4DR1M

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr1M02
4DR2M 4NXMM 3T1HM 1L1ZA 2F5PA 4DV5M 3TWKA 4JI1M 3SATA 2F5OA 2Q2EB 3GPYA 4DV0M 4G4OA 3A46A 2UXCM 1PJIA 4JI7M 1KFVA 4PDGA 2ZBKB 5ITXA 3GPXA 5BR8M 2F5SA 3U6DA 4JV5M 4LFCM 3DOAA 4DR6M 4LF6M 4PCZA 3SAUA 3GPPA 1K3XA 3TWLA 3J80S 2EA0A 3U6SA 4GKJM 3J81S 3U6OA 1EE8A 3A42A 2UUBM 2OQ4A 2UU9M 4YY3M 1N34M 1IBLM 1Z5BA 3W0FA 1XC8A 4DR4M 4LFAM 5LMUM 1FJGM 4GKKM 5ITTA 4CISA 1MX0A 4B3MM 1HR0M 5FLXS 4DV6M 2XZFA 1K82A 1XNQM 2VQEM 2F4VM 1L1TA 5ITXE 2VQFM 4DUZM 4NXNM 4DUYM 4KHPM 1L2BA 3GQ5A 3OTOM 4G4QA 3J7AS 4G4RA 4LF8M 3JR5A 1L2DA 4B3SM 1HNWM 4DR7M 1Z5AA 2HKJA 3T1YM 4DV2M 3U6MA 3SAWA 5ITRA 4B3RM 3SAVA 4LF7M 4JI0M 1PJJA 2OPFA 4JI2M 2F5QA 3GP1A 3VK8A 5IWAM 4X66M 1TDHA 1XMOM 5ITQA 3GQ4A 3VK7A 1PM5A 3JR4A 4JI4M 1Q3BA 3U6EA 1Q39A 4LFBM 2HHHM 3GPUA 4DV1M 4AQYM 1TDZA 1NNJA 1K3WA 1J5EM 2XZUA 1Q3CA 4B3TM 5IT9S 4DR3M 3C58A 5LMNM 2F5NA 1HNXM 3SASA 4PD2A 1HNZM 4JI5M 4K0KM 4DR5M 1IBKM 1Z5CA 4X62M 4G4NA 4MB7A 4PDIA 3SBJA 3U6LA 3SARA 1XMQM 1XNRM 1Z59A 1IBMM 4JI6M 5A2QS 1MU5A 4JI8M 2E5LM 5ITUA 1N32M 4JYAM 4YHHM 2UUAM 1L2CA 1I94M 4X65M 2ZM6M 3GO8A 3U6CA 4JI3M 4DV7M 5ITYA 1N36M 4LF5M 3JAMS 4DV4M 4X64M 3GQ3A 2UXDM 4LF4M 4NRWA 3A45A 4DR1M 1R2YA 1N33M 4DV3M 2UXBM 2UUCM 3U6PA 4OX9M 3U6QA 4ITQA 4NRVA 1R2ZA 3TWMA 4LF9M
chains in the Genus database with same CATH superfamily
2DZLA 2L4EA 2B3TA 2R0IA 2F5OA 2D7EA 3PNYA 2CE7A 2L7HA 3GPYA 2DWZB 3HHWA 4DV0M 1IY0A 2QQ8A 3A46A 1IM2A 2QNJA 4AZFA 4OW0A 4JI7M 1KFVA 1IN5A 2L2DA 5GKNA 5BR8M 1XXHE 1F4IA 4NC6A 2LHGA 3CTWB 1OFIA 2KHHA 1G4AE 3HGIA 2CP8A 3IHPA 4AKGA 4G6ZA 3J80S 1MJGM 2EA0A 1LV7A 4R7GA 3U6OA 2D7HA 4CJ6A 2JY5A 2YNMD 2EJSA 2XFSA 4KLNA 1Q02A 3HHYA 1PGYA 2WSFF 2JY6B 1IBLM 3L25A 1OIZA 4IBCA 5LMUM 4GH9A 4GKKM 2QENA 3PXGA 1IXZA 4B08A 1HR0M 5FLXS 4DV6M 1K82A 4IBDA 1YUBA 3M0EA 2VQEM 4II7A 3AL0C 3SHGB 2VQFM 2EUCA 4ZPXA 4DUYM 4LZZA 1ZMWA 4Z6YA 3U5ZA 4GEWA 4NOOB 2YR0A 1GKIA 5C1BA 1WGNA 4AKHA 3LW5F 3OTOM 4G4QA 1YSYA 3T6PA 4LGMA 3J7AS 1VDDA 3LCVB 3FTCA 1Z5AA 2HKJA 2VF8A 2R6FA 1SG9A 3B7QA 3J2PB 4UN2B 4AG5A 4DV2M 1JQJC 4QOZC 2H1RA 5ITRA 5EXTA 2CV2A 1SXJA 2OPFA 1HQCA 3ZC7B 2O5RA 2F5QA 3WHLA 2R4EA 4S12A 4X66M 4I81A 4JN6A 2RKOA 1TDHA 5ITQA 3J7BA 4F1IA 1TR8A 2BJWA 3K2LA 1D2NA 4MGZE 1QAMA 4LGYA 3AOGA 1NNJA 4GMQA 1J5EM 5IZ7D 4DR3M 3C3DA 4QNRA 2JZ1A 2KZSA 4GC5A 3KOXE 1IQPA 4LJ9A 4D81A 5LMNM 1G71A 4FD2A 4Z8XA 4AG6A 4OVZA 1HNXM 3SASA 3L2AA 3T15A 4BLCA 2CRUA 3A98B 2CHGA 4WP2A 4PD2A 3B7ZA 3SFZA 4JI5M 4X62M 3NBXX 1TH4A 2J7OA 4PDIA 3SBJA 3SARA 1XNRM 3EIHA 2L6OA 1XMQM 3KW6A 2M5ZA 1SXJC 2N35A 3I04M 1E9RA 2Y0QA 1MU5A 2L4FA 2LXEA 2Z4SA 3QAUA 3KOWE 3U61B 2E5LM 4JI8M 2JUJA 4TUWA 3AFHA 4YHHM 2UUAM 2DAGA 2VDBB 3U5ZB 4LY6A 1XXHA 1GABA 2EO2A 5ITYA 1N36M 2WZJA 1IN7A 2K6BA 2NQ8C 1VG5A 2APLA 2UXDM 1QZMA 2HWJA 3K1JA 4NRWA 2V6ZM 2Y0TA 3A45A 4KT0F 4B7HA 1N33M 2UUCM 4WW0A 4GRIA 1L8QA 1L2BA 1R2ZA 1OAOC 1PJSA 4M9SA 3TWMA 2V1UA 2RGOA 4DR2M 3FE3A 1GJTA 2LVAA 4QHTA 2F5PA 4JI1M 3U60A 3TE6A 4HEOA 3W68A 2YQZA 1OAIA 2DWLA 3I4YA 4G4OA 3LVWA 3HHZA 2UXCM 3HJSA 2O25A 4RF0A 2D7GA 2FNAA 3I51A 1G59A 4MGHA 2LVNC 3FUUA 4FCTA 2GNOA 2LVPC 5DYGA 4R71A 5EJCA 3U6DA 3BXWA 5E26A 4OVZB 1R7RA 5KQDA 4W5WA 4LF6M 3UJNA 4FCVA 2O01F 4GKJM 4LJ5A 4DBGB 2QBYA 1EFUB 2FFJA 3A42A 4IBEA 4L15A 4LF9M 2UU9M 2Z4RA 2KRKA 3ILKA 2CWBA 1BVSA 3QYEA 3PFIA 4L16A 4MM3B 5EXSA 5EP4A 5FTNA 1IXSB 3MHVC 3DFZA 4LFAM 1XXHB 1C1KA 5ITTA 2DKLA 1N75A 4B3MM 3H4JA 2CV1A 2XEPA 1WXQA 3IECA 2ZTDA 2XZFA 1XNQM 2G8LA 3FRIA 2F4VM 1QANA 2K0BX 5ITXE 1Z6TA 4LJAA 2JZ0A 3KOZE 4QHSA 3VDPA 1ZMUA 3B74A 3J27B 1QQWA 4I5SA 4P16A 1X37A 1G8PA 3W67A 5FTLA 1Y8GA 2DVWB 3CF6E 3SMSA 1DO2A 3U60B 3GRUA 2BJVA 2BNKA 2CUZA 4B3SM 3FKEA 1T6OA 4DR7M 5KPRA 2C9OA 3LMMA 3MJ5A 4Q7JA 3HWSA 3HU2A 1N78A 4B3RM 3SAVA 2DHYA 4NL4H 2LNHC 3MMPA 3HZJA 4JI0M 1IFYA 3KOYE 5FTJA 4I8OA 5IWAM 1OIPA 3I4VA 3L27A 4FWHA 4IBJA 