4DQYB

Structure of human parp-1 bound to a dna double strand break
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
SKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for DNA damage-dependent poly(ADP-ribosyl)ation by human PARP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords Poly [ADP-ribose] polymerase 1
total genus 37
structure length 136
sequence length 136
chains with identical sequence E
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4dqyB01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dqyB02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
4H9QB 2QA41 3FQMA 3VMHA 1TWGI 3PO3S 4Z2MG 3O62D 1S32B 1HQ3C 4R8PC 4MH4A 3WAAD 2LY8A 2G5HC 1ID3C 4M6BA 3MGPC 4A3MI 3CCMZ 4J8XC 2JE5A 3BG1B 3UTBD 3WTPA 3JAMf 1Q821 4RVHA 4NBDA 3AV1D 5JRGD 3B6GC 2Q51A 1ZLAB 5F99A 5AV8B 3AZLA 4J8UB 1QVGY 1X3WA 5GXQD 4ZBJB 5B1LA 1TZYD 1VQ5Z 3MVDB 5B2JB 3AZGD 1RO4A 1NJI2 2FFFB 2JA6I 5GSUB 1N1JB 4XZQC 4ZUXB 5AV5D 3AN2B 1HQ3D 4R8PD 5IP9I 4LD9C 3CC7Z 2H85A 2LEXA 3AZHB 2Y2HA 2G2KA 3VMGA 1N2FA 5AVCC 2BJOA 2JCHA 1M1K2 2OOXB 4CSRB 5AN9F 3R45A 2NAPA 3GTGI 1TZYA 1KQSY 5DNNC 2ZY5A 1KRLA 3MZLB 4NB9A 4CSRA 2Y2GA 5B31A 3A6NA 3UTAC 3AZMA 1VQ6Z 4Z5TA 3EPLA 3B6FC 5CP6B 3TU4B 3KUYC 3AZFA 2GTHA 3G6EZ 5JRGB 1P3AA 3C1BD 5AV8D 1KX4C 3KUYB 3KFUG 4XUJB 5AVCD 2HIOD 5DNMA 4NE5A 3WKJB 3CCL1 5CPJD 1Q812 3HOYI 3X1VA 4RV9A 1M1AA 1P3FC 3AN2D 3KIFA 1TWHI 3WTPB 2M6NA 3X1SB 2NQBC 3HOZI 2AROB 3HOVI 3X1VD 2QR1B 4H9PA 5GT3B 5GT0A 3CCV1 1M19B 2JIRA 1TAFA 1Q862 5B31D 1M901 2XD5A 1X0TA 3UTBB 4MONA 2KPIA 3UTAA 3AZMC 1U35D 3D2LA 4QLCC 5LL6f 2JS4A 3IF8A 2VUMI 4S1TA 1ZLAD 1KX5B 3X1UB 4AWLC 4YS3A 1EQZC 4A3LI 2R6MA 4KHAA 4XUJD 1QVGZ 1K731 1USPA 2V3VA 1FDOA 3REKC 3I4NI 3AZED 3AZJA 3CCSZ 1YIT1 3B0DB 3KIHA 5B40B 3FQQA 5CPKD 2AKLA 3LJAD 1BFMA 5CPKB 2OTLZ 3H0GI 5CPJC 4E32A 3AV1C 5GT0C 1I3QI 3V9RA 2OZKA 5B24C 3LJAA 1YI21 4UUZB 2E2II 3MNND 1RO0A 5AV6C 3KWQC 3CC4Z 2E7ZA 2RIQA 2RBLA 3LZ1A 3PO2I 3G4S1 3AV2A 1M1AC 3BG0B 1VQ7Z 4QTUA 2E9HA 3H0LC 2Y0SA 1YJN1 5B0ZA 2NZDC 1M18D 5B31C 1Q7Y2 2QLVB 1DL6A 5CPKC 1NJI1 2Y2QA 1Z03A 3A1KA 3MGRD 4HGYA 2QREB 3G6E1 3LZ1C 3AZID 1W2BY 3AV2C 3AZGA 5CP6D 3TU4D 1VQO1 1WWIA 3B0BA 3CD61 3GTJI 5DNMC 1Z01A 1TZYB 4WU9C 1F66A 4X23A 3REKB 3AZIA 3M4OI 4J8UD 3AV1A 5B31B 4RVGA 2OTL1 5CPID 1ML8A 4H9NA 1M18C 2VF1A 2V8JA 4RVDA 3HOXI 3GTMI 4YM6C 5B2IB 4HGAC 1USPB 2NVYI 4NFRA 1YJW1 3AZKA 3MNNB 1WZNA 3TDHB 2DE5A 5CPIA 1JJ2Y 3MGPD 3S14I 3NQUB 1VQ4Z 3NFZA 5D1OA 3CCE1 3OW2Y 4EWCA 2YU9I 1VQK1 3W96C 2XD1A 5E5AB 5AV9B 5B0YB 3EPHA 3AZKD 3HKZA 5CPIC 5F99B 3AZLB 4WZSB 3CMEZ 2CV5D 3CCJ1 3MGQC 5GSUC 4ZUXC 3H0MC 2JSSA 4H9PB 4H9OA 5B1LC 5GT3A 5B32G 5AV5C 4A3FI 3AFAD 4Y52I 3F6TA 4Z66D 3GTQI 1P3GB 1ZLAC 3LZ1D 3B0CW 3AZIC 1WIIA 4E31A 3VH5W 1ZB8A 3W96B 5CP6C 3TU4C 3KXBD 2JIMA 2IO5C 4NBAA 1EQZB 3WAAA 4A3BI 4J8XB 4E2YA 5B33B 1AOID 1EQZA 1JJ2Z 1QVFZ 2BYMB 3MGQD 3X1VB 3CCJZ 3W99D 1KX3C 2QKDA 5CP6A 3TU4A 4X23C 3AZFB 2V45A 1VQ41 5JRGA 4WU9A 2E2HI 2JR6A 4NE3A 1P3BD 3M3YI 1P3AC 5BT1D 5T67A 1KX4A 3KUYA 3REJA 2GU2A 1VQ91 4XZQB 2AROC 4XUJA 1S72Z 3CCEZ 1YJ91 1VQ81 1P3OD 1P3FB 1KX3A 3AL0C 3AN2C 2WAQA 3KUYD 2Y2JA 4A3KI 4UUZA 4MD9A 3PO3I 1P3FA 1KX3B 4KGCB 3KXBA 3F3FC 3NH8A 2HUEB 5CPJB 4NBBA 5GSUD 4ZUXD 1W2EA 4J8WC 3WTPE 1VQPZ 3CC71 1QF8A 5GT0B 3WAAC 5FLXf 5A2Qb 3NQJA 1Y1WI 3CMA1 1P3BC 3VTNA 2ZY2A 1P3IB 4LD9A 2OOYB 2F8ND 3MONA 3CMAZ 5AVBB 2QA4Z 2IO5B 5B33D 1AOIB 1R9TI 2R92I 3UTAB 3CD6Z 1BH8B 1K732 1Q7Y1 5AV5A 5B0ZD 4WNNB 3G4SZ 3D6WA 4E33A 2J8PA 2Y2IA 4YS3B 5GXQC 1KX5D 3X1SC 3CPWZ 3I55Z 3EPJA 1F66B 3WA9D 2W8SA 1S7MA 4J8XA 4J8WD 2IZ4A 2PM9A 4DK1A 1VQP1 5GXQB 3RZDI 5B33A 1YI2Z 4A3II 1YJ9Z 2G5IC 1Y8CA 3W97D 2VPWA 1P3AD 5AY8B 2DF4C 2Q4ZA 3HOWI 5IT9b 1SIWA 2FJ7D 1I50I 1M19C 4Z5TD 2V8KA 3W98A 4UPKA 2JA8I 1KC81 5B1MD 5B24D 5BNVA 2UWXA 3UTAD 1WCMI 4MXUA 1JWHC 3IFUA 3O62C 1S721 3LJAC 3EG5B 3C1BC 3G711 3AV2B 2JA5I 3GTKI 3QWUA 3HOUI 3KXBB 2I3CA 3AZHD 3C1BB 3RELC 3J80b 1HTAA 4H9OB 3AYWB 1KQSZ 1YIJ1 4J8VD 3KXBC 3NQJB 3A6NC 2WB1A 1F1EA 2IV2X 5C44I 4LD9B 4KUDB 4NBCA 1Z02A 5B2IA 1R4VA 3AZNC 4BY1I 3IP4C 3A6NB 3NH4A 1BH9A 4JJNA 4Z5TB 4KUDC 2NQBD 2QRCB 2PK7A 2LIYA 3CCU1 5E5AD 5B0YD 5AV9D 5D1PA 5B24B 5D1OB 3NDIA 1ULYA 4WU8B 2F8NK 1K9M1 2BYMA 5B40D 5BT1C 5AV6B 3X1SA 3KWQB 1P3KC 3U50C 4MD7A 3CCLZ 3S16I 4TNUA 1TAFB 3WKJD 5T6BA 3GTMS 3K7AI 1P3LB 1S32C 1K8A1 4J8UC 3UTBA 2DQNC 3C1CA 3W97A 5B1LB 3X1TC 3B6FD 3WA9B 1YUKA 2W04A 2RVQD 3MGSD 1QYPA 2DE6A 4YM6D 1M19A 3CCQ1 3VH6W 3C1CB 5FLMI 5B32C 5AV8C 3W96A 3UT9D 1KX4D 1VQOZ 3C1CD 5BO0A 4CAYB 3UT9B 4E44A 3WAAB 2F8NG 2O53A 3CXCZ 5JA4A 1TWFI 1VQ51 1M1K1 3AFAC 1VQL1 3MGQA 4NFTA 4ZBJC 4CAYA 4J8VC 3UT9A 3IR7A 4NB8A 1ID3B 3MGSA 1YUAA 5B40A 2YADA 3MNNC 1KD12 1P3PA 3AZMB 4H9QA 4NE6A 2QRDB 2YFVA 4G92B 5AV6D 5AV5B 3KWQD 1NUIA 4Y7NI 1RQFA 3CC41 3W98C 1QXFA 3AZJB 5B2JD 1F66C 4J8VA 3UT9C 1Q9CA 1YHQ1 5G49A 