B;  3UT9 D;  3X1S C;  3W97 B;  4QTU A;  5B2I B;  3AV1 B;  4KGC D;  5B0Y D;  1VQ4 1;  3CC4 Z;  2YFW A;  5GT0 D;  2QEX Z;  1K83 I;  4WNN A;  5JRG D;  1HQ3 B;  2FJ7 D;  4KHA A;  5F99 B;  2HIO B;  4H9O B;  4WU8 B;  3AZH A;  4MD8 A;  3EPL A;  3X1V C;  2JA6 I;  3TU4 C;  3UTB A;  4H9P B;  2F8N D;  3REH B;  2PYO B;  1VQL 1;  5B24 A;  1W2B Z;  1W2E A;  2V3V A;  3X1U D;  5B2J A;  5B1L A;  4J8U A;  2QRE B;  3CMA Z;  3C1C D;  3CME Z;  4ZBJ B;  4E44 A;  5AY8 D;  3CCJ 1;  1TAF B;  1U35 B;  5CPJ A;  2G5I C;  1P3A B;  1P3M C;  1ID3 C;  1ZLA C;  4JJN D;  2WAQ A;  2YFV A;  5IT9 b;  1P3K C;  3AZM C;  1VQL Z;  1JJ2 Z;  3MGS B;  3V9R B;  2F8N H;  5FLX b;  4BY7 I;  2RIQ A;  4YM6 B;  1QVG Z;  1Y1V S;  1P3L D;  2NZD B;  2DE7 A;  3GKQ A;  1P3O A;  3WKJ C;  3CCJ Z;  1VQN 1;  4CAY A;  3AZL D;  1YI2 1;  5CHL B;  2G5H C;  3AYW C;  1KX3 C;  2YAD A;  5IP7 I;  3CCV 1;  2E2H I;  1VQ6 1;  3S15 I;  3G4S 1;  5B32 C;  3HOY I;  3MNN C;  2E9H A;  5AV6 B;  2NQB D;  4QLC B;  3C1B D;  3RZD I;  1KD1 2;  2QKD A;  3G6E 1;  5DNM C;  5B0Z A;  3AZE D;  3AV1 A;  1YI2 Z;  5CP6 D;  3I4M I;  3CCV Z;  3CCU 1;  3LEL C;  2OZK A;  3LJA C;  1VQ6 Z;  3WTP D;  3CC2 1;  3GTP I;  3B6G B;  1M1K 1;  3KSY A;  4E30 A;  4H9Q B;  3REJ C;  3AFA B;  2IV2 X;  3I56 1;  5BS7 A;  4H9O A;  1KQS Z;  1F66 A;  3TE5 B;  4XUJ D;  1P3B D;  3VH5 W;  2EGT A;  3UTA C;  1ZB8 A;  4J8X B;  4WU9 B;  3NQJ A;  2JS4 A;  4H9P A;  1M1A C;  1SIW A;  3AN2 D;  4MH4 A;  3KWQ A;  2Y2H A;  2B63 I;  2DQN C;  3MVD A;  1M19 B;  1P34 C;  2Y2Q A;  4XZQ D;  3ESW A;  5FLX f;  3FDD A;  5JA4 A;  4YS3 C;  3I56 Z;  1VQ5 1;  1RQF A;  1U35 A;  1EQZ D;  1S7M A;  3D2L A;  3CCQ 1;  5AV8 C;  4G92 C;  4X23 C;  4DQY B;  1WII A;  5AV9 D;  4Z2M H;  3AZG A;  2JIQ A;  3AZN A;  2OTJ Z;  5AV5 A;  1KX4 C;  5CM2 M;  3V9R A;  3AZJ A;  1K8A 2;  5CPI C;  1Q81 2;  2JNY A;  3AV2 C;  4R8P C;  3VH6 A;  1USP A;  5GXQ A;  2NZD A;  2JSS A;  5A2Q b;  1KX5 A;  4E2X A;  5AVB B;  1FDO A;  4NBE A;  1H3O B;  3AZH D;  3OW2 Y;  1Z02 A;  5AVC B;  2CV5 A;  1P3G C;  5GSU B;  3X1S B;  5B1M B;  3NFZ A;  1K8A 1;  1Q81 1;  2V8J A;  4ZUX A;  4KUD A;  3UTB D;  3NH4 A;  3CCE Z;  2FFF B;  5B24 D;  1P3I C;  2JE5 A;  5B2J D;  5B1L D;  4J8U D;  3REI A;  2Y2O A;  1QVF Y;  3RZO I;  