5DNYA 1XMOM 1T3TA 3U61A 4JI4M 1AUAA 1VDLA 2JA2A 2QSFX 3VKHA 1Q39A 3I01M 2C98A 2QBYB 1OTRA 2R65A 2LBCA 4AQYM 4DV1M 3R9XB 5IT9S 4WURA 4B3TM 1Q3CA 3ZQJA 2MH8A 1V33A 1IN6A 1R6BX 3Q8XA 1GL6A 1R5LA 1HNZM 1E32A 3E46A 2OOAA 2R18A 2QCUA 2R62A 2XGNA 1OFHA 3U6LA 2Z3XA 3FUVA 4L4UA 2DAKA 5A2QS 3Q8GA 4EIWA 3L28A 1N32M 5E6JA 1RU3A 4MGKE 2KZUA 4LJ6A 3SYLA 3U6CA 4FWGA 3GO8A 1V34A 4JI3M 4R3DA 1QDRA 2XSZA 4LF5M 2KW0A 1GL7A 3K92A 3JAMS 4X64M 3ZH9B 4LF4M 1KYIA 1V92A 1QVRA 4KO8A 4GHLA 5EXPA 3KVWA 1TGUA 2JNHA 3HHXA 4ITQA 1TF0B 4QOSA 1QAOA 4L8RC 2ZAMA 2Z7JA 2WSCF 2AHMA 4DV5M 1GLNA 3H4MA 3FUXA 1IY1A 3SATA 3AOEC 2Q2EB 1MN3A 1EIJA 3PNVA 2Y21A 3THGA 4RKUF 2XH9A 3CF2A 4L78A 1QYRA 1WJ7A 1YLAA 4PDGA 2ZBKB 3NBIA 5ITXA 3GPXA 1IXSA 5FTMA 2F5SA 2DXIA 4LRSA 3SMPA 4LFCM 1NNUC 4L6V6 3E4RA 4DR6M 4PCZA 2A5YB 1K3XA 2LTUA 2G5GX 1NJGA 1T43A 3TL4X 4MGIE 3J81S 1I4WA 1EE8A 3HJQA 1NV8A 1C7YA 1CUKA 1D0MA 2OQ4A 1TH3A 2C99A 3L29A 4Y28F 3WHKA 1N34M 2KDLA 5H37D 1GJSA 1XC8A 2FOIC 4DR4M 4AI6A 1JR3E 3E9SA 3SHFA 4P17A 1FJGM 3D8LA 2KRUA 2C5RA 1MX0A 4CISA 2YFQA 3EIEA 2CHQA 1YE9A 5JI2E 2X4AA 2ZANA 3F92A 2KNAA 4XBOA 1LTMA 2MROB 1DGHB 1W5SA 3GLHB 4QNMA 2JXNA 4NXNM 5JI3E 3M7GA 4PT5A 3D8BA 2GQFA 3GRVA 4GITA 2FE8A 3GQ5A 3GLGA 2DNAA 3GLHE 3QYBA 2CV0A 1XB2B 4G4RA 2MR9A 3JR5A 1L2DA 2X8AA 2XF3A 3CGWA 3TQSA 1HNWM 3T1YM 3U6MA 2ZAOA 2KNVA 2L7IA 2JWSA 2LVOC 3FTFA 2KNZA 4LJ7A 2X49A 1IN4A 3NWLA 1SXJD 4LCBA 1VEGA 3T38A 2DWMA 1PRBA 2DZNB 3KSXA 3B7NA 2DWNA 3VKGA 3LVVA 1TH2A 1QUTA 3KS8A 3VDUA 5KO3A 2R45A 3GQ4A 2R4JA 2CEAA 2K9DA 4FWDA 1NY5A 5KPZA 3VK7A 2ERCA 1PM5A 3U6EA 1NY6A 2EKFA 2LH0A 4LFBM 2HCBA 1DO0A 5L8RF 3GPUA 1K3WA 1NVMA 3RGSA 3RFWA 4HL4A 3C58A 2DAMA 2KXEA 4BB9A 1GVNA 5KPTA 4CGYB 3R8FA 4M0WA 4I4LA 1NSFA 4IBKA 4K0KM 7CATA 3K9PA 4DR5M 1IBKM 1HJPA 2Y20A 1IBMM 3LCUA 1OQYA 2VF7A 5EP1A 3LQRA 2RRUA 3FTDA 1A5TA 1P3QQ 4JYAM 1OKSA 1WGLA 2KA6B 3LQQA 1JB0F 5FSWA 1L2CA 1QDTA 1E94E 4X65M 2ZM6M 1DV0A 3PVSA 4D82A 2XFTA 2QPAA 5BPVA 3GLGB 3IG8A 4DV4M 4ANRA 3GQ3A 3KFUG 2MGWA 4LZJA 4REZA 3UGJA 3AV0A 4DR1M 4DV3M 1WIVA 1R2YA 2UXBM 4OX9M 1E9SA 4KODA 3V76A 4M9XA 2P5TA 3GLGE 3IG5A 1FNNA 3KS4A 2CHVA 4GIPA 1DGBA 2LWXA 3FUTA 4FCWA 3HU1A 3T1HM 1L1ZA 4NXMM 2MJ5B 3TWKA 3UZUA 3GLIB 1JR3A 4IIWA 4M0DA 4IBIA 4B7FA 3FD9A 2QZ4A 5EQTA 2C96A 3AKZA 1J7KA 1N77A 3AOEA 1NO1A 4AW4A 3L26A 3CF0A 5EP2A 1PJIA 1ZMVA 3RGPA 3QWLA 3B89A 3GLIE 2H5XA 2DI0A 1G41A 4MGYE 2BWEA 2KEBA 1D0LA 1G3IA 2WSEF 2V1CA 1NHWC 3DA1A 3K9OA 2R46A 4XGIA 2ZTCA 4JV5M 1KSFX 3BOSA 3DOAA 3SAUA 3GPPA 1IY2A 2W82A 3FYCA 4CHTB 3TWLA 1VEKA 3U6SA 1DGHA 3GLHA 2JY8A 1ZV1A 1H6UA 1XHBA 2EKKA 2UUBM 3MK6A 4CIZA 3HY5A 1W5TA 1NJFA 2OOBA 4IJFA 2M60A 4YY3M 4NSOB 1Z5BA 3W0FA 5F3WA 1QAQA 2HAKA 1QZEA 1WR1B 3HKPA 1OJLA 1D0KA 3KP1E 3FTEA 3AJIB 3HU3A 3KDSE 4IBBA 2FH0A 5EXXA 1L1TA 5DYIA 2J5YA 2K47A 2DAEA 1HQYE 4DUZM 2FS1A 2LHCA 3GLFA 2L09A 1VEJA 1UFZA 1DGFA 2C9CA 2JP7A 3K8ZA 4M9ZA 4XK8F 3W0LB 4LG2A 4KHPM 4B7GA 1WHCA 3UK6A 2I7NA 1HT1E 3FYDA 3HX3A 4RNAA 3KSJA 4LF8M 2DHRA 1ZQ9A 2Z8YM 4G3OA 1IN8A 4D80A 3SAWA 3M6AA 1ORYB 2DAIA 5IREB 1VQ1A 4LF7M 2OO9A 3FRHA 1PJJA 4JI2M 1AIPC 4FW9A 2QP9X 3GP1A 2J7NA 3VK8A 3BBZA 1HT2E 8CATA 2LVQD 1ZAEA 4GHAA 3TPZA 3SC3A 3JR4A 3RE8A 3GRRA 1Q3BA 3KXEC 1R4GA 2HHHM 3FUWA 4RF1A 1TDZA 2QHOB 2XZUA 4JXJA 2F5NA 4IBFA 4GC9A 2R44A 4LJ8A 1SXJB 5DFLA 2JY7A 3VFDA 4F2LA 2DENA 3KP0E 4MH0E 2DZOB 1Z5CA 2BWBA 5KQ8A 1S3SA 2G3QA 4MB7A 4G4NA 1TTEA 2CFOA 1JR3D 3DZDA 1DGGA 1Z59A 3B9PA 4FVMA 1QUSA 4A3VB 5FTKA 4JI6M 3VLFB 1GO5A 3HJ8A 1SXJE 5ITUA 3C3EA 1XWIA 3GLFB 4AKIA 3GRYA 1I94M 2RGHA 3GLIA 4DV7M 2I7PA 2XSZD 4BBAA 3E21A 1UM8A 4LRTA 3ZCBB 4IJEA 3SYKA 3GLFE 2HL7A 5EP3A 1PJTA 1NV9A 3C9PA 4HLQA 5C18A 3UMMA 1NHGC 3U6PA 4NSRA 1IXRC 1PJQA 4IBGA 4LJ4A 4OU7A 3U6QA 4NRVA 2XLJA 2VIIA 1J09A
chains in the Genus database with same CATH topology
