4DR1I

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr1I00
2CZ9A 1H7SA 2HFUA 3B78A 4YHHI 1HNZE 4B3SE 4JI0E 4DPYA 1NHHA 3J7AM 4P52A 1XMQI 1N33I 1VISA 4Z7CA 4JI6I 4USMA 3T1HE 4DV2I 3QT6A 4X65I 4DV0E 4RPFA 4PRVA 4FWGA 3OTOE 1DARA 3K17A 4JV5I 4DR2E 1N0UA 4DUYI 3J80Q 4LF9E 2WW4A 4DR1E 4JI8I 5IWAE 3JAMQ 4JI5E 3ZKBA 4NXNI 4URLA 4JI2I 4LF7I 4GKKI 2UUAE 2A2DA 1IBLI 1Z5BA 4LF4I 1XNQE 1Z0VA 4LFAI 4P7AA 1Z0BA 3GONA 2HK3A 1FJGE 4B3ME 4NXME 4GKJE 2X7IA 4JI4I 4LF6I 4DR4I 1ZM3A 1U2RA 4JYAI 3F0NA 2VQEE 1ELOA 1ZM4A 2GS8A 4DPWA 4FW9A 4KHPI 2XEXA 4DV3I 4I3HA 4X65E 1HNWE 4HACA 2HFSA 4MYTA 1EI1A 3QT7A 4M1KA 2UXDI 3HULA 5FLXQ 1H74A 3CWVA 1RREA 4NXNE 4GKKE 4DR3I 1KVKA 2R3VA 4HY1A 3WU6A 4X66I 4DR6E 3V5RA 4LF5I 4DPUA 1ZXMA 4K0KE 4OX9E 1HNXI 2UUCE 1Z0WA 4JYAE 4YY3I 1IBKE 4DV4E 4DU7A 3D4JA 4X64I 4JG4A 1XMOE 1N34E 2VF3A 4X62I 4USKA 4DR7I 4HXZA 1NHJA 3J81Q 2V8PA 3WU3A 5IT9C 3PYDA 4XTJA 1HR0I 5A2QQ 2BM1A 4DUZE 4JI1I 5LMNE 3T1YI 2VQFI 1IBMI 5BR8I 4LFBE 2DEJA 3LTOA 4DR3E 1B62A 4WUCA 4WUDA 4JI7E 2ZBKB 2HHHI 3LPSA 2HKEA 4DR5E 2UUBE 1XNRI 1NHIA 5LMUE 2F4VE 2ZM6E 3J80C 4LF8E 1FNMA 4JI3I 3JAMC 1I94I 2BM0A 4YHHE 1Z5CA 4DR7E 1XMQE 1N33E 3B82A 2UXCI 1Z0GA 1BKNA 2UU9I 4JI6E 4DV6I 1S16A 5LL6R 4DV2E 2E5LI 1N36I 3B8HA 3ZM7A 1H72C 1NZ0A 4B3TI 4JV5E 1RR9A 4DUYE 1J5EI 2V2VA 4JI8E 4JI2E 4LF7E 2HHHE 3V2UC 4FWHA 4FWDA 2EFGA 1IBLE 3QT8A 2BV3A 3T1HI 4LF4E 4LFAE 1S4EA 1Z0TA 2V2ZA 3LNUA 4JI3E 5FLXC 3OTOI 1XHKA 4DR2I 3J7AG 4LF9I 4JI4E 4LF6E 4DR1I 4DR4E 3WU5A 4R1FA 4AQYI 5L3JA 5IWAI 4JI5I 1FWLA 3ZZ0A 4DV6E 4KHPE 3PYGA 4DV3E 2UUAI 1UEKA 2HKJA 2E5LE 4DV5I 1ZM2A 4Z7YA 1KIJA 4PU9A 2DEIA 2UXDE 4PRXA 1FJGI 4B3MI 4NXMI 1J5EE 1PVGA 4GKJI 1Z59A 3PYEA 4DV7I 3ZZTA 3K1JA 2VQEI 4KQVA 1EA6A 3J81C 4B3RI 3PYFA 2AJ4A 5A2QC 4X66E 1Z0CA 4LF5E 1HNWI 1WUUA 1FI4A 1PKPA 1Z5AA 2UXBI 2HK2A 1HNXE 2Q2EB 2V34A 1A6FA 4ZVIA 4AQYE 1H7UA 1MX0A 4YY3E 2A2CA 4X64E 3QT5A 1MU5A 4FN5A 4X62E 1KKHA 3WU4A 2X36A 2NPFA 3ZKDA 4DV5E 1N32I 3ZZUA 4DR6I 2LJPA 1HR0E 1D6TA 4DU8A 3M6AA 4K0KI 4LFCI 4OX9I 2UUCI 4JI1E 2J7KA 4DV1I 4DV7E 1ZM9A 3Q1QA 2ZITA 4DPTA 3T1YE 2VQFE 2R42A 1IBKI 1IBME 5GMEA 5BR8E 4DPXA 4DV4I 2V2QA 4B3RE 1HNZI 4B3SI 1XMOI 4HYMA 1N34I 4ED4A 5GMDA 4JI0I 1FKAE 1K47A 3H4LA 1N0VC 1XNRE 2UXBE 4DXLA 1ZXNA 4DV0I 4EMDA 4DUZI 1OJ4A 4UT4A 1MG7A 2OI2A 5LMNI 1I94E 1Z0EA 4HACB 4LFBI 4UTGA 4WUBA 4MYUA 2UXCE 4JI7I 2E1RA 1FWKA 1N32E 2UU9E 4DR5I 1PIEA 2UUBI 1QZRA 1N36E 1KTVA 4LFCE 1XNQI 1H73A 5LMUI 2F4VI 2ZM6I 1B63A 4LF8I 4DV1E 5IT9Q 4B3TE
chains in the Genus database with same CATH superfamily
