4DQYB

Structure of human parp-1 bound to a dna double strand break
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
SKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for DNA damage-dependent poly(ADP-ribosyl)ation by human PARP-1.
pubmed doi rcsb
molecule keywords Poly [ADP-ribose] polymerase 1
molecule tags Transferase/dna
source organism Homo sapiens
total genus 37
structure length 136
sequence length 136
chains with identical sequence E
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4dqyB01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dqyB02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
3B0DB 2RHBA 3CCEZ 2G5IC 2G2KA 2HF1A 2PYOB 2QA4Z 2LFUA 1KQSY 3AZED 4NE5A 1N1JA 1B67A 4Z66C 3LZ1C 3AZFC 4DRBA 3REIB 3MGQA 1U35A 2E9HA 3I56Z 3UTAA 1YJ91 1S32C 1NJI2 5GSUC 5BS7A 5AV5B 4CSRB 3MGPD 1P3PA 2OTJZ 3AFAC 2F8NK 4KHAA 2Y2IA 5AY8A 5F99D 4R8PA 1KX4A 3HOUI 4WU8D 3S1RI 4WU9A 4J8UD 3GTMI 4Z5TB 3C1BB 1M18C 3KUYB 3I55Z 5A2Qf 1VQK1 1K8A1 3G71Z 5AV6C 1TFIA 1Z01A 3RELA 3BG1B 4NB9A 4EWCA 5FLMI 5A2Qb 4CAYB 3AV1A 1P3AA 4YM6B 1VQ81 5JRGB 3CCE1 2PMZA 3CQZI 1P3ID 1F66C 2KI7B 1Q16A 4MXUA 3CCSZ 1W2EA 1K731 4NBEA 3AZNC 3W97B 3I561 3VH5A 5CPJB 5G49A 4J8VD 3AYWA 3EPHA 1WIIA 2CV5D 1K9M2 2JE5A 3X1UD 2WB1A 1Q861 2RVQD 3B6FB 2IZ4A 3NQJB 1USPA 2OTJ1 3IX0A 2CWEA 5B2IC 2JA7I 3M3YI 3MGRC 2NQBA 4H9RB 3BG0B 2Y2LA 2PYOA 5IT9f 1NJI1 4WNNB 4YS3C 1P3LD 5B31A 5CPKB 3AZLD 3AZIC 2RBLA 5IT9b 3REHB 1SIWA 3AZJC 2VPZA 1TAFB 5GT3D 3CC4Z 3NDJA 5CPIC 3GTPI 1P3OB 5B1LC 1Y8CA 2V8KA 4NBAA 4E32A 4WV4B 3G711 1ZB9A 1AOIB 1I3QI 1ZB8A 4J8XC 3REJB 2L5AA 3X1TC 1QXFA 3WTPA 3AV2C 1P3FA 2F4OA 2Q51A 3X1VB 5AV9B 2F8NG 2JS4A 1Y1WI 5DNMC 3GKQA 2NZDC 5IP9I 3C1BA 3MGSA 3AZKD 2XD1A 4ZBJB 3CMAZ 5B33C 3KXBB 3LJAD 2QEXZ 5JRGA 4G92C 1RLYA 3MVDA 3LELA 1K83I 4MONA 3C1CA 1P3KC 1KX5D 4LD9D 3W97A 3RZOI 4RV9A 2IV2X 3S1QI 1BH8B 2LIYA 2KPIA 4UPKA 3CC41 5AVCB 3B6FA 3REID 1W2BZ 3NQUB 5DNND 1EQZC 2Y2GA 1P34B 1P3BB 2AROA 3CCMZ 5IP7I 5AV5D 4DGLA 4M6BA 4WNNA 4A3CI 3X1SA 2OZKA 3UTBB 4H9SA 1U35C 4A3II 3MGQC 1TAFA 2VPWA 5B32B 1TZYB 3UTAC 1M19A 4NBFA 3CMA1 5F99B 3H0GI 4Z5TD 4A93I 5BS7C 3KUYD 1P3PC 2P3YA 1ZLAC 2RPRA 3CCQZ 2QEX1 4J8WB 1ID3C 5AY8C 4QLCD 4X23D 4R8PC 1KX4C 5GT0A 2QLVB 4YM6D 2VF1A 3HKZA 3KIHA 4WU9C 3B0CT 3F3PC 3LUSA 1H3OA 5B24A 1JFIB 5CPJD 1X0TA 1P3IB 4JJNB 3AV1C 1P3AC 4RVGA 4H9OA 5AVBA 5B0YB 3O62B 1TWGI 3CCM1 3PO2I 4UUZA 2E2HI 3S2DI 2IO5C 2VQRA 4XZQA 5B1MA 1KX3D 3WA9D 4DQYB 4Y7NI 4KGCB 2P28A 3AZGC 2FJ7B 3WKJB 3AYWC 3KWQB 1Q7Y2 5CPKD 4ZUXB 1Q821 4BY7I 3REHD 3NQUA 3V9RB 3Q87A 3UT9B 3AZEA 5C3IB 1P3OD 3AZLB 3W98B 1YJW1 3FDDA 3D2LA 2NQBC 5B0ZB 2VUMI 1AOID 2GTHA 1S7MA 2JNYA 3CCUZ 3REJD 5B31C 5C4XI 3J81f 3MGPA 5AV9D 3LZ0B 3X1VD 2GTIA 3I07A 3W99B 3J81b 3IP4C 1VQN1 1M1AB 5F99A 2V45A 3QWUA 3R45A 3CD6Z 3H0LC 5B2JC 4WU8A 3IFUA 3TDHB 4A3MI 5CHLB 4J8UA 3WTPC 3AN2C 1P3FC 2F4MA 4A3JI 3KXBD 3OW2Y 2R6MA 4MRIA 4AYBA 4S1TA 3S16I 1M1K2 5B40C 2OOXB 3MGSC 3TU4B 5GXQB 3B6GB 4HGAB 1VQ61 2BYMB 3GTOI 2HIOB 1P3IA 3PO3I 2HUEB 4LD9B 5E5AB 5BNVB 5AVCD 2LEXA 1WW9A 4J8VA 3MVDC 3LELC 3WAAB 2CV5A 3C1CC 5KDMA 3X1UA 4H9QB 1P34D 1P3BD 3KIFA 2JIOA 5CM2M 3CCU1 3GTGI 3S1MI 1Y1VS 2V8IA 5DNNB 1RO4A 2AKLA 5B31G 3UTBD 3B6FC 4E30A 3A6NB 4X6AI 3V9RA 1A7WA 5B32D 3A1IA 1P3LA 1TZYD 1PFTA 4Z2MH 3AZLA 4A3GI 2AROC 1R9TI 3VMIA 5GT3A 1ULYA 3VH5T 1JWHC 1QYPA 1NP6A 1VQMZ 4J8WD 3X1SC 1W2BY 4XUJB 2BYKA 4H9SC 4AWLB 5T6BA 1QVFZ 1RNIA 3AZID 5JA4B 2GU2A 4MD8A 2Y2OA 1M19C 2DE6A 4QLCB 4X23B 1VQ41 1P3MB 5AN9F 5B1LD 5FUGB 2YU9I 3AZKA 3VMHA 3HOZI 4JJND 5GT0C 5LL6f 3TE5B 2QA41 5B0YD 3O62D 4HH4A 3LJAA 5DNMD 2JA6I 2NZDD 2NVQI 5B24C 4KGCD 2BJOA 2FJ7D 3WKJD 2RIQA 3MNNC 3KWQD 3AZMB 1KX3B 5E5AA 5AVBC 3REKB 1KX5A 4ZUXD 3WA9B 4LD9A 2QREB 1N8R2 3P5JB 5AV8B 4DRAA 1N2FA 4E2YA 1HQ3B 4XZQC 5CP6B 3UT9D 5B1MC 3AZHC 1VLAA 3GTLI 3W98D 3REIA 2JMOA 1YITZ 5B0ZD 3W96D 5DNNA 3I551 4KUDB 4NH1C 3CXCZ 3OW2Z 5AV5A 3F3FC 4CSRA 1P3GB 3FQMA 2Y2HA 3LZ0D 2Y2KA 3W99D 3AZEC 1JJ2Z 2J8PA 1M1AD 3AZFB 3LZ1B 2QKDA 4Z66B 3CCS1 1RQFA 3VH6W 2R92I 2NVXI 4Z5TA 1S32B 3KUYA 3MGPC 4A3DI 1DL6A 5T67A 2Y2PA 5GSUB 3U50C 4E2WA 1RO0A 4QLCA 4X23A 2RT9A 2OTLZ 4CAYA 3TU4D 5GXQD 4YM6A 3B6GD 3S17I 4WU8C 1ZLAD 4J8UC 2VUGA 2HIOD 1K9M1 3NDIA 3MZLB 1ID3D 1M18B 5E5AD 3J80f 5CPJA 4MD9A 1YIT1 3GTKI 3WAAD 5AV6B 3J80b 4A3EI 2M6NA 3NQJA 2F8NB 1P3IC 3T4NB 3S15I 3MONA 5BO0B 1KX3A 2YFWB 1KD12 3WA9A 1F66B 3GTQI 3A6ND 4H9RA 1YUAA 4J8VC 3AZNB 2CV5C 3X1UC 5CPKA 2RVQC 3REHA 2DE5A 3CCJZ 2R93I 4A3FI 3AZGD 1P3OA 2F8NH 4XUJD 3FKII 5B2IB 1AOIA 3VB9A 3MGRB 5C4JI 1P3LC 3REJA 4G91C 3J7A4 3GTJI 3X1VA 5AV9A 1P3MD 5D1OB 3AZIB 1Z2CB 5BT1D 5GT3C 1VQ5Z 3AZJB 5CPIB 5B1LB 4Y52I 2JIQA 2YADA 3CCVZ 4J8XB 3KXBA 3RELC 5D1PA 3AV2B 1QVFY 3S14I 5BNXB 4NOZA 3WTPE 4MH4A 2IZ3A 5DNMB 3AZKC 3AN2D 3AZMD 2NZDB 3REKD 1TWFI 2AYDA 1YI2Z 5AV8D 1BH8A 3H0RC 3LJAC 4QTTA 4RVHA 