2F5OA 2D7EA 3PNYA 2CE7A 2L7HA 3GPYA 2DWZB 3HHWA 4DV0M 1IY0A 3A46A 1IM2A 4AZFA 4OW0A 4JI7M 1KFVA 1IN5A 5GKNA 5BR8M 3CTWB 1OFIA 1G4AE 3HGIA 4AKGA 4G6ZA 3J80S 2EA0A 1LV7A 4R7GA 3U6OA 2D7HA 2YNMD 2XFSA 4KLNA 3HHYA 1IBLM 3L25A 4IBCA 5LMUM 4GH9A 4GKKM 2QENA 3PXGA 1IXZA 4B08A 1HR0M 5FLXS 4DV6M 1K82A 4IBDA 1YUBA 3M0EA 2VQEM 4II7A 3AL0C 3SHGB 2VQFM 2EUCA 4ZPXA 4DUYM 4LZZA 4Z6YA 3U5ZA 4NOOB 2YR0A 1GKIA 5C1BA 4AKHA 3OTOM 4G4QA 1YSYA 3J7AS 4LGMA 1VDDA 3FTCA 1Z5AA 2HKJA 4DV2M 3J2PB 4AG5A 1JQJC 4QOZC 2H1RA 5ITRA 5EXTA 2CV2A 1SXJA 2OPFA 1HQCA 3ZC7B 2O5RA 2F5QA 3WHLA 2R4EA 4S12A 4X66M 4I81A 4JN6A 2RKOA 1TDHA 5ITQA 3J7BA 2BJWA 3K2LA 1D2NA 4MGZE 1QAMA 4LGYA 3AOGA 1NNJA 4GMQA 1J5EM 5IZ7D 4DR3M 4QNRA 4D81A 2KZSA 4GC5A 5LMNM 3KOXE 1IQPA 4LJ9A 4FD2A 4Z8XA 4AG6A 1HNXM 4OVZA 3SASA 3L2AA 3T15A 4BLCA 4PD2A 3A98B 2CHGA 4JI5M 3SFZA 4X62M 1TH4A 2J7OA 4PDIA 3SBJA 3SARA 1XNRM 3EIHA 2L6OA 1XMQM 3KW6A 2M5ZA 1SXJC 1E9RA 2Y0QA 1MU5A 3U61B 2LXEA 2Z4SA 3QAUA 3KOWE 2E5LM 4JI8M 4TUWA 3AFHA 4YHHM 2UUAM 3U5ZB 4LY6A 1XXHA 2EO2A 5ITYA 1N36M 1IN7A 2NQ8C 2UXDM 1QZMA 3K1JA 4NRWA 2V6ZM 2Y0TA 3A45A 4B7HA 1N33M 2UUCM 4WW0A 4GRIA 1L8QA 1L2BA 1R2ZA 3TWMA 4M9SA 2V1UA 2RGOA 4DR2M 2F5PA 4QHTA 4JI1M 3U60A 3TE6A 2YQZA 2DWLA 3I4YA 4G4OA 3LVWA 3HHZA 2UXCM 3HJSA 4RF0A 2D7GA 2FNAA 3I51A 1G59A 4MGHA 3FUUA 4FCTA 5DYGA 5EJCA 3U6DA 5E26A 4OVZB 1R7RA 5KQDA 4W5WA 4LF6M 3UJNA 4FCVA 4GKJM 4LJ5A 2QBYA 2FFJA 3A42A 4IBEA 4L15A 4LF9M 2UU9M 2Z4RA 2KRKA 3ILKA 4L16A 5EXSA 4MM3B 3PFIA 5EP4A 5FTNA 1IXSB 3MHVC 3DFZA 4LFAM 1XXHB 1C1KA 5ITTA 1N75A 4B3MM 2CV1A 2XEPA 1WXQA 2XZFA 1XNQM 2G8LA 2F4VM 1QANA 5ITXE 1Z6TA 4LJAA 3KOZE 4QHSA 3VDPA 3J27B 1QQWA 4I5SA 4P16A 1X37A 1G8PA 5FTLA 2DVWB 3CF6E 3SMSA 1DO2A 3U60B 3GRUA 2BJVA 2BNKA 2CUZA 4B3SM 3FKEA 4DR7M 5KPRA 2C9OA 3LMMA 3MJ5A 3HWSA 3HU2A 1N78A 4B3RM 3SAVA 4NL4H 2LNHC 4JI0M 3KOYE 5FTJA 4I8OA 5IWAM 3I4VA 3L27A 4FWHA 4IBJA 5DNYA 1XMOM 1T3TA 3U61A 4JI4M 2JA2A 3VKHA 1Q39A 2C98A 2QBYB 2R65A 4AQYM 4DV1M 3R9XB 5IT9S 4WURA 4B3TM 1Q3CA 3Q8XA 1IN6A 1R6BX 1GL6A 1HNZM 1E32A 2R18A 2QCUA 2R62A 2XGNA 1OFHA 3U6LA 2Z3XA 3FUVA 4L4UA 5A2QS 4EIWA 3L28A 1N32M 5E6JA 4MGKE 2KZUA 4LJ6A 3SYLA 3U6CA 4FWGA 3GO8A 4JI3M 4R3DA 2XSZA 4LF5M 2KW0A 1GL7A 3K92A 3JAMS 4X64M 3ZH9B 4LF4M 1KYIA 1QVRA 4KO8A 4GHLA 5EXPA 3KVWA 1TGUA 3HHXA 4ITQA 4QOSA 1QAOA 4L8RC 2ZAMA 2Z7JA 2AHMA 4DV5M 1GLNA 3H4MA 3FUXA 1IY1A 3SATA 3AOEC 2Q2EB 3PNVA 2Y21A 3THGA 2XH9A 3CF2A 4L78A 1QYRA 4PDGA 2ZBKB 3NBIA 5ITXA 3GPXA 5FTMA 2F5SA 2DXIA 4LRSA 3SMPA 4LFCM 1NNUC 3E4RA 4DR6M 4PCZA 2A5YB 1K3XA 2G5GX 1NJGA 3TL4X 4MGIE 3J81S 1I4WA 1EE8A 3HJQA 2OQ4A 1TH3A 2C99A 3L29A 3WHKA 1N34M 5H37D 1XC8A 2FOIC 4DR4M 4AI6A 3E9SA 3SHFA 1FJGM 3D8LA 2KRUA 2C5RA 1MX0A 4CISA 2YFQA 3EIEA 2CHQA 1YE9A 5JI2E 2X4AA 2ZANA 4XBOA 1DGHB 1W5SA 3GLHB 4QNMA 4NXNM 5JI3E 3M7GA 4PT5A 3D8BA 3GRVA 4GITA 2FE8A 3GQ5A 3GLGA 2CV0A 4G4RA 3JR5A 1L2DA 2X8AA 2XF3A 3TQSA 1HNWM 3T1YM 3U6MA 2ZAOA 2L7IA 3FTFA 4LJ7A 2X49A 1IN4A 3NWLA 1SXJD 4LCBA 2DWMA 3T38A 2DWNA 3KSXA 2DZNB 3VKGA 3LVVA 1TH2A 3KS8A 3VDUA 5KO3A 2R45A 3GQ4A 2R4JA 2CEAA 4FWDA 5KPZA 1NY5A 3VK7A 1PM5A 2ERCA 3U6EA 1NY6A 2LH0A 4LFBM 2HCBA 1DO0A 3GPUA 1K3WA 1NVMA 3RGSA 3RFWA 4HL4A 3C58A 2KXEA 4BB9A 1GVNA 5KPTA 4CGYB 3R8FA 4M0WA 4I4LA 1NSFA 4IBKA 4K0KM 7CATA 4DR5M 1IBKM 2Y20A 1IBMM 5EP1A 3LQRA 3FTDA 4JYAM 2KA6B 3LQQA 1L2CA 5FSWA 4X65M 1E94E 2ZM6M 3PVSA 4D82A 2XFTA 2QPAA 5BPVA 3GLGB 3IG8A 4DV4M 3KFUG 3GQ3A 4LZJA 4REZA 3UGJA 3AV0A 4DR1M 4DV3M 1R2YA 2UXBM 4OX9M 1E9SA 4KODA 4M9XA 2P5TA 3IG5A 3KS4A 1FNNA 2CHVA 4GIPA 1DGBA 2LWXA 3FUTA 4FCWA 3HU1A 3T1HM 1L1ZA 4NXMM 3TWKA 3UZUA 3GLIB 1JR3A 4IIWA 4M0DA 4IBIA 4B7FA 3FD9A 2QZ4A 5EQTA 2C96A 3AKZA 1J7KA 1N77A 3AOEA 4AW4A 3L26A 3CF0A 5EP2A 1PJIA 3RGPA 3QWLA 1G41A 4MGYE 2KEBA 1G3IA 3DA1A 4XGIA 2V1CA 1NHWC 4JV5M 2R46A 1KSFX 3BOSA 3DOAA 3SAUA 3GPPA 1IY2A 2W82A 3FYCA 4CHTB 3TWLA 3U6SA 1DGHA 3GLHA 1H6UA 1XHBA 2UUBM 3MK6A 1W5TA 1NJFA 4IJFA 2M60A 4YY3M 4NSOB 1Z5BA 3W0FA 