4DR1I

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr1I00
2ZITA 3J7AM 4OX9I 4I3HA 1XMOE 4LF8I 5LMNE 4LFCI 4X62I 3J80C 4B3SI 2Q2EB 4DPUA 4LF4I 1NHHA 4JI4I 4X62E 1HNXE 4JV5I 4GKKI 1H7UA 4X64I 4DUZI 4DV7I 4DR2E 4KHPE 3CWVA 3T1HE 2R3VA 4X64E 3ZM7A 1PVGA 4PRXA 2XEXA 2A2DA 4DV5E 1S16A 2A2CA 4FWHA 4JI3I 4JI7E 4DPTA 1IBKE 4LF7I 4AQYI 4NXNI 1IBLI 2LJPA 4YHHE 1N36E 3GONA 4LF9E 1IBLE 2HK3A 1Z0EA 4JI0E 3T1YI 2E1RA 1I94E 1VISA 1FWKA 1K47A 1Z0GA 3K1JA 4HY1A 1Z5AA 4B3TE 4JYAI 1FJGE 2V2QA 3D4JA 4B3ME 5A2QC 1XNQI 4DU7A 2UUAI 4JYAE 2V8PA 3ZZUA 1FWLA 1FKAE 2V2ZA 2BM1A 1ZM9A 1XNQE 2HHHI 4HXZA 4DPXA 2F4VE 3B82A 4DV3I 4LF5I 3QT5A 3QT6A 1OJ4A 4USKA 3PYGA 1ZM2A 1BKNA 3K17A 4LF5E 3V2UC 1XMQI 3J80Q 2HFSA 1Z0BA 5LMUE 4PU9A 4DV1I 1HR0E 1KTVA 4DUYE 4DR1I 2VQFE 2UXCE 4JI5E 4MYTA 3LNUA 4JI8I 5BR8E 4FN5A 3ZKDA 4OX9E 4JI6I 4LF8E 1XNRI 1EI1A 4LFCE 4B3SE 2UUBI 4JI6E 4HACA 4LF4E 4K0KI 4DV6I 3PYDA 4DR4I 4JI4E 4JV5E 4GKKE 2UUBE 3WU5A 4DUZE 4DV6E 4DV7E 4DR4E 1QZRA 2UXDI 3ZZTA 2ZM6I 4PRVA 1J5EI 1Z59A 4LFBI 4DV0I 4JI3E 4DV4I 3PYEA 3QT8A 4LF7E 5LL6R 4AQYE 2VF3A 1XHKA 4NXNE 4JI1I 5GMDA 1ELOA 1ZXNA 4NXMI 1EA6A 4DU8A 5A2QQ 2UUCI 3M6AA 3T1YE 4HYMA 1KKHA 1N32I 1DARA 1N34I 3WU6A 2V34A 4ZVIA 1Z5CA 1S4EA 4DR7I 2VQEI 4Z7YA 2E5LI 1PKPA 4X65I 1N33I 1FI4A 2J7KA 4EMDA 1Z0CA 2UU9I 4DR7E 2AJ4A 2UUAE 4X65E 2HKEA 1N33E 4WUCA 2BV3A 4LF6I 1UEKA 2EFGA 2HHHE 4DR6I 4RPFA 1U2RA 4DV3E 4KQVA 3ZKBA 4ED4A 2X36A 4R1FA 4GKJI 4M1KA 4DXLA 1HNZI 1IBMI 3V5RA 1XMQE 4JI2I 3WU4A 3QT7A 4HACB 1PIEA 4DV1E 5IWAI 4DV2I 4DR5I 4DR1E 1WUUA 4DPYA 4JI2E 2DEJA 1NZ0A 1XMOI 4JI8E 4DR3I 3Q1QA 3LTOA 2GS8A 1MG7A 3JAMC 1FNMA 5LMNI 1NHIA 4Z7CA 3ZZ0A 4UT4A 1XNRE 4DR3E 4YY3I 1HNXI 4LFAI 4K0KE 4X66I 1Z0TA 4YY3E 4DR2I 4KHPI 2ZBKB 3OTOI 4LFAE 3T1HI 1ZM4A 4X66E 3H4LA 2HFUA 2UXDE 3F0NA 2ZM6E 2UXBI 3OTOE 1J5EE 1NHJA 1MU5A 4LFBE 4DV5I 1Z0VA 1ZXMA 2UXBE 1RR9A 1IBKI 4JI7I 4DV0E 3HULA 2CZ9A 3B8HA 4DV4E 4WUDA 4YHHI 1MX0A 4B3RI 1N36I 4JI1E 4LF9I 2X7IA 4JI0I 4B3RE 4NXME 1ZM3A 2NPFA 1N0UA 2UUCE 1I94I 5IT9Q 4JG4A 4MYUA 4XTJA 1N32E 1H74A 3J7AG 1A6FA 1N34E 1H72C 2HKJA 4B3TI 4FWGA 2VQEE 2HK2A 1FJGI 2E5LE 4B3MI 5IT9C 5GMEA 4P52A 1B62A 3PYFA 2UU9E 4P7AA 3WU3A 2V2VA 3J81Q 2BM0A 1N0VC 2F4VI 1D6TA 1B63A 4LF6E 4DR6E 4URLA 4DPWA 1HNWI 3B78A 5L3JA 1Z0WA 4FWDA 1KVKA 1HNWE 5FLXQ 4GKJE 3J81C 2R42A 3JAMQ 1HNZE 4WUBA 2DEIA 1Z5BA 5LMUI 3LPSA 1IBME 1RREA 4FW9A 1HR0I 1KIJA 4DUYI 2WW4A 5IWAE 2VQFI 4USMA 5FLXC 4DV2E 4DR5E 2UXCI 1H73A 4UTGA 4JI5I 1H7SA 2OI2A 5BR8I
chains in the Genus database with same CATH superfamily