2CZ9A 1H7SA 2GO3A 2HFUA 3B78A 5EKWA 4YHHI 2VESA 1HNZE 4B3SE 5FWKA 5C0XF 5DRPA 1HK7A 4JI0E 4DPYA 1NHHA 3J7AM 4P52A 1XMQI 1N33I 5JEAE 1VISA 2IERA 4Z7CA 2PNMA 3KRNA 4JI6I 4OO1B 4USMA 2J65A 3T1HE 4DV2I 3QT6A 2NN6C 3PS3A 2PO1B 5C0XE 4X65I 4FW7A 4DV0E 4RPFA 1OYRA 4PRVA 4FWGA 3OTOE 1DARA 2PO0A 3K17A 3L7ZA 4DR2E 1N0UA 4JV5I 4DUYI 3J80Q 4LF9E 2WW4A 4DR1E 4IZJA 4JI8I 5IWAE 3M85D 3JAMQ 4JI5E 3ZKBA 4NXNI 4URLA 4JI2I 4LF7I 4GKKI 1VI7A 4LCFA 2UUAE 2BR2B 2A2DA 1IBLI 2JEBA 4U3BA 1Z5BA 4LF4I 1XNQE 3U1KA 2IESA 1Z0VA 4LFAI 4P7AA 1Z0BA 1YH8A 3GONA 4LOMA 2HK3A 1FJGE 4B3ME 4OO1F 4NXME 4GKJE 2X7IA 4JI4I 4LF6I 4DR4I 1ZM3A 1U2RA 4JYAI 5C0XA 3F0NA 2VQEE 1ELOA 1ZM4A 2GS8A 4DPWA 4IZJD 3NZKA 4FW9A 4KHPI 2GQ0A 2XEXA 5K36A 4DV3I 4OO1E 2C37B 4I3HA 4X65E 1HNWE 1USUA 3Q6NA 2BA0G 4HACA 4IFDC 2Z5CB 2HFSA 4MYTA 1EI1A 3QT7A 2IOPA 2AE8A 5DNXA 4M1KA 2UXDI 3HULA 1E3HA 2WNRA 5JEAD 5FLXQ 1H74A 3CWVA 1RREA 4NXNE 1UDQA 1UDOA 1Y5YA 4GKKE 1OYPA 4DR3I 5C0XD 1KVKA 2R3VA 4HY1A 3H1CA 3WU6A 4X66I 4DR6E 3V5RA 4LF5I 4DPUA 1ZXMA 2GO4A 4MDTA 4QNKA 4AIDA 5K36D 4K0KE 4OX9E 1HNXI 2UUCE 3B4TA 4MU1A 1Z0WA 4OO1A 4ISAA 4JYAE 4YY3I 1IBKE 4DV4E 2PO1A 4DU7A 3P3GA 3D4JA 4X64I 4JG4A 4U3DA 1XMOE 1N34E 2VF3A 3HKMA 4X62I 4USKA 3M7ND 1R6LA 4DR7I 4HXZA 3GLLA 1NHJA 3J81Q 2V8PA 5K36F 3WU3A 3M7NG 5IT9C 3PYDA 4XTJA 1HR0I 5A2QQ 5DRQA 2BM1A 4DUZE 4JI1I 1P42A 2BR2A 5LMNE 3T1YI 2VQFI 5K36E 1IBMI 5BR8I 2NN6B 4LFBE 4OO1D 2DEJA 3LTOA 4LCHA 4DR3E 1B62A 4WUCA 4WUDA 4JI7E 2ZBKB 2PO2B 2HHHI 3LPSA 2HKEA 4DR5E 3CDIA 2UUBE 1XNRI 3PS2A 2Z5EA 1NHIA 2Z5BB 5LMUE 2F4VE 2ZM6E 3J80C 4LF8E 1FNMA 4JI3I 3JAMC 2C37A 1I94I 4MQYA 2BM0A 4YHHE 2Z5CA 2PNZB 1Z5CA 4DR7E 1XMQE 1N33E 3B82A 2UXCI 1Z0GA 2C38B 1BKNA 1E3PA 2UU9I 4JI6E 4DV6I 1S16A 2BA0D 5LL6R 1R6MA 4OKGA 5DRRA 4DV2E 2NN6F 2E5LI 1N36I 2JEAB 3B8HA 1H72C 3ZM7A 1NZ0A 5DROA 5JEAC 4B3TI 4JV5E 1RR9A 4DUYE 4IS9A 4FW4A 1J5EI 2V2VA 3GMEA 5C0XC 4JI8E 2NN6E 4FW5A 4IFDB 5JEAB 4JI2E 4LF7E 2HHHE 3V2UC 1XXEA 4FWHA 4FWDA 5K36C 2EFGA 2WP8B 1IBLE 3QT8A 2BV3A 3T1HI 4LF4E 2O1UA 4BA1B 2CGEA 4LFAE 1S4EA 1Z0TA 2V2ZA 3LNUA 4JI3E 2CVEA 5FLXC 5ELWA 3DD6A 4OZEA 3CDJA 3GCMA 3OTOI 1XHKA 4DR2I 3J7AG 4BA2B 4LF9I 4JI4E 4LF6E 4DR1I 4DR4E 1USVA 3WU5A 4R1FA 4AQYI 5L3JA 5IWAI 4JI5I 1FWLA 2JT2A 4AM3A 4IZKB 1YHCA 3P06A 3ZZ0A 4DV6E 4KHPE 3PYGA 4DV3E 2UUAI 1UEKA 2HKJA 2BA1D 2E5LE 1Y4UA 4J3DA 4LF8I 4DV5I 2C39B 1ZM2A 2O1WA 2NN6A 4NBQA 4IFDF 4Z7YA 2BA1G 1KIJA 1RHYA 2O3ZA 2IOQA 4PU9A 2DEIA 2PO2A 2UXDE 4PRXA 1FJGI 1Y4SA 4MU3A 4B3MI 4OO1C 4NXMI 1J5EE 1PVGA 4GKJI 1Z59A 3PYEA 2JE6B 4DV7I 4QNJA 3ZZTA 3Q6MA 2CG9A 3K1JA 2Z5BA 4IFDE 2VQEI 4KQVA 1EA6A 5DNLA 3J81C 4B3RI 3PYFA 2AJ4A 5A2QC 4LCGA 4X66E 4MU0A 1Z0CA 4LF5E 1HNWI 3PS1A 1WUUA 1FI4A 1PKPA 1Z5AA 4GQUA 2UXBI 2HK2A 2PNZA 3P3EA 1HNXE 4LPFA 2C38A 2NN6D 2Q2EB 2V34A 1A6FA 4ZVIA 4AQYE 1H7UA 1MX0A 4YY3E 3PRYA 2JEAA 5EL9A 2A2CA 4X64E 3QT5A 4N3OA 1MU5A 4FN5A 4X62E 3M85G 1KKHA 1UDSA 3WU4A 2X36A 2NPFA 2PO0B 3L7ZB 3ZKDA 2PNLA 4DV5E 1N32I 3ZZUA 2O1TA 4DR6I 3UHMA 2LJPA 4IZJB 1HR0E 4IFDA 1D6TA 