5B2ID 3LZ0C 4RS4A 4HGZA 1U35C 4NBGA 3CC2Z 4YM6A 1M19D 1VQMZ 5A2Qf 2Y2PA 3I551 3S1RI 2RPRA 2NVTI 3ESWA 2ZY4A 3A1IA 3CCS1 1YITZ 1KX4B 3VMIA 4XZQA 1P3KA 1VQNZ 5BNXA 2AROA 4XUJC 3MVDA 1P3MA 1VQM1 3REJC 3S1MI 3W98D 5BS7A 1N1JA 2M48A 1P3IC 5C4XI 2F4MA 2RHBA 4G91C 2FJ7A 1B67A 1ID3D 4DRAA 1P3PD 2DE7A 4J8WB 4MD8A 3X1UD 4X23B 3REKA 4MRIA 4QLCD 3REIA 3RELB 1Y1VS 5BO0B 3A6ND 4J8WA 3IX0A 4NBEA 1TWAI 5DNND 3H3VJ 5B1MB 5C3IC 5B33C 3REIB 2ZY3A 3RELA 3AZJD 5AVBA 3CQZI 1N8R2 3D9XA 3S1NI 3REHD 3CCVZ 3FKII 1P9NA 1VQLZ 1P3ID 1VQ8Z 3AZKC 1S32A 2NZDD 2CV5C 1P3PC 5B40C 2VPZA 5FUGA 3I561 5KDMA 2E2JI 4BXXI 5E5AA 5AV9A 4WV4B 5B0YA 5GXQA 1P3BB 2PYOC 2EGTA 3LUSA 3CCQZ 3CCUZ 3S2HI 1P3FD 2J6AA 3VH5T 4CL1A 3AZEA 4YM6B 3I4MI 3J7A4 4QLCB 5DNMD 4KGCC 3X1TD 2P3YA 1QVFY 1KU5A 3GTOI 3X1TB 3REIC 3WA9C 1K83I 1P34A 1AOIC 2KI7B 3AN2A 3C1CC 3X1TA 3W97C 4WJ3C 3I56Z 1ZLAA 1KC82 4JJND 1M902 2L5AA 1YHQZ 1A7WA 1P3OA 1L1OC 1BH9B 5BS7C 4JJNB 1VQ61 4YS3C 1M18A 2NZDB 2K3RA 3CME1 4EO5B 4Z66B 1KX5A 5JA4B 3AV2D 2PMZA 3CXCY 3C1BA 4E45A 2QEXZ 3AFAA 3AYWA 3W96D 2W03A 1TZYC 4WU9B 4E2WA 3AZGC 3NDJA 4AYBA 1VQKZ 2OTJZ 4WU8C 5B31G 4LD9D 1VQ9Z 1SFOI 4H9NB 3RZOI 3CCR1 2HIOB 4JJNC 5B2IC 3AZNA 2IZ3A 3G71Z 2BYKA 3RELD 1YJWZ 3GTLI 2NQBB 4DRBA 3P5JB 4EO5C 4Z66C 5DNMB 5F99D 3AZLD 3W97B 3WA9A 4E30A 3AZNB 2HF1A 3MGRB 1Q861 2R7ZI 4WU8A 2JIQA 3S15I 5GT0D 3AZND 5AV6A 3KWQA 1M1AB 3LJAB 2O4HA 1AA6A 4DGLA 4H9SA 1W2BZ 3KSYA 1TWCI 4WU8D 3LZ1B 5E5AC 3VH6A 5B0YC 5AV9C 1P3LA 2PYOA 3REKD 3B6GB 1KX5C 2Y2NA 1P3GD 2JUBA 2JNYA 5B0ZB 5CPJA 1RO2A 2B63I 4A3DI 1P3KD 1P3MB 1BH8A 3MVDC 1B6WA 5B1LD 2Y2OA 1P34B 3CCM1 4WNNA 1P3GA 4BBRI 5C3EI 3Q87A 2ZM5A 4H9RA 1P34C 3LELC 1AOIA 2F8NH 4HGAB 3AZFD 4J8VB 1Y1VI 1VQ71 3X1UA 1WWSA 2JIOA 1M18B 3MGQB 3LZ0A 1JFIB 3AZIB 3AV1B 1YIJZ 1M1AD 1P3GC 2BG1A 5IP7I 1N8R1 3J81b 1PZRA 1Q16A 2NVQI 3B0CT 3W98B 2YFVB 3H0RC 4H9SC 4XZQD 5B2JC 2CV5B 1F66D 2JMOA 4BBSI 3MNNA 2PYOD 3MGRC 4NH1C 3TE5B 5F99C 5AY8A 3AZLC 2F2AC 5CPIB 3VH5A 1P3MC 3LZ0D 1P3LC 5AV8A 5G49B 2K5RA 3GCFA 5JRGC 2CWEA 3B6GD 5CM2M 2NQBA 4BY7I 3J80f 2FJ7B 5IT9f 4KGCD 1P3BA 3CPWY 3LELB 5BNVB 2F8NB 2Y2LA 5GT3D 2RT9A 3AZEC 3X1SD 4KUDD 3CC21 3LELA 2HU9A 2HUEC 3V9RB 5B1MA 3JAMb 4G91B 1VLAA 4YS3D 3J81f 1P3IA 1VQN1 1U35B 1T3UA 1P3OB 3AZFC 4A3GI 1TFIA 4G92C 2LFUA 4KUDA 3WKJC 3VH6T 1ZH1A 4RVFA 2VQRA 4Z66A 2YFWA 5B1MC 1P3AB 4H9RB 3AZJC 4NBHA 5T64A 3T4NB 3F3PC 3S1QI 1RLYA 4NOZA 5DNNB 1FDIA 2JIPA 2YFWB 3MGPA 1Z2CB 3GTPI 2RVQC 3LZ0B 3X1VC 1JFIA 3WTPD 3MZKB 3W99C 4DQYB 3X1UC 4AWLB 1KX3D 2HIOC 3AZEB 3B6FB 3CCRZ 3MGPB 5C4JI 5CHLB 1K9M2 3B0DC 4J8XD 3EERA 3REJB 2OTJ1 3O62A 2AROD 5FUGB 3NQUA 4J8UA 3UTBC 2FJ7C 4A3EI 2QEX1 3MGRA 5B2JA 3AZKB 5GSUA 4ZUXA 4HH4A 5GT3C 1Q811 4X6AI 4A93I 3AZHA 1H3OA 4QLCA 3EPKA 3WTPC 1K8A2 2F8NA 5AVBC 3AYWD 5C3IB 2Y2KA 3MGSB 3AZMD 2PYOB 4X23D 1H3OB 1WJ2A 4NBFA 3S2DI 1P3PB 3REHA 5B32A 5FLXb 1EQZD 2P28A 1ZB9A 3REHB 2HIOA 1NP6A 2VPYA 5B0ZC 2NZDA 3FDDA 3W99A 5AY8C 2BYKB 3REID 1RNIA 3VB9A 3NH5A 3AFAB 3W99B 3MGSC 2ZAEB 3REJD 5AVBD 3AYWC 5B32D 2JA7I 5B24A 3WKJA 5DNNA 1HQ3B 4R8PB 1P3KB 1P3MD 4KHAB 1P3LD 3OW2Z 2NVXI 1YJNZ 1X3ZA 2CV5A 2V8IA 4QTTA 2VUGA 4Z5TC 3B6FA 1HQ3A 4R8PA 4Z2MH 3I07A 1I6HI 5AY8D 3O62B 1S32D 2AYDA 5CPKA 2F4OA 4XX2A 5BNXB 3EEDA 3REHC 4A3JI 1Q822 4KGCA 1WW9A 4A3CI 3B6GA 2Y2MA 3R45B 1LQLA 3MVDD 3AZHC 3AZGB 4E2ZA 4E2XA 3GKQA 2VPXA 1PFTA 5AVCB 2GTIA 3S17I 1P3OC 1ID3A 4WU9D 1P34D 2R93I 3LELD 5B32B 1U35A 5AVCA 5KDMB 1KD11
chains in the Genus database with same CATH topology
4H9QB 2QA41 3FQMA 3VMHA 1TWGI 3PO3S 4Z2MG 3O62D 1S32B 1HQ3C 4R8PC 4MH4A 3WAAD 2LY8A 2G5HC 1ID3C 4M6BA 3MGPC 4A3MI 3CCMZ 4J8XC 2JE5A 3BG1B 3UTBD 3WTPA 3JAMf 1Q821 4RVHA 4NBDA 3AV1D 5JRGD 3B6GC 2Q51A 1ZLAB 5F99A 5AV8B 3AZLA 4J8UB 1QVGY 1X3WA 5GXQD 4ZBJB 5B1LA 1TZYD 1VQ5Z 3MVDB 5B2JB 3AZGD 1RO4A 1NJI2 2FFFB 2JA6I 5GSUB 1N1JB 4XZQC 4ZUXB 5AV5D 3AN2B 1HQ3D 4R8PD 5IP9I 4LD9C 3CC7Z 2H85A 3AZHB 2Y2HA 2G2KA 3VMGA 1N2FA 5AVCC 2BJOA 2JCHA 1M1K2 2OOXB 4CSRB 5AN9F 3R45A 3GTGI 1TZYA 1KQSY 5DNNC 2ZY5A 1KRLA 3MZLB 4NB9A 4CSRA 2Y2GA 5B31A 3A6NA 3UTAC 3AZMA 1VQ6Z 4Z5TA 3EPLA 3B6FC 5CP6B 3TU4B 3KUYC 3AZFA 2GTHA 3G6EZ 5JRGB 1P3AA 3C1BD 5AV8D 1KX4C 3KUYB 3KFUG 4XUJB 5AVCD 2HIOD 5DNMA 4NE5A 3WKJB 3CCL1 5CPJD 1Q812 3HOYI 3X1VA 4RV9A 1M1AA 1P3FC 3AN2D 3KIFA 1TWHI 3WTPB 2M6NA 3X1SB 2NQBC 3HOZI 2AROB 3HOVI 3X1VD 2QR1B 4H9PA 5GT3B 5GT0A 3CCV1 1M19B 1TAFA 1Q862 5B31D 1M901 2XD5A 1X0TA 3UTBB 4MONA 2KPIA 3UTAA 3AZMC 1U35D 4QLCC 5LL6f 2JS4A 3IF8A 2VUMI 4S1TA 1ZLAD 1KX5B 3X1UB 4AWLC 4YS3A 1EQZC 4A3LI 2R6MA 4KHAA 4XUJD 1QVGZ 1K731 1USPA 3REKC 3I4NI 3AZED 3AZJA 3CCSZ 1YIT1 3B0DB 3KIHA 5B40B 3FQQA 5CPKD 2AKLA 3LJAD 1BFMA 5CPKB 2OTLZ 3H0GI 5CPJC 4E32A 3AV1C 5GT0C 1I3QI 3V9RA 2OZKA 5B24C 3LJAA 1YI21 4UUZB 2E2II 3MNND 1RO0A 5AV6C 3KWQC 3CC4Z 3PO2I 2RIQA 2RBLA 3LZ1A 3G4S1 3AV2A 1M1AC 3BG0B 1VQ7Z 4QTUA 2E9HA 