2ZITA 3Q6NA 3J7AM 4OX9I 4I3HA 1XMOE 4IZJD 4LF8I 2GO4A 5LMNE 2BA0D 4LFCI 4X62I 3J80C 4B3SI 2Q2EB 4DPUA 2BA0G 4LF4I 1NHHA 4JI4I 3CDJA 3PS1A 2BR2A 4X62E 4IFDE 1HNXE 4JV5I 4GKKI 1H7UA 4X64I 4DUZI 4DV7I 4DR2E 4KHPE 2NN6E 3CWVA 5JEAC 3T1HE 2R3VA 5K36F 4OO1F 4X64E 3ZM7A 1PVGA 4IFDD 4PRXA 2XEXA 2A2DA 4DV5E 1S16A 2A2CA 4FWHA 2GO3A 4JI3I 2NN6D 4JI7E 4DPTA 1IBKE 4LF7I 4AQYI 2AE8A 4NXNI 1IBLI 2LJPA 1UDSA 1Y4SA 4YHHE 4BA1B 1E3HA 1N36E 3GONA 4MQYA 4LF9E 1IBLE 4BA2A 2HK3A 5JEAA 1Z0EA 4JI0E 3T1YI 4U3BA 5C0XA 2E1RA 1I94E 1VISA 1FWKA 1K47A 1Z0GA 3K1JA 3CDIA 4HY1A 1Z5AA 2WNRB 4B3TE 4JYAI 4NBQA 3P06A 1FJGE 2V2QA 3D4JA 4B3ME 5A2QC 1XNQI 4DU7A 2UUAI 4JYAE 2V8PA 3ZZUA 1FWLA 4FW7A 5EKWA 5DRPA 1FKAE 2V2ZA 2BM1A 1ZM9A 1XNQE 2HHHI 4HXZA 4AIDA 4DPXA 2F4VE 3PRYA 3B82A 4DV3I 2VESA 4LF5I 3GLLA 3QT5A 3QT6A 2JT2A 1OJ4A 4USKA 3PYGA 1ZM2A 1BKNA 3K17A 3P3CA 3UHMA 4LF5E 1UDQA 4IFDA 5C0XD 3V2UC 1XMQI 3J80Q 2HFSA 1Z0BA 5LMUE 4PU9A 4DV1I 2NN6A 1HR0E 1KTVA 4DUYE 4DR1I 2BR2B 2VQFE 2UXCE 4JI5E 4MYTA 3LNUA 4JI8I 5BR8E 4FN5A 3ZKDA 4OX9E 4JI6I 4LF8E 2PO1A 3PS2A 1XNRI 1EI1A 3L7ZA 4LFCE 4B3SE 2UUBI 4JI6E 4HACA 2BA1D 3B4TA 4LF4E 4K0KI 4DV6I 3PYDA 4DR4I 4JI4E 2BA1G 4JV5E 4IZKA 4GKKE 4ISAA 2UUBE 3WU5A 4DUZE 4DV6E 4DV7E 4DR4E 2JEBA 1QZRA 2UXDI 3ZZTA 5C0XC 2ZM6I 4PRVA 3U1YA 3M7ND 1J5EI 4BA2B 3NZKA 3K85A 1Z59A 4LCFA 4LFBI 5JEAB 3P3EA 1HK7A 2PNZA 4DV0I 2C39A 5C0XB 2O1WA 2Z5BA 4FW4A 4JI3E 2PO0A 4DV4I 3PYEA 3QT8A 4LF7E 5LL6R 4AQYE 2VF3A 1XHKA 2JEAA 4NXNE 4JI1I 5GMDA 2F1DA 4IZJB 1ELOA 1ZXNA 4NXMI 4LOMA 4J3DA 1EA6A 4DU8A 5A2QQ 4MU0A 3M6AA 2UUCI 3T1YE 4HYMA 3P3GA 1KKHA 1N32I 1DARA 1N34I 3WU6A 4OKGA 2V34A 1USUA 4IFDC 2WP8A 5DRRA 4ZVIA 1Z5CA 1OYRA 1S4EA 2VQEI 4DR7I 4Z7YA 3U1KA 2E5LI 1PKPA 4X65I 1N33I 1FI4A 2J7KA 4EMDA 2NN6C 3PS3A 5EL9A 1Z0CA 2UU9I 4DR7E 2AJ4A 4IFDB 2UUAE 4X65E 2HKEA 1N33E 4MU4A 4LPFA 1UDNA 4OZEA 2O3ZA 4WUCA 2PO2A 3KRNA 2O1TA 5JEAF 2BV3A 3H1CA 2NN6B 4LF6I 1UEKA 2EFGA 2HHHE 4DR6I 4RPFA 1U2RA 4DV3E 4AIMA 3HKMA 4KQVA 3ZKBA 4N3OA 5C0XF 2IOPA 4ED4A 2X36A 4R1FA 4GKJI 1RHYA 4M1KA 3GCMA 2JE6A 4DXLA 2Z5CA 1OYPA 1Y6ZA 1HNZI 4U3DA 2PO1B 2PNMA 3L7ZB 1IBMI 3V5RA 1XMQE 4FW3A 2C38A 4JI2I 3WU4A 3DD6A 3QT7A 4HACB 1PIEA 4DV1E 5IWAI 2CVEA 1USVA 4DV2I 4DR5I 5K36A 4OO1A 4DR1E 1WUUA 4DPYA 4JI2E 2DEJA 1NZ0A 1XMOI 4JI8E 4DR3I 3Q1QA 3LTOA 2GS8A 1MG7A 3JAMC 1FNMA 1NHIA 4MU3A 4Z7CA 3ZZ0A 4UT4A 1XNRE 4DR3E 5FWKA 5DROA 5DNXA 2C37A 4YY3I 2PNLA 1HNXI 5ELWA 2PNZB 4LFAI 2C39B 4K0KE 4IFDF 2Z5BB 4X66I 1YHCA 2PO0B 5K36E 4OO1E 1Z0TA 4LCGA 4YY3E 3HJCA 4DR2I 2ZBKB 3OTOI 2JEAB 4KHPI 1R6MA 4LFAE 2O1UA 3T1HI 2NN6F 1ZM4A 4X66E 3M7NG 3H4LA 2HFUA 2IOQA 3F0NA 2UXDE 2ZM6E 2UXBI 3OTOE 1J5EE 1Y5YA 1NHJA 1MU5A 4LFBE 4DV5I 1Z0VA 5DRQA 1ZXMA 3M85D 2UXBE 5K36D 4OO1D 1Y60A 1RR9A 2IESA 3M85G 1IBKI 4JI7I 4DV0E 3HULA 2CZ9A 3B8HA 4DV4E 4WUDA 4YHHI 1MX0A 2WP8B 4B3RI 1UDOA 1N36I 4JI1E 3Q6MA 4LF9I 1VI7A 2X7IA 4JI0I 4B3RE 1YH8A 4NXME 4LCHA 1ZM3A 2CGEA 2NPFA 1N0UA 2UUCE 1I94I 2Z5EA 5IT9Q 4JG4A 4MYUA 2PO2B 4XTJA 1N32E 1H74A 3J7AG 5DNLA 1A6FA 