4DU8A 5JEAA 3M6AA 4K0KI 3K85A 4LFCI 4OX9I 2UUCI 4JI1E 2J7KA 3P76A 4DV1I 4DV7E 1ZM9A 3Q1QA 2WP8A 2ZITA 2JEBB 4DPTA 2VQFE 3T1YE 2R42A 1IBKI 1IBME 5GMEA 5BR8E 4DPXA 4DV4I 2V2QA 4B3RE 4BA1A 1HNZI 4B3SI 4AIMA 1XMOI 4HYMA 1N34I 3P3CA 4ED4A 5GMDA 4JI0I 1FKAE 1K47A 4BA2A 3H4LA 1N0VC 1XNRE 2UXBE 3U1YA 5C0XB 3HJCA 4DXLA 1ZXNA 4IZKA 4DV0I 4EMDA 4FW3A 4DUZI 1OJ4A 4UT4A 4IFDD 1MG7A 5K36B 2OI2A 5LMNI 1I94E 1Z0EA 4FW6A 2C39A 4HACB 1Y60A 4LFBI 4UTGA 2O1VA 4WUBA 4MYUA 1Y6ZA 2UXCE 4JI7I 2E1RA 1FWKA 1N32E 1OYSA 1UDNA 2UU9E 4MU4A 4DR5I 2JE6A 1PIEA 2WNRB 2UUBI 1QZRA 2F1DA 1N36E 1KTVA 4LFCE 1XNQI 1H73A 5LMUI 2F4VI 2ZM6I 1B63A 5JEAF 4DV1E 5IT9Q 4B3TE
chains in the Genus database with same CATH topology
2CZ9A 1H7SA 2HFUA 3B78A 4YHHI 1HNZE 4B3SE 5FWKA 1HK7A 4JI0E 4DPYA 1NHHA 3J7AM 4P52A 1XMQI 1N33I 1VISA 4Z7CA 2PNMA 4JI6I 4USMA 3T1HE 4DV2I 3QT6A 4X65I 4DV0E 4RPFA 4PRVA 4FWGA 3OTOE 1DARA 3K17A 4JV5I 4DR2E 1N0UA 4DUYI 3J80Q 4LF9E 2WW4A 4DR1E 4IZJA 4JI8I 5IWAE 3JAMQ 4JI5E 3ZKBA 4NXNI 4URLA 4JI2I 4LF7I 4GKKI 2UUAE 2A2DA 1IBLI 1Z5BA 4LF4I 1XNQE 1Z0VA 4LFAI 4P7AA 1Z0BA 3GONA 2HK3A 1FJGE 4B3ME 4NXME 4GKJE 2X7IA 4JI4I 4LF6I 4DR4I 1ZM3A 1U2RA 4JYAI 3F0NA 2VQEE 1ELOA 1ZM4A 2GS8A 4DPWA 4IZJD 4FW9A 4KHPI 2GQ0A 2XEXA 4DV3I 4I3HA 4X65E 1HNWE 1USUA 3Q6NA 4HACA 2Z5CB 2HFSA 4MYTA 1EI1A 3QT7A 2IOPA 4M1KA 2UXDI 3HULA 5FLXQ 1H74A 3CWVA 1RREA 4NXNE 4GKKE 4DR3I 1KVKA 2R3VA 4HY1A 3WU6A 4X66I 4DR6E 3V5RA 4LF5I 4DPUA 1ZXMA 4K0KE 4OX9E 1HNXI 2UUCE 1Z0WA 4JYAE 4YY3I 1IBKE 4DV4E 4DU7A 3D4JA 4X64I 4JG4A 1XMOE 1N34E 2VF3A 4X62I 4USKA 4DR7I 4HXZA 1NHJA 3J81Q 2V8PA 3WU3A 5IT9C 3PYDA 4XTJA 1HR0I 5A2QQ 2BM1A 4DUZE 4JI1I 5LMNE 3T1YI 2VQFI 1IBMI 5BR8I 4LFBE 2DEJA 3LTOA 4DR3E 1B62A 4WUCA 4WUDA 4JI7E 2ZBKB 2HHHI 3LPSA 2HKEA 4DR5E 2UUBE 1XNRI 2Z5EA 1NHIA 2Z5BB 5LMUE 2F4VE 2ZM6E 3J80C 4LF8E 1FNMA 4JI3I 3JAMC 1I94I 2BM0A 4YHHE 2Z5CA 1Z5CA 4DR7E 1XMQE 1N33E 3B82A 2UXCI 1Z0GA 1BKNA 2UU9I 4JI6E 4DV6I 1S16A 5LL6R 4DV2E 2E5LI 1N36I 3B8HA 3ZM7A 1H72C 1NZ0A 4B3TI 4JV5E 1RR9A 4DUYE 1J5EI 2V2VA 4JI8E 4JI2E 4LF7E 2HHHE 3V2UC 4FWHA 4FWDA 2EFGA 1IBLE 3QT8A 2BV3A 3T1HI 4LF4E 2O1UA 2CGEA 4LFAE 1S4EA 1Z0TA 2V2ZA 3LNUA 4JI3E 5FLXC 3OTOI 1XHKA 4DR2I 3J7AG 4LF9I 4JI4E 4LF6E 4DR1I 4DR4E 1USVA 3WU5A 4R1FA 4AQYI 5L3JA 5IWAI 4JI5I 1FWLA 4IZKB 3P06A 3ZZ0A 4DV6E 4KHPE 3PYGA 4DV3E 2UUAI 1UEKA 2HKJA 2E5LE 1Y4UA 4DV5I 1ZM2A 2O1WA 4Z7YA 1KIJA 2IOQA 4PU9A 2DEIA 2UXDE 4PRXA 1FJGI 1Y4SA 4B3MI 4NXMI 1J5EE 1PVGA 4GKJI 1Z59A 3PYEA 4DV7I 3ZZTA 3Q6MA 2CG9A 3K1JA 2Z5BA 2VQEI 4KQVA 1EA6A 3J81C 4B3RI 3PYFA 2AJ4A 5A2QC 4X66E 1Z0CA 4LF5E 1HNWI 1WUUA 1FI4A 1PKPA 1Z5AA 2UXBI 2HK2A 1HNXE 2Q2EB 2V34A 1A6FA 4ZVIA 4AQYE 1H7UA 1MX0A 4YY3E 3PRYA 2A2CA 4X64E 3QT5A 4N3OA 1MU5A 4FN5A 4X62E 1KKHA 3WU4A 2X36A 2NPFA 3ZKDA 2PNLA 4DV5E 