5F3WA 1QAQA 3HKPA 1OJLA 3KP1E 3FTEA 3AJIB 3HU3A 3KDSE 4IBBA 5EXXA 1L1TA 5DYIA 2K47A 1HQYE 4DUZM 3GLFA 2L09A 2C9CA 3K8ZA 1DGFA 3W0LB 4M9ZA 4KHPM 4LG2A 4B7GA 3UK6A 2I7NA 1HT1E 3FYDA 4RNAA 3KSJA 4LF8M 2DHRA 1ZQ9A 1IN8A 4D80A 3SAWA 3M6AA 1ORYB 5IREB 4LF7M 1PJJA 4JI2M 4FW9A 2QP9X 3GP1A 2J7NA 3VK8A 1HT2E 8CATA 1ZAEA 4GHAA 3TPZA 3SC3A 3JR4A 3RE8A 3GRRA 1Q3BA 3KXEC 2HHHM 3FUWA 4RF1A 1TDZA 2XZUA 4JXJA 2F5NA 4IBFA 4GC9A 4LJ8A 1SXJB 3VFDA 3KP0E 4MH0E 2DZOB 1Z5CA 5KQ8A 4G4NA 1S3SA 4MB7A 2CFOA 1JR3D 3DZDA 1DGGA 1Z59A 3B9PA 4FVMA 4A3VB 4JI6M 5FTKA 3VLFB 3HJ8A 1SXJE 5ITUA 1XWIA 3GLFB 4AKIA 3GRYA 1I94M 2RGHA 3GLIA 4DV7M 2I7PA 2XSZD 4BBAA 1UM8A 4LRTA 3ZCBB 4IJEA 3SYKA 2HL7A 5EP3A 4HLQA 5C18A 3UMMA 1NHGC 3U6PA 4NSRA 1IXRC 4IBGA 4LJ4A 4OU7A 3U6QA 4NRVA 2XLJA 2VIIA 1J09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 M;  4NXM M;  3T1H M;  1L1Z A;  2F5P A;  4DV5 M;  3TWK A;  4JI1 M;  3SAT A;  2F5O A;  2Q2E B;  3GPY A;  4DV0 M;  4G4O A;  3A46 A;  2UXC M;  1PJI A;  4JI7 M;  1KFV A;  4PDG A;  2ZBK B;  5ITX A;  3GPX A;  5BR8 M;  2F5S A;  3U6D A;  4JV5 M;  4LFC M;  3DOA A;  4DR6 M;  4LF6 M;  4PCZ A;  3SAU A;  3GPP A;  1K3X A;  3TWL A;  3J80 S;  2EA0 A;  3U6S A;  4GKJ M;  3J81 S;  3U6O A;  1EE8 A;  3A42 A;  2UUB M;  2OQ4 A;  2UU9 M;  4YY3 M;  1N34 M;  1IBL M;  1Z5B A;  3W0F A;  1XC8 A;  4DR4 M;  4LFA M;  5LMU M;  1FJG M;  4GKK M;  5ITT A;  4CIS A;  1MX0 A;  4B3M M;  1HR0 M;  5FLX S;  4DV6 M;  2XZF A;  1K82 A;  1XNQ M;  2VQE M;  2F4V M;  1L1T A;  5ITX E;  2VQF M;  4DUZ M;  4NXN M;  4DUY M;  4KHP M;  1L2B A;  3GQ5 A;  3OTO M;  4G4Q A;  3J7A S;  4G4R A;  4LF8 M;  3JR5 A;  1L2D A;  4B3S M;  1HNW M;  4DR7 M;  1Z5A A;  2HKJ A;  3T1Y M;  4DV2 M;  3U6M A;  3SAW A;  5ITR A;  4B3R M;  3SAV A;  4LF7 M;  4JI0 M;  1PJJ A;  2OPF A;  4JI2 M;  2F5Q A;  3GP1 A;  3VK8 A;  5IWA M;  4X66 M;  1TDH A;  1XMO M;  5ITQ A;  3GQ4 A;  3VK7 A;  1PM5 A;  3JR4 A;  4JI4 M;  1Q3B A;  3U6E A;  1Q39 A;  4LFB M;  2HHH M;  3GPU A;  4DV1 M;  4AQY M;  1TDZ A;  1NNJ A;  1K3W A;  1J5E M;  2XZU A;  1Q3C A;  4B3T M;  5IT9 S;  4DR3 M;  3C58 A;  5LMN M;  2F5N A;  1HNX M;  3SAS A;  4PD2 A;  1HNZ M;  4JI5 M;  4K0K M;  4DR5 M;  1IBK M;  1Z5C A;  4X62 M;  4G4N A;  4MB7 A;  4PDI A;  3SBJ A;  3U6L A;  3SAR A;  1XMQ M;  1XNR M;  1Z59 A;  1IBM M;  4JI6 M;  5A2Q S;  1MU5 A;  4JI8 M;  2E5L M;  5ITU A;  1N32 M;  4JYA M;  4YHH M;  2UUA M;  1L2C A;  1I94 M;  4X65 M;  2ZM6 M;  3GO8 A;  3U6C A;  4JI3 M;  4DV7 M;  5ITY A;  1N36 M;  4LF5 M;  3JAM S;  4DV4 M;  4X64 M;  3GQ3 A;  2UXD M;  4LF4 M;  4NRW A;  3A45 A;  4DR1 M;  1R2Y A;  1N33 M;  4DV3 M;  2UXB M;  2UUC M;  3U6P A;  4OX9 M;  3U6Q A;  4ITQ A;  4NRV A;  1R2Z A;  3TWM A;  4LF9 M; 
#chains in the Genus database with same CATH topology
 2DZL A;  2L4E A;  2B3T A;  2R0I A;  2F5O A;  2D7E A;  3PNY A;  2CE7 A;  2L7H A;  3GPY A;  2DWZ B;  3HHW A;  4DV0 M;  1IY0 A;  2QQ8 A;  3A46 A;  1IM2 A;  2QNJ A;  4AZF A;  4OW0 A;  4JI7 M;  1KFV A;  1IN5 A;  2L2D A;  5GKN A;  5BR8 M;  1XXH E;  1F4I A;  4NC6 A;  2LHG A;  3CTW B;  1OFI A;  2KHH A;  1G4A E;  3HGI A;  2CP8 A;  3IHP A;  4AKG A;  4G6Z A;  3J80 S;  1MJG M;  2EA0 A;  1LV7 A;  4R7G A;  3U6O A;  2D7H A;  4CJ6 A;  2JY5 A;  2YNM D;  2EJS A;  2XFS A;  4KLN A;  1Q02 A;  3HHY A;  1PGY A;  2WSF F;  2JY6 B;  1IBL M;  3L25 A;  1OIZ A;  4IBC A;  5LMU M;  4GH9 A;  4GKK M;  2QEN A;  3PXG A;  1IXZ A;  4B08 A;  1HR0 M;  5FLX S;  4DV6 M;  1K82 A;  4IBD A;  1YUB A;  3M0E A;  2VQE M;  4II7 A;  3AL0 C;  3SHG B;  2VQF M;  2EUC A;  4ZPX A;  4DUY M;  4LZZ A;  1ZMW A;  4Z6Y A;  3U5Z A;  4GEW A;  4NOO B;  2YR0 A;  1GKI A;  5C1B A;  1WGN A;  4AKH A;  3LW5 F;  3OTO M;  4G4Q A;  1YSY A;  3T6P A;  4LGM A;  3J7A S;  1VDD A;  3LCV B;  3FTC A;  1Z5A A;  2HKJ A;  2VF8 A;  2R6F A;  1SG9 A;  3B7Q A;  3J2P B;  4UN2 B;  4AG5 A;  4DV2 M;  1JQJ C;  4QOZ C;  