1N34E 1H72C 2HKJA 4GQUA 4B3TI 4BA1A 4FWGA 2VQEE 2HK2A 1FJGI 4MU1A 2E5LE 4B3MI 5IT9C 2IERA 2JE6B 4P52A 5GMEA 1B62A 3PYFA 5K36C 4OO1C 2UU9E 2Z5CB 4P7AA 4IZJA 3WU3A 2O1VA 2V2VA 3P76A 4AM3A 2C38B 3J81Q 2BM0A 5JEAE 1N0VC 2F4VI 1D6TA 1B63A 4LF6E 2J65A 1OYSA 4DR6E 4URLA 4OO1B 4DPWA 1HNWI 1XXEA 5K36B 3B78A 4QNKA 5L3JA 1Y4UA 2WNRA 5C0XE 2CG9A 1Z0WA 4FW6A 4FWDA 1KVKA 1HNWE 5FLXQ 4GKJE 3J81C 2R42A 4FW5A 5JEAD 3JAMQ 1HNZE 4IS9A 4QNJA 4WUBA 1R6LA 2DEIA 1Z5BA 5LMUI 3LPSA 1IBME 1RREA 1P42A 4FW9A 1E3PA 1KIJA 4IZKB 4MDTA 4DUYI 2C37B 1HR0I 2WW4A 5IWAE 2VQFI 4USMA 5FLXC 4DV2E 4DR5E 2JEBB 3GMEA 2UXCI 1H73A 4UTGA 4JI5I 1H7SA 5BR8I 2OI2A 5LMNI 2GQ0A
chains in the Genus database with same CATH topology
2ZITA 3Q6NA 3J7AM 4OX9I 4I3HA 1XMOE 4IZJD 4LF8I 5LMNE 4LFCI 4X62I 3J80C 4B3SI 2Q2EB 4DPUA 4LF4I 1NHHA 4JI4I 4X62E 1HNXE 4JV5I 4GKKI 1H7UA 4X64I 4DUZI 4DV7I 4DR2E 4KHPE 3CWVA 3T1HE 2R3VA 4X64E 3ZM7A 1PVGA 4PRXA 2XEXA 2A2DA 4DV5E 1S16A 2A2CA 4FWHA 4JI3I 4JI7E 4DPTA 1IBKE 4LF7I 4AQYI 4NXNI 1IBLI 2LJPA 1Y4SA 4YHHE 1N36E 3GONA 4LF9E 1IBLE 2HK3A 1Z0EA 4JI0E 3T1YI 2E1RA 1I94E 1VISA 1FWKA 1K47A 1Z0GA 3K1JA 4HY1A 1Z5AA 4B3TE 4JYAI 3P06A 1FJGE 2V2QA 3D4JA 4B3ME 5A2QC 1XNQI 4DU7A 2UUAI 4JYAE 2V8PA 3ZZUA 1FWLA 1FKAE 2V2ZA 2BM1A 1ZM9A 1XNQE 2HHHI 4HXZA 4DPXA 2F4VE 3PRYA 3B82A 4DV3I 4LF5I 3QT5A 3QT6A 1OJ4A 4USKA 3PYGA 1ZM2A 1BKNA 3K17A 4LF5E 3V2UC 1XMQI 3J80Q 2HFSA 1Z0BA 5LMUE 4PU9A 4DV1I 1HR0E 1KTVA 4DUYE 4DR1I 2VQFE 2UXCE 4JI5E 4MYTA 3LNUA 4JI8I 5BR8E 4FN5A 3ZKDA 4OX9E 4JI6I 4LF8E 1XNRI 1EI1A 4LFCE 4B3SE 2UUBI 4JI6E 4HACA 4LF4E 4K0KI 4DV6I 3PYDA 4DR4I 4JI4E 4JV5E 4IZKA 4GKKE 2UUBE 3WU5A 4DUZE 4DV6E 4DV7E 4DR4E 1QZRA 2UXDI 3ZZTA 2ZM6I 4PRVA 1J5EI 3K85A 1Z59A 4LFBI 1HK7A 4DV0I 2O1WA 2Z5BA 4JI3E 4DV4I 3PYEA 3QT8A 4LF7E 5LL6R 4AQYE 2VF3A 1XHKA 4NXNE 4JI1I 5GMDA 4IZJB 1ELOA 1ZXNA 4NXMI 1EA6A 4DU8A 5A2QQ 2UUCI 3M6AA 3T1YE 4HYMA 1KKHA 1N32I 1DARA 1N34I 3WU6A 2V34A 1USUA 4ZVIA 1Z5CA 1S4EA 4DR7I 2VQEI 4Z7YA 2E5LI 1PKPA 4X65I 1N33I 1FI4A 2J7KA 4EMDA 1Z0CA 2UU9I 4DR7E 2AJ4A 2UUAE 4X65E 2HKEA 1N33E 4WUCA 2O1TA 2BV3A 4LF6I 1UEKA 2EFGA 2HHHE 4DR6I 4RPFA 1U2RA 4DV3E 4KQVA 3ZKBA 4N3OA 2IOPA 4ED4A 2X36A 4R1FA 4GKJI 4M1KA 4DXLA 2Z5CA 1Y6ZA 1HNZI 2PNMA 1IBMI 3V5RA 1XMQE 4JI2I 3WU4A 3QT7A 4HACB 1PIEA 4DV1E 5IWAI 1USVA 4DV2I 4DR5I 4DR1E 1WUUA 4DPYA 4JI2E 2DEJA 1NZ0A 1XMOI 4JI8E 4DR3I 3Q1QA 3LTOA 2GS8A 1MG7A 3JAMC 1FNMA 5LMNI 1NHIA 4Z7CA 3ZZ0A 4UT4A 1XNRE 4DR3E 5FWKA 4YY3I 2PNLA 1HNXI 4LFAI 4K0KE 2Z5BB 4X66I 1Z0TA 4YY3E 3HJCA 4DR2I 2ZBKB 3OTOI 4KHPI 4LFAE 2O1UA 3T1HI 1ZM4A 4X66E 3H4LA 2HFUA 2IOQA 3F0NA 2UXDE 2ZM6E 2UXBI 3OTOE 1J5EE 1NHJA 1MU5A 4LFBE 4DV5I 1Z0VA 1ZXMA 2UXBE 1RR9A 1IBKI 4JI7I 4DV0E 3HULA 2CZ9A 3B8HA 4DV4E 4WUDA 4YHHI 1MX0A 4B3RI 1N36I 4JI1E 3Q6MA 4LF9I 