3H0LC 2Y0SA 1YJN1 5B0ZA 2NZDC 1M18D 5B31C 1Q7Y2 2QLVB 1DL6A 5CPKC 1NJI1 2Y2QA 1Z03A 3A1KA 3MGRD 4HGYA 2QREB 3G6E1 3LZ1C 3AZID 1W2BY 3AV2C 3AZGA 5CP6D 3TU4D 1VQO1 1WWIA 3B0BA 3CD61 3GTJI 5DNMC 1Z01A 1TZYB 4WU9C 1F66A 4X23A 3REKB 3AZIA 3M4OI 4J8UD 3AV1A 5B31B 4RVGA 2OTL1 5CPID 1ML8A 4H9NA 1M18C 2VF1A 2V8JA 4RVDA 3HOXI 3GTMI 4YM6C 5B2IB 4HGAC 1USPB 2NVYI 4NFRA 1YJW1 3AZKA 3MNNB 3TDHB 2DE5A 5CPIA 1JJ2Y 3MGPD 3S14I 3NQUB 1VQ4Z 3NFZA 5D1OA 3CCE1 3OW2Y 4EWCA 2YU9I 1VQK1 3W96C 2XD1A 5E5AB 5AV9B 5B0YB 3EPHA 3AZKD 3HKZA 5CPIC 5F99B 3AZLB 4WZSB 3CMEZ 2CV5D 3CCJ1 3MGQC 5GSUC 4ZUXC 3H0MC 2JSSA 4H9PB 4H9OA 5B1LC 5GT3A 5B32G 5AV5C 4A3FI 3AFAD 4Y52I 3F6TA 4Z66D 3GTQI 1P3GB 1ZLAC 3LZ1D 3B0CW 3AZIC 1WIIA 4E31A 3VH5W 1ZB8A 3W96B 5CP6C 3TU4C 3KXBD 2IO5C 4NBAA 1EQZB 3WAAA 4A3BI 4J8XB 4E2YA 5B33B 1AOID 1EQZA 1JJ2Z 1QVFZ 2BYMB 3MGQD 3X1VB 3CCJZ 3W99D 1KX3C 2QKDA 5CP6A 3TU4A 4X23C 3AZFB 1VQ41 2E2HI 5JRGA 4WU9A 2JR6A 4NE3A 1P3BD 3M3YI 1P3AC 5BT1D 5T67A 1KX4A 3KUYA 3REJA 2GU2A 1VQ91 4XZQB 2AROC 4XUJA 1S72Z 3CCEZ 1YJ91 1VQ81 1P3OD 1P3FB 1KX3A 3AL0C 3AN2C 2WAQA 3KUYD 2Y2JA 4A3KI 4UUZA 4MD9A 3PO3I 1P3FA 1KX3B 4KGCB 3KXBA 3F3FC 3NH8A 2HUEB 5CPJB 4NBBA 5GSUD 4ZUXD 1W2EA 4J8WC 3WTPE 1VQPZ 3CC71 1QF8A 5GT0B 3WAAC 5FLXf 5A2Qb 3NQJA 1Y1WI 3CMA1 1P3BC 3VTNA 2ZY2A 1P3IB 4LD9A 2OOYB 2F8ND 3MONA 3CMAZ 5AVBB 2QA4Z 2IO5B 5B33D 1AOIB 1R9TI 2R92I 3UTAB 3CD6Z 1BH8B 1K732 1Q7Y1 5AV5A 5B0ZD 4WNNB 3G4SZ 3D6WA 4E33A 2J8PA 2Y2IA 4YS3B 5GXQC 1KX5D 3X1SC 3CPWZ 3I55Z 3EPJA 1F66B 3WA9D 2W8SA 1S7MA 4J8XA 4J8WD 2IZ4A 2PM9A 4DK1A 1VQP1 5GXQB 3RZDI 5B33A 1YI2Z 4A3II 1YJ9Z 2G5IC 3W97D 1P3AD 5AY8B 2DF4C 2Q4ZA 3HOWI 5IT9b 2FJ7D 1I50I 1M19C 4Z5TD 2V8KA 3W98A 4UPKA 2JA8I 1KC81 5B1MD 5B24D 5BNVA 2UWXA 3UTAD 1WCMI 4MXUA 1JWHC 3IFUA 3O62C 1S721 3LJAC 3EG5B 3C1BC 3G711 3AV2B 2JA5I 3GTKI 3QWUA 3HOUI 3KXBB 2I3CA 3AZHD 3C1BB 3RELC 3J80b 1HTAA 4H9OB 3AYWB 1KQSZ 1YIJ1 4J8VD 3KXBC 3NQJB 3A6NC 2WB1A 1F1EA 5C44I 4LD9B 4KUDB 4NBCA 1Z02A 5B2IA 1R4VA 3AZNC 4BY1I 3IP4C 3A6NB 3NH4A 1BH9A 4JJNA 4Z5TB 4KUDC 2NQBD 2QRCB 2PK7A 2LIYA 3CCU1 5E5AD 5B0YD 5AV9D 5D1PA 5B24B 5D1OB 3NDIA 1ULYA 4WU8B 2F8NK 1K9M1 2BYMA 5B40D 5BT1C 5AV6B 3X1SA 3KWQB 1P3KC 3U50C 4MD7A 3CCLZ 3S16I 4TNUA 1TAFB 3WKJD 5T6BA 3GTMS 3K7AI 1P3LB 1S32C 1K8A1 4J8UC 3UTBA 2DQNC 3C1CA 3W97A 5B1LB 3X1TC 3B6FD 3WA9B 1YUKA 2W04A 2RVQD 3MGSD 1QYPA 2DE6A 4YM6D 1M19A 3CCQ1 3VH6W 3C1CB 5FLMI 5B32C 5AV8C 3W96A 3UT9D 1KX4D 1VQOZ 3C1CD 5BO0A 4CAYB 3UT9B 4E44A 3WAAB 2F8NG 2O53A 3CXCZ 5JA4A 1TWFI 1VQ51 1M1K1 3AFAC 1VQL1 3MGQA 4NFTA 4ZBJC 4CAYA 4J8VC 3UT9A 4NB8A 1ID3B 3MGSA 1YUAA 5B40A 2YADA 3MNNC 1KD12 1P3PA 3AZMB 4H9QA 4NE6A 2QRDB 2YFVA 4G92B 5AV6D 5AV5B 3KWQD 1NUIA 4Y7NI 1RQFA 3CC41 3W98C 3AZJB 5B2JD 1F66C 4J8VA 3UT9C 1Q9CA 1YHQ1 5G49A 5B2ID 3LZ0C 4RS4A 4HGZA 1U35C 4NBGA 3CC2Z 4YM6A 1M19D 1VQMZ 5A2Qf 2Y2PA 3I551 3S1RI 2RPRA 2NVTI 3ESWA 2ZY4A 3A1IA 3CCS1 1YITZ 1KX4B 3VMIA 4XZQA 1P3KA 1VQNZ 5BNXA 2AROA 4XUJC 3MVDA 1P3MA 1VQM1 3REJC 3S1MI 3W98D 5BS7A 1N1JA 2M48A 1P3IC 5C4XI 2F4MA 2RHBA 4G91C 2FJ7A 1B67A 1ID3D 4DRAA 1P3PD 2DE7A 4J8WB 4MD8A 3X1UD 4X23B 3REKA 4MRIA 4QLCD 3REIA 3RELB 1Y1VS 5BO0B 3A6ND 4J8WA 3IX0A 4NBEA 1TWAI 5DNND 3H3VJ 5B1MB 5C3IC 5B33C 3REIB 2ZY3A 3RELA 3AZJD 5AVBA 3CQZI 1N8R2 3D9XA 3S1NI 3REHD 3CCVZ 3FKII 1P9NA 1VQLZ 1P3ID 1VQ8Z 3AZKC 1S32A 2NZDD 2CV5C 1P3PC 5B40C 3I561 5FUGA 2E2JI 5KDMA 4BXXI 5E5AA 5AV9A 4WV4B 5B0YA 5GXQA 1P3BB 2PYOC 2EGTA 3LUSA 3CCQZ 3CCUZ 3S2HI 1P3FD 2J6AA 3VH5T 4CL1A 3AZEA 4YM6B 3I4MI 3J7A4 4QLCB 5DNMD 4KGCC 3X1TD 2P3YA 1QVFY 1KU5A 3GTOI 3X1TB 3REIC 3WA9C 1K83I 1P34A 1AOIC 2KI7B 3AN2A 3C1CC 3X1TA 3W97C 4WJ3C 3I56Z 1ZLAA 1KC82 4JJND 1M902 2L5AA 1YHQZ 1A7WA 1P3OA 1L1OC 1BH9B 5BS7C 4JJNB 1VQ61 4YS3C 1M18A 2NZDB 2K3RA 3CME1 4EO5B 4Z66B 1KX5A 5JA4B 3AV2D 2PMZA 3CXCY 3C1BA 4E45A 2QEXZ 3AFAA 3AYWA 3W96D 2W03A 1TZYC 4WU9B 4E2WA 3AZGC 3NDJA 4AYBA 1VQKZ 2OTJZ 4WU8C 5B31G 4LD9D 1VQ9Z 1SFOI 4H9NB 3RZOI 3CCR1 2HIOB 4JJNC 5B2IC 3AZNA 2IZ3A 3G71Z 2BYKA 3RELD 1YJWZ 3GTLI 2NQBB 4DRBA 3P5JB 4EO5C 4Z66C 5DNMB 5F99D 3AZLD 3W97B 3WA9A 4E30A 3AZNB 2HF1A 3MGRB 1Q861 2R7ZI 4WU8A 3S15I 5GT0D 3AZND 5AV6A 3KWQA 1M1AB 3LJAB 2O4HA 4DGLA 4H9SA 1W2BZ 3KSYA 1TWCI 4WU8D 3LZ1B 5E5AC 3VH6A 5B0YC 5AV9C 1P3LA 2PYOA 3REKD 3B6GB 1KX5C 2Y2NA 1P3GD 2JUBA 2JNYA 5B0ZB 5CPJA 1RO2A 2B63I 4A3DI 1P3KD 1P3MB 1BH8A 3MVDC 1B6WA 5B1LD 2Y2OA 1P34B 3CCM1 4WNNA 1P3GA 4BBRI 5C3EI 3Q87A 2ZM5A 4H9RA 1P34C 3LELC 1AOIA 2F8NH 4HGAB 3AZFD 4J8VB 1Y1VI 1VQ71 3X1UA 1WWSA 1M18B 3MGQB 3LZ0A 1JFIB 3AZIB 3AV1B 1YIJZ 1M1AD 1P3GC 2BG1A 5IP7I 1N8R1 3J81b 1PZRA 2NVQI 3B0CT 3W98B 2YFVB 3H0RC 4H9SC 4XZQD 5B2JC 2CV5B 1F66D 2JMOA 4BBSI 3MNNA 2PYOD 3MGRC 4NH1C 3TE5B 5F99C 5AY8A 3AZLC 2F2AC 5CPIB 3VH5A 1P3MC 3LZ0D 1P3LC 5AV8A 5G49B 2K5RA 3GCFA 5JRGC 2CWEA 3B6GD 5CM2M 2NQBA 4BY7I 3J80f 2FJ7B 5IT9f 4KGCD 1P3BA 