1N32I 3ZZUA 2O1TA 4DR6I 2LJPA 4IZJB 1HR0E 1D6TA 4DU8A 3M6AA 4K0KI 3K85A 4LFCI 4OX9I 2UUCI 4JI1E 2J7KA 4DV1I 4DV7E 1ZM9A 3Q1QA 2ZITA 4DPTA 3T1YE 2VQFE 2R42A 1IBKI 1IBME 5GMEA 5BR8E 4DPXA 4DV4I 2V2QA 4B3RE 1HNZI 4B3SI 1XMOI 4HYMA 1N34I 4ED4A 5GMDA 4JI0I 1FKAE 1K47A 3H4LA 1N0VC 1XNRE 2UXBE 3HJCA 4DXLA 1ZXNA 4IZKA 4DV0I 4EMDA 4DUZI 1OJ4A 4UT4A 1MG7A 2OI2A 5LMNI 1I94E 1Z0EA 4HACB 4LFBI 4UTGA 2O1VA 4WUBA 4MYUA 1Y6ZA 2UXCE 4JI7I 2E1RA 1FWKA 1N32E 2UU9E 4DR5I 1PIEA 2UUBI 1QZRA 1N36E 1KTVA 4LFCE 1XNQI 1H73A 5LMUI 2F4VI 2ZM6I 1B63A 4LF8I 4DV1E 5IT9Q 4B3TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ9 A;  1H7S A;  2HFU A;  3B78 A;  4YHH I;  1HNZ E;  4B3S E;  4JI0 E;  4DPY A;  1NHH A;  3J7A M;  4P52 A;  1XMQ I;  1N33 I;  1VIS A;  4Z7C A;  4JI6 I;  4USM A;  3T1H E;  4DV2 I;  3QT6 A;  4X65 I;  4DV0 E;  4RPF A;  4PRV A;  4FWG A;  3OTO E;  1DAR A;  3K17 A;  4JV5 I;  4DR2 E;  1N0U A;  4DUY I;  3J80 Q;  4LF9 E;  2WW4 A;  4DR1 E;  4JI8 I;  5IWA E;  3JAM Q;  4JI5 E;  3ZKB A;  4NXN I;  4URL A;  4JI2 I;  4LF7 I;  4GKK I;  2UUA E;  2A2D A;  1IBL I;  1Z5B A;  4LF4 I;  1XNQ E;  1Z0V A;  4LFA I;  4P7A A;  1Z0B A;  3GON A;  2HK3 A;  1FJG E;  4B3M E;  4NXM E;  4GKJ E;  2X7I A;  4JI4 I;  4LF6 I;  4DR4 I;  1ZM3 A;  1U2R A;  4JYA I;  3F0N A;  2VQE E;  1ELO A;  1ZM4 A;  2GS8 A;  4DPW A;  4FW9 A;  4KHP I;  2XEX A;  4DV3 I;  4I3H A;  4X65 E;  1HNW E;  4HAC A;  2HFS A;  4MYT A;  1EI1 A;  3QT7 A;  4M1K A;  2UXD I;  3HUL A;  5FLX Q;  1H74 A;  3CWV A;  1RRE A;  4NXN E;  4GKK E;  4DR3 I;  1KVK A;  2R3V A;  4HY1 A;  3WU6 A;  4X66 I;  4DR6 E;  3V5R A;  4LF5 I;  4DPU A;  1ZXM A;  4K0K E;  4OX9 E;  1HNX I;  2UUC E;  1Z0W A;  4JYA E;  4YY3 I;  1IBK E;  4DV4 E;  4DU7 A;  3D4J A;  4X64 I;  4JG4 A;  1XMO E;  1N34 E;  2VF3 A;  4X62 I;  4USK A;  4DR7 I;  4HXZ A;  1NHJ A;  3J81 Q;  2V8P A;  3WU3 A;  5IT9 C;  3PYD A;  4XTJ A;  1HR0 I;  5A2Q Q;  2BM1 A;  4DUZ E;  4JI1 I;  5LMN E;  3T1Y I;  2VQF I;  1IBM I;  5BR8 I;  4LFB E;  2DEJ A;  3LTO A;  4DR3 E;  1B62 A;  4WUC A;  4WUD A;  4JI7 E;  2ZBK B;  2HHH I;  3LPS A;  2HKE A;  4DR5 E;  2UUB E;  1XNR I;  1NHI A;  5LMU E;  2F4V E;  2ZM6 E;  3J80 C;  4LF8 E;  1FNM A;  4JI3 I;  3JAM C;  1I94 I;  2BM0 A;  4YHH E;  1Z5C A;  4DR7 E;  1XMQ E;  1N33 E;  3B82 A;  2UXC I;  1Z0G A;  1BKN A;  2UU9 I;  4JI6 E;  4DV6 I;  1S16 A;  5LL6 R;  4DV2 E;  2E5L I;  1N36 I;  3B8H A;  3ZM7 A;  1H72 C;  1NZ0 A;  4B3T I;  4JV5 E;  1RR9 A;  4DUY E;  1J5E I;  2V2V A;  4JI8 E;  4JI2 E;  4LF7 E;  2HHH E;  3V2U C;  4FWH A;  4FWD A;  2EFG A;  1IBL E;  3QT8 A;  2BV3 A;  3T1H I;  4LF4 E;  4LFA E;  1S4E A;  1Z0T A;  2V2Z A;  3LNU A;  4JI3 E;  5FLX C;  3OTO I;  1XHK A;  4DR2 I;  3J7A G;  4LF9 I;  4JI4 E;  4LF6 E;  4DR1 I;  4DR4 E;  3WU5 A;  4R1F A;  