5B33B 1HQ3D 5CP6D 5B40D 5AVCA 1NUIA 1KD11 3H0MC 2B63I 4EO5C 3CCQ1 2YFWA 1P34A 1P3BA 1KX5C 4KUDD 2K3RA 3IF8A 3B0DC 5T64A 2OOYB 1P3KB 3AZNA 1P3GD 2PYOC 3W96B 1Z02A 2YFVB 1VQ51 3VH6A 1WJ2A 3UTBA 2W8SA 1LQLA 3REIC 3K7AI 3S2HI 3AZFD 3LZ1D 5C3EI 4Z66D 5B32A 4A3LI 1TZYA 3EPLA 2QRDB 4NBHA 4H9PB 1EQZB 2FFFB 5AV5C 1S32D 2NVYI 3CC2Z 2PK7A 3CPWY 5GSUD 1RO2A 4J8WA 4NBDA 1QF8A 3AFAD 3CXCY 1N1JB 3EEDA 3AZIA 1WCMI 4XX2A 1VQOZ 3MGQB 2Y2NA 1YJNZ 1JJ2Y 2F2AC 4Z5TC 3C1BC 3UTAB 5B1LA 3KUYC 5CPIA 2O4HA 1YIJZ 1L1OC 4E44A 1P3PB 1M18D 3AL0C 1JFIA 1ZLAB 4X23C 4BBRI 4JJNA 5AV6D 5AY8B 4YM6C 5BNXA 5JRGC 5B0YA 4R8PB 1ID3B 2JIPA 2DF4C 3O62A 1KX4B 2F8ND 1Q812 5DNMA 2NZDA 2Q4ZA 4QTUA 4WU9B 1Q7Y1 3RZDI 1VQ9Z 1F66D 3W97C 4KGCA 5CPJC 1YUKA 2JR6A 1AA6A 2FJ7A 3WKJA 3AZND 3KWQA 1YJ9Z 4ZUXA 4DK1A 3AV1B 5C44I 1P3AB 3HOXI 3UT9A 1VQPZ 1K8A2 3CD61 2XD5A 1KX3C 4NBBA 4E33A 3W98A 2IO5B 3MNND 3GCFA 5B0ZA 3W96A 5B2ID 1X3ZA 4RVFA 3MGRD 1WWSA 1VQO1 3AZGB 5CPKC 5G49B 3AYWB 1YJN1 3AZHD 4YS3D 3REHC 1R4VA 1VQKZ 3LZ0A 4BY1I 1I6HI 3W99A 3GTMS 3D9XA 4H9PA 1M1AA 4WZSB 3AZJD 1P3OC 2VPYA 5CPID 1AOIC 1P9NA 4HGYA 1Q862 4NFTA 2NQBB 1M1K1 3REJC 1F1EA 3D6WA 4J8XD 1Y1VI 3X1TD 5B31B 5AV9C 3X1VC 3CCL1 3AV2D 1VQ91 3G4SZ 3TU4A 5GXQA 3B6GA 3CMEZ 4ZBJC 2JA5I 2BYMA 4RVDA 1ZLAA 1Q811 2HIOA 3F6TA 5B2JB 1VQ7Z 3KXBC 4A3BI 1ID3A 3AN2B 3WTPB 5B33D 1P3FB 1VQP1 5BNVA 2ZY5A 3WAAA 2QRCB 5B40B 4H9QA 3EPJA 3MGSB 2PM9A 1BH9B 3ESWA 5FLXf 3CPWZ 1VQM1 2NVTI 2QR1B 1P3KD 5FLXb 2ZY2A 2ZM5A 4NBGA 4E31A 5AVCC 2JA8I 3I4MI 3A6NA 3S1NI 2E2II 3VTNA 2WAQA 1P34C 1P3BC 3MVDB 3LELB 3NH8A 3C1CB 1EQZD 1KC82 2E7ZA 4H9NB 3AZGA 3UTBC 4XUJA 2HU9A 1VQLZ 3G4S1 5B32C 5JA4A 1U35D 1TZYC 3MGQD 2W04A 3CME1 1T3UA 5F99C 2ZY4A 3AFAB 3UTAD 1P3MA 4NB8A 4NBCA 1VQ71 2AROB 5FUGA 3M4OI 2LY8A 4J8WC 1P3PD 3X1SB 1FDIA 5AY8D 4R8PD 2K5RA 1KX4D 2EGTA 3B0CW 1M19B 2DE7A 2BG1A 4WU9D 1N8R1 1QVGZ 2V3VA 3NH4A 1X3WA 5B2JA 3AN2A 2Y2JA 3AZMA 4JJNC 1TWHI 3REKA 3RELD 1TWAI 5B0YC 3O62C 5GT0B 5AV8A 3AV1D 1P3AD 2DQNC 1HQ3A 4NE6A 5B40A 5CP6A 1BH9A 1VQL1 4KGCC 1KRLA 3KSYA 4BBSI 2FJ7C 3WKJC 1Z03A 1H3OB 5B24B 3KWQC 4KUDA 3MZKB 2O53A 1KQSZ 4ZUXC 3AYWD 3MNNB 3CCLZ 1KC81 1P3GA 4H9OB 5B32G 5AVBB 1S72Z 2OTL1 3UT9C 3G6EZ 5C3IC 2R7ZI 4UUZB 1TWCI 3AZLC 3W98C 4XZQB 3AZHB 3AZFA 3LZ1A 4H9NA 5B1MB 3W96C 5B0ZC 4Z66A 2UWXA 3A1KA 4YS3B 3CC7Z 2NQBD 2PYOD 1PZRA 3HOWI 1S32A 1KU5A 5B31D 3LZ0C 5GSUA 3W99C 3EG5B 1M1AC 3AFAA 3JAMf 3AZEB 3KFUG 4HGZA 3X1TB 1YHQZ 3JAMb 1WZNA 5B2JD 1M902 3VH6T 2JUBA 3VMGA 1HTAA 3WTPD 1P3FD 3HOVI 1M18A 2I3CA 3MGPB 1ML8A 3CCJ1 1B6WA 5AV6A 2Y2QA 5GXQC 3TU4C 3B6GC 3C1BD 3MGSD 4HGAC 3R45B 2F8NA 2ZAEB 1YJWZ 2HIOC 4WU8B 4G92B 1S721 2VPXA 2HUEC 5BO0A 4J8UB 2J6AA 3G6E1 4LD9C 5E5AC 1F66A 2E2JI 5JRGD 3WAAC 2W03A 3CC71 1BFMA 3MVDD 3LELD 3C1CD 1VQNZ 3W97D 5DNNC 3CCRZ 3MNNA 3CCV1 2H85A 3A6NC 2NAPA 5B2IA 2V8JA 3B6FD 3MGRA 3EPKA 4J8VB 4RS4A 3AZHA 2G5HC 5KDMB 3X1UB 4YS3A 2CV5B 1FDOA 5D1OA 2AROD 1U35B 3VH5W 4CL1A 3AZJA 4MD7A 4XUJC 1YI21 4AWLC 1VQ6Z 3X1SD 3CCR1 4NE3A 1M901 4QLCC 4J8XA 1P3LB 3X1TA 3FQQA 4G91B 1P3MC 1M19D 4KHAB 5BT1C 3AV2A 1ZH1A 3PO3S 4A3KI 4WJ3C 5GT3B 2Y0SA 3H3VJ 2Y2MA 2JCHA 2BYKB 4Z2MG 3HOYI 3I4NI 3NH5A 5GT0D 3NFZA 5B33A 4NFRA 3RELB 1I50I 2JIRA 1SFOI 4E45A 4E2ZA 3CC21 2JIMA 3AZMC 5B24D 4E2XA 3REKC 1Q822 4BXXI 3WA9C 3AZKB 4TNUA 1WWIA 3B0BA 1P3KA 5AV8C 2M48A 5AVBD 1QVGY 2ZY3A 1HQ3C 1Q9CA 2YFVA 5CP6C 3LJAB 4XZQD 2JSSA 3EERA 5B1MD 1YIJ1 1K732 4KUDC 1USPB 1VQ4Z 1VQ8Z 4EO5B 1EQZA 3IR7A 1KX5B 1YHQ1 1P3GC
chains in the Genus database with same CATH topology
3B0DB 2RHBA 3CCEZ 2G5IC 2G2KA 2HF1A 2PYOB 2QA4Z 2LFUA 1KQSY 3AZED 4NE5A 1N1JA 1B67A 4Z66C 3LZ1C 3AZFC 4DRBA 3REIB 3MGQA 1U35A 2E9HA 3I56Z 3UTAA 1YJ91 1S32C 1NJI2 5GSUC 5BS7A 5AV5B 4CSRB 3MGPD 1P3PA 2OTJZ 3AFAC 2F8NK 4KHAA 2Y2IA 5AY8A 5F99D 4R8PA 1KX4A 3HOUI 4WU8D 3S1RI 4WU9A 4J8UD 3GTMI 4Z5TB 3C1BB 1M18C 3KUYB 3I55Z 5A2Qf 1VQK1 1K8A1 3G71Z 5AV6C 1TFIA 1Z01A 3RELA 3BG1B 4NB9A 4EWCA 5FLMI 5A2Qb 4CAYB 3AV1A 1P3AA 4YM6B 1VQ81 5JRGB 3CCE1 2PMZA 3CQZI 1P3ID 1F66C 2KI7B 4MXUA 3CCSZ 1K731 1W2EA 4NBEA 3AZNC 3W97B 3I561 3VH5A 5CPJB 5G49A 4J8VD 3AYWA 3EPHA 1WIIA 2CV5D 1K9M2 2JE5A 3X1UD 2WB1A 1Q861 2RVQD 3B6FB 2IZ4A 3NQJB 1USPA 2OTJ1 3IX0A 2CWEA 5B2IC 2JA7I 3M3YI 3MGRC 2NQBA 4H9RB 3BG0B 2Y2LA 2PYOA 5IT9f 1NJI1 4WNNB 4YS3C 1P3LD 5B31A 5CPKB 3AZLD 3AZIC 2RBLA 5IT9b 3REHB 3AZJC 1TAFB 5GT3D 3CC4Z 3NDJA 5CPIC 3GTPI 1P3OB 5B1LC 2V8KA 4NBAA 4E32A 3G711 4WV4B 1ZB9A 1AOIB 1I3QI 1ZB8A 4J8XC 3REJB 2L5AA 3X1TC 3WTPA 3AV2C 1P3FA 2F4OA 2Q51A 3X1VB 5AV9B 2F8NG 2JS4A 1Y1WI 5DNMC 3GKQA 2NZDC 5IP9I 3C1BA 3MGSA 3AZKD 2XD1A 4ZBJB 3CMAZ 5B33C 3KXBB 3LJAD 2QEXZ 5JRGA 4G92C 1RLYA 3MVDA 3LELA 1K83I 4MONA 3C1CA 1P3KC 1KX5D 4LD9D 3W97A 3RZOI 4RV9A 3S1QI 1BH8B 2LIYA 2KPIA 4UPKA 3CC41 5AVCB 3B6FA 3REID 1W2BZ 3NQUB 5DNND 1EQZC 2Y2GA 1P34B 1P3BB 2AROA 3CCMZ 5IP7I 5AV5D 4DGLA 4M6BA 