3CPWY 3LELB 5BNVB 2F8NB 2Y2LA 5GT3D 2RT9A 3AZEC 3X1SD 4KUDD 3CC21 3LELA 2HU9A 2HUEC 3V9RB 5B1MA 3JAMb 4G91B 1VLAA 4YS3D 3J81f 1P3IA 1VQN1 1U35B 1T3UA 1P3OB 3AZFC 4A3GI 1TFIA 4G92C 2LFUA 4KUDA 3WKJC 3VH6T 1ZH1A 4RVFA 2VQRA 4Z66A 2YFWA 5B1MC 1P3AB 4H9RB 3AZJC 4NBHA 5T64A 3T4NB 3F3PC 3S1QI 1RLYA 4NOZA 5DNNB 3GTPI 2YFWB 3MGPA 1Z2CB 2RVQC 3LZ0B 3X1VC 1JFIA 3WTPD 3MZKB 3W99C 4DQYB 3X1UC 4AWLB 1KX3D 2HIOC 3AZEB 3B6FB 3CCRZ 3MGPB 5C4JI 5CHLB 1K9M2 3B0DC 4J8XD 3EERA 3REJB 2OTJ1 3O62A 2AROD 5FUGB 3NQUA 4J8UA 3UTBC 2FJ7C 4A3EI 2QEX1 3MGRA 5B2JA 3AZKB 5GSUA 4ZUXA 4HH4A 5GT3C 1Q811 4X6AI 4A93I 3AZHA 1H3OA 4QLCA 3EPKA 3WTPC 1K8A2 2F8NA 5AVBC 3AYWD 5C3IB 2Y2KA 3MGSB 3AZMD 2PYOB 4X23D 1H3OB 4NBFA 3S2DI 1P3PB 3REHA 5B32A 5FLXb 1EQZD 2P28A 1ZB9A 3REHB 2HIOA 1NP6A 5B0ZC 2NZDA 3FDDA 3W99A 5AY8C 2BYKB 3REID 1RNIA 3VB9A 3NH5A 3AFAB 3W99B 3MGSC 2ZAEB 3REJD 5AVBD 3AYWC 5B32D 2JA7I 5B24A 3WKJA 5DNNA 1HQ3B 4R8PB 1P3KB 1P3MD 4KHAB 1P3LD 3OW2Z 2NVXI 1YJNZ 1X3ZA 2CV5A 2V8IA 4QTTA 2VUGA 4Z5TC 3B6FA 1HQ3A 4R8PA 4Z2MH 3I07A 1I6HI 5AY8D 3O62B 1S32D 5CPKA 2F4OA 4XX2A 5BNXB 3EEDA 3REHC 4A3JI 1Q822 4KGCA 1WW9A 4A3CI 3B6GA 2Y2MA 3R45B 1LQLA 3MVDD 3AZHC 3AZGB 4E2ZA 4E2XA 3GKQA 1PFTA 5AVCB 2GTIA 3S17I 1P3OC 1ID3A 4WU9D 1P34D 2R93I 3LELD 5B32B 1U35A 5AVCA 5KDMB 1KD11
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 4H9Q B;  2QA4 1;  3FQM A;  3VMH A;  1TWG I;  3PO3 S;  4Z2M G;  3O62 D;  1S32 B;  1HQ3 C;  4R8P C;  4MH4 A;  3WAA D;  2LY8 A;  2G5H C;  1ID3 C;  4M6B A;  3MGP C;  4A3M I;  3CCM Z;  4J8X C;  2JE5 A;  3BG1 B;  3UTB D;  3WTP A;  3JAM f;  1Q82 1;  4RVH A;  4NBD A;  3AV1 D;  5JRG D;  3B6G C;  2Q51 A;  1ZLA B;  5F99 A;  5AV8 B;  3AZL A;  4J8U B;  1QVG Y;  1X3W A;  5GXQ D;  4ZBJ B;  5B1L A;  1TZY D;  1VQ5 Z;  3MVD B;  5B2J B;  3AZG D;  1RO4 A;  1NJI 2;  2FFF B;  2JA6 I;  5GSU B;  1N1J B;  4XZQ C;  4ZUX B;  5AV5 D;  3AN2 B;  1HQ3 D;  4R8P D;  5IP9 I;  4LD9 C;  3CC7 Z;  2H85 A;  2LEX A;  3AZH B;  2Y2H A;  2G2K A;  3VMG A;  1N2F A;  5AVC C;  2BJO A;  2JCH A;  1M1K 2;  2OOX B;  4CSR B;  5AN9 F;  3R45 A;  2NAP A;  3GTG I;  1TZY A;  1KQS Y;  5DNN C;  2ZY5 A;  1KRL A;  3MZL B;  4NB9 A;  4CSR A;  2Y2G A;  5B31 A;  3A6N A;  3UTA C;  3AZM A;  1VQ6 Z;  4Z5T A;  3EPL A;  3B6F C;  5CP6 B;  3TU4 B;  3KUY C;  3AZF A;  2GTH A;  3G6E Z;  5JRG B;  1P3A A;  3C1B D;  5AV8 D;  1KX4 C;  3KUY B;  3KFU G;  4XUJ B;  5AVC D;  2HIO D;  5DNM A;  4NE5 A;  3WKJ B;  3CCL 1;  5CPJ D;  1Q81 2;  3HOY I;  3X1V A;  4RV9 A;  1M1A A;  1P3F C;  3AN2 D;  3KIF A;  1TWH I;  3WTP B;  2M6N A;  3X1S B;  2NQB C;  3HOZ I;  2ARO B;  3HOV I;  3X1V D;  2QR1 B;  4H9P A;  5GT3 B;  5GT0 A;  3CCV 1;  1M19 B;  2JIR A;  1TAF A;  1Q86 2;  5B31 D;  1M90 1;  2XD5 A;  1X0T A;  3UTB B;  4MON A;  2KPI A;  3UTA A;  3AZM C;  1U35 D;  3D2L A;  4QLC C;  5LL6 f;  2JS4 A;  3IF8 A;  2VUM I;  4S1T A;  1ZLA D;  1KX5 B;  3X1U B;  4AWL C;  4YS3 A;  1EQZ C;  4A3L I;  2R6M A;  4KHA A;  4XUJ D;  1QVG Z;  1K73 1;  1USP A;  2V3V A;  1FDO A;  3REK C;  3I4N I;  3AZE D;  3AZJ A;  3CCS Z;  1YIT 1;  3B0D B;  3KIH A;  5B40 B;  3FQQ A;  5CPK D;  2AKL A;  3LJA D;  1BFM A;  5CPK B;  2OTL Z;  3H0G I;  5CPJ C;  4E32 A;  3AV1 C;  5GT0 C;  1I3Q I;  3V9R A;  2OZK A;  5B24 C;  3LJA A;  1YI2 1;  4UUZ B;  2E2I I;  3MNN D;  1RO0 A;  5AV6 C;  3KWQ C;  3CC4 Z;  2E7Z A;  2RIQ A;  2RBL A;  3LZ1 A;  3PO2 I;  3G4S 1;  3AV2 A;  1M1A C;  3BG0 B;  1VQ7 Z;  4QTU A;  2E9H A;  3H0L C;  2Y0S A;  1YJN 1;  5B0Z A;  2NZD C;  1M18 D;  5B31 C;  1Q7Y 2;  2QLV B;  1DL6 A;  5CPK C;  1NJI 1;  2Y2Q A;  1Z03 A;  3A1K A;  3MGR D;  4HGY A;  2QRE B;  3G6E 1;  3LZ1 C;  3AZI D;  1W2B Y;  3AV2 C;  3AZG A;  5CP6 D;  3TU4 D;  1VQO 1;  1WWI A;  3B0B A;  3CD6 1;  3GTJ I;  5DNM C;  1Z01 A;  1TZY B;  4WU9 C;  1F66 A;  4X23 A;  3REK B;  3AZI A;  3M4O I;  4J8U D;  3AV1 A;  5B31 B;  4RVG A;  2OTL 1;  5CPI D;  1ML8 A;  4H9N A;  1M18 C;  2VF1 A;  2V8J A;  4RVD A;  3HOX I;  3GTM I;  4YM6 C;  5B2I B;  4HGA C;  1USP B;  2NVY I;  4NFR A;  1YJW 1;  3AZK A;  3MNN B;  1WZN A;  3TDH B;  2DE5 A;  5CPI A;  1JJ2 Y;  3MGP D;  3S14 I;  3NQU B;  1VQ4 Z;  3NFZ A;  5D1O A;  3CCE 1;  3OW2 Y;  4EWC A;  2YU9 I;  1VQK 1;  3W96 C;  2XD1 A;  5E5A B;  5AV9 B;  5B0Y B;  3EPH A;  3AZK D;  3HKZ A;  5CPI C;  5F99 B;  3AZL B;  4WZS B;  3CME Z;  2CV5 D;  3CCJ 1;  3MGQ C;  5GSU C;  4ZUX C;  3H0M C;  2JSS A;  4H9P B;  4H9O A;  5B1L C;  5GT3 A;  5B32 G;  5AV5 C;  4A3F I;  3AFA D;  4Y52 I;  3F6T A;  4Z66 D;  3GTQ I;  1P3G B;  1ZLA C;  3LZ1 D;  3B0C W;  3AZI C;  1WII A;  4E31 A;  3VH5 W;  1ZB8 A;  3W96 B;  5CP6 C;  3TU4 C;  3KXB D;  2JIM A;  2IO5 C;  4NBA A;  1EQZ B;  3WAA A;  4A3B I;  4J8X B;  4E2Y A;  5B33 B;  1AOI D;  1EQZ A;  1JJ2 Z;  1QVF Z;  2BYM B;  3MGQ D;  3X1V B;  3CCJ Z;  3W99 D;  1KX3 C;  2QKD A;  5CP6 A;  3TU4 A;  4X23 C;  3AZF