4AQY I;  5L3J A;  5IWA I;  4JI5 I;  1FWL A;  3ZZ0 A;  4DV6 E;  4KHP E;  3PYG A;  4DV3 E;  2UUA I;  1UEK A;  2HKJ A;  2E5L E;  4DV5 I;  1ZM2 A;  4Z7Y A;  1KIJ A;  4PU9 A;  2DEI A;  2UXD E;  4PRX A;  1FJG I;  4B3M I;  4NXM I;  1J5E E;  1PVG A;  4GKJ I;  1Z59 A;  3PYE A;  4DV7 I;  3ZZT A;  3K1J A;  2VQE I;  4KQV A;  1EA6 A;  3J81 C;  4B3R I;  3PYF A;  2AJ4 A;  5A2Q C;  4X66 E;  1Z0C A;  4LF5 E;  1HNW I;  1WUU A;  1FI4 A;  1PKP A;  1Z5A A;  2UXB I;  2HK2 A;  1HNX E;  2Q2E B;  2V34 A;  1A6F A;  4ZVI A;  4AQY E;  1H7U A;  1MX0 A;  4YY3 E;  2A2C A;  4X64 E;  3QT5 A;  1MU5 A;  4FN5 A;  4X62 E;  1KKH A;  3WU4 A;  2X36 A;  2NPF A;  3ZKD A;  4DV5 E;  1N32 I;  3ZZU A;  4DR6 I;  2LJP A;  1HR0 E;  1D6T A;  4DU8 A;  3M6A A;  4K0K I;  4LFC I;  4OX9 I;  2UUC I;  4JI1 E;  2J7K A;  4DV1 I;  4DV7 E;  1ZM9 A;  3Q1Q A;  2ZIT A;  4DPT A;  3T1Y E;  2VQF E;  2R42 A;  1IBK I;  1IBM E;  5GME A;  5BR8 E;  4DPX A;  4DV4 I;  2V2Q A;  4B3R E;  1HNZ I;  4B3S I;  1XMO I;  4HYM A;  1N34 I;  4ED4 A;  5GMD A;  4JI0 I;  1FKA E;  1K47 A;  3H4L A;  1N0V C;  1XNR E;  2UXB E;  4DXL A;  1ZXN A;  4DV0 I;  4EMD A;  4DUZ I;  1OJ4 A;  4UT4 A;  1MG7 A;  2OI2 A;  5LMN I;  1I94 E;  1Z0E A;  4HAC B;  4LFB I;  4UTG A;  4WUB A;  4MYU A;  2UXC E;  4JI7 I;  2E1R A;  1FWK A;  1N32 E;  2UU9 E;  4DR5 I;  1PIE A;  2UUB I;  1QZR A;  1N36 E;  1KTV A;  4LFC E;  1XNQ I;  1H73 A;  5LMU I;  2F4V I;  2ZM6 I;  1B63 A;  4LF8 I;  4DV1 E;  5IT9 Q;  4B3T E; 
#chains in the Genus database with same CATH topology
 2CZ9 A;  1H7S A;  2GO3 A;  2HFU A;  3B78 A;  5EKW A;  4YHH I;  2VES A;  1HNZ E;  4B3S E;  5FWK A;  5C0X F;  5DRP A;  1HK7 A;  4JI0 E;  4DPY A;  1NHH A;  3J7A M;  4P52 A;  1XMQ I;  1N33 I;  5JEA E;  1VIS A;  2IER A;  4Z7C A;  2PNM A;  3KRN A;  4JI6 I;  4OO1 B;  4USM A;  2J65 A;  3T1H E;  4DV2 I;  3QT6 A;  2NN6 C;  3PS3 A;  2PO1 B;  5C0X E;  4X65 I;  4FW7 A;  4DV0 E;  4RPF A;  1OYR A;  4PRV A;  4FWG A;  3OTO E;  1DAR A;  2PO0 A;  3K17 A;  3L7Z A;  4DR2 E;  1N0U A;  4JV5 I;  4DUY I;  3J80 Q;  4LF9 E;  2WW4 A;  4DR1 E;  4IZJ A;  4JI8 I;  5IWA E;  3M85 D;  3JAM Q;  4JI5 E;  3ZKB A;  4NXN I;  4URL A;  4JI2 I;  4LF7 I;  4GKK I;  1VI7 A;  4LCF A;  2UUA E;  2BR2 B;  2A2D A;  1IBL I;  2JEB A;  4U3B A;  1Z5B A;  4LF4 I;  1XNQ E;  3U1K A;  2IES A;  1Z0V A;  4LFA I;  4P7A A;  1Z0B A;  1YH8 A;  3GON A;  4LOM A;  2HK3 A;  1FJG E;  4B3M E;  4OO1 F;  4NXM E;  4GKJ E;  2X7I A;  4JI4 I;  4LF6 I;  4DR4 I;  1ZM3 A;  1U2R A;  4JYA I;  5C0X A;  3F0N A;  2VQE E;  1ELO A;  1ZM4 A;  2GS8 A;  4DPW A;  4IZJ D;  3NZK A;  4FW9 A;  4KHP I;  2GQ0 A;  2XEX A;  5K36 A;  4DV3 I;  4OO1 E;  2C37 B;  4I3H A;  4X65 E;  1HNW E;  1USU A;  3Q6N A;  2BA0 G;  4HAC A;  4IFD C;  2Z5C B;  2HFS A;  4MYT A;  1EI1 A;  3QT7 