2X7IA 4JI0I 4B3RE 4NXME 1ZM3A 2CGEA 2NPFA 1N0UA 2UUCE 1I94I 2Z5EA 5IT9Q 4JG4A 4MYUA 4XTJA 1N32E 1H74A 3J7AG 1A6FA 1N34E 1H72C 2HKJA 4B3TI 4FWGA 2VQEE 2HK2A 1FJGI 2E5LE 4B3MI 5IT9C 5GMEA 4P52A 1B62A 3PYFA 2UU9E 2Z5CB 4P7AA 4IZJA 3WU3A 2O1VA 2V2VA 3J81Q 2BM0A 1N0VC 2F4VI 1D6TA 1B63A 4LF6E 4DR6E 4URLA 4DPWA 1HNWI 3B78A 5L3JA 1Y4UA 2CG9A 1Z0WA 4FWDA 1KVKA 1HNWE 5FLXQ 4GKJE 3J81C 2R42A 3JAMQ 1HNZE 4WUBA 2DEIA 1Z5BA 5LMUI 3LPSA 1IBME 1RREA 4FW9A 4IZKB 1KIJA 1HR0I 4DUYI 2WW4A 5IWAE 2VQFI 4USMA 5FLXC 4DV2E 4DR5E 2UXCI 1H73A 4UTGA 4JI5I 1H7SA 2OI2A 5BR8I 2GQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  3J7A M;  4OX9 I;  4I3H A;  1XMO E;  4LF8 I;  5LMN E;  4LFC I;  4X62 I;  3J80 C;  4B3S I;  2Q2E B;  4DPU A;  4LF4 I;  1NHH A;  4JI4 I;  4X62 E;  1HNX E;  4JV5 I;  4GKK I;  1H7U A;  4X64 I;  4DUZ I;  4DV7 I;  4DR2 E;  4KHP E;  3CWV A;  3T1H E;  2R3V A;  4X64 E;  3ZM7 A;  1PVG A;  4PRX A;  2XEX A;  2A2D A;  4DV5 E;  1S16 A;  2A2C A;  4FWH A;  4JI3 I;  4JI7 E;  4DPT A;  1IBK E;  4LF7 I;  4AQY I;  4NXN I;  1IBL I;  2LJP A;  4YHH E;  1N36 E;  3GON A;  4LF9 E;  1IBL E;  2HK3 A;  1Z0E A;  4JI0 E;  3T1Y I;  2E1R A;  1I94 E;  1VIS A;  1FWK A;  1K47 A;  1Z0G A;  3K1J A;  4HY1 A;  1Z5A A;  4B3T E;  4JYA I;  1FJG E;  2V2Q A;  3D4J A;  4B3M E;  5A2Q C;  1XNQ I;  4DU7 A;  2UUA I;  4JYA E;  2V8P A;  3ZZU A;  1FWL A;  1FKA E;  2V2Z A;  2BM1 A;  1ZM9 A;  1XNQ E;  2HHH I;  4HXZ A;  4DPX A;  2F4V E;  3B82 A;  4DV3 I;  4LF5 I;  3QT5 A;  3QT6 A;  1OJ4 A;  4USK A;  3PYG A;  1ZM2 A;  1BKN A;  3K17 A;  4LF5 E;  3V2U C;  1XMQ I;  3J80 Q;  2HFS A;  1Z0B A;  5LMU E;  4PU9 A;  4DV1 I;  1HR0 E;  1KTV A;  4DUY E;  4DR1 I;  2VQF E;  2UXC E;  4JI5 E;  4MYT A;  3LNU A;  4JI8 I;  5BR8 E;  4FN5 A;  3ZKD A;  4OX9 E;  4JI6 I;  4LF8 E;  1XNR I;  1EI1 A;  4LFC E;  4B3S E;  2UUB I;  4JI6 E;  4HAC A;  4LF4 E;  4K0K I;  4DV6 I;  3PYD A;  4DR4 I;  4JI4 E;  4JV5 E;  4GKK E;  2UUB E;  3WU5 A;  4DUZ E;  4DV6 E;  4DV7 E;  4DR4 E;  1QZR A;  2UXD I;  3ZZT A;  2ZM6 I;  4PRV A;  1J5E I;  1Z59 A;  4LFB I;  4DV0 I;  4JI3 E;  4DV4 I;  3PYE A;  3QT8 A;  4LF7 E;  5LL6 R;  4AQY E;  2VF3 A;  1XHK A;  4NXN E;  4JI1 I;  5GMD A;  1ELO A;  1ZXN A;  4NXM I;  1EA6 A;  4DU8 A;  5A2Q Q;  2UUC I;  3M6A A;  3T1Y E;  4HYM A;  1KKH A;  1N32 I;  1DAR A;  1N34 I;  3WU6 A;  2V34 A;  4ZVI A;  1Z5C A;  1S4E A;  4DR7 I;  2VQE I;  4Z7Y A;  2E5L I;  1PKP A;  4X65 I;  1N33 I;  1FI4 A;  2J7K A;  4EMD A;  1Z0C A;  2UU9 I;  4DR7 E;  2AJ4 A;  2UUA E;  4X65 E;  2HKE A;  1N33 E;  4WUC A;  2BV3 A;  4LF6 I;  1UEK A;  2EFG A;  2HHH E;  4DR6 I;  4RPF A;  1U2R A;  4DV3 E;  4KQV A;  3ZKB A;  4ED4 A;  2X36 A;  4R1F A;  4GKJ I;  4M1K A;  4DXL A;  1HNZ I;  1IBM I;  3V5R A;  1XMQ E;  4JI2 I;  3WU4 A;  3QT7 A;  