4WNNA 4A3CI 3X1SA 2OZKA 3UTBB 4H9SA 1U35C 4A3II 3MGQC 1TAFA 5B32B 1TZYB 3UTAC 1M19A 4NBFA 3CMA1 5F99B 3H0GI 4Z5TD 4A93I 5BS7C 3KUYD 1P3PC 2P3YA 1ZLAC 2RPRA 3CCQZ 2QEX1 4J8WB 1ID3C 5AY8C 4QLCD 4X23D 4R8PC 1KX4C 5GT0A 2QLVB 4YM6D 2VF1A 3HKZA 3KIHA 4WU9C 3B0CT 3F3PC 3LUSA 1H3OA 5B24A 1JFIB 5CPJD 1X0TA 1P3IB 4JJNB 3AV1C 1P3AC 4RVGA 4H9OA 5AVBA 5B0YB 3O62B 1TWGI 3CCM1 3PO2I 4UUZA 2E2HI 3S2DI 2IO5C 2VQRA 4XZQA 5B1MA 1KX3D 3WA9D 4DQYB 4Y7NI 4KGCB 2P28A 3AZGC 2FJ7B 3WKJB 3AYWC 3KWQB 1Q7Y2 5CPKD 4ZUXB 1Q821 4BY7I 3REHD 3NQUA 3V9RB 3Q87A 3UT9B 3AZEA 5C3IB 1P3OD 3AZLB 3W98B 1YJW1 3FDDA 2VUMI 2NQBC 5B0ZB 1AOID 2GTHA 1S7MA 2JNYA 3CCUZ 3REJD 5B31C 5C4XI 3J81f 3MGPA 5AV9D 3LZ0B 3X1VD 2GTIA 3I07A 3W99B 3J81b 3IP4C 1VQN1 1M1AB 5F99A 3QWUA 3R45A 3CD6Z 3H0LC 5B2JC 4WU8A 3IFUA 3TDHB 4A3MI 5CHLB 4J8UA 3WTPC 3AN2C 1P3FC 2F4MA 4A3JI 3KXBD 3OW2Y 2R6MA 4MRIA 4AYBA 4S1TA 3S16I 1M1K2 5B40C 2OOXB 3MGSC 3TU4B 5GXQB 3B6GB 4HGAB 1VQ61 2BYMB 3GTOI 2HIOB 1P3IA 3PO3I 2HUEB 4LD9B 5E5AB 5BNVB 5AVCD 1WW9A 4J8VA 3MVDC 3LELC 3WAAB 2CV5A 3C1CC 5KDMA 3X1UA 4H9QB 1P34D 1P3BD 3KIFA 5CM2M 3CCU1 3GTGI 3S1MI 1Y1VS 2V8IA 5DNNB 1RO4A 2AKLA 5B31G 3UTBD 3B6FC 4E30A 3A6NB 4X6AI 3V9RA 1A7WA 5B32D 3A1IA 1P3LA 1TZYD 1PFTA 4Z2MH 3AZLA 4A3GI 2AROC 1R9TI 3VMIA 5GT3A 1ULYA 3VH5T 1JWHC 1QYPA 1NP6A 1VQMZ 4J8WD 3X1SC 1W2BY 4XUJB 2BYKA 4H9SC 4AWLB 5T6BA 1QVFZ 1RNIA 3AZID 5JA4B 2GU2A 4MD8A 2Y2OA 1M19C 2DE6A 4QLCB 4X23B 1VQ41 1P3MB 5AN9F 5B1LD 5FUGB 2YU9I 3AZKA 3VMHA 3HOZI 4JJND 5GT0C 5LL6f 3TE5B 2QA41 5B0YD 3O62D 4HH4A 3LJAA 5DNMD 2JA6I 2NZDD 2NVQI 5B24C 4KGCD 2BJOA 2FJ7D 3WKJD 2RIQA 3MNNC 3KWQD 3AZMB 1KX3B 5E5AA 5AVBC 3REKB 1KX5A 4ZUXD 3WA9B 4LD9A 2QREB 1N8R2 3P5JB 5AV8B 4DRAA 1N2FA 4E2YA 1HQ3B 4XZQC 5CP6B 3UT9D 5B1MC 3AZHC 1VLAA 3GTLI 3W98D 3REIA 2JMOA 1YITZ 5B0ZD 3W96D 5DNNA 3I551 4KUDB 4NH1C 3CXCZ 3OW2Z 5AV5A 3F3FC 4CSRA 1P3GB 3FQMA 2Y2HA 3LZ0D 2Y2KA 3W99D 3AZEC 1JJ2Z 2J8PA 1M1AD 3AZFB 3LZ1B 2QKDA 4Z66B 3CCS1 1RQFA 3VH6W 2R92I 2NVXI 4Z5TA 1S32B 3KUYA 3MGPC 4A3DI 1DL6A 5T67A 2Y2PA 5GSUB 3U50C 4E2WA 1RO0A 4QLCA 4X23A 2RT9A 2OTLZ 4CAYA 3TU4D 5GXQD 4YM6A 3B6GD 3S17I 4WU8C 1ZLAD 4J8UC 2VUGA 2HIOD 1K9M1 3NDIA 3MZLB 1ID3D 1M18B 5E5AD 3J80f 5CPJA 4MD9A 1YIT1 3GTKI 3WAAD 5AV6B 3J80b 4A3EI 2M6NA 3NQJA 2F8NB 1P3IC 3T4NB 3S15I 3MONA 5BO0B 1KX3A 2YFWB 1KD12 3WA9A 1F66B 3GTQI 3A6ND 4H9RA 1YUAA 4J8VC 3AZNB 2CV5C 3X1UC 5CPKA 2RVQC 3REHA 2DE5A 3CCJZ 2R93I 4A3FI 3AZGD 1P3OA 2F8NH 4XUJD 3FKII 5B2IB 1AOIA 3VB9A 3MGRB 5C4JI 1P3LC 3REJA 4G91C 3J7A4 3GTJI 3X1VA 5AV9A 1P3MD 5D1OB 3AZIB 1Z2CB 5BT1D 5GT3C 1VQ5Z 3AZJB 5CPIB 5B1LB 4Y52I 2YADA 3CCVZ 4J8XB 3KXBA 3RELC 5D1PA 3AV2B 1QVFY 3S14I 5BNXB 4NOZA 3WTPE 4MH4A 2IZ3A 5DNMB 3AZKC 3AN2D 3AZMD 2NZDB 3REKD 1TWFI 1YI2Z 5AV8D 1BH8A 3H0RC 3LJAC 4QTTA 4RVHA 5B33B 1HQ3D 5CP6D 5B40D 5AVCA 1NUIA 1KD11 3H0MC 2B63I 4EO5C 3CCQ1 2YFWA 1P34A 1P3BA 1KX5C 4KUDD 2K3RA 3IF8A 3B0DC 5T64A 2OOYB 1P3KB 3AZNA 1P3GD 2PYOC 3W96B 1Z02A 2YFVB 1VQ51 3VH6A 3UTBA 2W8SA 1LQLA 3REIC 3K7AI 3S2HI 3AZFD 3LZ1D 5C3EI 4Z66D 5B32A 4A3LI 1TZYA 3EPLA 2QRDB 4NBHA 4H9PB 1EQZB 2FFFB 5AV5C 1S32D 2NVYI 3CC2Z 2PK7A 3CPWY 5GSUD 1RO2A 4J8WA 4NBDA 1QF8A 3AFAD 3CXCY 1N1JB 3EEDA 3AZIA 1WCMI 4XX2A 1VQOZ 3MGQB 2Y2NA 1YJNZ 1JJ2Y 2F2AC 4Z5TC 3C1BC 3UTAB 5B1LA 3KUYC 5CPIA 2O4HA 1YIJZ 1L1OC 4E44A 1P3PB 1M18D 3AL0C 1JFIA 1ZLAB 4X23C 4BBRI 4JJNA 5AV6D 5AY8B 4YM6C 5BNXA 5JRGC 5B0YA 4R8PB 1ID3B 2DF4C 3O62A 1KX4B 2F8ND 1Q812 5DNMA 2NZDA 2Q4ZA 4QTUA 4WU9B 1Q7Y1 3RZDI 1VQ9Z 1F66D 3W97C 4KGCA 5CPJC 1YUKA 2JR6A 1YJ9Z 2FJ7A 3WKJA 3AZND 3KWQA 4ZUXA 4DK1A 3AV1B 5C44I 1P3AB 3HOXI 3UT9A 1VQPZ 1K8A2 3CD61 2XD5A 1KX3C 4NBBA 4E33A 3W98A 2IO5B 3MNND 3GCFA 5B0ZA 3W96A 5B2ID 1X3ZA 4RVFA 3MGRD 1WWSA 1VQO1 3AZGB 5CPKC 5G49B 3AYWB 1YJN1 3AZHD 4YS3D 3REHC 1R4VA 1VQKZ 3LZ0A 4BY1I 1I6HI 3W99A 3GTMS 3D9XA 4H9PA 1M1AA 4WZSB 3AZJD 1P3OC 5CPID 1AOIC 1P9NA 4HGYA 1Q862 4NFTA 2NQBB 1M1K1 3REJC 1F1EA 3D6WA 4J8XD 1Y1VI 3X1TD 5B31B 5AV9C 3X1VC 3CCL1 3AV2D 1VQ91 3G4SZ 3TU4A 5GXQA 3B6GA 3CMEZ 4ZBJC 2JA5I 2BYMA 4RVDA 1ZLAA 1Q811 2HIOA 3F6TA 5B2JB 1VQ7Z 3KXBC 4A3BI 1ID3A 3AN2B 3WTPB 5B33D 1P3FB 1VQP1 5BNVA 2ZY5A 3WAAA 2QRCB 5B40B 4H9QA 3EPJA 3MGSB 2PM9A 1BH9B 3ESWA 5FLXf 3CPWZ 1VQM1 2NVTI 2QR1B 1P3KD 5FLXb 2ZY2A 2ZM5A 4NBGA 4E31A 5AVCC 2JA8I 3I4MI 3A6NA 3S1NI 2E2II 3VTNA 2WAQA 1P34C 1P3BC 3MVDB 3LELB 3NH8A 3C1CB 1EQZD 1KC82 4H9NB 3AZGA 3UTBC 4XUJA 2HU9A 1VQLZ 3G4S1 5B32C 5JA4A 1U35D 1TZYC 3MGQD 2W04A 3CME1 1T3UA 5F99C 2ZY4A 3AFAB 3UTAD 1P3MA 4NB8A 4NBCA 1VQ71 2AROB 5FUGA 3M4OI 2LY8A 4J8WC 1P3PD 3X1SB 5AY8D 4R8PD 2K5RA 1KX4D 2EGTA 3B0CW 1M19B 2DE7A 2BG1A 4WU9D 1N8R1 1QVGZ 3NH4A 1X3WA 5B2JA 3AN2A 2Y2JA 3AZMA 4JJNC 1TWHI 3REKA 3RELD 1TWAI 5B0YC 3O62C 5GT0B 5AV8A 3AV1D 1P3AD 2DQNC 1HQ3A 4NE6A 5B40A 5CP6A 1BH9A 1VQL1 4KGCC 1KRLA 3KSYA 4BBSI 2FJ7C 3WKJC 1Z03A 1H3OB 5B24B 3KWQC 