4H9S A;  3CC7 Z;  3A6N A;  5CPJ D;  3JAM b;  1YJN Z;  3NQU A;  1KC8 1;  1VQK 1;  3LZ0 C;  3WA9 A;  3MGP C;  3X1V B;  1Q7Y 2;  4J8W A;  4A3K I;  1VQ9 1;  3B0C T;  3TU4 B;  4G91 C;  2J6A A;  4CSR A;  2DE5 A;  1LQL A;  1P3O D;  1RLY A;  2PM9 A;  1RNI A;  3W99 C;  3F6T A;  2Y2I A;  5GT3 A;  2F8N K;  2J8P A;  1TWA I;  3CQZ I;  1P3M B;  1ID3 B;  1ZLA B;  1P9N A;  3D6W A;  1VQ9 Z;  5A2Q f;  4NE5 A;  3M4O I;  4DRA A;  3U50 C;  1P3K B;  3AZM B;  3S1N I;  2PK7 A;  3KUY C;  3MGR A;  5DNN A;  5B31 D;  5B0Z D;  1Q16 A;  3O62 C;  4A3F I;  2QR1 B;  3AV1 D;  4MD9 A;  3WKJ B;  2LIY A;  2JA7 I;  3S2D I;  4NBD A;  4NBG A;  3AYW B;  1KX3 B;  4J8V C;  2W03 A;  4E33 A;  3CD6 1;  2Y2K A;  5B32 B;  5AVB A;  3MNN B;  3X1T C;  1JJ2 Y;  2CWE A;  2K5R A;  1F66 D;  5E5A A;  5AVC A;  5DNM B;  5GSU A;  5B33 A;  1BH9 B;  3X1S A;  3REK C;  5C3I C;  4A3B I;  3REH D;  1YJW Z;  3KWQ D;  3LEL B;  3LJA B;  2DF4 C;  3MVD D;  3REL C;  1BFM A;  2VUG A;  3CD6 Z;  3J81 f;  1TWH I;  3I4N I;  1HTA A;  3REJ B;  2IO5 C;  3S16 I;  2ARO C;  1U35 D;  3CCM 1;  5CPK A;  4DRB A;  2JR6 A;  3UTA B;  3HOX I;  1S32 C;  2RVQ D;  3AZG D;  1WJ2 A;  3AZN D;  3FQQ A;  2JA5 I;  5AV5 D;  5BT1 D;  5GT0 C;  3MGS D;  1M1A B;  1QVF Z;  5JRG C;  3AZI C;  3AZJ D;  1R4V A;  2F4O A;  2KPI A;  4CL1 A;  4A3I I;  1S72 Z;  3GTK I;  5GXQ D;  3LZ1 A;  2NZD D;  1VQO 1;  4YS3 B;  1KX5 D;  3AZF C;  2K3R A;  2KI7 B;  4H9N B;  1KQS Y;  1YIJ 1;  1BH8 B;  1P3M A;  4LD9 B;  2IZ4 A;  5AV8 B;  4DK1 A;  1AOI C;  4G92 B;  4X23 B;  1JFI B;  2CV5 D;  3W98 C;  3BG1 B;  2NVQ I;  2Q4Z A;  1TZY C;  3AZM A;  1P3K A;  1KX4 B;  3H0M C;  5B1M C;  4ZUX D;  4NE6 A;  4KUD D;  2NVY I;  1VQ7 1;  3GTM I;  5CPI B;  3AV2 B;  4R8P B;  3CPW Y;  5AY8 C;  3REI D;  1YIJ Z;  2OOY B;  4UUZ B;  3HOW I;  4JJN C;  1YIT Z;  3AYW A;  1KX3 A;  3A6N D;  4E2Z A;  2UWX A;  4MRI A;  5T64 A;  1P3G B;  3WA9 D;  3MNN A;  3KXB C;  4J8W D;  4A3E I;  1VQ4 Z;  5FUG A;  1VQ7 Z;  3PO3 S;  4MXU A;  2F2A C;  1WWI A;  3B0B A;  5DNM A;  4NBF A;  1P3I B;  3AZL C;  3W96 A;  3CCS Z;  1Z03 A;  2NVX I;  5GT3 D;  1K73 1;  4A3D I;  4H9R B;  3LZ0 B;  2NQB C;  3MGP B;  3NH5 A;  3HOZ I;  1P3F C;  2QLV B;  2E2J I;  3GTL I;  3AZK C;  3H0G I;  1ULY A;  4G91 B;  3AZE C;  