4HAC B;  1PIE A;  4DV1 E;  5IWA I;  4DV2 I;  4DR5 I;  4DR1 E;  1WUU A;  4DPY A;  4JI2 E;  2DEJ A;  1NZ0 A;  1XMO I;  4JI8 E;  4DR3 I;  3Q1Q A;  3LTO A;  2GS8 A;  1MG7 A;  3JAM C;  1FNM A;  5LMN I;  1NHI A;  4Z7C A;  3ZZ0 A;  4UT4 A;  1XNR E;  4DR3 E;  4YY3 I;  1HNX I;  4LFA I;  4K0K E;  4X66 I;  1Z0T A;  4YY3 E;  4DR2 I;  4KHP I;  2ZBK B;  3OTO I;  4LFA E;  3T1H I;  1ZM4 A;  4X66 E;  3H4L A;  2HFU A;  2UXD E;  3F0N A;  2ZM6 E;  2UXB I;  3OTO E;  1J5E E;  1NHJ A;  1MU5 A;  4LFB E;  4DV5 I;  1Z0V A;  1ZXM A;  2UXB E;  1RR9 A;  1IBK I;  4JI7 I;  4DV0 E;  3HUL A;  2CZ9 A;  3B8H A;  4DV4 E;  4WUD A;  4YHH I;  1MX0 A;  4B3R I;  1N36 I;  4JI1 E;  4LF9 I;  2X7I A;  4JI0 I;  4B3R E;  4NXM E;  1ZM3 A;  2NPF A;  1N0U A;  2UUC E;  1I94 I;  5IT9 Q;  4JG4 A;  4MYU A;  4XTJ A;  1N32 E;  1H74 A;  3J7A G;  1A6F A;  1N34 E;  1H72 C;  2HKJ A;  4B3T I;  4FWG A;  2VQE E;  2HK2 A;  1FJG I;  2E5L E;  4B3M I;  5IT9 C;  5GME A;  4P52 A;  1B62 A;  3PYF A;  2UU9 E;  4P7A A;  3WU3 A;  2V2V A;  3J81 Q;  2BM0 A;  1N0V C;  2F4V I;  1D6T A;  1B63 A;  4LF6 E;  4DR6 E;  4URL A;  4DPW A;  1HNW I;  3B78 A;  5L3J A;  1Z0W A;  4FWD A;  1KVK A;  1HNW E;  5FLX Q;  4GKJ E;  3J81 C;  2R42 A;  3JAM Q;  1HNZ E;  4WUB A;  2DEI A;  1Z5B A;  5LMU I;  3LPS A;  1IBM E;  1RRE A;  4FW9 A;  1HR0 I;  1KIJ A;  4DUY I;  2WW4 A;  5IWA E;  2VQF I;  4USM A;  5FLX C;  4DV2 E;  4DR5 E;  2UXC I;  1H73 A;  4UTG A;  4JI5 I;  1H7S A;  2OI2 A;  5BR8 I; 
#chains in the Genus database with same CATH topology
 2ZIT A;  3Q6N A;  3J7A M;  4OX9 I;  4I3H A;  1XMO E;  4IZJ D;  4LF8 I;  2GO4 A;  5LMN E;  2BA0 D;  4LFC I;  4X62 I;  3J80 C;  4B3S I;  2Q2E B;  4DPU A;  2BA0 G;  4LF4 I;  1NHH A;  4JI4 I;  3CDJ A;  3PS1 A;  2BR2 A;  4X62 E;  4IFD E;  1HNX E;  4JV5 I;  4GKK I;  1H7U A;  4X64 I;  4DUZ I;  4DV7 I;  4DR2 E;  4KHP E;  2NN6 E;  3CWV A;  5JEA C;  3T1H E;  2R3V A;  5K36 F;  4OO1 F;  4X64 E;  3ZM7 A;  1PVG A;  4IFD D;  4PRX A;  2XEX A;  2A2D A;  4DV5 E;  1S16 A;  2A2C A;  4FWH A;  2GO3 A;  4JI3 I;  2NN6 D;  4JI7 E;  4DPT A;  1IBK E;  4LF7 I;  4AQY I;  2AE8 A;  4NXN I;  1IBL I;  2LJP A;  1UDS A;  1Y4S A;  4YHH E;  4BA1 B;  1E3H A;  1N36 E;  3GON A;  4MQY A;  4LF9 E;  1IBL E;  4BA2 A;  2HK3 A;  5JEA A;  1Z0E A;  4JI0 E;  3T1Y I;  4U3B A;  5C0X A;  2E1R A;  1I94 E;  1VIS A;  1FWK A;  1K47 A;  1Z0G A;  3K1J A;  3CDI A;  4HY1 A;  1Z5A A;  2WNR B;  4B3T E;  4JYA I;  4NBQ A;  3P06 A;  1FJG E;  2V2Q A;  3D4J A;  4B3M E;  5A2Q C;  1XNQ I;  4DU7 A;  2UUA I;  4JYA E;  2V8P A;  3ZZU A;  1FWL A;  4FW7 A;  5EKW A;  5DRP A;  1FKA E;  2V2Z A;  2BM1 A;  1ZM9 A;  1XNQ E;  2HHH I;  4HXZ A;  4AID A;  4DPX A;  2F4V E;  3PRY A;  3B82 A;  4DV3 I;  2VES A;  4LF5 I;  3GLL A;  3QT5 A;  3QT6 A;  2JT2 A;  1OJ4 