4KUDA 3MZKB 2O53A 1KQSZ 4ZUXC 3AYWD 3MNNB 3CCLZ 1KC81 1P3GA 4H9OB 5B32G 5AVBB 1S72Z 2OTL1 3UT9C 3G6EZ 5C3IC 2R7ZI 4UUZB 1TWCI 3AZLC 3W98C 4XZQB 3AZHB 3AZFA 3LZ1A 4H9NA 5B1MB 3W96C 5B0ZC 4Z66A 2UWXA 3A1KA 4YS3B 3CC7Z 2NQBD 2PYOD 1PZRA 3HOWI 1S32A 1KU5A 5B31D 3LZ0C 5GSUA 3W99C 3EG5B 1M1AC 3AFAA 3JAMf 3AZEB 3KFUG 4HGZA 3X1TB 1YHQZ 3JAMb 5B2JD 1M902 3VH6T 2JUBA 3VMGA 1HTAA 3WTPD 1P3FD 3HOVI 1M18A 2I3CA 3MGPB 1ML8A 3CCJ1 1B6WA 5AV6A 2Y2QA 5GXQC 3TU4C 3B6GC 3C1BD 3MGSD 4HGAC 3R45B 2F8NA 2ZAEB 1YJWZ 2HIOC 4WU8B 4G92B 1S721 2HUEC 5BO0A 4J8UB 2J6AA 3G6E1 4LD9C 5E5AC 1F66A 2E2JI 5JRGD 3WAAC 2W03A 3CC71 1BFMA 3MVDD 3LELD 3C1CD 1VQNZ 3W97D 5DNNC 3CCRZ 3MNNA 3CCV1 2H85A 3A6NC 5B2IA 2V8JA 3B6FD 3MGRA 3EPKA 4J8VB 4RS4A 3AZHA 2G5HC 5KDMB 3X1UB 4YS3A 2CV5B 5D1OA 2AROD 1U35B 3VH5W 4CL1A 3AZJA 4MD7A 4XUJC 1YI21 4AWLC 1VQ6Z 3X1SD 3CCR1 4NE3A 1M901 4QLCC 4J8XA 1P3LB 3X1TA 3FQQA 4G91B 1P3MC 1M19D 4KHAB 5BT1C 3AV2A 1ZH1A 3PO3S 4A3KI 4WJ3C 5GT3B 2Y0SA 3H3VJ 2Y2MA 2JCHA 2BYKB 4Z2MG 3HOYI 3I4NI 3NH5A 5GT0D 3NFZA 5B33A 4NFRA 3RELB 1I50I 1SFOI 4E45A 4E2ZA 3CC21 3AZMC 5B24D 4E2XA 3REKC 1Q822 4BXXI 3WA9C 3AZKB 4TNUA 1WWIA 3B0BA 1P3KA 5AV8C 2M48A 5AVBD 1QVGY 2ZY3A 1HQ3C 1Q9CA 2YFVA 5CP6C 3LJAB 4XZQD 2JSSA 3EERA 5B1MD 1YIJ1 1K732 4KUDC 1USPB 1VQ4Z 1VQ8Z 4EO5B 1EQZA 1KX5B 1YHQ1 1P3GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 3B0D B;  2RHB A;  3CCE Z;  2G5I C;  2G2K A;  2HF1 A;  2PYO B;  2QA4 Z;  2LFU A;  1KQS Y;  3AZE D;  4NE5 A;  1N1J A;  1B67 A;  4Z66 C;  3LZ1 C;  3AZF C;  4DRB A;  3REI B;  3MGQ A;  1U35 A;  2E9H A;  3I56 Z;  3UTA A;  1YJ9 1;  1S32 C;  1NJI 2;  5GSU C;  5BS7 A;  5AV5 B;  4CSR B;  3MGP D;  1P3P A;  2OTJ Z;  3AFA C;  2F8N K;  4KHA A;  2Y2I A;  5AY8 A;  5F99 D;  4R8P A;  1KX4 A;  3HOU I;  4WU8 D;  3S1R I;  4WU9 A;  4J8U D;  3GTM I;  4Z5T B;  3C1B B;  1M18 C;  3KUY B;  3I55 Z;  5A2Q f;  1VQK 1;  1K8A 1;  3G71 Z;  5AV6 C;  1TFI A;  1Z01 A;  3REL A;  3BG1 B;  4NB9 A;  4EWC A;  5FLM I;  5A2Q b;  4CAY B;  3AV1 A;  1P3A A;  4YM6 B;  1VQ8 1;  5JRG B;  3CCE 1;  2PMZ A;  3CQZ I;  1P3I D;  1F66 C;  2KI7 B;  1Q16 A;  4MXU A;  3CCS Z;  1W2E A;  1K73 1;  4NBE A;  3AZN C;  3W97 B;  3I56 1;  3VH5 A;  5CPJ B;  5G49 A;  4J8V D;  3AYW A;  3EPH A;  1WII A;  2CV5 D;  1K9M 2;  2JE5 A;  3X1U D;  2WB1 A;  1Q86 1;  2RVQ D;  3B6F B;  2IZ4 A;  3NQJ B;  1USP A;  2OTJ 1;  3IX0 A;  2CWE A;  5B2I C;  2JA7 I;  3M3Y I;  3MGR C;  2NQB A;  4H9R B;  3BG0 B;  2Y2L A;  2PYO A;  5IT9 f;  1NJI 1;  4WNN B;  4YS3 C;  1P3L D;  5B31 A;  5CPK B;  3AZL D;  3AZI C;  2RBL A;  5IT9 b;  3REH B;  1SIW A;  3AZJ C;  2VPZ A;  1TAF B;  5GT3 D;  3CC4 Z;  3NDJ A;  5CPI C;  3GTP I;  1P3O B;  5B1L C;  1Y8C A;  2V8K A;  4NBA A;  4E32 A;  4WV4 B;  3G71 1;  1ZB9 A;  1AOI B;  1I3Q I;  1ZB8 A;  4J8X C;  3REJ B;  2L5A A;  3X1T C;  1QXF A;  3WTP A;  3AV2 C;  1P3F A;  2F4O A;  2Q51 A;  3X1V B;  5AV9 B;  2F8N G;  2JS4 A;  1Y1W I;  5DNM C;  3GKQ A;  2NZD C;  5IP9 I;  3C1B A;  3MGS A;  3AZK D;  2XD1 A;  4ZBJ B;  3CMA Z;  5B33 C;  3KXB B;  3LJA D;  2QEX Z;  5JRG A;  4G92 C;  1RLY A;  3MVD A;  3LEL A;  1K83 I;  4MON A;  3C1C A;  1P3K C;  1KX5 D;  4LD9 D;  3W97 A;  3RZO I;  4RV9 A;  2IV2 X;  3S1Q I;  1BH8 B;  2LIY A;  2KPI A;  4UPK A;  3CC4 1;  5AVC B;  3B6F A;  3REI D;  1W2B Z;  3NQU B;  5DNN D;  1EQZ C;  2Y2G A;  1P34 B;  1P3B B;  2ARO A;  3CCM Z;  5IP7 I;  5AV5 D;  4DGL A;  4M6B A;  4WNN A;  4A3C I;  3X1S A;  2OZK A;  3UTB B;  4H9S A;  1U35 C;  4A3I I;  3MGQ C;  1TAF A;  2VPW A;  5B32 B;  1TZY B;  3UTA C;  1M19 A;  4NBF A;  3CMA 1;  5F99 B;  3H0G I;  4Z5T D;  4A93 I;  5BS7 C;  3KUY D;  1P3P C;  2P3Y A;  1ZLA C;  2RPR A;  3CCQ Z;  2QEX 1;  4J8W B;  1ID3 C;  5AY8 C;  4QLC D;  4X23 D;  4R8P C;  1KX4 C;  5GT0 A;  2QLV B;  4YM6 D;  2VF1 A;  3HKZ A;  3KIH A;  4WU9 C;  3B0C T;  3F3P C;  3LUS A;  1H3O A;  5B24 A;  1JFI B;  5CPJ D;  1X0T A;  1P3I B;  4JJN B;  3AV1 C;  1P3A C;  4RVG A;  4H9O A;  5AVB A;  5B0Y B;  3O62 B;  1TWG I;  3CCM 1;  3PO2 I;  4UUZ A;  2E2H I;  3S2D I;  2IO5 C;  2VQR A;  4XZQ A;  5B1M A;  1KX3 D;  3WA9 D;  4DQY B;  4Y7N I;  4KGC B;  2P28 A;  3AZG C;  2FJ7 B;  3WKJ B;  3AYW C;  3KWQ B;  1Q7Y 2;  5CPK D;  4ZUX B;  1Q82 1;  4BY7 I;  3REH D;  3NQU A;  3V9R B;  3Q87 A;  3UT9 B;  3AZE A;  5C3I B;  1P3O D;  3AZL B;  3W98 B;  1YJW 1;  3FDD A;  3D2L A;  2NQB C;  5B0Z B;  2VUM I;  1AOI D;  2GTH A;  1S7M A;  2JNY A;  3CCU Z;  3REJ D;  5B31 C;  5C4X I;  3J81 f;  3MGP A;  5AV9 D;  3LZ0 B;  3X1V D;  2GTI A;  3I07 A;  3W99 B;  3J81 b;  3IP4 C;  1VQN 1;  1M1A B;  5F99 A;  2V45 A;  3QWU A;  3R45 A;  3CD6 Z;  3H0L C;  5B2J C;  4WU8 A;  3IFU A;  3TDH B;  4A3M I;  5CHL B;  4J8U A;  3WTP C;  3AN2 C;  1P3F C;  2F4M A;  4A3J I;  3KXB D;  3OW2 Y;  2R6M A;  4MRI A;  4AYB A;  4S1T A;  3S16 I;  1M1K 2;  5B40 C;  2OOX B;  3MGS C;  3TU4 