4DR1M

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr1M02
4DV1M 3U6QA 4GKJM 1I94M 2OPFA 3GPXA 5LMNM 1NNJA 4DR6M 3GO8A 3DOAA 1XMOM 1PJJA 3U6EA 1PJIA 2F5SA 2ZBKB 4NXMM 1Z5CA 4B3SM 1HNWM 1Z5BA 3GPPA 2F5NA 5LMUM 4KHPM 4X66M 4DV2M 4X62M 4NRWA 2F5QA 2E5LM 1EE8A 3SAVA 3GP1A 4DR4M 1K3WA 1XNQM 1HNXM 1MX0A 4JI7M 2Q2EB 4DR3M 1K82A 4PCZA 3TWMA 5ITXA 1Q39A 4G4QA 1L2BA 3A42A 3GQ5A 2ZM6M 1HR0M 5FLXS 3J80S 4G4RA 3U6CA 1J5EM 1N36M 1R2ZA 2F5PA 1KFVA 4JV5M 4OX9M 4JI5M 3TWLA 5ITYA 5A2QS 5ITRA 3C58A 4LF9M 1XMQM 3A46A 4X65M 4JI8M 1TDHA 2HKJA 4PD2A 1TDZA 1IBMM 1K3XA 4JI3M 1L2DA 4ITQA 4DV7M 1FJGM 2XZUA 1L1TA 4PDGA 4DUYM 4DUZM 1N33M 2F5OA 3SAWA 4B3MM 1R2YA 3SARA 4K0KM 4X64M 2UXCM 2EA0A 4DR1M 4CISA 2UXDM 2VQFM 4LF5M 5ITXE 3JAMS 3GQ3A 3JR4A 1Z5AA 5ITUA 4GKKM 2UXBM 5ITTA 3SBJA 3VK8A 1IBKM 4G4NA 4LFAM 3U6LA 4DV6M 2UUAM 3TWKA 3VK7A 4G4OA 3U6DA 1L2CA 3T1HM 4NXNM 4DV3M 2UUBM 4DV0M 2VQEM 5ITQA 3U6PA 4PDIA 4LF6M 4NRVA 1IBLM 2F4VM 1Q3CA 3A45A 1XNRM 3J7AS 5IT9S 3SATA 3OTOM 1L1ZA 3GPYA 3U6MA 4DR7M 3SAUA 2UU9M 1N32M 1N34M 5IWAM 4LF4M 2XZFA 4DV5M 4DR2M 4B3TM 3J81S 3W0FA 1PM5A 4JYAM 2HHHM 3GPUA 4JI2M 4YY3M 4JI6M 4YHHM 4LFCM 1Q3BA 4DV4M 4LF7M 3JR5A 4JI0M 1HNZM 3SASA 1XC8A 3GQ4A 4JI1M 1MU5A 4JI4M 3U6SA 4B3RM 2OQ4A 4LFBM 4LF8M 5BR8M 4DR5M 1Z59A 2UUCM 4MB7A 4AQYM 3U6OA 3T1YM
chains in the Genus database with same CATH superfamily
1T43A 3QAUA 3L2AA 2R45A 2OPFA 2DAKA 1J7KA 2D7HA 3KW6A 4L8RC 3GO8A 4BBAA 5FSWA 1WJ7A 4CGYB 3HU2A 2QNJA 1SXJB 1PJIA 2DAEA 1IM2A 1HJPA 2CFOA 1LTMA 1Z5BA 2LVAA 3HKPA 5LMUM 1XXHE 2JWSA 1IQPA 1XXHA 3C3DA 4X66M 4CIZA 2XFSA 3U5ZB 2E5LM 2F5QA 1SG9A 4OU7A 3E21A 1N77A 1K3WA 3AV0A 1YLAA 1IY1A 2FE8A 4I5SA 4BLCA 3A98B 3KSJA 4D82A 5ITXA 2DAMA 4AZFA 3ZC7B 1NY6A 4AG5A 5FLXS 3GRYA 4FWGA 5H37D 2AHMA 4M9SA 4Z6YA 4AKGA 3M6AA 3U6CA 1GLNA 4JV5M 4OX9M 3KOZE 3PNVA 3FTCA 2Y20A 1XMQM 3T6PA 3Q8GA 2Z3XA 1TDZA 4PD2A 3K1JA 4LCBA 2O5RA 1XXHB 3H4JA 1AIPC 3GLHA 2HCBA 2Z8YM 3E9SA 4HL4A 3U61A 4LG2A 1L1TA 4GRIA 5KQDA 4DUYM 1N78A 1SXJD 2KA6B 1PRBA 4B3MM 3K9OA 1R2YA 3L25A 5IREB 1D0LA 4X64M 1LV7A 2EA0A 4CISA 3DA1A 2FS1A 2GQFA 1OQYA 