B;  2V45 A;  1VQ4 1;  5JRG A;  4WU9 A;  2E2H I;  2JR6 A;  4NE3 A;  1P3B D;  3M3Y I;  1P3A C;  5BT1 D;  5T67 A;  1KX4 A;  3KUY A;  3REJ A;  2GU2 A;  1VQ9 1;  4XZQ B;  2ARO C;  4XUJ A;  1S72 Z;  3CCE Z;  1YJ9 1;  1VQ8 1;  1P3O D;  1P3F B;  1KX3 A;  3AL0 C;  3AN2 C;  2WAQ A;  3KUY D;  2Y2J A;  4A3K I;  4UUZ A;  4MD9 A;  3PO3 I;  1P3F A;  1KX3 B;  4KGC B;  3KXB A;  3F3F C;  3NH8 A;  2HUE B;  5CPJ B;  4NBB A;  5GSU D;  4ZUX D;  1W2E A;  4J8W C;  3WTP E;  1VQP Z;  3CC7 1;  1QF8 A;  5GT0 B;  3WAA C;  5FLX f;  5A2Q b;  3NQJ A;  1Y1W I;  3CMA 1;  1P3B C;  3VTN A;  2ZY2 A;  1P3I B;  4LD9 A;  2OOY B;  2F8N D;  3MON A;  3CMA Z;  5AVB B;  2QA4 Z;  2IO5 B;  5B33 D;  1AOI B;  1R9T I;  2R92 I;  3UTA B;  3CD6 Z;  1BH8 B;  1K73 2;  1Q7Y 1;  5AV5 A;  5B0Z D;  4WNN B;  3G4S Z;  3D6W A;  4E33 A;  2J8P A;  2Y2I A;  4YS3 B;  5GXQ C;  1KX5 D;  3X1S C;  3CPW Z;  3I55 Z;  3EPJ A;  1F66 B;  3WA9 D;  2W8S A;  1S7M A;  4J8X A;  4J8W D;  2IZ4 A;  2PM9 A;  4DK1 A;  1VQP 1;  5GXQ B;  3RZD I;  5B33 A;  1YI2 Z;  4A3I I;  1YJ9 Z;  2G5I C;  1Y8C A;  3W97 D;  2VPW A;  1P3A D;  5AY8 B;  2DF4 C;  2Q4Z A;  3HOW I;  5IT9 b;  1SIW A;  2FJ7 D;  1I50 I;  1M19 C;  4Z5T D;  2V8K A;  3W98 A;  4UPK A;  2JA8 I;  1KC8 1;  5B1M D;  5B24 D;  5BNV A;  2UWX A;  3UTA D;  1WCM I;  4MXU A;  1JWH C;  3IFU A;  3O62 C;  1S72 1;  3LJA C;  3EG5 B;  3C1B C;  3G71 1;  3AV2 B;  2JA5 I;  3GTK I;  3QWU A;  3HOU I;  3KXB B;  2I3C A;  3AZH D;  3C1B B;  3REL C;  3J80 b;  1HTA A;  4H9O B;  3AYW B;  1KQS Z;  1YIJ 1;  4J8V D;  3KXB C;  3NQJ B;  3A6N C;  2WB1 A;  1F1E A;  2IV2 X;  5C44 I;  4LD9 B;  4KUD B;  4NBC A;  1Z02 A;  5B2I A;  1R4V A;  3AZN C;  4BY1 I;  3IP4 C;  3A6N B;  3NH4 A;  1BH9 A;  4JJN A;  4Z5T B;  4KUD C;  2NQB D;  2QRC B;  2PK7 A;  2LIY A;  3CCU 1;  5E5A D;  5B0Y D;  5AV9 D;  5D1P A;  5B24 B;  5D1O B;  3NDI A;  1ULY A;  4WU8 B;  2F8N K;  1K9M 1;  2BYM A;  5B40 D;  5BT1 C;  5AV6 B;  3X1S A;  3KWQ B;  1P3K C;  3U50 C;  4MD7 A;  3CCL Z;  3S16 I;  4TNU A;  1TAF B;  3WKJ D;  5T6B A;  3GTM S;  3K7A I;  1P3L B;  1S32 C;  1K8A 1;  4J8U C;  3UTB A;  2DQN C;  3C1C A;  3W97 A;  5B1L B;  3X1T C;  3B6F D;  3WA9 B;  1YUK A;  2W04 A;  2RVQ D;  3MGS D;  1QYP A;  2DE6 A;  4YM6 D;  1M19 A;  3CCQ 1;  3VH6 W;  3C1C B;  5FLM I;  5B32 C;  5AV8 C;  3W96 A;  3UT9 D;  1KX4 D;  1VQO Z;  3C1C D;  5BO0 A;  4CAY B;  3UT9 B;  4E44 A;  3WAA B;  2F8N G;  2O53 A;  3CXC Z;  5JA4 A;  1TWF I;  1VQ5 1;  1M1K 1;  3AFA C;  1VQL 1;  3MGQ A;  4NFT A;  4ZBJ C;  4CAY A;  4J8V C;  3UT9 A;  3IR7 A;  4NB8 A;  1ID3 B;  3MGS A;  1YUA A;  5B40 A;  2YAD A;  3MNN C;  1KD1 2;  1P3P A;  3AZM B;  4H9Q A;  4NE6 A;  2QRD B;  2YFV A;  4G92 B;  5AV6 D;  5AV5 B;  3KWQ D;  1NUI A;  4Y7N I;  1RQF A;  3CC4 1;  3W98 C;  1QXF A;  3AZJ B;  5B2J D;  1F66 C;  4J8V A;  3UT9 C;  1Q9C A;  1YHQ 1;  5G49 A;  5B2I D;  3LZ0 C;  4RS4 A;  4HGZ A;  1U35 C;  4NBG A;  3CC2 Z;  4YM6 A;  1M19 D;  1VQM Z;  5A2Q f;  2Y2P A;  3I55 1;  3S1R I;  2RPR A;  2NVT I;  3ESW A;  2ZY4 A;  3A1I A;  3CCS 1;  1YIT Z;  1KX4 B;  3VMI A;  4XZQ A;  1P3K A;  1VQN Z;  5BNX A;  2ARO A;  4XUJ C;  3MVD A;  1P3M A;  1VQM 1;  3REJ C;  3S1M I;  3W98 D;  5BS7 A;  1N1J A;  2M48 A;  1P3I C;  5C4X I;  2F4M A;  2RHB A;  4G91 C;  2FJ7 A;  1B67 A;  1ID3 D;  4DRA A;  1P3P D;  2DE7 A;  4J8W B;  4MD8 A;  3X1U D;  4X23 B;  3REK A;  4MRI A;  4QLC D;  3REI A;  3REL B;  1Y1V S;  5BO0 B;  3A6N D;  4J8W A;  3IX0 A;  4NBE A;  1TWA I;  5DNN D;  3H3V J;  5B1M B;  5C3I C;  5B33 C;  3REI B;  2ZY3 A;  3REL A;  3AZJ D;  5AVB A;  3CQZ I;  1N8R 2;  3D9X A;  3S1N I;  3REH D;  3CCV Z;  3FKI I;  1P9N A;  1VQL Z;  1P3I D;  1VQ8 Z;  3AZK C;  1S32 A;  2NZD D;  2CV5 C;  1P3P C;  5B40 C;  2VPZ A;  5FUG A;  3I56 1;  5KDM A;  2E2J I;  4BXX I;  5E5A A;  5AV9 A;  4WV4 B;  5B0Y A;  5GXQ A;  1P3B B;  2PYO C;  2EGT A;  3LUS A;  3CCQ Z;  3CCU Z;  3S2H I;  1P3F D;  2J6A A;  3VH5 T;  4CL1 A;  3AZE A;  4YM6 B;  3I4M I;  3J7A 4;  4QLC B;  5DNM D;  4KGC C;  3X1T D;  2P3Y A;  1QVF Y;  1KU5 A;  3GTO I;  3X1T B;  3REI C;  3WA9 C;  1K83 I;  1P34 A;  1AOI C;  2KI7 B;  3AN2 A;  3C1C C;  3X1T A;  3W97 C;  4WJ3 C;  3I56 Z;  1ZLA A;  1KC8 2;  4JJN D;  1M90 2;  2L5A A;  1YHQ Z;  1A7W A;  1P3O A;  1L1O C;  1BH9 B;  5BS7 C;  4JJN B;  1VQ6 1;  4YS3 C;  1M18 A;  2NZD B;  2K3R A;  3CME 1;  4EO5 B;  4Z66 B;  1KX5 A;  5JA4 B;  3AV2 D;  2PMZ A;  3CXC Y;  3C1B A;  4E45 A;  2QEX Z;  3AFA A;  3AYW A;  3W96 D;  2W03 A;  1TZY C;  4WU9 B;  4E2W A;  3AZG C;  3NDJ A;  4AYB A;  1VQK Z;  2OTJ Z;  4WU8 C;  5B31 G;  4LD9 D;  1VQ9 Z;  1SFO I;  4H9N B;  3RZO I;  3CCR 1;  2HIO B;  4JJN C;  5B2I C;  3AZN A;  2IZ3 A;  3G71 Z;  2BYK A;  3REL D;  1YJW Z;  3GTL I;  2NQB B;  4DRB A;  3P5J B;  4EO5 C;  4Z66 C;  5DNM B;  5F99 D;  3AZL D;  3W97 B;  3WA9 A;  4E30 A;  3AZN B;  2HF1 A;  3MGR