A;  4USK A;  3PYG A;  1ZM2 A;  1BKN A;  3K17 A;  3P3C A;  3UHM A;  4LF5 E;  1UDQ A;  4IFD A;  5C0X D;  3V2U C;  1XMQ I;  3J80 Q;  2HFS A;  1Z0B A;  5LMU E;  4PU9 A;  4DV1 I;  2NN6 A;  1HR0 E;  1KTV A;  4DUY E;  4DR1 I;  2BR2 B;  2VQF E;  2UXC E;  4JI5 E;  4MYT A;  3LNU A;  4JI8 I;  5BR8 E;  4FN5 A;  3ZKD A;  4OX9 E;  4JI6 I;  4LF8 E;  2PO1 A;  3PS2 A;  1XNR I;  1EI1 A;  3L7Z A;  4LFC E;  4B3S E;  2UUB I;  4JI6 E;  4HAC A;  2BA1 D;  3B4T A;  4LF4 E;  4K0K I;  4DV6 I;  3PYD A;  4DR4 I;  4JI4 E;  2BA1 G;  4JV5 E;  4IZK A;  4GKK E;  4ISA A;  2UUB E;  3WU5 A;  4DUZ E;  4DV6 E;  4DV7 E;  4DR4 E;  2JEB A;  1QZR A;  2UXD I;  3ZZT A;  5C0X C;  2ZM6 I;  4PRV A;  3U1Y A;  3M7N D;  1J5E I;  4BA2 B;  3NZK A;  3K85 A;  1Z59 A;  4LCF A;  4LFB I;  5JEA B;  3P3E A;  1HK7 A;  2PNZ A;  4DV0 I;  2C39 A;  5C0X B;  2O1W A;  2Z5B A;  4FW4 A;  4JI3 E;  2PO0 A;  4DV4 I;  3PYE A;  3QT8 A;  4LF7 E;  5LL6 R;  4AQY E;  2VF3 A;  1XHK A;  2JEA A;  4NXN E;  4JI1 I;  5GMD A;  2F1D A;  4IZJ B;  1ELO A;  1ZXN A;  4NXM I;  4LOM A;  4J3D A;  1EA6 A;  4DU8 A;  5A2Q Q;  4MU0 A;  3M6A A;  2UUC I;  3T1Y E;  4HYM A;  3P3G A;  1KKH A;  1N32 I;  1DAR A;  1N34 I;  3WU6 A;  4OKG A;  2V34 A;  1USU A;  4IFD C;  2WP8 A;  5DRR A;  4ZVI A;  1Z5C A;  1OYR A;  1S4E A;  2VQE I;  4DR7 I;  4Z7Y A;  3U1K A;  2E5L I;  1PKP A;  4X65 I;  1N33 I;  1FI4 A;  2J7K A;  4EMD A;  2NN6 C;  3PS3 A;  5EL9 A;  1Z0C A;  2UU9 I;  4DR7 E;  2AJ4 A;  4IFD B;  2UUA E;  4X65 E;  2HKE A;  1N33 E;  4MU4 A;  4LPF A;  1UDN A;  4OZE A;  2O3Z A;  4WUC A;  2PO2 A;  3KRN A;  2O1T A;  5JEA F;  2BV3 A;  3H1C A;  2NN6 B;  4LF6 I;  1UEK A;  2EFG A;  2HHH E;  4DR6 I;  4RPF A;  1U2R A;  4DV3 E;  4AIM A;  3HKM A;  4KQV A;  3ZKB A;  4N3O A;  5C0X F;  2IOP A;  4ED4 A;  2X36 A;  4R1F A;  4GKJ I;  1RHY A;  4M1K A;  3GCM A;  2JE6 A;  4DXL A;  2Z5C A;  1OYP A;  1Y6Z A;  1HNZ I;  4U3D A;  2PO1 B;  2PNM A;  3L7Z B;  1IBM I;  3V5R A;  1XMQ E;  4FW3 A;  2C38 A;  4JI2 I;  3WU4 A;  3DD6 A;  3QT7 A;  4HAC B;  1PIE A;  4DV1 E;  5IWA I;  2CVE A;  1USV A;  4DV2 I;  4DR5 I;  5K36 A;  4OO1 A;  4DR1 E;  1WUU A;  4DPY A;  4JI2 E;  2DEJ A;  1NZ0 A;  1XMO I;  4JI8 E;  4DR3 I;  3Q1Q A;  3LTO A;  2GS8 A;  1MG7 A;  3JAM C;  1FNM A;  1NHI A;  4MU3 A;  4Z7C A;  3ZZ0 A;  4UT4 A;  1XNR E;  4DR3 E;  5FWK A;  5DRO A;  5DNX A;  2C37 A;  4YY3 I;  2PNL A;  1HNX I;  5ELW A;  2PNZ B;  4LFA I;  2C39 B;  4K0K E;  4IFD F;  2Z5B B;  4X66 I;  1YHC A;  2PO0 B;  5K36 E;  4OO1 E;  1Z0T A;  4LCG A;  4YY3 E;  3HJC A;  4DR2 I;  2ZBK B;  3OTO I;  2JEA B;  4KHP I;  1R6M A;  4LFA E;  2O1U A;  3T1H I;  2NN6 F;  1ZM4 A;  4X66 E;  3M7N G;  3H4L A;  2HFU A;  2IOQ A;  3F0N A;  2UXD E;  2ZM6 E;  2UXB I;  3OTO E;  1J5E E;  1Y5Y A;  1NHJ A;  1MU5 A;  4LFB E;  4DV5 