B;  5GXQ B;  3B6G B;  4HGA B;  1VQ6 1;  2BYM B;  3GTO I;  2HIO B;  1P3I A;  3PO3 I;  2HUE B;  4LD9 B;  5E5A B;  5BNV B;  5AVC D;  2LEX A;  1WW9 A;  4J8V A;  3MVD C;  3LEL C;  3WAA B;  2CV5 A;  3C1C C;  5KDM A;  3X1U A;  4H9Q B;  1P34 D;  1P3B D;  3KIF A;  2JIO A;  5CM2 M;  3CCU 1;  3GTG I;  3S1M I;  1Y1V S;  2V8I A;  5DNN B;  1RO4 A;  2AKL A;  5B31 G;  3UTB D;  3B6F C;  4E30 A;  3A6N B;  4X6A I;  3V9R A;  1A7W A;  5B32 D;  3A1I A;  1P3L A;  1TZY D;  1PFT A;  4Z2M H;  3AZL A;  4A3G I;  2ARO C;  1R9T I;  3VMI A;  5GT3 A;  1ULY A;  3VH5 T;  1JWH C;  1QYP A;  1NP6 A;  1VQM Z;  4J8W D;  3X1S C;  1W2B Y;  4XUJ B;  2BYK A;  4H9S C;  4AWL B;  5T6B A;  1QVF Z;  1RNI A;  3AZI D;  5JA4 B;  2GU2 A;  4MD8 A;  2Y2O A;  1M19 C;  2DE6 A;  4QLC B;  4X23 B;  1VQ4 1;  1P3M B;  5AN9 F;  5B1L D;  5FUG B;  2YU9 I;  3AZK A;  3VMH A;  3HOZ I;  4JJN D;  5GT0 C;  5LL6 f;  3TE5 B;  2QA4 1;  5B0Y D;  3O62 D;  4HH4 A;  3LJA A;  5DNM D;  2JA6 I;  2NZD D;  2NVQ I;  5B24 C;  4KGC D;  2BJO A;  2FJ7 D;  3WKJ D;  2RIQ A;  3MNN C;  3KWQ D;  3AZM B;  1KX3 B;  5E5A A;  5AVB C;  3REK B;  1KX5 A;  4ZUX D;  3WA9 B;  4LD9 A;  2QRE B;  1N8R 2;  3P5J B;  5AV8 B;  4DRA A;  1N2F A;  4E2Y A;  1HQ3 B;  4XZQ C;  5CP6 B;  3UT9 D;  5B1M C;  3AZH C;  1VLA A;  3GTL I;  3W98 D;  3REI A;  2JMO A;  1YIT Z;  5B0Z D;  3W96 D;  5DNN A;  3I55 1;  4KUD B;  4NH1 C;  3CXC Z;  3OW2 Z;  5AV5 A;  3F3F C;  4CSR A;  1P3G B;  3FQM A;  2Y2H A;  3LZ0 D;  2Y2K A;  3W99 D;  3AZE C;  1JJ2 Z;  2J8P A;  1M1A D;  3AZF B;  3LZ1 B;  2QKD A;  4Z66 B;  3CCS 1;  1RQF A;  3VH6 W;  2R92 I;  2NVX I;  4Z5T A;  1S32 B;  3KUY A;  3MGP C;  4A3D I;  1DL6 A;  5T67 A;  2Y2P A;  5GSU B;  3U50 C;  4E2W A;  1RO0 A;  4QLC A;  4X23 A;  2RT9 A;  2OTL Z;  4CAY A;  3TU4 D;  5GXQ D;  4YM6 A;  3B6G D;  3S17 I;  4WU8 C;  1ZLA D;  4J8U C;  2VUG A;  2HIO D;  1K9M 1;  3NDI A;  3MZL B;  1ID3 D;  1M18 B;  5E5A D;  3J80 f;  5CPJ A;  4MD9 A;  1YIT 1;  3GTK I;  3WAA D;  5AV6 B;  3J80 b;  4A3E I;  2M6N A;  3NQJ A;  2F8N B;  1P3I C;  3T4N B;  3S15 I;  3MON A;  5BO0 B;  1KX3 A;  2YFW B;  1KD1 2;  3WA9 A;  1F66 B;  3GTQ I;  3A6N D;  4H9R A;  1YUA A;  4J8V C;  3AZN B;  2CV5 C;  3X1U C;  5CPK A;  2RVQ C;  3REH A;  2DE5 A;  3CCJ Z;  2R93 I;  4A3F I;  3AZG D;  1P3O A;  2F8N H;  4XUJ D;  3FKI I;  5B2I B;  1AOI A;  3VB9 A;  3MGR B;  5C4J I;  1P3L C;  3REJ A;  4G91 C;  3J7A 4;  3GTJ I;  3X1V A;  5AV9 A;  1P3M D;  5D1O B;  3AZI B;  1Z2C B;  5BT1 D;  5GT3 C;  1VQ5 Z;  3AZJ B;  5CPI B;  5B1L B;  4Y52 I;  2JIQ A;  2YAD A;  3CCV Z;  4J8X B;  3KXB A;  3REL C;  5D1P A;  3AV2 B;  1QVF Y;  3S14 I;  5BNX B;  4NOZ A;  3WTP E;  4MH4 A;  2IZ3 A;  5DNM B;  3AZK C;  3AN2 D;  3AZM D;  2NZD B;  3REK D;  1TWF I;  2AYD A;  1YI2 Z;  5AV8 D;  1BH8 A;  3H0R C;  3LJA C;  4QTT A;  4RVH A;  5B33 B;  1HQ3 D;  5CP6 D;  5B40 D;  5AVC A;  1NUI A;  1KD1 1;  3H0M C;  2B63 I;  4EO5 C;  3CCQ 1;  2YFW A;  1P34 A;  1P3B A;  1KX5 C;  4KUD D;  2K3R A;  3IF8 A;  3B0D C;  5T64 A;  2OOY B;  1P3K B;  3AZN A;  1P3G D;  2PYO C;  3W96 B;  1Z02 A;  2YFV B;  1VQ5 1;  3VH6 A;  1WJ2 A;  3UTB A;  2W8S A;  1LQL A;  3REI C;  3K7A I;  3S2H I;  3AZF D;  3LZ1 D;  5C3E I;  4Z66 D;  5B32 A;  4A3L I;  1TZY A;  3EPL A;  2QRD B;  4NBH A;  4H9P B;  1EQZ B;  2FFF B;  5AV5 C;  1S32 D;  2NVY I;  3CC2 Z;  2PK7 A;  3CPW Y;  5GSU D;  1RO2 A;  4J8W A;  4NBD A;  1QF8 A;  3AFA D;  3CXC Y;  1N1J B;  3EED A;  3AZI A;  1WCM I;  4XX2 A;  1VQO Z;  3MGQ B;  2Y2N A;  1YJN Z;  1JJ2 Y;  2F2A C;  4Z5T C;  3C1B C;  3UTA B;  5B1L A;  3KUY C;  5CPI A;  2O4H A;  1YIJ Z;  1L1O C;  4E44 A;  1P3P B;  1M18 D;  3AL0 C;  1JFI A;  1ZLA B;  4X23 C;  4BBR I;  4JJN A;  5AV6 D;  5AY8 B;  4YM6 C;  5BNX A;  5JRG C;  5B0Y A;  4R8P B;  1ID3 B;  2JIP A;  2DF4 C;  3O62 A;  1KX4 B;  2F8N D;  1Q81 2;  5DNM A;  2NZD A;  2Q4Z A;  4QTU A;  4WU9 B;  1Q7Y 1;  3RZD I;  1VQ9 Z;  1F66 D;  3W97 C;  4KGC A;  5CPJ C;  1YUK A;  2JR6 A;  1AA6 A;  2FJ7 A;  3WKJ A;  3AZN D;  3KWQ A;  1YJ9 Z;  4ZUX A;  4DK1 A;  3AV1 B;  5C44 I;  1P3A B;  3HOX I;  3UT9 A;  1VQP Z;  1K8A 2;  3CD6 1;  2XD5 A;  1KX3 C;  4NBB A;  4E33 A;  3W98 A;  2IO5 B;  3MNN D;  3GCF A;  5B0Z A;  3W96 A;  5B2I D;  1X3Z A;  4RVF A;  3MGR D;  1WWS A;  1VQO 1;  3AZG B;  5CPK C;  5G49 B;  3AYW B;  1YJN 1;  3AZH D;  4YS3 D;  3REH C;  1R4V A;  1VQK Z;  3LZ0 A;  4BY1 I;  1I6H I;  3W99 A;  3GTM S;  3D9X A;  4H9P A;  1M1A A;  4WZS B;  3AZJ D;  1P3O C;  2VPY A;  5CPI D;  1AOI C;  1P9N A;  4HGY A;  1Q86 2;  4NFT A;  2NQB B;  1M1K 1;  3REJ C;  1F1E A;  3D6W A;  4J8X D;  1Y1V I;  3X1T D;  5B31 B;  5AV9 C;  3X1V C;  3CCL 1;  3AV2 D;  1VQ9 1;  3G4S Z;  3TU4 A;  5GXQ A;  3B6G A;  3CME Z;  4ZBJ C;  2JA5 I;  2BYM A;  4RVD A;  1ZLA A;  1Q81 1;  2HIO A;  3F6T A;  5B2J B;  1VQ7 Z;  3KXB C;  4A3B I;  1ID3 A;  3AN2 B;  3WTP B;  5B33 