B;  1Q86 1;  2R7Z I;  4WU8 A;  2JIQ A;  3S15 I;  5GT0 D;  3AZN D;  5AV6 A;  3KWQ A;  1M1A B;  3LJA B;  2O4H A;  1AA6 A;  4DGL A;  4H9S A;  1W2B Z;  3KSY A;  1TWC I;  4WU8 D;  3LZ1 B;  5E5A C;  3VH6 A;  5B0Y C;  5AV9 C;  1P3L A;  2PYO A;  3REK D;  3B6G B;  1KX5 C;  2Y2N A;  1P3G D;  2JUB A;  2JNY A;  5B0Z B;  5CPJ A;  1RO2 A;  2B63 I;  4A3D I;  1P3K D;  1P3M B;  1BH8 A;  3MVD C;  1B6W A;  5B1L D;  2Y2O A;  1P34 B;  3CCM 1;  4WNN A;  1P3G A;  4BBR I;  5C3E I;  3Q87 A;  2ZM5 A;  4H9R A;  1P34 C;  3LEL C;  1AOI A;  2F8N H;  4HGA B;  3AZF D;  4J8V B;  1Y1V I;  1VQ7 1;  3X1U A;  1WWS A;  2JIO A;  1M18 B;  3MGQ B;  3LZ0 A;  1JFI B;  3AZI B;  3AV1 B;  1YIJ Z;  1M1A D;  1P3G C;  2BG1 A;  5IP7 I;  1N8R 1;  3J81 b;  1PZR A;  1Q16 A;  2NVQ I;  3B0C T;  3W98 B;  2YFV B;  3H0R C;  4H9S C;  4XZQ D;  5B2J C;  2CV5 B;  1F66 D;  2JMO A;  4BBS I;  3MNN A;  2PYO D;  3MGR C;  4NH1 C;  3TE5 B;  5F99 C;  5AY8 A;  3AZL C;  2F2A C;  5CPI B;  3VH5 A;  1P3M C;  3LZ0 D;  1P3L C;  5AV8 A;  5G49 B;  2K5R A;  3GCF A;  5JRG C;  2CWE A;  3B6G D;  5CM2 M;  2NQB A;  4BY7 I;  3J80 f;  2FJ7 B;  5IT9 f;  4KGC D;  1P3B A;  3CPW Y;  3LEL B;  5BNV B;  2F8N B;  2Y2L A;  5GT3 D;  2RT9 A;  3AZE C;  3X1S D;  4KUD D;  3CC2 1;  3LEL A;  2HU9 A;  2HUE C;  3V9R B;  5B1M A;  3JAM b;  4G91 B;  1VLA A;  4YS3 D;  3J81 f;  1P3I A;  1VQN 1;  1U35 B;  1T3U A;  1P3O B;  3AZF C;  4A3G I;  1TFI A;  4G92 C;  2LFU A;  4KUD A;  3WKJ C;  3VH6 T;  1ZH1 A;  4RVF A;  2VQR A;  4Z66 A;  2YFW A;  5B1M C;  1P3A B;  4H9R B;  3AZJ C;  4NBH A;  5T64 A;  3T4N B;  3F3P C;  3S1Q I;  1RLY A;  4NOZ A;  5DNN B;  1FDI A;  2JIP A;  2YFW B;  3MGP A;  1Z2C B;  3GTP I;  2RVQ C;  3LZ0 B;  3X1V C;  1JFI A;  3WTP D;  3MZK B;  3W99 C;  4DQY B;  3X1U C;  4AWL B;  1KX3 D;  2HIO C;  3AZE B;  3B6F B;  3CCR Z;  3MGP B;  5C4J I;  5CHL B;  1K9M 2;  3B0D C;  4J8X D;  3EER A;  3REJ B;  2OTJ 1;  3O62 A;  2ARO D;  5FUG B;  3NQU A;  4J8U A;  3UTB C;  2FJ7 C;  4A3E I;  2QEX 1;  3MGR A;  5B2J A;  3AZK B;  5GSU A;  4ZUX A;  4HH4 A;  5GT3 C;  1Q81 1;  4X6A I;  4A93 I;  3AZH A;  1H3O A;  4QLC A;  3EPK A;  3WTP C;  1K8A 2;  2F8N A;  5AVB C;  3AYW D;  5C3I B;  2Y2K A;  3MGS B;  3AZM D;  2PYO B;  4X23 D;  1H3O B;  1WJ2 A;  4NBF A;  3S2D I;  1P3P B;  3REH A;  5B32 A;  5FLX b;  1EQZ D;  2P28 A;  1ZB9 A;  3REH B;  2HIO A;  1NP6 A;  2VPY A;  5B0Z C;  2NZD A;  3FDD A;  3W99 A;  5AY8 C;  2BYK B;  3REI D;  1RNI A;  3VB9 A;  3NH5 A;  3AFA B;  3W99 B;  3MGS C;  2ZAE B;  3REJ D;  5AVB D;  3AYW C;  5B32 D;  2JA7 I;  5B24 A;  3WKJ A;  5DNN A;  1HQ3 B;  4R8P B;  1P3K B;  1P3M D;  4KHA B;  1P3L D;  3OW2 Z;  2NVX I;  1YJN Z;  1X3Z A;  2CV5 A;  2V8I A;  4QTT A;  2VUG A;  4Z5T C;  3B6F A;  1HQ3 A;  4R8P A;  4Z2M H;  3I07 A;  1I6H I;  5AY8 D;  3O62 B;  1S32 D;  2AYD A;  5CPK A;  2F4O A;  4XX2 A;  5BNX B;  3EED A;  3REH C;  4A3J I;  1Q82 2;  4KGC A;  1WW9 A;  4A3C I;  3B6G A;  2Y2M A;  3R45 B;  1LQL A;  3MVD D;  3AZH C;  3AZG B;  4E2Z A;  4E2X A;  3GKQ A;  2VPX A;  1PFT A;  5AVC B;  2GTI A;  3S17 I;  1P3O C;  1ID3 A;  4WU9 D;  1P34 D;  2R93 I;  3LEL D;  5B32 B;  1U35 A;  5AVC A;  5KDM B;  1KD1 1; 
#chains in the Genus database with same CATH homology
 4H9Q B;  2QA4 1;  3FQM A;  3VMH A;  1TWG I;  3PO3 S;  4Z2M G;  3O62 D;  1S32 B;  1HQ3 C;  4R8P C;  4MH4 A;  3WAA D;  2LY8 A;  2G5H C;  1ID3 C;  4M6B A;  3MGP C;  4A3M I;  3CCM Z;  4J8X C;  2JE5 A;  3BG1 B;  3UTB D;  3WTP A;  3JAM f;  1Q82 1;  4RVH A;  4NBD A;  3AV1 D;  5JRG D;  3B6G C;  2Q51 A;  1ZLA B;  5F99 A;  5AV8 B;  3AZL A;  4J8U B;  1QVG Y;  1X3W A;  5GXQ D;  4ZBJ B;  5B1L A;  1TZY D;  1VQ5 Z;  3MVD B;  5B2J B;  3AZG D;  1RO4 A;  1NJI 2;  2FFF B;  2JA6 I;  5GSU B;  1N1J B;  4XZQ C;  4ZUX B;  5AV5 D;  3AN2 B;  1HQ3 D;  4R8P D;  5IP9 I;  4LD9 C;  3CC7 Z;  2H85 A;  3AZH B;  2Y2H A;  2G2K A;  3VMG A;  1N2F A;  5AVC C;  2BJO A;  2JCH A;  1M1K 2;  2OOX B;  4CSR B;  5AN9 F;  3R45 A;  3GTG I;  1TZY A;  1KQS Y;  5DNN C;  2ZY5 A;  1KRL A;  3MZL B;  4NB9 A;  4CSR A;  2Y2G A;  5B31 A;  3A6N A;  3UTA C;  3AZM A;  1VQ6 Z;  4Z5T A;  3EPL A;  3B6F C;  5CP6 B;  3TU4 B;  3KUY C;  3AZF A;  2GTH A;  3G6E Z;  5JRG B;  1P3A A;  3C1B D;  5AV8 D;  1KX4 C;  3KUY B;  3KFU G;  4XUJ B;  5AVC D;  2HIO D;  5DNM A;  4NE5 A;  3WKJ B;  3CCL 1;  5CPJ D;  1Q81 2;  3HOY I;  3X1V A;  4RV9 A;  1M1A A;  1P3F C;  3AN2 D;  3KIF A;  1TWH I;  3WTP B;  2M6N A;  3X1S B;  2NQB C;  3HOZ I;  2ARO B;  3HOV I;  3X1V D;  2QR1 B;  4H9P A;  5GT3 B;  5GT0 A;  3CCV 1;  1M19 B;  1TAF A;  1Q86 2;  5B31 D;  1M90 1;  2XD5 A;  1X0T A;  3UTB B;  4MON A;  2KPI A;  3UTA A;  3AZM C;  1U35 D;  4QLC C;  5LL6 f;  2JS4 A;  3IF8 A;  2VUM I;  4S1T A;  1ZLA D;  1KX5 B;  3X1U B;  4AWL C;  4YS3 A;  1EQZ C;  4A3L I;  2R6M A;  4KHA A;  4XUJ D;  1QVG Z;  1K73 1;  1USP A;  3REK C;  