I;  1Z0V A;  5DRQ A;  1ZXM A;  3M85 D;  2UXB E;  5K36 D;  4OO1 D;  1Y60 A;  1RR9 A;  2IES A;  3M85 G;  1IBK I;  4JI7 I;  4DV0 E;  3HUL A;  2CZ9 A;  3B8H A;  4DV4 E;  4WUD A;  4YHH I;  1MX0 A;  2WP8 B;  4B3R I;  1UDO A;  1N36 I;  4JI1 E;  3Q6M A;  4LF9 I;  1VI7 A;  2X7I A;  4JI0 I;  4B3R E;  1YH8 A;  4NXM E;  4LCH A;  1ZM3 A;  2CGE A;  2NPF A;  1N0U A;  2UUC E;  1I94 I;  2Z5E A;  5IT9 Q;  4JG4 A;  4MYU A;  2PO2 B;  4XTJ A;  1N32 E;  1H74 A;  3J7A G;  5DNL A;  1A6F A;  1N34 E;  1H72 C;  2HKJ A;  4GQU A;  4B3T I;  4BA1 A;  4FWG A;  2VQE E;  2HK2 A;  1FJG I;  4MU1 A;  2E5L E;  4B3M I;  5IT9 C;  2IER A;  2JE6 B;  4P52 A;  5GME A;  1B62 A;  3PYF A;  5K36 C;  4OO1 C;  2UU9 E;  2Z5C B;  4P7A A;  4IZJ A;  3WU3 A;  2O1V A;  2V2V A;  3P76 A;  4AM3 A;  2C38 B;  3J81 Q;  2BM0 A;  5JEA E;  1N0V C;  2F4V I;  1D6T A;  1B63 A;  4LF6 E;  2J65 A;  1OYS A;  4DR6 E;  4URL A;  4OO1 B;  4DPW A;  1HNW I;  1XXE A;  5K36 B;  3B78 A;  4QNK A;  5L3J A;  1Y4U A;  2WNR A;  5C0X E;  2CG9 A;  1Z0W A;  4FW6 A;  4FWD A;  1KVK A;  1HNW E;  5FLX Q;  4GKJ E;  3J81 C;  2R42 A;  4FW5 A;  5JEA D;  3JAM Q;  1HNZ E;  4IS9 A;  4QNJ A;  4WUB A;  1R6L A;  2DEI A;  1Z5B A;  5LMU I;  3LPS A;  1IBM E;  1RRE A;  1P42 A;  4FW9 A;  1E3P A;  1KIJ A;  4IZK B;  4MDT A;  4DUY I;  2C37 B;  1HR0 I;  2WW4 A;  5IWA E;  2VQF I;  4USM A;  5FLX C;  4DV2 E;  4DR5 E;  2JEB B;  3GME A;  2UXC I;  1H73 A;  4UTG A;  4JI5 I;  1H7S A;  5BR8 I;  2OI2 A;  5LMN I;  2GQ0 A; 
#chains in the Genus database with same CATH homology
 2ZIT A;  3Q6N A;  3J7A M;  4OX9 I;  4I3H A;  1XMO E;  4IZJ D;  4LF8 I;  5LMN E;  4LFC I;  4X62 I;  3J80 C;  4B3S I;  2Q2E B;  4DPU A;  4LF4 I;  1NHH A;  4JI4 I;  4X62 E;  1HNX E;  4JV5 I;  4GKK I;  1H7U A;  4X64 I;  4DUZ I;  4DV7 I;  4DR2 E;  4KHP E;  3CWV A;  3T1H E;  2R3V A;  4X64 E;  3ZM7 A;  1PVG A;  4PRX A;  2XEX A;  2A2D A;  4DV5 E;  1S16 A;  2A2C A;  4FWH A;  4JI3 I;  4JI7 E;  4DPT A;  1IBK E;  4LF7 I;  4AQY I;  4NXN I;  1IBL I;  2LJP A;  1Y4S A;  4YHH E;  1N36 E;  3GON A;  4LF9 E;  1IBL E;  2HK3 A;  1Z0E A;  4JI0 E;  3T1Y I;  2E1R A;  1I94 E;  1VIS A;  1FWK A;  1K47 A;  1Z0G A;  3K1J A;  4HY1 A;  1Z5A A;  4B3T E;  4JYA I;  3P06 A;  1FJG E;  2V2Q A;  3D4J A;  4B3M E;  5A2Q C;  1XNQ I;  4DU7 A;  2UUA I;  4JYA E;  2V8P A;  3ZZU A;  1FWL A;  1FKA E;  2V2Z A;  2BM1 A;  1ZM9 A;  1XNQ E;  2HHH I;  4HXZ A;  4DPX A;  2F4V E;  3PRY A;  3B82 A;  4DV3 I;  4LF5 I;  3QT5 A;  3QT6 A;  1OJ4 A;  4USK A;  3PYG A;  1ZM2 A;  1BKN A;  3K17 A;  4LF5 E;  3V2U C;  1XMQ I;  3J80 Q;  2HFS A;  1Z0B A;  5LMU E;  4PU9 A;  4DV1 I;  1HR0 E;  1KTV A;  4DUY E;  4DR1 I;  2VQF E;  2UXC E;  4JI5 E;  4MYT A;  3LNU A;  4JI8 I;  5BR8 E;  4FN5 A;  3ZKD A;  4OX9 E;  4JI6 I;  4LF8 E;  1XNR I;  