D;  1P3F B;  1VQP 1;  5BNV A;  2ZY5 A;  3WAA A;  2QRC B;  5B40 B;  4H9Q A;  3EPJ A;  3MGS B;  2PM9 A;  1BH9 B;  3ESW A;  5FLX f;  3CPW Z;  1VQM 1;  2NVT I;  2QR1 B;  1P3K D;  5FLX b;  2ZY2 A;  2ZM5 A;  4NBG A;  4E31 A;  5AVC C;  2JA8 I;  3I4M I;  3A6N A;  3S1N I;  2E2I I;  3VTN A;  2WAQ A;  1P34 C;  1P3B C;  3MVD B;  3LEL B;  3NH8 A;  3C1C B;  1EQZ D;  1KC8 2;  2E7Z A;  4H9N B;  3AZG A;  3UTB C;  4XUJ A;  2HU9 A;  1VQL Z;  3G4S 1;  5B32 C;  5JA4 A;  1U35 D;  1TZY C;  3MGQ D;  2W04 A;  3CME 1;  1T3U A;  5F99 C;  2ZY4 A;  3AFA B;  3UTA D;  1P3M A;  4NB8 A;  4NBC A;  1VQ7 1;  2ARO B;  5FUG A;  3M4O I;  2LY8 A;  4J8W C;  1P3P D;  3X1S B;  1FDI A;  5AY8 D;  4R8P D;  2K5R A;  1KX4 D;  2EGT A;  3B0C W;  1M19 B;  2DE7 A;  2BG1 A;  4WU9 D;  1N8R 1;  1QVG Z;  2V3V A;  3NH4 A;  1X3W A;  5B2J A;  3AN2 A;  2Y2J A;  3AZM A;  4JJN C;  1TWH I;  3REK A;  3REL D;  1TWA I;  5B0Y C;  3O62 C;  5GT0 B;  5AV8 A;  3AV1 D;  1P3A D;  2DQN C;  1HQ3 A;  4NE6 A;  5B40 A;  5CP6 A;  1BH9 A;  1VQL 1;  4KGC C;  1KRL A;  3KSY A;  4BBS I;  2FJ7 C;  3WKJ C;  1Z03 A;  1H3O B;  5B24 B;  3KWQ C;  4KUD A;  3MZK B;  2O53 A;  1KQS Z;  4ZUX C;  3AYW D;  3MNN B;  3CCL Z;  1KC8 1;  1P3G A;  4H9O B;  5B32 G;  5AVB B;  1S72 Z;  2OTL 1;  3UT9 C;  3G6E Z;  5C3I C;  2R7Z I;  4UUZ B;  1TWC I;  3AZL C;  3W98 C;  4XZQ B;  3AZH B;  3AZF A;  3LZ1 A;  4H9N A;  5B1M B;  3W96 C;  5B0Z C;  4Z66 A;  2UWX A;  3A1K A;  4YS3 B;  3CC7 Z;  2NQB D;  2PYO D;  1PZR A;  3HOW I;  1S32 A;  1KU5 A;  5B31 D;  3LZ0 C;  5GSU A;  3W99 C;  3EG5 B;  1M1A C;  3AFA A;  3JAM f;  3AZE B;  3KFU G;  4HGZ A;  3X1T B;  1YHQ Z;  3JAM b;  1WZN A;  5B2J D;  1M90 2;  3VH6 T;  2JUB A;  3VMG A;  1HTA A;  3WTP D;  1P3F D;  3HOV I;  1M18 A;  2I3C A;  3MGP B;  1ML8 A;  3CCJ 1;  1B6W A;  5AV6 A;  2Y2Q A;  5GXQ C;  3TU4 C;  3B6G C;  3C1B D;  3MGS D;  4HGA C;  3R45 B;  2F8N A;  2ZAE B;  1YJW Z;  2HIO C;  4WU8 B;  4G92 B;  1S72 1;  2VPX A;  2HUE C;  5BO0 A;  4J8U B;  2J6A A;  3G6E 1;  4LD9 C;  5E5A C;  1F66 A;  2E2J I;  5JRG D;  3WAA C;  2W03 A;  3CC7 1;  1BFM A;  3MVD D;  3LEL D;  3C1C D;  1VQN Z;  3W97 D;  5DNN C;  3CCR Z;  3MNN A;  3CCV 1;  2H85 A;  3A6N C;  2NAP A;  5B2I A;  2V8J A;  3B6F D;  3MGR A;  3EPK A;  4J8V B;  4RS4 A;  3AZH A;  2G5H C;  5KDM B;  3X1U B;  4YS3 A;  2CV5 B;  1FDO A;  5D1O A;  2ARO D;  1U35 B;  3VH5 W;  4CL1 A;  3AZJ A;  4MD7 A;  4XUJ C;  1YI2 1;  4AWL C;  1VQ6 Z;  3X1S D;  3CCR 1;  4NE3 A;  1M90 1;  4QLC C;  4J8X A;  1P3L B;  3X1T A;  3FQQ A;  4G91 B;  1P3M C;  1M19 D;  4KHA B;  5BT1 C;  3AV2 A;  1ZH1 A;  3PO3 S;  4A3K I;  4WJ3 C;  5GT3 B;  2Y0S A;  3H3V J;  2Y2M A;  2JCH A;  2BYK B;  4Z2M G;  3HOY I;  3I4N I;  3NH5 A;  5GT0 D;  3NFZ A;  5B33 A;  4NFR A;  3REL B;  1I50 I;  2JIR A;  1SFO I;  4E45 A;  4E2Z A;  3CC2 1;  2JIM A;  3AZM C;  5B24 D;  4E2X A;  3REK C;  1Q82 2;  4BXX I;  3WA9 C;  3AZK B;  4TNU A;  1WWI A;  3B0B A;  1P3K A;  5AV8 C;  2M48 A;  5AVB D;  1QVG Y;  2ZY3 A;  1HQ3 C;  1Q9C A;  2YFV A;  5CP6 C;  3LJA B;  4XZQ D;  2JSS A;  3EER A;  5B1M D;  1YIJ 1;  1K73 2;  4KUD C;  1USP B;  1VQ4 Z;  1VQ8 Z;  4EO5 B;  1EQZ A;  3IR7 A;  1KX5 B;  1YHQ 1;  1P3G C; 
#chains in the Genus database with same CATH homology
 3B0D B;  2RHB A;  3CCE Z;  2G5I C;  2G2K A;  2HF1 A;  2PYO B;  2QA4 Z;  2LFU A;  1KQS Y;  3AZE D;  4NE5 A;  1N1J A;  1B67 A;  4Z66 C;  3LZ1 C;  3AZF C;  4DRB A;  3REI B;  3MGQ A;  1U35 A;  2E9H A;  3I56 Z;  3UTA A;  1YJ9 1;  1S32 C;  1NJI 2;  5GSU C;  5BS7 A;  5AV5 B;  4CSR B;  3MGP D;  1P3P A;  2OTJ Z;  3AFA C;  2F8N K;  4KHA A;  2Y2I A;  5AY8 A;  5F99 D;  4R8P A;  1KX4 A;  3HOU I;  4WU8 D;  3S1R I;  4WU9 A;  4J8U D;  3GTM I;  4Z5T B;  3C1B B;  1M18 C;  3KUY B;  3I55 Z;  5A2Q f;  1VQK 1;  1K8A 1;  3G71 Z;  5AV6 C;  1TFI A;  1Z01 A;  3REL A;  3BG1 B;  4NB9 A;  4EWC A;  5FLM I;  5A2Q b;  4CAY B;  3AV1 A;  1P3A A;  4YM6 B;  1VQ8 1;  5JRG B;  3CCE 1;  2PMZ A;  3CQZ I;  1P3I D;  1F66 C;  2KI7 B;  4MXU A;  3CCS Z;  1K73 1;  1W2E A;  4NBE A;  3AZN C;  3W97 B;  3I56 1;  3VH5 A;  5CPJ B;  5G49 A;  4J8V D;  3AYW A;  3EPH A;  1WII A;  2CV5 D;  1K9M 2;  2JE5 A;  3X1U D;  2WB1 A;  1Q86 1;  2RVQ D;  3B6F B;  2IZ4 A;  3NQJ B;  1USP A;  2OTJ 1;  3IX0 A;  2CWE A;  5B2I C;  2JA7 I;  3M3Y I;  3MGR C;  2NQB A;  4H9R B;  3BG0 B;  2Y2L A;  2PYO A;  5IT9 f;  1NJI 1;  4WNN B;  4YS3 C;  1P3L D;  5B31 A;  5CPK B;  3AZL D;  3AZI C;  2RBL A;  5IT9 b;  3REH B;  3AZJ C;  1TAF B;  5GT3 D;  3CC4 Z;  3NDJ A;  5CPI C;  3GTP I;  1P3O B;  5B1L C;  2V8K A;  4NBA A;  4E32 A;  3G71 1;  4WV4 B;  1ZB9 A;  1AOI B;  1I3Q I;  1ZB8 A;  4J8X C;  3REJ B;  2L5A A;  3X1T C;  3WTP A;  3AV2 C;  1P3F A;  2F4O A;  2Q51 A;  3X1V B;  5AV9 B;  2F8N G;  2JS4 A;  1Y1W I;  5DNM C;  3GKQ A;  2NZD C;  5IP9 I;  3C1B A;  3MGS A;  3AZK D;  2XD1 A;  4ZBJ B;  3CMA Z;  