4HH4 A;  3UTA A;  3MGR D;  5DNN D;  3VMI A;  3WTP C;  3MGQ B;  4Z2M G;  3W99 B;  1NUI A;  3AL0 C;  1P34 A;  3B0C W;  1X3Z A;  4XUJ C;  5AVB D;  3I07 A;  1BH8 A;  4XX2 A;  1M1K 2;  2I3C A;  5E5A D;  3KUY B;  5AVC D;  2JIM A;  4RVH A;  5GSU D;  5B33 D;  3X1S D;  3O62 B;  5B31 A;  4NH1 C;  3W97 A;  1VQN Z;  2AKL A;  5B2I A;  4XZQ C;  4Z66 C;  3HOV I;  5CPI A;  1TFI A;  4J8V B;  4E32 A;  3G4S Z;  5IP9 I;  2HU9 A;  1HQ3 A;  3X1T B;  3BG0 B;  1Q86 2;  1I50 I;  3G6E Z;  5F99 A;  2HIO A;  4WU8 A;  1PZR A;  5CPK D;  3GTJ I;  1NJI 1;  1Z01 A;  3REK B;  4E31 A;  3GTO I;  5C3I B;  3IF8 A;  4Z5T C;  2HUE C;  4NOZ A;  3EED A;  4HGY A;  3CCU Z;  3REH A;  2PYO A;  3CC2 Z;  3REL B;  1Q86 1;  3WAA C;  3LZ1 D;  2P3Y A;  3CPW Z;  1L1O C;  2IO5 B;  1WW9 A;  2ARO B;  2M6N A;  1TAF A;  3UT9 B;  1P3M D;  1P3A A;  3LZ0 A;  4LD9 C;  4NBC A;  5B0Y B;  3UTB C;  1TWF I;  1M90 1;  1S32 B;  2BYM B;  2Y2P A;  1P3K D;  3AZM D;  5GT0 B;  4NBH A;  4RS4 A;  3HKZ A;  4EWC A;  5B2J C;  5JRG B;  3MGS A;  4J8U C;  3AZI B;  1RO2 A;  4YM6 A;  3WKJ D;  3B6F C;  5CPJ C;  3AZF B;  1VQ5 Z;  3GCF A;  2VQR A;  4DGL A;  3AYW D;  1KX3 D;  1QYP A;  3CCQ Z;  1N8R 1;  1AOI B;  3W98 B;  2F8N B;  3IP4 C;  3MNN D;  4QTT A;  1TZY B;  1Z2C B;  1KC8 2;  5AV6 A;  4QLC A;  5DNM D;  3C1C B;  3R45 B;  4BBS I;  1N1J B;  5AY8 B;  3W96 D;  2VUM I;  1T3U A;  3KIH A;  3KFU G;  4JJN B;  3VTN A;  5B31 G;  3IR7 A;  2XD1 A;  4NB9 A;  3B6G A;  5C3E I;  3M3Y I;  3X1T A;  3KXB B;  3REJ D;  1M18 C;  4H9Q A;  2ZM5 A;  3AFA A;  5B0Z C;  1P3L B;  1VQ8 1;  2JIP A;  3UTA D;  3GTM S;  3AZL B;  3J81 b;  4J8X A;  4WU9 A;  2O4H A;  1P3P C;  3VH6 T;  3MGQ C;  2LEX A;  5BNX B;  2M48 A;  1P34 D;  1VQK Z;  4AYB A;  4WZS B;  1M19 A;  2NQB B;  2LY8 A;  1P3F B;  1F66 C;  1Y8C A;  2ARO A;  2VPY A;  3AZK B;  1VQ8 Z;  4X6A I;  4BY1 I;  3AZE B;  1VLA A;  5CP6 B;  1Y1V I;  5KDM B;  1ZB9 A;  3KWQ C;  2GTH A;  5B40 C;  3MVD C;  3WTP B;  3W97 D;  5B2I D;  3CCR 1;  3AZI A;  5CPI D;  3FQM A;  4RVF A;  4RV9 A;  1VQP 1;  3AZF A;  1K9M 1;  4XUJ B;  1HQ3 D;  1P3B B;  2OTL 1;  3J80 f;  2RHB A;  2RVQ C;  3AZG C;  1AOI A;  5F99 D;  1H3O A;  2HIO D;  5AV5 C;  4WV4 B;  3AZN C;  4WU8 D;  1QF8 A;  2JIO A; 
#chains in the Genus database with same CATH homology