2H1R A;  5ITR A;  5EXT A;  2CV2 A;  1SXJ A;  2OPF A;  1HQC A;  3ZC7 B;  2O5R A;  2F5Q A;  3WHL A;  2R4E A;  4S12 A;  4X66 M;  4I81 A;  4JN6 A;  2RKO A;  1TDH A;  5ITQ A;  3J7B A;  4F1I A;  1TR8 A;  2BJW A;  3K2L A;  1D2N A;  4MGZ E;  1QAM A;  4LGY A;  3AOG A;  1NNJ A;  4GMQ A;  1J5E M;  5IZ7 D;  4DR3 M;  3C3D A;  4QNR A;  2JZ1 A;  2KZS A;  4GC5 A;  3KOX E;  1IQP A;  4LJ9 A;  4D81 A;  5LMN M;  1G71 A;  4FD2 A;  4Z8X A;  4AG6 A;  4OVZ A;  1HNX M;  3SAS A;  3L2A A;  3T15 A;  4BLC A;  2CRU A;  3A98 B;  2CHG A;  4WP2 A;  4PD2 A;  3B7Z A;  3SFZ A;  4JI5 M;  4X62 M;  3NBX X;  1TH4 A;  2J7O A;  4PDI A;  3SBJ A;  3SAR A;  1XNR M;  3EIH A;  2L6O A;  1XMQ M;  3KW6 A;  2M5Z A;  1SXJ C;  2N35 A;  3I04 M;  1E9R A;  2Y0Q A;  1MU5 A;  2L4F A;  2LXE A;  2Z4S A;  3QAU A;  3KOW E;  3U61 B;  2E5L M;  4JI8 M;  2JUJ A;  4TUW A;  3AFH A;  4YHH M;  2UUA M;  2DAG A;  2VDB B;  3U5Z B;  4LY6 A;  1XXH A;  1GAB A;  2EO2 A;  5ITY A;  1N36 M;  2WZJ A;  1IN7 A;  2K6B A;  2NQ8 C;  1VG5 A;  2APL A;  2UXD M;  1QZM A;  2HWJ A;  3K1J A;  4NRW A;  2V6Z M;  2Y0T A;  3A45 A;  4KT0 F;  4B7H A;  1N33 M;  2UUC M;  4WW0 A;  4GRI A;  1L8Q A;  1L2B A;  1R2Z A;  1OAO C;  1PJS A;  4M9S A;  3TWM A;  2V1U A;  2RGO A;  4DR2 M;  3FE3 A;  1GJT A;  2LVA A;  4QHT A;  2F5P A;  4JI1 M;  3U60 A;  3TE6 A;  4HEO A;  3W68 A;  2YQZ A;  1OAI A;  2DWL A;  3I4Y A;  4G4O A;  3LVW A;  3HHZ A;  2UXC M;  3HJS A;  2O25 A;  4RF0 A;  2D7G A;  2FNA A;  3I51 A;  1G59 A;  4MGH A;  2LVN C;  3FUU A;  4FCT A;  2GNO A;  2LVP C;  5DYG A;  4R71 A;  5EJC A;  3U6D A;  3BXW A;  5E26 A;  4OVZ B;  1R7R A;  5KQD A;  4W5W A;  4LF6 M;  3UJN A;  4FCV A;  2O01 F;  4GKJ M;  4LJ5 A;  4DBG B;  2QBY A;  1EFU B;  2FFJ A;  3A42 A;  4IBE A;  4L15 A;  4LF9 M;  2UU9 M;  2Z4R A;  2KRK A;  3ILK A;  2CWB A;  1BVS A;  3QYE A;  3PFI A;  4L16 A;  4MM3 B;  5EXS A;  5EP4 A;  5FTN A;  1IXS B;  3MHV C;  3DFZ A;  4LFA M;  1XXH B;  1C1K A;  5ITT A;  2DKL A;  1N75 A;  4B3M M;  3H4J A;  2CV1 A;  2XEP A;  1WXQ A;  3IEC A;  2ZTD A;  2XZF A;  1XNQ M;  2G8L A;  3FRI A;  2F4V M;  1QAN A;  2K0B X;  5ITX E;  1Z6T A;  4LJA A;  2JZ0 A;  3KOZ E;  4QHS A;  3VDP A;  1ZMU A;  3B74 A;  3J27 B;  1QQW A;  4I5S A;  4P16 A;  1X37 A;  1G8P A;  3W67 A;  5FTL A;  1Y8G A;  2DVW B;  3CF6 E;  3SMS A;  1DO2 A;  3U60 B;  3GRU A;  2BJV A;  2BNK A;  2CUZ A;  4B3S M;  3FKE A;  1T6O A;  4DR7 M;  5KPR A;  2C9O A;  3LMM A;  3MJ5 A;  4Q7J A;  3HWS A;  3HU2 A;  1N78 A;  4B3R M;  3SAV A;  2DHY A;  4NL4 H;  2LNH C;  3MMP A;  3HZJ A;  4JI0 M;  1IFY A;  3KOY E;  5FTJ A;  4I8O A;  5IWA M;  1OIP A;  3I4V A;  3L27 A;  4FWH A;  4IBJ A;  5DNY A;  1XMO M;  1T3T A;  3U61 A;  4JI4 M;  1AUA A;  1VDL A;  2JA2 A;  2QSF X;  3VKH A;  1Q39 A;  3I01 M;  2C98 A;  2QBY B;  1OTR A;  2R65 A;  2LBC A;  4AQY M;  4DV1 M;  3R9X B;  5IT9 S;  4WUR A;  4B3T M;  1Q3C A;  3ZQJ A;  2MH8 A;  1V33 A;  1IN6 A;  1R6B X;  3Q8X A;  1GL6 A;  1R5L A;  1HNZ M;  1E32 A;  3E46 A;  2OOA A;  2R18 A;  2QCU A;  2R62 A;  2XGN A;  1OFH A;  3U6L A;  2Z3X A;  3FUV A;  4L4U A;  2DAK A;  5A2Q S;  3Q8G A;  4EIW A;  3L28 A;  1N32 M;  5E6J A;  1RU3 A;  4MGK E;  2KZU A;  4LJ6 A;  3SYL A;  3U6C A;  4FWG A;  3GO8 A;  1V34 A;  4JI3 M;  4R3D A;  1QDR A;  2XSZ A;  4LF5 M;  2KW0 A;  1GL7 A;  3K92 A;  3JAM S;  4X64 M;  3ZH9 B;  4LF4 M;  1KYI A;  1V92 A;  1QVR A;  4KO8 A;  4GHL A;  5EXP A;  3KVW A;  1TGU A;  2JNH A;  3HHX A;  4ITQ A;  1TF0 B;  4QOS A;  1QAO A;  4L8R C;  2ZAM A;  2Z7J A;  2WSC F;  2AHM A;  4DV5 M;  1GLN A;  3H4M A;  3FUX A;  1IY1 A;  3SAT A;  3AOE C;  2Q2E B;  1MN3 A;  1EIJ A;  3PNV A;  2Y21 A;  3THG A;  4RKU F;  2XH9 A;  3CF2 A;  4L78 A;  1QYR A;  1WJ7 A;  1YLA A;  4PDG A;  2ZBK B;  3NBI A;  5ITX A;  3GPX A;  1IXS A;  5FTM A;  2F5S A;  2DXI A;  4LRS A;  3SMP A;  4LFC M;  1NNU C;  4L6V 6;  3E4R A;  4DR6 M;  4PCZ A;  2A5Y B;  1K3X