A;  2IOP A;  2AE8 A;  5DNX A;  4M1K A;  2UXD I;  3HUL A;  1E3H A;  2WNR A;  5JEA D;  5FLX Q;  1H74 A;  3CWV A;  1RRE A;  4NXN E;  1UDQ A;  1UDO A;  1Y5Y A;  4GKK E;  1OYP A;  4DR3 I;  5C0X D;  1KVK A;  2R3V A;  4HY1 A;  3H1C A;  3WU6 A;  4X66 I;  4DR6 E;  3V5R A;  4LF5 I;  4DPU A;  1ZXM A;  2GO4 A;  4MDT A;  4QNK A;  4AID A;  5K36 D;  4K0K E;  4OX9 E;  1HNX I;  2UUC E;  3B4T A;  4MU1 A;  1Z0W A;  4OO1 A;  4ISA A;  4JYA E;  4YY3 I;  1IBK E;  4DV4 E;  2PO1 A;  4DU7 A;  3P3G A;  3D4J A;  4X64 I;  4JG4 A;  4U3D A;  1XMO E;  1N34 E;  2VF3 A;  3HKM A;  4X62 I;  4USK A;  3M7N D;  1R6L A;  4DR7 I;  4HXZ A;  3GLL A;  1NHJ A;  3J81 Q;  2V8P A;  5K36 F;  3WU3 A;  3M7N G;  5IT9 C;  3PYD A;  4XTJ A;  1HR0 I;  5A2Q Q;  5DRQ A;  2BM1 A;  4DUZ E;  4JI1 I;  1P42 A;  2BR2 A;  5LMN E;  3T1Y I;  2VQF I;  5K36 E;  1IBM I;  5BR8 I;  2NN6 B;  4LFB E;  4OO1 D;  2DEJ A;  3LTO A;  4LCH A;  4DR3 E;  1B62 A;  4WUC A;  4WUD A;  4JI7 E;  2ZBK B;  2PO2 B;  2HHH I;  3LPS A;  2HKE A;  4DR5 E;  3CDI A;  2UUB E;  1XNR I;  3PS2 A;  2Z5E A;  1NHI A;  2Z5B B;  5LMU E;  2F4V E;  2ZM6 E;  3J80 C;  4LF8 E;  1FNM A;  4JI3 I;  3JAM C;  2C37 A;  1I94 I;  4MQY A;  2BM0 A;  4YHH E;  2Z5C A;  2PNZ B;  1Z5C A;  4DR7 E;  1XMQ E;  1N33 E;  3B82 A;  2UXC I;  1Z0G A;  2C38 B;  1BKN A;  1E3P A;  2UU9 I;  4JI6 E;  4DV6 I;  1S16 A;  2BA0 D;  5LL6 R;  1R6M A;  4OKG A;  5DRR A;  4DV2 E;  2NN6 F;  2E5L I;  1N36 I;  2JEA B;  3B8H A;  1H72 C;  3ZM7 A;  1NZ0 A;  5DRO A;  5JEA C;  4B3T I;  4JV5 E;  1RR9 A;  4DUY E;  4IS9 A;  4FW4 A;  1J5E I;  2V2V A;  3GME A;  5C0X C;  4JI8 E;  2NN6 E;  4FW5 A;  4IFD B;  5JEA B;  4JI2 E;  4LF7 E;  2HHH E;  3V2U C;  1XXE A;  4FWH A;  4FWD A;  5K36 C;  2EFG A;  2WP8 B;  1IBL E;  3QT8 A;  2BV3 A;  3T1H I;  4LF4 E;  2O1U A;  4BA1 B;  2CGE A;  4LFA E;  1S4E A;  1Z0T A;  2V2Z A;  3LNU A;  4JI3 E;  2CVE A;  5FLX C;  5ELW A;  3DD6 A;  4OZE A;  3CDJ A;  3GCM A;  3OTO I;  1XHK A;  4DR2 I;  3J7A G;  4BA2 B;  4LF9 I;  4JI4 E;  4LF6 E;  4DR1 I;  4DR4 E;  1USV A;  3WU5 A;  4R1F A;  4AQY I;  5L3J A;  5IWA I;  4JI5 I;  1FWL A;  2JT2 A;  4AM3 A;  4IZK B;  1YHC A;  3P06 A;  3ZZ0 A;  4DV6 E;  4KHP E;  3PYG A;  4DV3 E;  2UUA I;  1UEK A;  2HKJ A;  2BA1 D;  2E5L E;  1Y4U A;  4J3D A;  4LF8 I;  4DV5 I;  2C39 B;  1ZM2 A;  2O1W A;  2NN6 A;  4NBQ A;  4IFD F;  4Z7Y A;  2BA1 G;  1KIJ A;  1RHY A;  2O3Z A;  2IOQ A;  4PU9 A;  2DEI A;  2PO2 A;  2UXD E;  4PRX A;  1FJG I;  1Y4S A;  4MU3 A;  4B3M I;  4OO1 C;  4NXM I;  1J5E E;  1PVG A;  4GKJ I;  1Z59 A;  3PYE A;  2JE6 B;  4DV7 I;  4QNJ A;  3ZZT A;  3Q6M A;  2CG9 A;  3K1J A;  2Z5B A;  4IFD E;  2VQE I;  4KQV A;  1EA6 A;  5DNL A;  3J81 C;  4B3R I;  3PYF A;  2AJ4 A;  5A2Q C;  4LCG A;  4X66 E;  4MU0 A;  1Z0C A;  4LF5 E;  1HNW I;  