 3AZJ C;  5BO0 B;  5B1M A;  5G49 B;  3CCR Z;  4XZQ B;  4Z66 B;  3VMH A;  2PYO D;  1VQP Z;  3W98 A;  5D1O B;  2OTL Z;  2R93 I;  1PFT A;  4WJ3 C;  2CV5 C;  5AV9 B;  3B0D C;  3NDI A;  1P3A D;  3LZ0 D;  3UT9 C;  2L5A A;  4ZUX C;  3KXB A;  4KGC C;  4KUD C;  5B0Y C;  3X1V A;  1X3W A;  5FLM I;  4Z5T B;  2HUE B;  3TU4 A;  1YJ9 1;  4WNN B;  3REI C;  2R6M A;  5T6B A;  2W8S A;  4KHA B;  4YM6 D;  3A6N C;  2FJ7 C;  3WAA B;  1I3Q I;  1ZH1 A;  3WA9 C;  2HF1 A;  2O53 A;  2Y2N A;  3CCM Z;  4J8W C;  3EG5 B;  2QA4 1;  1ID3 A;  1ZLA A;  3PO2 I;  3UTB B;  1P3F A;  4A3C I;  3EPJ A;  3AZK A;  2H85 A;  5AV6 D;  4QLC D;  5B1L B;  5B2J B;  3X1U C;  4J8U B;  1Q9C A;  1Q82 1;  2NVT I;  3A1I A;  3C1C C;  1VQO Z;  5GT3 C;  1RO0 A;  3B6F B;  5CPJ B;  1YHQ 1;  3WKJ A;  4Y7N I;  2QA4 Z;  2YFV B;  3Q87 A;  2Y0S A;  2JMO A;  3B6G D;  3X1T D;  2YU9 I;  2ZY2 A;  4M6B A;  5B32 A;  1K73 2;  3AFA D;  3MGR C;  2IZ3 A;  4E2Y A;  1P3L C;  1P3O B;  3MON A;  3T4N B;  4CAY B;  1BH9 A;  1YHQ Z;  4J8X D;  5G49 A;  4WU9 D;  3CC4 1;  4Z66 A;  2JA8 I;  1B67 A;  2QEX 1;  4Y52 I;  2BG1 A;  3LEL A;  3LJA A;  4AWL C;  3REL D;  1A7W A;  1M19 D;  3LUS A;  4NB8 A;  1M18 B;  5E5A C;  3C1B C;  2RPR A;  3REJ A;  4S1T A;  2ARO D;  5B0Z B;  5B33 C;  2ZY4 A;  3EPK A;  1S32 D;  5CP6 C;  3VB9 A;  4Z5T A;  1P3P B;  1F1E A;  4HGA C;  1M1A A;  2G2K A;  3AZI D;  3EPH A;  2GTI A;  2E2I I;  3CMA 1;  2BJO A;  3CME 1;  1TWC I;  3WAA A;  2Y2J A;  4NFT A;  1Y1W I;  3AZF D;  5CPK C;  4YS3 A;  1F66 B;  1P3B C;  4H9N A;  4LD9 A;  3NQJ B;  1AOI D;  5AV8 A;  3W98 D;  1JFI A;  4X23 A;  3H0L C;  3VH6 W;  3KWQ B;  2RBL A;  1TZY D;  5B40 B;  3AN2 C;  3MVD B;  5B1M D;  4NFR A;  1KX4 A;  5IP9 I;  3G71 1;  3H0R C;  1NJI 2;  3LZ1 C;  5JA4 B;  3CXC Y;  3AV2 A;  4R8P A;  2RT9 A;  3B6F A;  1EQZ C;  4EO5 C;  4UUZ A;  3AZG B;  5AV9 C;  3AZN B;  5AV5 B;  3CCS 1;  3KXB D;  1P3G A;  3AZJ B;  3X1V D;  3G71 Z;  1USP B;  1M90 2;  3TU4 D;  3GTG I;  5GXQ B;  5B32 G;  1KX5 B;  2LFU A;  2Q51 A;  1P3I A;  3F3F C;  3NH8 A;  2ZY5 A;  3S1Q I;  3AZH C;  2CV5 B;  3B0D B;  3S14 I;  4A93 I;  3NDJ A;  2WB1 A;  1ID3 D;  1ZLA D;  4ZUX B;  4H9R A;  1M18 A;  1P3F D;  3MGP A;  4KGC B;  4KUD B;  2Y2G A;  3AZK D;  1N8R 