3I4N I;  3AZE D;  3AZJ A;  3CCS Z;  1YIT 1;  3B0D B;  3KIH A;  5B40 B;  3FQQ A;  5CPK D;  2AKL A;  3LJA D;  1BFM A;  5CPK B;  2OTL Z;  3H0G I;  5CPJ C;  4E32 A;  3AV1 C;  5GT0 C;  1I3Q I;  3V9R A;  2OZK A;  5B24 C;  3LJA A;  1YI2 1;  4UUZ B;  2E2I I;  3MNN D;  1RO0 A;  5AV6 C;  3KWQ C;  3CC4 Z;  3PO2 I;  2RIQ A;  2RBL A;  3LZ1 A;  3G4S 1;  3AV2 A;  1M1A C;  3BG0 B;  1VQ7 Z;  4QTU A;  2E9H A;  3H0L C;  2Y0S A;  1YJN 1;  5B0Z A;  2NZD C;  1M18 D;  5B31 C;  1Q7Y 2;  2QLV B;  1DL6 A;  5CPK C;  1NJI 1;  2Y2Q A;  1Z03 A;  3A1K A;  3MGR D;  4HGY A;  2QRE B;  3G6E 1;  3LZ1 C;  3AZI D;  1W2B Y;  3AV2 C;  3AZG A;  5CP6 D;  3TU4 D;  1VQO 1;  1WWI A;  3B0B A;  3CD6 1;  3GTJ I;  5DNM C;  1Z01 A;  1TZY B;  4WU9 C;  1F66 A;  4X23 A;  3REK B;  3AZI A;  3M4O I;  4J8U D;  3AV1 A;  5B31 B;  4RVG A;  2OTL 1;  5CPI D;  1ML8 A;  4H9N A;  1M18 C;  2VF1 A;  2V8J A;  4RVD A;  3HOX I;  3GTM I;  4YM6 C;  5B2I B;  4HGA C;  1USP B;  2NVY I;  4NFR A;  1YJW 1;  3AZK A;  3MNN B;  3TDH B;  2DE5 A;  5CPI A;  1JJ2 Y;  3MGP D;  3S14 I;  3NQU B;  1VQ4 Z;  3NFZ A;  5D1O A;  3CCE 1;  3OW2 Y;  4EWC A;  2YU9 I;  1VQK 1;  3W96 C;  2XD1 A;  5E5A B;  5AV9 B;  5B0Y B;  3EPH A;  3AZK D;  3HKZ A;  5CPI C;  5F99 B;  3AZL B;  4WZS B;  3CME Z;  2CV5 D;  3CCJ 1;  3MGQ C;  5GSU C;  4ZUX C;  3H0M C;  2JSS A;  4H9P B;  4H9O A;  5B1L C;  5GT3 A;  5B32 G;  5AV5 C;  4A3F I;  3AFA D;  4Y52 I;  3F6T A;  4Z66 D;  3GTQ I;  1P3G B;  1ZLA C;  3LZ1 D;  3B0C W;  3AZI C;  1WII A;  4E31 A;  3VH5 W;  1ZB8 A;  3W96 B;  5CP6 C;  3TU4 C;  3KXB D;  2IO5 C;  4NBA A;  1EQZ B;  3WAA A;  4A3B I;  4J8X B;  4E2Y A;  5B33 B;  1AOI D;  1EQZ A;  1JJ2 Z;  1QVF Z;  2BYM B;  3MGQ D;  3X1V B;  3CCJ Z;  3W99 D;  1KX3 C;  2QKD A;  5CP6 A;  3TU4 A;  4X23 C;  3AZF B;  1VQ4 1;  2E2H I;  5JRG A;  4WU9 A;  2JR6 A;  4NE3 A;  1P3B D;  3M3Y I;  1P3A C;  5BT1 D;  5T67 A;  1KX4 A;  3KUY A;  3REJ A;  2GU2 A;  1VQ9 1;  4XZQ B;  2ARO C;  4XUJ A;  1S72 Z;  3CCE Z;  1YJ9 1;  1VQ8 1;  1P3O D;  1P3F B;  1KX3 A;  3AL0 C;  3AN2 C;  2WAQ A;  3KUY D;  2Y2J A;  4A3K I;  4UUZ A;  4MD9 A;  3PO3 I;  1P3F A;  1KX3 B;  4KGC B;  3KXB A;  3F3F C;  3NH8 A;  2HUE B;  5CPJ B;  4NBB A;  5GSU D;  4ZUX D;  1W2E A;  4J8W C;  3WTP E;  1VQP Z;  3CC7 1;  1QF8 A;  5GT0 B;  3WAA C;  5FLX f;  5A2Q b;  3NQJ A;  1Y1W I;  3CMA 1;  1P3B C;  3VTN A;  2ZY2 A;  1P3I B;  4LD9 A;  2OOY B;  2F8N D;  3MON A;  3CMA Z;  5AVB B;  2QA4 Z;  2IO5 B;  5B33 D;  1AOI B;  1R9T I;  2R92 I;  3UTA B;  3CD6 Z;  1BH8 B;  1K73 2;  1Q7Y 1;  5AV5 A;  5B0Z D;  4WNN B;  3G4S Z;  3D6W A;  4E33 A;  2J8P A;  2Y2I A;  4YS3 B;  5GXQ C;  1KX5 D;  3X1S C;  3CPW Z;  3I55 Z;  3EPJ A;  1F66 B;  3WA9 D;  2W8S A;  1S7M A;  4J8X A;  4J8W D;  2IZ4 A;  2PM9 A;  4DK1 A;  1VQP 1;  5GXQ B;  3RZD I;  5B33 A;  1YI2 Z;  4A3I I;  1YJ9 Z;  2G5I C;  3W97 D;  1P3A D;  5AY8 B;  2DF4 C;  2Q4Z A;  3HOW I;  5IT9 b;  2FJ7 D;  1I50 I;  1M19 C;  4Z5T D;  2V8K A;  3W98 A;  4UPK A;  2JA8 I;  1KC8 1;  5B1M D;  5B24 D;  5BNV A;  2UWX A;  3UTA D;  1WCM I;  4MXU A;  1JWH C;  3IFU A;  3O62 C;  1S72 1;  3LJA C;  3EG5 B;  3C1B C;  3G71 1;  3AV2 B;  2JA5 I;  3GTK I;  3QWU A;  3HOU I;  3KXB B;  2I3C A;  3AZH D;  3C1B B;  3REL C;  3J80 b;  1HTA A;  4H9O B;  3AYW B;  1KQS Z;  1YIJ 1;  4J8V D;  3KXB C;  3NQJ B;  3A6N C;  2WB1 A;  1F1E A;  5C44 I;  4LD9 B;  4KUD B;  4NBC A;  1Z02 A;  5B2I A;  1R4V A;  3AZN C;  4BY1 I;  3IP4 C;  3A6N B;  3NH4 A;  1BH9 A;  4JJN A;  4Z5T B;  4KUD C;  2NQB D;  2QRC B;  2PK7 A;  2LIY A;  3CCU 1;  5E5A D;  5B0Y D;  5AV9 D;  5D1P A;  5B24 B;  5D1O B;  3NDI A;  1ULY A;  4WU8 B;  2F8N K;  1K9M 1;  2BYM A;  5B40 D;  5BT1 C;  5AV6 B;  3X1S A;  3KWQ B;  1P3K C;  3U50 C;  4MD7 A;  3CCL Z;  3S16 I;  4TNU A;  1TAF B;  3WKJ D;  5T6B A;  3GTM S;  3K7A I;  1P3L B;  1S32 C;  1K8A 1;  4J8U C;  3UTB A;  2DQN C;  3C1C A;  3W97 A;  5B1L B;  3X1T C;  3B6F D;  3WA9 B;  1YUK A;  2W04 A;  2RVQ D;  3MGS D;  1QYP A;  2DE6 A;  4YM6 D;  1M19 A;  3CCQ 1;  3VH6 W;  3C1C B;  5FLM I;  5B32 C;  5AV8 C;  3W96 A;  3UT9 D;  1KX4 D;  1VQO Z;  3C1C D;  5BO0 A;  4CAY B;  3UT9 B;  4E44 A;  3WAA B;  2F8N G;  2O53 A;  3CXC Z;  5JA4 A;  1TWF I;  1VQ5 1;  1M1K 1;  3AFA C;  1VQL 1;  3MGQ A;  4NFT A;  4ZBJ C;  4CAY A;  4J8V C;  3UT9 A;  4NB8 A;  1ID3 B;  3MGS A;  1YUA A;  5B40 A;  2YAD A;  3MNN C;  1KD1 2;  1P3P A;  3AZM B;  4H9Q A;  4NE6 A;  2QRD B;  2YFV A;  4G92 B;  5AV6 D;  5AV5 B;  3KWQ D;  1NUI A;  4Y7N I;  1RQF A;  3CC4 1;  3W98 C;  3AZJ B;  5B2J D;  1F66 C;  4J8V A;  3UT9 C;  1Q9C A;  1YHQ 1;  5G49 A;  5B2I D;  3LZ0 C;  4RS4 A;  4HGZ A;  1U35 C;  4NBG A;  3CC2 Z;  4YM6 A;  1M19 D;  1VQM Z;  5A2Q f;  2Y2P A;  3I55 1;  3S1R I;  2RPR A;  2NVT I;  3ESW A;  2ZY4 A;  3A1I A;  3CCS 1;  1YIT Z;  1KX4 B;  3VMI A;  4XZQ A;  1P3K A;  1VQN Z;  5BNX A;  2ARO A;  