1EI1 A;  4LFC E;  4B3S E;  2UUB I;  4JI6 E;  4HAC A;  4LF4 E;  4K0K I;  4DV6 I;  3PYD A;  4DR4 I;  4JI4 E;  4JV5 E;  4IZK A;  4GKK E;  2UUB E;  3WU5 A;  4DUZ E;  4DV6 E;  4DV7 E;  4DR4 E;  1QZR A;  2UXD I;  3ZZT A;  2ZM6 I;  4PRV A;  1J5E I;  3K85 A;  1Z59 A;  4LFB I;  1HK7 A;  4DV0 I;  2O1W A;  2Z5B A;  4JI3 E;  4DV4 I;  3PYE A;  3QT8 A;  4LF7 E;  5LL6 R;  4AQY E;  2VF3 A;  1XHK A;  4NXN E;  4JI1 I;  5GMD A;  4IZJ B;  1ELO A;  1ZXN A;  4NXM I;  1EA6 A;  4DU8 A;  5A2Q Q;  2UUC I;  3M6A A;  3T1Y E;  4HYM A;  1KKH A;  1N32 I;  1DAR A;  1N34 I;  3WU6 A;  2V34 A;  1USU A;  4ZVI A;  1Z5C A;  1S4E A;  4DR7 I;  2VQE I;  4Z7Y A;  2E5L I;  1PKP A;  4X65 I;  1N33 I;  1FI4 A;  2J7K A;  4EMD A;  1Z0C A;  2UU9 I;  4DR7 E;  2AJ4 A;  2UUA E;  4X65 E;  2HKE A;  1N33 E;  4WUC A;  2O1T A;  2BV3 A;  4LF6 I;  1UEK A;  2EFG A;  2HHH E;  4DR6 I;  4RPF A;  1U2R A;  4DV3 E;  4KQV A;  3ZKB A;  4N3O A;  2IOP A;  4ED4 A;  2X36 A;  4R1F A;  4GKJ I;  4M1K A;  4DXL A;  2Z5C A;  1Y6Z A;  1HNZ I;  2PNM A;  1IBM I;  3V5R A;  1XMQ E;  4JI2 I;  3WU4 A;  3QT7 A;  4HAC B;  1PIE A;  4DV1 E;  5IWA I;  1USV A;  4DV2 I;  4DR5 I;  4DR1 E;  1WUU A;  4DPY A;  4JI2 E;  2DEJ A;  1NZ0 A;  1XMO I;  4JI8 E;  4DR3 I;  3Q1Q A;  3LTO A;  2GS8 A;  1MG7 A;  3JAM C;  1FNM A;  5LMN I;  1NHI A;  4Z7C A;  3ZZ0 A;  4UT4 A;  1XNR E;  4DR3 E;  5FWK A;  4YY3 I;  2PNL A;  1HNX I;  4LFA I;  4K0K E;  2Z5B B;  4X66 I;  1Z0T A;  4YY3 E;  3HJC A;  4DR2 I;  2ZBK B;  3OTO I;  4KHP I;  4LFA E;  2O1U A;  3T1H I;  1ZM4 A;  4X66 E;  3H4L A;  2HFU A;  2IOQ A;  3F0N A;  2UXD E;  2ZM6 E;  2UXB I;  3OTO E;  1J5E E;  1NHJ A;  1MU5 A;  4LFB E;  4DV5 I;  1Z0V A;  1ZXM A;  2UXB E;  1RR9 A;  1IBK I;  4JI7 I;  4DV0 E;  3HUL A;  2CZ9 A;  3B8H A;  4DV4 E;  4WUD A;  4YHH I;  1MX0 A;  4B3R I;  1N36 I;  4JI1 E;  3Q6M A;  4LF9 I;  2X7I A;  4JI0 I;  4B3R E;  4NXM E;  1ZM3 A;  2CGE A;  2NPF A;  1N0U A;  2UUC E;  1I94 I;  2Z5E A;  5IT9 Q;  4JG4 A;  4MYU A;  4XTJ A;  1N32 E;  1H74 A;  3J7A G;  1A6F A;  1N34 E;  1H72 C;  2HKJ A;  4B3T I;  4FWG A;  2VQE E;  2HK2 A;  1FJG I;  2E5L E;  4B3M I;  5IT9 C;  5GME A;  4P52 A;  1B62 A;  3PYF A;  2UU9 E;  2Z5C B;  4P7A A;  4IZJ A;  3WU3 A;  2O1V A;  2V2V A;  3J81 Q;  2BM0 A;  1N0V C;  2F4V I;  1D6T A;  1B63 A;  4LF6 E;  4DR6 E;  4URL A;  4DPW A;  1HNW I;  3B78 A;  5L3J A;  1Y4U A;  2CG9 A;  1Z0W A;  4FWD A;  1KVK A;  1HNW E;  5FLX Q;  4GKJ E;  3J81 C;  2R42 A;  3JAM Q;  1HNZ E;  4WUB A;  2DEI A;  1Z5B A;  5LMU I;  3LPS A;  1IBM E;  1RRE A;  4FW9 A;  4IZK B;  1KIJ A;  1HR0 I;  4DUY I;  2WW4 A;  5IWA E;  2VQF I;  4USM A;  5FLX C;  4DV2 E;  4DR5 E;  2UXC I;  1H73 A;  4UTG A;  4JI5 I;  1H7S A;  2OI2 A;  5BR8 I;  2GQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...