2;  5B24 C;  3W96 C;  3REI B;  5B1L C;  2QRD B;  4UPK A;  1YUK A;  4BBR I;  1P3P A;  2FJ7 B;  3A6N B;  1WCM I;  3MGQ A;  3NQU B;  1TWG I;  1KD1 1;  3WA9 B;  3W99 A;  2JUB A;  5C4X I;  3J7A 4;  4J8W B;  3IX0 A;  1VQM 1;  2JCH A;  1I6H I;  5B32 D;  4CSR B;  3P5J B;  3EER A;  2BYK B;  3X1U B;  3KUY A;  5D1P A;  5IT9 f;  2OTJ 1;  5B40 A;  1P3O C;  2R92 I;  3O62 A;  5GT3 B;  1N2F A;  4Z66 D;  3J80 b;  1KRL A;  3LEL D;  3FKI I;  3LJA D;  1VQM Z;  4J8V A;  1SFO I;  3PO3 I;  1WWS A;  3MGR B;  5DNN B;  2V8K A;  5B31 C;  3W97 C;  1B6W A;  5B2I C;  3AV1 C;  3IFU A;  3CCE 1;  3REK A;  3HOU I;  4Z5T D;  4E2W A;  1M1A D;  5C44 I;  4AWL B;  3TDH B;  1HQ3 C;  3REL A;  4BXX I;  3WAA D;  3CC7 1;  3CXC Z;  5BS7 C;  2HIO C;  2Y2L A;  5E5A B;  5F99 C;  4YS3 D;  3C1B B;  5B33 B;  4WU8 C;  1ML8 A;  2VF1 A;  4NBB A;  1YJN 1;  3UT9 A;  4LD9 D;  1K9M 2;  5AV8 D;  3S2H I;  4KGC A;  5BNV B;  5B0Y A;  4X23 D;  5AN9 F;  1S32 A;  3REH C;  2PYO C;  2BYM A;  4HGA B;  5GT0 A;  1KX4 D;  3VH5 A;  5JRG A;  1YUA A;  4ZBJ C;  2DE6 A;  3AV2 D;  4R8P D;  2FJ7 A;  4RVD A;  3B6F D;  3I55 1;  1JWH C;  5CPK B;  1U35 C;  1P3A C;  2ZAE B;  3K7A I;  2PMZ A;  1NP6 A;  4MON A;  3S1M I;  2ZY3 A;  1X0T A;  3KIF A;  2F8N A;  5BT1 C;  1P3G D;  3MGS C;  3AN2 B;  3H3V J;  1TZY A;  2BYK A;  4YM6 C;  3X1U A;  3LZ1 B;  4RVG A;  5GXQ C;  3C1C A;  2NZD C;  2QRC B;  1P3I D;  1KX5 C;  3R45 A;  1Q7Y 1;  1N1J A;  5AY8 A;  2V8I A;  3VMG A;  3WTP E;  4EO5 B;  1EQZ B;  3S17 I;  1DL6 A;  4JJN A;  3I55 Z;  5AV6 C;  1M18 D;  4QLC C;  3MGP D;  1W2B Y;  2YFW B;  5C4J I;  1P3L A;  3VH5 T;  2W04 A;  4A3L I;  5T67 A;  3AZL A;  1YJW 1;  4H9S C;  1P3P D;  3MGQ D;  1KU5 A;  3B6G C;  1Q82 2;  3AZH B;  3W99 D;  5BNX A;  4NE3 A;  5FUG B;  3AFA C;  2GU2 A;  2Y2M A;  2NQB A;  3C1B A;  3JAM f;  1QVG Y;  3QWU A;  1R9T I;  5B24 B;  4MD7 A;  3W96 B;  4J8X C;  3A1K A;  4WU9 C;  3AZE A;  1YJ9 Z;  2R7Z I;  5BNV A;  3KUY D;  5CP6 A;  3MZK B;  5KDM A;  5B40 D;  5LL6 f;  3O62 D;  1S72 1;  3WTP A;  1M19 C;  4A3G I;  4HGZ A;  4TNU A;  3MZL B;  2F4M A;  4J8V D;  4E45 A;  3CCL 1;  4XUJ A;  1P3B A;  2P28 A;  2OOX B;  3OW2 Z;  5DNN C;  3GTQ I;  3AN2 A;  3REK D;  3F3P C;  5BO0 A;  3D9X A;  1P34 B;  4A3J I;  3S1R I;  4XZQ A;  2F8N G;  4NBA A;  1RO4 A;  4A3M I;  3CCL Z;  5AVB C;  1EQZ A;  5D1O A;  1YIT 1;  2XD5 A;  5AVC C;  5AV9 A;  5GSU C;  5B31 B;  3UT9 D;  3X1S C;  3W97 B;  4QTU A;  5B2I B;  3AV1 B;  4KGC D;  5B0Y D;  1VQ4 1;  3CC4 Z;  2YFW A;  5GT0 D;  2QEX Z;  1K83 I;  4WNN A;  5JRG D;  1HQ3 B;  2FJ7 D;  4KHA A;  5F99 B;  2HIO B;  4H9O B;  4WU8 B;  3AZH A;  4MD8 A;  3EPL A;  3X1V C;  2JA6 I;  3TU4 C;  3UTB A;  4H9P B;  2F8N D;  3REH B;  2PYO B;  1VQL 1;  5B24 A;  1W2B Z;  1W2E A;  3X1U D;  5B2J A;  5B1L A;  4J8U A;  2QRE B;  3CMA Z;  3C1C D;  3CME Z;  4ZBJ B;  4E44 A;  5AY8 D;  3CCJ 1;  1TAF B;  1U35 B;  5CPJ A;  2G5I C;  1P3A B;  1P3M C;  1ID3 C;  1ZLA C;  4JJN D;  2WAQ A;  2YFV A;  5IT9 b;  1P3K C;  3AZM C;  1VQL Z;  1JJ2 Z;  3MGS B;  3V9R B;  2F8N H;  5FLX b;  4BY7 I;  2RIQ A;  4YM6 B;  1QVG Z;  1Y1V S;  1P3L D;  2NZD B;  2DE7 A;  3GKQ A;  1P3O A;  3WKJ C;  3CCJ Z;  1VQN 1;  4CAY A;  3AZL D;  1YI2 1;  5CHL B;  2G5H C;  3AYW C;  1KX3 C;  2YAD A;  5IP7 I;  3CCV 1;  2E2H I;  1VQ6 1;  3S15 I;  3G4S 1;  5B32 C;  3HOY I;  3MNN C;  2E9H A;  5AV6 B;  2NQB D;  4QLC B;  3C1B D;  3RZD I;  1KD1 2;  2QKD A;  3G6E 1;  5DNM C;  5B0Z A;  3AZE D;  3AV1 A;  1YI2 Z;  5CP6 D;  3I4M I;  3CCV Z;  3CCU 1;  3LEL C;  2OZK A;  3LJA C;  1VQ6 Z;  3WTP D;  3CC2 1;  3GTP I;  3B6G B;  1M1K 1;  3KSY A;  4E30 A;  4H9Q B;  3REJ C;  3AFA B;  3I56 1;  5BS7 A;  4H9O A;  1KQS Z;  1F66 A;  3TE5 B;  4XUJ D;  1P3B D;  3VH5 W;  2EGT A;  3UTA C;  1ZB8 A;  4J8X B;  4WU9 B;  3NQJ A;  2JS4 A;  4H9P A;  1M1A C;  2B63 I;  3AN2 D;  4MH4 A;  3KWQ A;  2Y2H A;  2DQN C;  3MVD A;  1M19 B;  1P34 C;  2Y2Q A;  4XZQ D;  3ESW A;  5FLX f;  3FDD A;  5JA4 A;  4YS3 C;  3I56 Z;  1VQ5 1;  1RQF A;  1U35 A;  1EQZ D;  1S7M A;  3CCQ 1;  5AV8 C;  4G92 C;  4X23 C;  4DQY B;  1WII A;  5AV9 D;  4Z2M H;  3AZG A;  3AZN A;  2OTJ Z;  5AV5 A;  1KX4 C;  5CM2 M;  3V9R A;  3AZJ A;  1K8A 2;  5CPI C;  1Q81 2;  2JNY A;  3AV2 C;  4R8P C;  3VH6 A;  1USP A;  5GXQ A;  2NZD A;  2JSS A;  5A2Q b;  1KX5 A;  4E2X A;  5AVB B;  4NBE A;  1H3O B;  3AZH D;  3OW2 Y;  1Z02 A;  5AVC B;  2CV5 A;  1P3G C;  5GSU B;  3X1S B;  5B1M B;  3NFZ A;  1K8A 1;  1Q81 1;  2V8J A;  4ZUX A;  4KUD A;  3UTB D;  3NH4 A;  3CCE Z;  2FFF B;  5B24 D;  1P3I C;  