5B33 C;  3KXB B;  3LJA D;  2QEX Z;  5JRG A;  4G92 C;  1RLY A;  3MVD A;  3LEL A;  1K83 I;  4MON A;  3C1C A;  1P3K C;  1KX5 D;  4LD9 D;  3W97 A;  3RZO I;  4RV9 A;  3S1Q I;  1BH8 B;  2LIY A;  2KPI A;  4UPK A;  3CC4 1;  5AVC B;  3B6F A;  3REI D;  1W2B Z;  3NQU B;  5DNN D;  1EQZ C;  2Y2G A;  1P34 B;  1P3B B;  2ARO A;  3CCM Z;  5IP7 I;  5AV5 D;  4DGL A;  4M6B A;  4WNN A;  4A3C I;  3X1S A;  2OZK A;  3UTB B;  4H9S A;  1U35 C;  4A3I I;  3MGQ C;  1TAF A;  5B32 B;  1TZY B;  3UTA C;  1M19 A;  4NBF A;  3CMA 1;  5F99 B;  3H0G I;  4Z5T D;  4A93 I;  5BS7 C;  3KUY D;  1P3P C;  2P3Y A;  1ZLA C;  2RPR A;  3CCQ Z;  2QEX 1;  4J8W B;  1ID3 C;  5AY8 C;  4QLC D;  4X23 D;  4R8P C;  1KX4 C;  5GT0 A;  2QLV B;  4YM6 D;  2VF1 A;  3HKZ A;  3KIH A;  4WU9 C;  3B0C T;  3F3P C;  3LUS A;  1H3O A;  5B24 A;  1JFI B;  5CPJ D;  1X0T A;  1P3I B;  4JJN B;  3AV1 C;  1P3A C;  4RVG A;  4H9O A;  5AVB A;  5B0Y B;  3O62 B;  1TWG I;  3CCM 1;  3PO2 I;  4UUZ A;  2E2H I;  3S2D I;  2IO5 C;  2VQR A;  4XZQ A;  5B1M A;  1KX3 D;  3WA9 D;  4DQY B;  4Y7N I;  4KGC B;  2P28 A;  3AZG C;  2FJ7 B;  3WKJ B;  3AYW C;  3KWQ B;  1Q7Y 2;  5CPK D;  4ZUX B;  1Q82 1;  4BY7 I;  3REH D;  3NQU A;  3V9R B;  3Q87 A;  3UT9 B;  3AZE A;  5C3I B;  1P3O D;  3AZL B;  3W98 B;  1YJW 1;  3FDD A;  2VUM I;  2NQB C;  5B0Z B;  1AOI D;  2GTH A;  1S7M A;  2JNY A;  3CCU Z;  3REJ D;  5B31 C;  5C4X I;  3J81 f;  3MGP A;  5AV9 D;  3LZ0 B;  3X1V D;  2GTI A;  3I07 A;  3W99 B;  3J81 b;  3IP4 C;  1VQN 1;  1M1A B;  5F99 A;  3QWU A;  3R45 A;  3CD6 Z;  3H0L C;  5B2J C;  4WU8 A;  3IFU A;  3TDH B;  4A3M I;  5CHL B;  4J8U A;  3WTP C;  3AN2 C;  1P3F C;  2F4M A;  4A3J I;  3KXB D;  3OW2 Y;  2R6M A;  4MRI A;  4AYB A;  4S1T A;  3S16 I;  1M1K 2;  5B40 C;  2OOX B;  3MGS C;  3TU4 B;  5GXQ B;  3B6G B;  4HGA B;  1VQ6 1;  2BYM B;  3GTO I;  2HIO B;  1P3I A;  3PO3 I;  2HUE B;  4LD9 B;  5E5A B;  5BNV B;  5AVC D;  1WW9 A;  4J8V A;  3MVD C;  3LEL C;  3WAA B;  2CV5 A;  3C1C C;  5KDM A;  3X1U A;  4H9Q B;  1P34 D;  1P3B D;  3KIF A;  5CM2 M;  3CCU 1;  3GTG I;  3S1M I;  1Y1V S;  2V8I A;  5DNN B;  1RO4 A;  2AKL A;  5B31 G;  3UTB D;  3B6F C;  4E30 A;  3A6N B;  4X6A I;  3V9R A;  1A7W A;  5B32 D;  3A1I A;  1P3L A;  1TZY D;  1PFT A;  4Z2M H;  3AZL A;  4A3G I;  2ARO C;  1R9T I;  3VMI A;  5GT3 A;  1ULY A;  3VH5 T;  1JWH C;  1QYP A;  1NP6 A;  1VQM Z;  4J8W D;  3X1S C;  1W2B Y;  4XUJ B;  2BYK A;  4H9S C;  4AWL B;  5T6B A;  1QVF Z;  1RNI A;  3AZI D;  5JA4 B;  2GU2 A;  4MD8 A;  2Y2O A;  1M19 C;  2DE6 A;  4QLC B;  4X23 B;  1VQ4 1;  1P3M B;  5AN9 F;  5B1L D;  5FUG B;  2YU9 I;  3AZK A;  3VMH A;  3HOZ I;  4JJN D;  5GT0 C;  5LL6 f;  3TE5 B;  2QA4 1;  5B0Y D;  3O62 D;  4HH4 A;  3LJA A;  5DNM D;  2JA6 I;  2NZD D;  2NVQ I;  5B24 C;  4KGC D;  2BJO A;  2FJ7 D;  3WKJ D;  2RIQ A;  3MNN C;  3KWQ D;  3AZM B;  1KX3 B;  5E5A A;  5AVB C;  3REK B;  1KX5 A;  4ZUX D;  3WA9 B;  4LD9 A;  2QRE B;  1N8R 2;  3P5J B;  5AV8 B;  4DRA A;  1N2F A;  4E2Y A;  1HQ3 B;  4XZQ C;  5CP6 B;  3UT9 D;  5B1M C;  3AZH C;  1VLA A;  3GTL I;  3W98 D;  3REI A;  2JMO A;  1YIT Z;  5B0Z D;  3W96 D;  5DNN A;  3I55 1;  4KUD B;  4NH1 C;  3CXC Z;  3OW2 Z;  5AV5 A;  3F3F C;  4CSR A;  1P3G B;  3FQM A;  2Y2H A;  3LZ0 D;  2Y2K A;  3W99 D;  3AZE C;  1JJ2 Z;  2J8P A;  1M1A D;  3AZF B;  3LZ1 B;  2QKD A;  4Z66 B;  3CCS 1;  1RQF A;  3VH6 W;  2R92 I;  2NVX I;  4Z5T A;  1S32 B;  3KUY A;  3MGP C;  4A3D I;  1DL6 A;  5T67 A;  2Y2P A;  5GSU B;  3U50 C;  4E2W A;  1RO0 A;  4QLC A;  4X23 A;  2RT9 A;  2OTL Z;  4CAY A;  3TU4 D;  5GXQ D;  4YM6 A;  3B6G D;  3S17 I;  4WU8 C;  1ZLA D;  4J8U C;  2VUG A;  2HIO D;  1K9M 1;  3NDI A;  3MZL B;  1ID3 D;  1M18 B;  5E5A D;  3J80 f;  5CPJ A;  4MD9 A;  1YIT 1;  3GTK I;  3WAA D;  5AV6 B;  3J80 b;  4A3E I;  2M6N A;  3NQJ A;  2F8N B;  1P3I C;  3T4N B;  3S15 I;  3MON A;  5BO0 B;  1KX3 A;  2YFW B;  1KD1 2;  3WA9 A;  1F66 B;  3GTQ I;  3A6N D;  4H9R A;  1YUA A;  4J8V C;  3AZN B;  2CV5 C;  3X1U C;  5CPK A;  2RVQ C;  3REH A;  2DE5 A;  3CCJ Z;  2R93 I;  4A3F I;  3AZG D;  1P3O A;  2F8N H;  4XUJ D;  3FKI I;  5B2I B;  1AOI A;  3VB9 A;  3MGR B;  5C4J I;  1P3L C;  3REJ A;  4G91 C;  3J7A 4;  3GTJ I;  3X1V A;  5AV9 A;  1P3M D;  5D1O B;  3AZI B;  1Z2C B;  5BT1 D;  5GT3 C;  1VQ5 Z;  3AZJ B;  5CPI B;  5B1L B;  4Y52 I;  2YAD A;  3CCV Z;  4J8X B;  3KXB A;  3REL C;  5D1P A;  3AV2 B;  1QVF Y;  3S14 I;  5BNX B;  4NOZ A;  3WTP E;  4MH4 A;  2IZ3 A;  5DNM B;  3AZK C;  3AN2 D;  3AZM D;  2NZD B;  3REK D;  1TWF I;  1YI2 Z;  5AV8 D;  1BH8 A;  3H0R C;  3LJA C;  4QTT A;  4RVH A;  5B33 B;  1HQ3 D;  5CP6 D;  5B40 D;  5AVC A;  1NUI A;  1KD1 1;  3H0M C;  2B63 I;  4EO5 C;  3CCQ 1;  2YFW A;  1P34 A;  1P3B A;  1KX5 C;  4KUD D;  2K3R A;  3IF8 A;  3B0D C;  5T64 A;  2OOY B;  1P3K B;  3AZN A;  1P3G D;  2PYO C;  3W96 B;  1Z02 A;  2YFV B;  1VQ5 1;  3VH6 A;  3UTB