3PS1 A;  1WUU A;  1FI4 A;  1PKP A;  1Z5A A;  4GQU A;  2UXB I;  2HK2 A;  2PNZ A;  3P3E A;  1HNX E;  4LPF A;  2C38 A;  2NN6 D;  2Q2E B;  2V34 A;  1A6F A;  4ZVI A;  4AQY E;  1H7U A;  1MX0 A;  4YY3 E;  3PRY A;  2JEA A;  5EL9 A;  2A2C A;  4X64 E;  3QT5 A;  4N3O A;  1MU5 A;  4FN5 A;  4X62 E;  3M85 G;  1KKH A;  1UDS A;  3WU4 A;  2X36 A;  2NPF A;  2PO0 B;  3L7Z B;  3ZKD A;  2PNL A;  4DV5 E;  1N32 I;  3ZZU A;  2O1T A;  4DR6 I;  3UHM A;  2LJP A;  4IZJ B;  1HR0 E;  4IFD A;  1D6T A;  4DU8 A;  5JEA A;  3M6A A;  4K0K I;  3K85 A;  4LFC I;  4OX9 I;  2UUC I;  4JI1 E;  2J7K A;  3P76 A;  4DV1 I;  4DV7 E;  1ZM9 A;  3Q1Q A;  2WP8 A;  2ZIT A;  2JEB B;  4DPT A;  2VQF E;  3T1Y E;  2R42 A;  1IBK I;  1IBM E;  5GME A;  5BR8 E;  4DPX A;  4DV4 I;  2V2Q A;  4B3R E;  4BA1 A;  1HNZ I;  4B3S I;  4AIM A;  1XMO I;  4HYM A;  1N34 I;  3P3C A;  4ED4 A;  5GMD A;  4JI0 I;  1FKA E;  1K47 A;  4BA2 A;  3H4L A;  1N0V C;  1XNR E;  2UXB E;  3U1Y A;  5C0X B;  3HJC A;  4DXL A;  1ZXN A;  4IZK A;  4DV0 I;  4EMD A;  4FW3 A;  4DUZ I;  1OJ4 A;  4UT4 A;  4IFD D;  1MG7 A;  5K36 B;  2OI2 A;  5LMN I;  1I94 E;  1Z0E A;  4FW6 A;  2C39 A;  4HAC B;  1Y60 A;  4LFB I;  4UTG A;  2O1V A;  4WUB A;  4MYU A;  1Y6Z A;  2UXC E;  4JI7 I;  2E1R A;  1FWK A;  1N32 E;  1OYS A;  1UDN A;  2UU9 E;  4MU4 A;  4DR5 I;  2JE6 A;  1PIE A;  2WNR B;  2UUB I;  1QZR A;  2F1D A;  1N36 E;  1KTV A;  4LFC E;  1XNQ I;  1H73 A;  5LMU I;  2F4V I;  2ZM6 I;  1B63 A;  5JEA F;  4DV1 E;  5IT9 Q;  4B3T E; 
#chains in the Genus database with same CATH homology
 2CZ9 A;  1H7S A;  2HFU A;  3B78 A;  4YHH I;  1HNZ E;  4B3S E;  5FWK A;  1HK7 A;  4JI0 E;  4DPY A;  1NHH A;  3J7A M;  4P52 A;  1XMQ I;  1N33 I;  1VIS A;  4Z7C A;  2PNM A;  4JI6 I;  4USM A;  3T1H E;  4DV2 I;  3QT6 A;  4X65 I;  4DV0 E;  4RPF A;  4PRV A;  4FWG A;  3OTO E;  1DAR A;  3K17 A;  4JV5 I;  4DR2 E;  1N0U A;  4DUY I;  3J80 Q;  4LF9 E;  2WW4 A;  4DR1 E;  4IZJ A;  4JI8 I;  5IWA E;  3JAM Q;  4JI5 E;  3ZKB A;  4NXN I;  4URL A;  4JI2 I;  4LF7 I;  4GKK I;  2UUA E;  2A2D A;  1IBL I;  1Z5B A;  4LF4 I;  1XNQ E;  1Z0V A;  4LFA I;  4P7A A;  1Z0B A;  3GON A;  2HK3 A;  1FJG E;  4B3M E;  4NXM E;  4GKJ E;  2X7I A;  4JI4 I;  4LF6 I;  4DR4 I;  1ZM3 A;  1U2R A;  4JYA I;  3F0N A;  2VQE E;  1ELO A;  1ZM4 A;  2GS8 A;  4DPW A;  4IZJ D;  4FW9 A;  4KHP I;  2GQ0 A;  2XEX A;  4DV3 I;  4I3H A;  4X65 E;  1HNW E;  1USU A;  3Q6N A;  4HAC A;  2Z5C B;  2HFS A;  4MYT A;  1EI1 A;  3QT7 A;  2IOP A;  4M1K A;  2UXD I;  3HUL A;  5FLX Q;  1H74 A;  3CWV A;  1RRE A;  4NXN E;  4GKK E;  4DR3 I;  1KVK A;  2R3V A;  4HY1 A;  3WU6 A;  4X66 I;  4DR6 E;  3V5R A;  4LF5 I;  4DPU A;  1ZXM A;  4K0K E;  4OX9 E;  1HNX I;  2UUC E;  1Z0W A;  4JYA E;  4YY3 I;  1IBK E;  4DV4 E;  4DU7 A;  3D4J A;  4X64 I;  4JG4 A;  1XMO E;  1N34 E;  2VF3 A;  4X62 I;  4USK A;  4DR7 I;  4HXZ A;  1NHJ A;  3J81 Q;  2V8P A;  3WU3 A;  5IT9 C;  3PYD A;  4XTJ A;  1HR0 I;  5A2Q Q;  2BM1 A;  4DUZ E;  4JI1 I;  5LMN E;  3T1Y I;  2VQF I;  1IBM I;  5BR8 I;  4LFB E;  2DEJ A;  3LTO A;  4DR3 E;  1B62 A;  4WUC A;  4WUD A;  4JI7 E;  2ZBK B;  2HHH I;  3LPS A;  2HKE A;  4DR5 E;  2UUB E;  1XNR I;  2Z5E A;  1NHI A;  2Z5B B;  5LMU E;  2F4V E;  2ZM6 E;  3J80 C;  4LF8 E;  1FNM A;  4JI3 I;  3JAM C;  1I94 I;  2BM0 A;  4YHH E;  2Z5C A;  1Z5C A;  4DR7 E;  1XMQ E;  1N33 E;  3B82 A;  2UXC I;  1Z0G A;  1BKN A;  2UU9 I;  4JI6 E;  4DV6 I;  1S16 A;  5LL6 R;  4DV2 E;  2E5L I;  1N36 I;  3B8H A;  3ZM7 A;  1H72 C;  1NZ0 A;  4B3T I;  4JV5 E;  1RR9 A;  4DUY E;  1J5E I;  2V2V A;  4JI8 E;  4JI2 E;  4LF7 E;  2HHH E;  3V2U C;  4FWH A;  4FWD A;  2EFG A;  1IBL E;  3QT8 A;  2BV3 A;  3T1H I;  4LF4 E;  2O1U A;  2CGE A;  4LFA E;  1S4E A;  1Z0T A;  2V2Z A;  3LNU A;  4JI3 E;  5FLX C;  3OTO I;  1XHK A;  4DR2 I;  3J7A G;  4LF9 I;  4JI4 E;  4LF6 E;  4DR1 I;  4DR4 E;  1USV A;  3WU5 A;  4R1F A;  4AQY I;  5L3J A;  5IWA I;  4JI5 I;  1FWL A;  4IZK B;  3P06 A;  3ZZ0 A;  4DV6 E;  4KHP E;  3PYG A;  4DV3 E;  2UUA I;  1UEK A;  2HKJ A;  2E5L E;  1Y4U A;  4DV5 I;  1ZM2 A;  2O1W A;  4Z7Y A;  1KIJ A;  2IOQ A;  4PU9 A;  2DEI A;  2UXD E;  4PRX A;  1FJG I;  1Y4S A;  4B3M I;  4NXM I;  1J5E E;  1PVG A;  4GKJ I;  1Z59 A;  3PYE A;  4DV7 I;  3ZZT A;  3Q6M A;  2CG9 A;  3K1J A;  2Z5B A;  2VQE I;  4KQV A;  1EA6 A;  3J81 C;  4B3R I;  3PYF A;  2AJ4 A;  5A2Q C;  4X66 E;  1Z0C A;  4LF5 E;  1HNW I;  1WUU A;  1FI4 A;  1PKP A;  1Z5A A;  2UXB I;  2HK2 A;  1HNX E;  2Q2E B;  2V34 A;  1A6F A;  4ZVI A;  4AQY E;  1H7U A;  1MX0 A;  4YY3 E;  3PRY A;  2A2C A;  4X64 E;  3QT5 A;  4N3O A;  1MU5 A;  4FN5 A;  4X62 E;  1KKH A;  3WU4 A;  2X36 A;  2NPF A;  3ZKD A;  2PNL A;  4DV5 E;  1N32 I;  3ZZU A;  2O1T A;  4DR6 I;  2LJP A;  4IZJ B;  1HR0 E;  1D6T A;  4DU8 A;  3M6A A;  4K0K I;  3K85 A;  4LFC I;  4OX9 I;  2UUC I;  4JI1 E;  2J7K A;  4DV1 I;  4DV7 E;  1ZM9 A;  3Q1Q A;  2ZIT A;  4DPT A;  3T1Y E;  2VQF E;  2R42 A;  1IBK I;  1IBM E;  5GME A;  5BR8 E;  4DPX A;  4DV4 I;  2V2Q A;  4B3R E;  1HNZ I;  4B3S I;  1XMO I;  4HYM A;  1N34 I;  4ED4 A;  5GMD A;  4JI0 I;  1FKA E;  1K47 A;  3H4L A;  1N0V C;  1XNR E;  2UXB E;  3HJC A;  4DXL A;  1ZXN A;  4IZK A;  4DV0 I;  4EMD A;  4DUZ I;  1OJ4 A;  4UT4 A;  1MG7 A;  2OI2 A;  5LMN I;  1I94 E;  1Z0E A;  4HAC B;  4LFB I;  4UTG A;  2O1V A;  4WUB A;  4MYU A;  1Y6Z A;  2UXC E;  4JI7 I;  2E1R A;  1FWK A;  1N32 E;  2UU9 E;  4DR5 I;  1PIE A;  2UUB I;  1QZR A;  1N36 E;  1KTV A;  4LFC E;  1XNQ I;  1H73 A;  5LMU I;  2F4V I;  2ZM6 I;  1B63 A;  4LF8 I;  4DV1 E;  5IT9 Q;  4B3T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...