2JE5 A;  5B2J D;  5B1L D;  4J8U D;  3REI A;  2Y2O A;  1QVF Y;  3RZO I;  4H9S A;  3CC7 Z;  3A6N A;  5CPJ D;  3JAM b;  1YJN Z;  3NQU A;  1KC8 1;  1VQK 1;  3LZ0 C;  3WA9 A;  3MGP C;  3X1V B;  1Q7Y 2;  4J8W A;  4A3K I;  1VQ9 1;  3B0C T;  3TU4 B;  4G91 C;  2J6A A;  4CSR A;  2DE5 A;  1LQL A;  1P3O D;  1RLY A;  2PM9 A;  1RNI A;  3W99 C;  3F6T A;  2Y2I A;  5GT3 A;  2F8N K;  2J8P A;  1TWA I;  3CQZ I;  1P3M B;  1ID3 B;  1ZLA B;  1P9N A;  3D6W A;  1VQ9 Z;  5A2Q f;  4NE5 A;  3M4O I;  4DRA A;  3U50 C;  1P3K B;  3AZM B;  3S1N I;  2PK7 A;  3KUY C;  3MGR A;  5DNN A;  5B31 D;  5B0Z D;  4A3F I;  3O62 C;  2QR1 B;  3AV1 D;  4MD9 A;  3WKJ B;  2LIY A;  2JA7 I;  3S2D I;  4NBD A;  4NBG A;  3AYW B;  1KX3 B;  4J8V C;  2W03 A;  4E33 A;  3CD6 1;  2Y2K A;  5B32 B;  5AVB A;  3MNN B;  3X1T C;  1JJ2 Y;  2CWE A;  2K5R A;  1F66 D;  5E5A A;  5AVC A;  5DNM B;  5GSU A;  5B33 A;  1BH9 B;  3X1S A;  3REK C;  5C3I C;  4A3B I;  3REH D;  1YJW Z;  3KWQ D;  3LEL B;  3LJA B;  2DF4 C;  3MVD D;  3REL C;  1BFM A;  2VUG A;  3CD6 Z;  3J81 f;  1TWH I;  3I4N I;  1HTA A;  3REJ B;  2IO5 C;  3S16 I;  2ARO C;  1U35 D;  3CCM 1;  5CPK A;  4DRB A;  2JR6 A;  3UTA B;  3HOX I;  1S32 C;  2RVQ D;  3AZG D;  2JA5 I;  3AZN D;  3FQQ A;  1QVF Z;  5AV5 D;  5BT1 D;  5GT0 C;  3MGS D;  1M1A B;  5JRG C;  3AZI C;  3AZJ D;  1R4V A;  2F4O A;  2KPI A;  4CL1 A;  4A3I I;  1S72 Z;  3GTK I;  5GXQ D;  3LZ1 A;  2NZD D;  1VQO 1;  4YS3 B;  1KX5 D;  3AZF C;  2K3R A;  2KI7 B;  4H9N B;  1KQS Y;  1YIJ 1;  1BH8 B;  1P3M A;  4LD9 B;  2IZ4 A;  5AV8 B;  4DK1 A;  1AOI C;  4G92 B;  4X23 B;  1JFI B;  2CV5 D;  3W98 C;  3BG1 B;  2NVQ I;  2Q4Z A;  1TZY C;  3AZM A;  1P3K A;  1KX4 B;  3H0M C;  5B1M C;  4ZUX D;  4NE6 A;  4KUD D;  2NVY I;  1VQ7 1;  3GTM I;  5CPI B;  3AV2 B;  4R8P B;  3CPW Y;  5AY8 C;  3REI D;  1YIJ Z;  2OOY B;  4UUZ B;  3HOW I;  4JJN C;  1YIT Z;  3AYW A;  1KX3 A;  3A6N D;  4E2Z A;  2UWX A;  4MRI A;  5T64 A;  1P3G B;  3WA9 D;  3MNN A;  3KXB C;  4J8W D;  4A3E I;  1VQ4 Z;  5FUG A;  1VQ7 Z;  3PO3 S;  4MXU A;  2F2A C;  1WWI A;  3B0B A;  5DNM A;  4NBF A;  1P3I B;  3AZL C;  3W96 A;  3CCS Z;  1Z03 A;  2NVX I;  5GT3 D;  1K73 1;  4A3D I;  4H9R B;  3LZ0 B;  2NQB C;  3MGP B;  3NH5 A;  3HOZ I;  1P3F C;  2QLV B;  2E2J I;  