A;  2LTU A;  2G5G X;  1NJG A;  1T43 A;  3TL4 X;  4MGI E;  3J81 S;  1I4W A;  1EE8 A;  3HJQ A;  1NV8 A;  1C7Y A;  1CUK A;  1D0M A;  2OQ4 A;  1TH3 A;  2C99 A;  3L29 A;  4Y28 F;  3WHK A;  1N34 M;  2KDL A;  5H37 D;  1GJS A;  1XC8 A;  2FOI C;  4DR4 M;  4AI6 A;  1JR3 E;  3E9S A;  3SHF A;  4P17 A;  1FJG M;  3D8L A;  2KRU A;  2C5R A;  1MX0 A;  4CIS A;  2YFQ A;  3EIE A;  2CHQ A;  1YE9 A;  5JI2 E;  2X4A A;  2ZAN A;  3F92 A;  2KNA A;  4XBO A;  1LTM A;  2MRO B;  1DGH B;  1W5S A;  3GLH B;  4QNM A;  2JXN A;  4NXN M;  5JI3 E;  3M7G A;  4PT5 A;  3D8B A;  2GQF A;  3GRV A;  4GIT A;  2FE8 A;  3GQ5 A;  3GLG A;  2DNA A;  3GLH E;  3QYB A;  2CV0 A;  1XB2 B;  4G4R A;  2MR9 A;  3JR5 A;  1L2D A;  2X8A A;  2XF3 A;  3CGW A;  3TQS A;  1HNW M;  3T1Y M;  3U6M A;  2ZAO A;  2KNV A;  2L7I A;  2JWS A;  2LVO C;  3FTF A;  2KNZ A;  4LJ7 A;  2X49 A;  1IN4 A;  3NWL A;  1SXJ D;  4LCB A;  1VEG A;  3T38 A;  2DWM A;  1PRB A;  2DZN B;  3KSX A;  3B7N A;  2DWN A;  3VKG A;  3LVV A;  1TH2 A;  1QUT A;  3KS8 A;  3VDU A;  5KO3 A;  2R45 A;  3GQ4 A;  2R4J A;  2CEA A;  2K9D A;  4FWD A;  1NY5 A;  5KPZ A;  3VK7 A;  2ERC A;  1PM5 A;  3U6E A;  1NY6 A;  2EKF A;  2LH0 A;  4LFB M;  2HCB A;  1DO0 A;  5L8R F;  3GPU A;  1K3W A;  1NVM A;  3RGS A;  3RFW A;  4HL4 A;  3C58 A;  2DAM A;  2KXE A;  4BB9 A;  1GVN A;  5KPT A;  4CGY B;  3R8F A;  4M0W A;  4I4L A;  1NSF A;  4IBK A;  4K0K M;  7CAT A;  3K9P A;  4DR5 M;  1IBK M;  1HJP A;  2Y20 A;  1IBM M;  3LCU A;  1OQY A;  2VF7 A;  5EP1 A;  3LQR A;  2RRU A;  3FTD A;  1A5T A;  1P3Q Q;  4JYA M;  1OKS A;  1WGL A;  2KA6 B;  3LQQ A;  1JB0 F;  5FSW A;  1L2C A;  1QDT A;  1E94 E;  4X65 M;  2ZM6 M;  1DV0 A;  3PVS A;  4D82 A;  2XFT A;  2QPA A;  5BPV A;  3GLG B;  3IG8 A;  4DV4 M;  4ANR A;  3GQ3 A;  3KFU G;  2MGW A;  4LZJ A;  4REZ A;  3UGJ A;  3AV0 A;  4DR1 M;  4DV3 M;  1WIV A;  1R2Y A;  2UXB M;  4OX9 M;  1E9S A;  4KOD A;  3V76 A;  4M9X A;  2P5T A;  3GLG E;  3IG5 A;  1FNN A;  3KS4 A;  2CHV A;  4GIP A;  1DGB A;  2LWX A;  3FUT A;  4FCW A;  3HU1 A;  3T1H M;  1L1Z A;  4NXM M;  2MJ5 B;  3TWK A;  3UZU A;  3GLI B;  1JR3 A;  4IIW A;  4M0D A;  4IBI A;  4B7F A;  3FD9 A;  2QZ4 A;  5EQT A;  2C96 A;  3AKZ A;  1J7K A;  1N77 A;  3AOE A;  1NO1 A;  4AW4 A;  3L26 A;  3CF0 A;  5EP2 A;  1PJI A;  1ZMV A;  3RGP A;  3QWL A;  3B89 A;  3GLI E;  2H5X A;  2DI0 A;  1G41 A;  4MGY E;  2BWE A;  2KEB A;  1D0L A;  1G3I A;  2WSE F;  2V1C A;  1NHW C;  3DA1 A;  3K9O A;  2R46 A;  4XGI A;  2ZTC A;  4JV5 M;  1KSF X;  3BOS A;  3DOA A;  3SAU A;  3GPP A;  1IY2 A;  2W82 A;  3FYC A;  4CHT B;  3TWL A;  1VEK A;  3U6S A;  1DGH A;  3GLH A;  2JY8 A;  1ZV1 A;  1H6U A;  1XHB A;  2EKK A;  2UUB M;  3MK6 A;  4CIZ A;  3HY5 A;  1W5T A;  1NJF A;  2OOB A;  4IJF A;  2M60 A;  4YY3 M;  4NSO B;  1Z5B A;  3W0F A;  5F3W A;  1QAQ A;  2HAK A;  1QZE A;  1WR1 B;  3HKP A;  1OJL A;  1D0K A;  3KP1 E;  3FTE A;  3AJI B;  3HU3 A;  3KDS E;  4IBB A;  2FH0 A;  5EXX A;  1L1T A;  5DYI A;  2J5Y A;  2K47 A;  2DAE A;  1HQY E;  4DUZ M;  2FS1 A;  2LHC A;  3GLF A;  2L09 A;  1VEJ A;  1UFZ A;  1DGF A;  2C9C A;  2JP7 A;  3K8Z A;  4M9Z A;  4XK8 F;  3W0L B;  4LG2 A;  4KHP M;  4B7G A;  1WHC A;  3UK6 A;  2I7N A;  1HT1 E;  3FYD A;  3HX3 A;  4RNA A;  3KSJ A;  4LF8 M;  2DHR A;  1ZQ9 A;  2Z8Y M;  4G3O A;  1IN8 A;  4D80 A;  3SAW A;  3M6A A;  1ORY B;  2DAI A;  5IRE B;  1VQ1 A;  4LF7 M;  2OO9 A;  3FRH A;  1PJJ A;  4JI2 M;  1AIP C;  4FW9 A;  2QP9 X;  3GP1 A;  2J7N A;  3VK8 A;  3BBZ A;  1HT2 E;  8CAT A;  2LVQ D;  1ZAE A;  4GHA A;  3TPZ A;  3SC3 A;  3JR4 A;  3RE8 A;  3GRR A;  1Q3B A;  3KXE C;  1R4G A;  2HHH M;  3FUW A;  4RF1 A;  1TDZ A;  2QHO B;  2XZU A;  4JXJ A;  2F5N A;  4IBF A;  4GC9 A;  2R44 A;  4LJ8 A;  1SXJ B;  5DFL A;  2JY7 A;  3VFD A;  4F2L A;  2DEN A;  3KP0 E;  4MH0 E;  2DZO B;  1Z5C A;  2BWB A;  5KQ8 A;  1S3S A;  2G3Q A;  4MB7 A;  4G4N A;  1TTE A;  2CFO A;  1JR3 D;  3DZD A;  1DGG A;  1Z59 A;  3B9P A;  4FVM A;  1QUS A;  4A3V B;  5FTK A;  4JI6 M;  3VLF B;  1GO5 A;  3HJ8 A;  1SXJ E;  5ITU A;  3C3E A;  1XWI A;  3GLF B;  4AKI A;  3GRY A;  1I94 M;  2RGH A;  3GLI A;  4DV7 M;  2I7P A;  2XSZ D;  4BBA A;  3E21 A;  1UM8 A;  4LRT A;  3ZCB B;  4IJE A;  3SYK A;  3GLF E;  2HL7 A;  5EP3 A;  1PJT A;  1NV9 A;  3C9P A;  4HLQ A;  5C18 A;  3UMM A;  1NHG C;  3U6P A;  4NSR A;  1IXR C;  1PJQ A;  4IBG A;  4LJ4 A;  4OU7 A;  3U6Q A;  4NRV A;  2XLJ A;  2VII A;  1J09 A; 
#chains in the Genus database with same CATH homology
 2F5O A;  2D7E A;  3PNY A;  2CE7 A;  2L7H A;  3GPY A;  2DWZ B;  3HHW A;  4DV0 M;  1IY0 A;  3A46 A;  1IM2 A;  4AZF A;  4OW0 A;  4JI7 M;  1KFV A;  1IN5 A;  5GKN A;  5BR8 M;  3CTW B;  1OFI A;  1G4A E;  3HGI A;  4AKG A;  4G6Z A;  3J80 S;  2EA0 A;  1LV7 A;  4R7G A;  3U6O A;  2D7H A;  2YNM D;  2XFS A;  4KLN A;  3HHY A;  1IBL M;  3L25 A;  4IBC A;  5LMU M;  4GH9 A;  4GKK M;  2QEN A;  3PXG A;  1IXZ A;  4B08 A;  1HR0 M;  5FLX S;  4DV6 M;  1K82 A;  4IBD A;  1YUB A;  3M0E A;  2VQE M;  4II7 A;  3AL0 C;  3SHG B;  2VQF M;  2EUC A;  4ZPX A;  4DUY M;  4LZZ A;  4Z6Y A;  3U5Z A;  4NOO B;  2YR0 A;  1GKI A;  5C1B A;  4AKH A;  3OTO M;  4G4Q A;  1YSY A;  3J7A S;  4LGM A;  1VDD A;  3FTC A;  1Z5A A;  2HKJ A;  4DV2 M;  3J2P B;  4AG5 A;  1JQJ C;  4QOZ C;  2H1R A;  5ITR A;  5EXT A;  2CV2 A;  1SXJ A;  2OPF A;  1HQC A;  3ZC7 B;  2O5R A;  2F5Q A;  3WHL A;  2R4E A;  4S12 A;  4X66 M;  4I81 A;  4JN6 A;  2RKO A;  1TDH A;  5ITQ A;  3J7B A;  2BJW A;  3K2L A;  1D2N A;  4MGZ E;  1QAM A;  4LGY A;  3AOG A;  1NNJ A;  4GMQ A;  1J5E M;  5IZ7 D;  4DR3 M;  4QNR A;  4D81 A;  2KZS A;  4GC5 A;  5LMN M;  3KOX E;  1IQP A;  4LJ9 A;  4FD2 A;  4Z8X A;  4AG6 A;  1HNX M;  4OVZ A;  3SAS A;  3L2A A;  3T15 A;  4BLC A;  4PD2 A;  3A98 B;  2CHG A;  4JI5 M;  3SFZ A;  4X62 M;  1TH4 A;  2J7O A;  4PDI A;  3SBJ A;  3SAR A;  1XNR M;  3EIH A;  2L6O A;  1XMQ M;  3KW6 A;  2M5Z A;  1SXJ C;  1E9R A;  2Y0Q A;  1MU5 A;  3U61 B;  2LXE A;  2Z4S A;  3QAU A;  3KOW E;  2E5L M;  4JI8 M;  4TUW A;  3AFH A;  4YHH M;  2UUA M;  3U5Z B;  4LY6 A;  1XXH A;  2EO2 A;  5ITY A;  1N36 M;  1IN7 A;  2NQ8 C;  2UXD M;  1QZM A;  3K1J A;  4NRW A;  2V6Z M;  2Y0T A;  3A45 A;  4B7H A;  1N33 M;  2UUC M;  4WW0 A;  4GRI A;  1L8Q A;  1L2B A;  1R2Z A;  3TWM A;  4M9S A;  2V1U A;  2RGO A;  4DR2 M;  2F5P A;  4QHT A;  4JI1 M;  3U60 A;  3TE6 A;  2YQZ A;  2DWL A;  3I4Y A;  4G4O A;  3LVW A;  3HHZ A;  2UXC M;  3HJS A;  4RF0 A;  2D7G A;  2FNA A;  3I51 A;  1G59 A;  4MGH A;  3FUU A;  4FCT A;  5DYG A;  5EJC A;  3U6D A;  5E26 A;  4OVZ B;  1R7R A;  5KQD A;  4W5W A;  4LF6 M;  3UJN A;  4FCV A;  4GKJ M;  4LJ5 A;  2QBY A;  2FFJ A;  3A42 A;  4IBE A;  4L15 A;  4LF9 M;  2UU9 M;  2Z4R A;  2KRK A;  3ILK A;  4L16 A;  5EXS A;  4MM3 B;  3PFI A;  5EP4 A;  5FTN A;  1IXS B;  3MHV C;  3DFZ A;  4LFA M;  1XXH B;  1C1K A;  5ITT A;  1N75 A;  4B3M M;  2CV1 A;  2XEP A;  1WXQ A;  2XZF A;  1XNQ M;  2G8L A;  2F4V M;  1QAN A;  5ITX E;  1Z6T A;  4LJA A;  3KOZ E;  4QHS A;  3VDP A;  3J27 B;  1QQW A;  4I5S A;  4P16 A;  1X37 A;  1G8P A;  5FTL A;  2DVW B;  3CF6 E;  3SMS A;  1DO2 A;  3U60 B;  3GRU A;  2BJV A;  2BNK A;  2CUZ A;  4B3S M;  3FKE A;  4DR7 M;  5KPR A;  2C9O A;  3LMM A;  3MJ5 A;  3HWS A;  3HU2 A;  1N78 A;  4B3R M;  3SAV A;  4NL4 H;  2LNH C;  4JI0 M;  3KOY E;  5FTJ A;  4I8O A;  5IWA M;  3I4V A;  3L27 A;  4FWH A;  4IBJ A;  5DNY A;  1XMO M;  1T3T A;  3U61 A;  4JI4 M;  2JA2 A;  3VKH A;  1Q39 A;  2C98 A;  2QBY B;  2R65 A;  4AQY M;  4DV1 M;  3R9X B;  5IT9 S;  4WUR A;  4B3T M;  1Q3C A;  3Q8X A;  1IN6 A;  1R6B X;  1GL6 A;  1HNZ M;  1E32 A;  2R18 A;  2QCU A;  2R62 A;  2XGN A;  1OFH A;  3U6L A;  2Z3X A;  3FUV A;  4L4U A;  5A2Q S;  4EIW A;  3L28 A;  1N32 M;  5E6J A;  4MGK E;  2KZU A;  4LJ6 A;  3SYL A;  3U6C A;  4FWG A;  3GO8 A;  4JI3 M;  4R3D A;  2XSZ A;  4LF5 M;  2KW0 A;  1GL7 A;  3K92 A;  3JAM S;  4X64 M;  3ZH9 B;  4LF4 M;  1KYI A;  1QVR A;  4KO8 A;  4GHL A;  5EXP A;  3KVW A;  1TGU A;  3HHX A;  4ITQ A;  4QOS A;  1QAO A;  4L8R C;  2ZAM A;  2Z7J A;  2AHM A;  4DV5 M;  1GLN A;  3H4M A;  3FUX A;  1IY1 A;  3SAT A;  3AOE C;  2Q2E B;  3PNV A;  2Y21 A;  3THG A;  2XH9 A;  3CF2 A;  4L78 A;  1QYR A;  4PDG A;  2ZBK B;  3NBI A;  5ITX A;  3GPX A;  5FTM A;  2F5S A;  2DXI A;  4LRS A;  3SMP A;  4LFC M;  1NNU C;  3E4R A;  4DR6 M;  4PCZ A;  2A5Y B;  1K3X A;  2G5G X;  1NJG A;  3TL4 X;  4MGI E;  3J81 S;  1I4W A;  1EE8 A;  3HJQ A;  2OQ4 A;  1TH3 A;  2C99 A;  3L29 A;  3WHK A;  1N34 M;  5H37 D;  1XC8 A;  2FOI C;  4DR4 M;  4AI6 A;  3E9S A;  3SHF A;  1FJG M;  3D8L A;  2KRU A;  2C5R A;  1MX0 A;  4CIS A;  2YFQ A;  3EIE A;  2CHQ A;  1YE9 A;  5JI2 E;  2X4A A;  2ZAN A;  4XBO A;  1DGH B;  1W5S A;  3GLH B;  4QNM A;  4NXN M;  5JI3 E;  3M7G A;  4PT5 A;  3D8B A;  3GRV A;  4GIT A;  2FE8 A;  3GQ5 A;  3GLG A;  2CV0 A;  4G4R A;  3JR5 A;  1L2D A;  2X8A A;  2XF3 A;  3TQS A;  1HNW M;  3T1Y M;  3U6M A;  2ZAO A;  2L7I A;  3FTF A;  4LJ7 A;  2X49 A;  1IN4 A;  3NWL A;  1SXJ D;  4LCB A;  2DWM A;  3T38 A;  2DWN A;  3KSX A;  2DZN B;  3VKG A;  3LVV A;  1TH2 A;  3KS8 A;  3VDU A;  5KO3 A;  2R45 A;  3GQ4 A;  2R4J A;  2CEA A;  4FWD A;  5KPZ A;  1NY5 A;  3VK7 A;  1PM5 A;  2ERC A;  3U6E A;  1NY6 A;  2LH0 A;  4LFB M;  2HCB A;  1DO0 A;  3GPU A;  1K3W A;  1NVM A;  3RGS A;  3RFW A;  4HL4 A;  3C58 A;  2KXE A;  4BB9 A;  1GVN A;  5KPT A;  4CGY B;  3R8F A;  4M0W A;  4I4L A;  1NSF A;  4IBK A;  4K0K M;  7CAT A;  4DR5 M;  1IBK M;  2Y20 A;  1IBM M;  5EP1 A;  3LQR A;  3FTD A;  4JYA M;  2KA6 B;  3LQQ A;  1L2C A;  5FSW A;  4X65 M;  1E94 E;  2ZM6 M;  3PVS A;  4D82 A;  2XFT A;  2QPA A;  5BPV A;  3GLG B;  3IG8 A;  4DV4 M;  3KFU G;  3GQ3 A;  4LZJ A;  4REZ A;  3UGJ A;  3AV0 A;  4DR1 M;  4DV3 M;  1R2Y A;  2UXB M;  4OX9 M;  1E9S A;  4KOD A;  4M9X A;  2P5T A;  3IG5 A;  3KS4 A;  1FNN A;  2CHV A;  4GIP A;  1DGB A;  2LWX A;  3FUT A;  4FCW A;  3HU1 A;  3T1H M;  1L1Z A;  4NXM M;  3TWK A;  3UZU A;  3GLI B;  1JR3 A;  4IIW A;  4M0D A;  4IBI A;  4B7F A;  3FD9 A;  2QZ4 A;  5EQT A;  2C96 A;  3AKZ A;  1J7K A;  1N77 A;  3AOE A;  4AW4 A;  3L26 A;  3CF0 A;  5EP2 A;  1PJI A;  3RGP A;  3QWL A;  1G41 A;  4MGY E;  2KEB A;  1G3I A;  3DA1 A;  4XGI A;  2V1C A;  1NHW C;  4JV5 M;  2R46 A;  1KSF X;  3BOS A;  3DOA A;  3SAU A;  3GPP A;  1IY2 A;  2W82 A;  3FYC A;  4CHT B;  3TWL A;  3U6S A;  1DGH A;  3GLH A;  1H6U A;  1XHB A;  2UUB M;  3MK6 A;  1W5T A;  1NJF A;  4IJF A;  2M60 A;  4YY3 M;  4NSO B;  1Z5B A;  3W0F A;  5F3W A;  1QAQ A;  3HKP A;  1OJL A;  3KP1 E;  3FTE A;  3AJI B;  3HU3 A;  3KDS E;  4IBB A;  5EXX A;  1L1T A;  5DYI A;  2K47 A;  1HQY E;  4DUZ M;  3GLF A;  2L09 A;  2C9C A;  3K8Z A;  1DGF A;  3W0L B;  4M9Z A;  4KHP M;  4LG2 A;  4B7G A;  3UK6 A;  2I7N A;  1HT1 E;  3FYD A;  4RNA A;  3KSJ A;  4LF8 M;  2DHR A;  1ZQ9 A;  1IN8 A;  4D80 A;  3SAW A;  3M6A A;  1ORY B;  5IRE B;  4LF7 M;  1PJJ A;  4JI2 M;  4FW9 A;  2QP9 X;  3GP1 A;  2J7N A;  3VK8 A;  1HT2 E;  8CAT A;  1ZAE A;  4GHA A;  3TPZ A;  3SC3 A;  3JR4 A;  3RE8 A;  3GRR A;  1Q3B A;  3KXE C;  2HHH M;  3FUW A;  4RF1 A;  1TDZ A;  2XZU A;  4JXJ A;  2F5N A;  4IBF A;  4GC9 A;  4LJ8 A;  1SXJ B;  3VFD A;  3KP0 E;  4MH0 E;  2DZO B;  1Z5C A;  5KQ8 A;  4G4N A;  1S3S A;  4MB7 A;  2CFO A;  1JR3 D;  3DZD A;  1DGG A;  1Z59 A;  3B9P A;  4FVM A;  4A3V B;  4JI6 M;  5FTK A;  3VLF B;  3HJ8 A;  1SXJ E;  5ITU A;  1XWI A;  3GLF B;  4AKI A;  3GRY A;  1I94 M;  2RGH A;  3GLI A;  4DV7 M;  2I7P A;  2XSZ D;  4BBA A;  1UM8 A;  4LRT A;  3ZCB B;  4IJE A;  3SYK A;  2HL7 A;  5EP3 A;  4HLQ A;  5C18 A;  3UMM A;  1NHG C;  3U6P A;  4NSR A;  1IXR C;  4IBG A;  4LJ4 A;  4OU7 A;  3U6Q A;  4NRV A;  2XLJ A;  2VII A;  1J09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...