A;  2W8S A;  1LQL A;  3REI C;  3K7A I;  3S2H I;  3AZF D;  3LZ1 D;  5C3E I;  4Z66 D;  5B32 A;  4A3L I;  1TZY A;  3EPL A;  2QRD B;  4NBH A;  4H9P B;  1EQZ B;  2FFF B;  5AV5 C;  1S32 D;  2NVY I;  3CC2 Z;  2PK7 A;  3CPW Y;  5GSU D;  1RO2 A;  4J8W A;  4NBD A;  1QF8 A;  3AFA D;  3CXC Y;  1N1J B;  3EED A;  3AZI A;  1WCM I;  4XX2 A;  1VQO Z;  3MGQ B;  2Y2N A;  1YJN Z;  1JJ2 Y;  2F2A C;  4Z5T C;  3C1B C;  3UTA B;  5B1L A;  3KUY C;  5CPI A;  2O4H A;  1YIJ Z;  1L1O C;  4E44 A;  1P3P B;  1M18 D;  3AL0 C;  1JFI A;  1ZLA B;  4X23 C;  4BBR I;  4JJN A;  5AV6 D;  5AY8 B;  4YM6 C;  5BNX A;  5JRG C;  5B0Y A;  4R8P B;  1ID3 B;  2DF4 C;  3O62 A;  1KX4 B;  2F8N D;  1Q81 2;  5DNM A;  2NZD A;  2Q4Z A;  4QTU A;  4WU9 B;  1Q7Y 1;  3RZD I;  1VQ9 Z;  1F66 D;  3W97 C;  4KGC A;  5CPJ C;  1YUK A;  2JR6 A;  1YJ9 Z;  2FJ7 A;  3WKJ A;  3AZN D;  3KWQ A;  4ZUX A;  4DK1 A;  3AV1 B;  5C44 I;  1P3A B;  3HOX I;  3UT9 A;  1VQP Z;  1K8A 2;  3CD6 1;  2XD5 A;  1KX3 C;  4NBB A;  4E33 A;  3W98 A;  2IO5 B;  3MNN D;  3GCF A;  5B0Z A;  3W96 A;  5B2I D;  1X3Z A;  4RVF A;  3MGR D;  1WWS A;  1VQO 1;  3AZG B;  5CPK C;  5G49 B;  3AYW B;  1YJN 1;  3AZH D;  4YS3 D;  3REH C;  1R4V A;  1VQK Z;  3LZ0 A;  4BY1 I;  1I6H I;  3W99 A;  3GTM S;  3D9X A;  4H9P A;  1M1A A;  4WZS B;  3AZJ D;  1P3O C;  5CPI D;  1AOI C;  1P9N A;  4HGY A;  1Q86 2;  4NFT A;  2NQB B;  1M1K 1;  3REJ C;  1F1E A;  3D6W A;  4J8X D;  1Y1V I;  3X1T D;  5B31 B;  5AV9 C;  3X1V C;  3CCL 1;  3AV2 D;  1VQ9 1;  3G4S Z;  3TU4 A;  5GXQ A;  3B6G A;  3CME Z;  4ZBJ C;  2JA5 I;  2BYM A;  4RVD A;  1ZLA A;  1Q81 1;  2HIO A;  3F6T A;  5B2J B;  1VQ7 Z;  3KXB C;  4A3B I;  1ID3 A;  3AN2 B;  3WTP B;  5B33 D;  1P3F B;  1VQP 1;  5BNV A;  2ZY5 A;  3WAA A;  2QRC B;  5B40 B;  4H9Q A;  3EPJ A;  3MGS B;  2PM9 A;  1BH9 B;  3ESW A;  5FLX f;  3CPW Z;  1VQM 1;  2NVT I;  2QR1 B;  1P3K D;  5FLX b;  2ZY2 A;  2ZM5 A;  4NBG A;  4E31 A;  5AVC C;  2JA8 I;  3I4M I;  3A6N A;  3S1N I;  2E2I I;  3VTN A;  2WAQ A;  1P34 C;  1P3B C;  3MVD B;  3LEL B;  3NH8 A;  3C1C B;  1EQZ D;  1KC8 2;  4H9N B;  3AZG A;  3UTB C;  4XUJ A;  2HU9 A;  1VQL Z;  3G4S 1;  5B32 C;  5JA4 A;  1U35 D;  1TZY C;  3MGQ D;  2W04 A;  3CME 1;  1T3U A;  5F99 C;  2ZY4 A;  3AFA B;  3UTA D;  1P3M A;  4NB8 A;  4NBC A;  1VQ7 1;  2ARO B;  5FUG A;  3M4O I;  2LY8 A;  4J8W C;  1P3P D;  3X1S B;  5AY8 D;  4R8P D;  2K5R A;  1KX4 D;  2EGT A;  3B0C W;  1M19 B;  2DE7 A;  2BG1 A;  4WU9 D;  1N8R 1;  1QVG Z;  3NH4 A;  1X3W A;  5B2J A;  3AN2 A;  2Y2J A;  3AZM A;  4JJN C;  1TWH I;  3REK A;  3REL D;  1TWA I;  5B0Y C;  3O62 C;  5GT0 B;  5AV8 A;  3AV1 D;  1P3A D;  2DQN C;  1HQ3 A;  4NE6 A;  5B40 A;  5CP6 A;  1BH9 A;  1VQL 1;  4KGC C;  1KRL A;  3KSY A;  4BBS I;  2FJ7 C;  3WKJ C;  1Z03 A;  1H3O B;  5B24 B;  3KWQ C;  4KUD A;  3MZK B;  2O53 A;  1KQS Z;  4ZUX C;  3AYW D;  3MNN B;  3CCL Z;  1KC8 1;  1P3G A;  4H9O B;  5B32 G;  5AVB B;  1S72 Z;  2OTL 1;  3UT9 C;  3G6E Z;  5C3I C;  2R7Z I;  4UUZ B;  1TWC I;  3AZL C;  3W98 C;  4XZQ B;  3AZH B;  3AZF A;  3LZ1 A;  4H9N A;  5B1M B;  3W96 C;  5B0Z C;  4Z66 A;  2UWX A;  3A1K A;  4YS3 B;  3CC7 Z;  2NQB D;  2PYO D;  1PZR A;  3HOW I;  1S32 A;  1KU5 A;  5B31 D;  3LZ0 C;  5GSU A;  3W99 C;  3EG5 B;  1M1A C;  3AFA A;  3JAM f;  3AZE B;  3KFU G;  4HGZ A;  3X1T B;  1YHQ Z;  3JAM b;  5B2J D;  1M90 2;  3VH6 T;  2JUB A;  3VMG A;  1HTA A;  3WTP D;  1P3F D;  3HOV I;  1M18 A;  2I3C A;  3MGP B;  1ML8 A;  3CCJ 1;  1B6W A;  5AV6 A;  2Y2Q A;  5GXQ C;  3TU4 C;  3B6G C;  3C1B D;  3MGS D;  4HGA C;  3R45 B;  2F8N A;  2ZAE B;  1YJW Z;  2HIO C;  4WU8 B;  4G92 B;  1S72 1;  2HUE C;  5BO0 A;  4J8U B;  2J6A A;  3G6E 1;  4LD9 C;  5E5A C;  1F66 A;  2E2J I;  5JRG D;  3WAA C;  2W03 A;  3CC7 1;  1BFM A;  3MVD D;  3LEL D;  3C1C D;  1VQN Z;  3W97 D;  5DNN C;  3CCR Z;  3MNN A;  3CCV 1;  2H85 A;  3A6N C;  5B2I A;  2V8J A;  3B6F D;  3MGR A;  3EPK A;  4J8V B;  4RS4 A;  3AZH A;  2G5H C;  5KDM B;  3X1U B;  4YS3 A;  2CV5 B;  5D1O A;  2ARO D;  1U35 B;  3VH5 W;  4CL1 A;  3AZJ A;  4MD7 A;  4XUJ C;  1YI2 1;  4AWL C;  1VQ6 Z;  3X1S D;  3CCR 1;  4NE3 A;  1M90 1;  4QLC C;  4J8X A;  1P3L B;  3X1T A;  3FQQ A;  4G91 B;  1P3M C;  1M19 D;  4KHA B;  5BT1 C;  3AV2 A;  1ZH1 A;  3PO3 S;  4A3K I;  4WJ3 C;  5GT3 B;  2Y0S A;  3H3V J;  2Y2M A;  2JCH A;  2BYK B;  4Z2M G;  3HOY I;  3I4N I;  3NH5 A;  5GT0 D;  3NFZ A;  5B33 A;  4NFR A;  3REL B;  1I50 I;  1SFO I;  4E45 A;  4E2Z A;  3CC2 1;  3AZM C;  5B24 D;  4E2X A;  3REK C;  1Q82 2;  4BXX I;  3WA9 C;  3AZK B;  4TNU A;  1WWI A;  3B0B A;  1P3K A;  5AV8 C;  2M48 A;  5AVB D;  1QVG Y;  2ZY3 A;  1HQ3 C;  1Q9C A;  2YFV A;  5CP6 C;  3LJA B;  4XZQ D;  2JSS A;  3EER A;  5B1M D;  1YIJ 1;  1K73 2;  4KUD C;  1USP B;  1VQ4 Z;  1VQ8 Z;  4EO5 B;  1EQZ A;  1KX5 B;  1YHQ 1;  1P3G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...