3GTL I;  3AZK C;  3H0G I;  1ULY A;  4G91 B;  3AZE C;  4HH4 A;  3UTA A;  3MGR D;  5DNN D;  3VMI A;  3WTP C;  3MGQ B;  4Z2M G;  3W99 B;  1NUI A;  3AL0 C;  1P34 A;  3B0C W;  1X3Z A;  4XUJ C;  5AVB D;  3I07 A;  1BH8 A;  4XX2 A;  1M1K 2;  2I3C A;  5E5A D;  3KUY B;  5AVC D;  4RVH A;  5GSU D;  5B33 D;  3X1S D;  3O62 B;  5B31 A;  4NH1 C;  3W97 A;  1VQN Z;  2AKL A;  5B2I A;  4XZQ C;  4Z66 C;  3HOV I;  5CPI A;  1TFI A;  4J8V B;  4E32 A;  3G4S Z;  2HU9 A;  1HQ3 A;  3X1T B;  3BG0 B;  1Q86 2;  1I50 I;  3G6E Z;  5F99 A;  2HIO A;  4WU8 A;  1PZR A;  5CPK D;  3GTJ I;  1NJI 1;  1Z01 A;  3REK B;  4E31 A;  3GTO I;  5C3I B;  3IF8 A;  4Z5T C;  2HUE C;  4NOZ A;  3EED A;  4HGY A;  3CCU Z;  3REH A;  2PYO A;  3CC2 Z;  3REL B;  1Q86 1;  3WAA C;  3LZ1 D;  2P3Y A;  3CPW Z;  1L1O C;  2IO5 B;  1WW9 A;  2ARO B;  2M6N A;  1TAF A;  3UT9 B;  1P3M D;  1P3A A;  3LZ0 A;  4LD9 C;  4NBC A;  5B0Y B;  3UTB C;  1TWF I;  1M90 1;  1S32 B;  2BYM B;  2Y2P A;  1P3K D;  3AZM D;  5GT0 B;  4NBH A;  4RS4 A;  3HKZ A;  4EWC A;  5B2J C;  5JRG B;  3MGS A;  4J8U C;  3AZI B;  1RO2 A;  4YM6 A;  3WKJ D;  3B6F C;  5CPJ C;  3AZF B;  1VQ5 Z;  3GCF A;  2VQR A;  4DGL A;  3AYW D;  1KX3 D;  1QYP A;  3CCQ Z;  1N8R 1;  1AOI B;  3W98 B;  2F8N B;  3IP4 C;  3MNN D;  4QTT A;  1TZY B;  1Z2C B;  1KC8 2;  5AV6 A;  4QLC A;  5DNM D;  3C1C B;  3R45 B;  4BBS I;  1N1J B;  5AY8 B;  3W96 D;  2VUM I;  1T3U A;  3KIH A;  3KFU G;  4JJN B;  3VTN A;  5B31 G;  4NB9 A;  2XD1 A;  3B6G A;  5C3E I;  3M3Y I;  3X1T A;  3KXB B;  3REJ D;  1M18 C;  4H9Q A;  2ZM5 A;  3AFA A;  5B0Z C;  1P3L B;  1VQ8 1;  3UTA D;  3GTM S;  3AZL B;  3J81 b;  4J8X A;  4WU9 A;  2O4H A;  1P3P C;  3VH6 T;  3MGQ C;  5BNX B;  2M48 A;  1P34 D;  1VQK Z;  4AYB A;  4WZS B;  1M19 A;  2NQB B;  2LY8 A;  1P3F B;  1F66 C;  2ARO A;  1VQ8 Z;  3AZK B;  4X6A I;  4BY1 I;  3AZE B;  1VLA A;  5CP6 B;  1Y1V I;  5KDM B;  1ZB9 A;  3KWQ C;  2GTH A;  5B40 C;  3MVD C;  3WTP B;  3W97 D;  5B2I D;  3CCR 1;  3AZI A;  5CPI D;  3FQM A;  4RVF A;  4RV9 A;  1VQP 1;  3AZF A;  1K9M 1;  4XUJ B;  1HQ3 D;  1P3B B;  2OTL 1;  3J80 f;  2RHB A;  2RVQ C;  3AZG C;  1AOI A;  5F99 D;  1H3O A;  2HIO D;  5AV5 C;  4WV4 B;  3AZN C;  4WU8 D;  1QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...