4XUJ C;  3MVD A;  1P3M A;  1VQM 1;  3REJ C;  3S1M I;  3W98 D;  5BS7 A;  1N1J A;  2M48 A;  1P3I C;  5C4X I;  2F4M A;  2RHB A;  4G91 C;  2FJ7 A;  1B67 A;  1ID3 D;  4DRA A;  1P3P D;  2DE7 A;  4J8W B;  4MD8 A;  3X1U D;  4X23 B;  3REK A;  4MRI A;  4QLC D;  3REI A;  3REL B;  1Y1V S;  5BO0 B;  3A6N D;  4J8W A;  3IX0 A;  4NBE A;  1TWA I;  5DNN D;  3H3V J;  5B1M B;  5C3I C;  5B33 C;  3REI B;  2ZY3 A;  3REL A;  3AZJ D;  5AVB A;  3CQZ I;  1N8R 2;  3D9X A;  3S1N I;  3REH D;  3CCV Z;  3FKI I;  1P9N A;  1VQL Z;  1P3I D;  1VQ8 Z;  3AZK C;  1S32 A;  2NZD D;  2CV5 C;  1P3P C;  5B40 C;  3I56 1;  5FUG A;  2E2J I;  5KDM A;  4BXX I;  5E5A A;  5AV9 A;  4WV4 B;  5B0Y A;  5GXQ A;  1P3B B;  2PYO C;  2EGT A;  3LUS A;  3CCQ Z;  3CCU Z;  3S2H I;  1P3F D;  2J6A A;  3VH5 T;  4CL1 A;  3AZE A;  4YM6 B;  3I4M I;  3J7A 4;  4QLC B;  5DNM D;  4KGC C;  3X1T D;  2P3Y A;  1QVF Y;  1KU5 A;  3GTO I;  3X1T B;  3REI C;  3WA9 C;  1K83 I;  1P34 A;  1AOI C;  2KI7 B;  3AN2 A;  3C1C C;  3X1T A;  3W97 C;  4WJ3 C;  3I56 Z;  1ZLA A;  1KC8 2;  4JJN D;  1M90 2;  2L5A A;  1YHQ Z;  1A7W A;  1P3O A;  1L1O C;  1BH9 B;  5BS7 C;  4JJN B;  1VQ6 1;  4YS3 C;  1M18 A;  2NZD B;  2K3R A;  3CME 1;  4EO5 B;  4Z66 B;  1KX5 A;  5JA4 B;  3AV2 D;  2PMZ A;  3CXC Y;  3C1B A;  4E45 A;  2QEX Z;  3AFA A;  3AYW A;  3W96 D;  2W03 A;  1TZY C;  4WU9 B;  4E2W A;  3AZG C;  3NDJ A;  4AYB A;  1VQK Z;  2OTJ Z;  4WU8 C;  5B31 G;  4LD9 D;  1VQ9 Z;  1SFO I;  4H9N B;  3RZO I;  3CCR 1;  2HIO B;  4JJN C;  5B2I C;  3AZN A;  2IZ3 A;  3G71 Z;  2BYK A;  3REL D;  1YJW Z;  3GTL I;  2NQB B;  4DRB A;  3P5J B;  4EO5 C;  4Z66 C;  5DNM B;  5F99 D;  3AZL D;  3W97 B;  3WA9 A;  4E30 A;  3AZN B;  2HF1 A;  3MGR B;  1Q86 1;  2R7Z I;  4WU8 A;  3S15 I;  5GT0 D;  3AZN D;  5AV6 A;  3KWQ A;  1M1A B;  3LJA B;  2O4H A;  4DGL A;  4H9S A;  1W2B Z;  3KSY A;  1TWC I;  4WU8 D;  3LZ1 B;  5E5A C;  3VH6 A;  5B0Y C;  5AV9 C;  1P3L A;  2PYO A;  3REK D;  3B6G B;  1KX5 C;  2Y2N A;  1P3G D;  2JUB A;  2JNY A;  5B0Z B;  5CPJ A;  1RO2 A;  2B63 I;  4A3D I;  1P3K D;  1P3M B;  1BH8 A;  3MVD C;  1B6W A;  5B1L D;  2Y2O A;  1P34 B;  3CCM 1;  4WNN A;  1P3G A;  4BBR I;  5C3E I;  3Q87 A;  2ZM5 A;  4H9R A;  1P34 C;  3LEL C;  1AOI A;  2F8N H;  4HGA B;  3AZF D;  4J8V B;  1Y1V I;  1VQ7 1;  3X1U A;  1WWS A;  1M18 B;  3MGQ B;  3LZ0 A;  1JFI B;  3AZI B;  3AV1 B;  1YIJ Z;  1M1A D;  1P3G C;  2BG1 A;  5IP7 I;  1N8R 1;  3J81 b;  1PZR A;  2NVQ I;  3B0C T;  3W98 B;  2YFV B;  3H0R C;  4H9S C;  4XZQ D;  5B2J C;  2CV5 B;  1F66 D;  2JMO A;  4BBS I;  3MNN A;  2PYO D;  3MGR C;  4NH1 C;  3TE5 B;  5F99 C;  5AY8 A;  3AZL C;  2F2A C;  5CPI B;  3VH5 A;  1P3M C;  3LZ0 D;  1P3L C;  5AV8 A;  5G49 B;  2K5R A;  3GCF A;  5JRG C;  2CWE A;  3B6G D;  5CM2 M;  2NQB A;  4BY7 I;  3J80 f;  2FJ7 B;  5IT9 f;  4KGC D;  1P3B A;  3CPW Y;  3LEL B;  5BNV B;  2F8N B;  2Y2L A;  5GT3 D;  2RT9 A;  3AZE C;  3X1S D;  4KUD D;  3CC2 1;  3LEL A;  2HU9 A;  2HUE C;  3V9R B;  5B1M A;  3JAM b;  4G91 B;  1VLA A;  4YS3 D;  3J81 f;  1P3I A;  1VQN 1;  1U35 B;  1T3U A;  1P3O B;  3AZF C;  4A3G I;  1TFI A;  4G92 C;  2LFU A;  4KUD A;  3WKJ C;  3VH6 T;  1ZH1 A;  4RVF A;  2VQR A;  4Z66 A;  2YFW A;  5B1M C;  1P3A B;  4H9R B;  3AZJ C;  4NBH A;  5T64 A;  3T4N B;  3F3P C;  3S1Q I;  1RLY A;  4NOZ A;  5DNN B;  3GTP I;  2YFW B;  3MGP A;  1Z2C B;  2RVQ C;  3LZ0 B;  3X1V C;  1JFI A;  3WTP D;  3MZK B;  3W99 C;  4DQY B;  3X1U C;  4AWL B;  1KX3 D;  2HIO C;  3AZE B;  3B6F B;  3CCR Z;  3MGP B;  5C4J I;  5CHL B;  1K9M 2;  3B0D C;  4J8X D;  3EER A;  3REJ B;  2OTJ 1;  3O62 A;  2ARO D;  5FUG B;  3NQU A;  4J8U A;  3UTB C;  2FJ7 C;  4A3E I;  2QEX 1;  3MGR A;  5B2J A;  3AZK B;  5GSU A;  4ZUX A;  4HH4 A;  5GT3 C;  1Q81 1;  4X6A I;  4A93 I;  3AZH A;  1H3O A;  4QLC A;  3EPK A;  3WTP C;  1K8A 2;  2F8N A;  5AVB C;  3AYW D;  5C3I B;  2Y2K A;  3MGS B;  3AZM D;  2PYO B;  4X23 D;  1H3O B;  4NBF A;  3S2D I;  1P3P B;  3REH A;  5B32 A;  5FLX b;  1EQZ D;  2P28 A;  1ZB9 A;  3REH B;  2HIO A;  1NP6 A;  5B0Z C;  2NZD A;  3FDD A;  3W99 A;  5AY8 C;  2BYK B;  3REI D;  1RNI A;  3VB9 A;  3NH5 A;  3AFA B;  3W99 B;  3MGS C;  2ZAE B;  3REJ D;  5AVB D;  3AYW C;  5B32 D;  2JA7 I;  5B24 A;  3WKJ A;  5DNN A;  1HQ3 B;  4R8P B;  1P3K B;  1P3M D;  4KHA B;  1P3L D;  3OW2 Z;  2NVX I;  1YJN Z;  1X3Z A;  2CV5 A;  2V8I A;  4QTT A;  2VUG A;  4Z5T C;  3B6F A;  1HQ3 A;  4R8P A;  4Z2M H;  3I07 A;  1I6H I;  5AY8 D;  3O62 B;  1S32 D;  5CPK A;  2F4O A;  4XX2 A;  5BNX B;  3EED A;  3REH C;  4A3J I;  1Q82 2;  4KGC A;  1WW9 A;  4A3C I;  3B6G A;  2Y2M A;  3R45 B;  1LQL A;  3MVD D;  3AZH C;  3AZG B;  4E2Z A;  4E2X A;  3GKQ A;  1PFT A;  5AVC B;  2GTI A;  3S17 I;  1P3O C;  1ID3 A;  4WU9 D;  1P34 D;  2R93 I;  3LEL D;  5B32 B;  1U35 A;  5AVC A;  5KDM B;  1KD1 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...