1WHCA 4LF5M 3JAMS 3TPZA 3JR4A 4R7GA 2XGNA 2DWZB 1G59A 1IXZA 3SBJA 2WSEF 4XGIA 3B7ZA 2ZAMA 3TWKA 4NOOB 1G41A 4G4OA 1L2CA 2APLA 3T1HM 5KPZA 3GLHB 3QWLA 3U61B 3DZDA 2KNVA 3T38A 4PDIA 4LF6M 4Y28F 2F4VM 4FCTA 4FWDA 1XNRM 3D8BA 4G6ZA 3SATA 2DI0A 1DGFA 2HWJA 3DFZA 3C3EA 3LCUA 1T6OA 5EP1A 1OAOC 3U6MA 4LJ5A 5FTNA 1NJFA 3HZJA 4GIPA 1TH3A 2CRUA 4LRSA 1OKSA 2YR0A 2Y0TA 1OIPA 2R46A 1QDTA 2OO9A 1KSFX 3TE6A 2CHVA 2DWMA 2XZFA 4DV5M 4DR2M 1XB2B 2CP8A 4IBDA 5DYIA 2DWLA 1E9SA 2JXNA 1R5LA 4PT5A 3W67A 2DZOB 2HHHM 1F4IA 2JA2A 3GPUA 4JI6M 4WP2A 4LFCM 2C5RA 1Q3BA 1R7RA 3VFDA 5KPRA 3CTWB 4HEOA 3UMMA 3UGJA 4LJ8A 2KW0A 4JI4M 4B3RM 5KPTA 2MJ5B 4FW9A 4MGKE 4I4LA 3R8FA 1Z59A 3FUWA 2UUCM 3HX3A 2D7EA 1TH4A 4MB7A 4MGIE 2DWNA 1ZMVA 1D0MA 4FCVA 3E46A 3HJSA 1QYRA 3TL4X 4RKUF 4F2LA 1S3SA 3UK6A 5LMNM 3VKGA 1NNJA 3ZCBB 3KVWA 1VEJA 3CGWA 3DOAA 1AUAA 4CHTB 1XMOM 3U6EA 3HHXA 1TF0B 1HQYE 1WIVA 1Z5CA 3IECA 3L28A 3FKEA 3GPPA 2F5NA 4B3SM 1IFYA 3RFWA 1VDLA 5EP4A 1UFZA 4P17A 4DV2M 2RGHA 2L09A 4KHPM 1OJLA 3FTFA 3FE3A 1D2NA 2KDLA 2X4AA 3GRUA 3GP1A 4A3VB 1NY5A 2X49A 3VLFB 1HNXM 4II7A 2Q2EB 3KP0E 1K82A 2MR9A 3LMMA 4ANRA 5JI2E 3CF2A 4MGZE 4AG6A 1NHGC 1Q39A 4G4QA 1L2BA 2QBYA 2M60A 2ZM6M 1N75A 2CV1A 2BJVA 5EXTA 2KZSA 2JY6B 2HAKA 2WSFF 1QUSA 1YE9A 3BBZA 3KS4A 4LGYA 1N36M 5ITYA 2F5PA 5ITRA 4JI5M 2DXIA 1JQJC 4LF9M 1WXQA 3A46A 2HKJA 4FD2A 4ITQA 5JI3E 3KFUG 3KSXA 4RF0A 3FUTA 3GLGE 3GLGA 2XZUA 2K6BA 2VDBB 2C96A 3NBIA 3HU1A 4DBGB 3L27A 2Y0QA 4KO8A 1GL6A 2QBYB 3HGIA 2R62A 3IHPA 2VQFM 2UXDM 3B89A 4R3DA 5ITXE 2X8AA 1I4WA 3RGSA 2YFQA 1OFIA 4XBOA 1CUKA 1IXRC 3H4MA 3ILKA 2EKFA 4GKKM 3J2PB 3SFZA 1G3IA 4REZA 1NV9A 4G4NA 1QZMA 5E6JA 1QZEA 3NWLA 4IBIA 3U6DA 3FTEA 4NXNM 4AKIA 2H5XA 2I7PA 2UUBM 2V1CA 4GITA 2KHHA 1XWIA 5ITQA 3GLGB 4GMQA 3M0EA 1IBLM 5IZ7D 3GLHE 3J7AS 1XHBA 5IT9S 1HT1E 1WGLA 2RGOA 3IG5A 1NNUC 1C7YA 1PGYA 2DAGA 3GPYA 4DR7M 3VKHA 1ZQ9A 2D7GA 2DKLA 3SAUA 2DZNB 3LW5F 2UU9M 2XEPA 2DHRA 2QSFX 2ZTCA 3J7BA 4NC6A 1GL7A 3TQSA 1IN7A 1W5SA 2QQ8A 3BXWA 2LNHC 4LF4M 4IBEA 3HHWA 5BPVA 3EIEA 5EXPA 3U60A 3W68A 1VEKA 2YQZA 3W0FA 1HQCA 2KRUA 4B08A 1IY0A 1DGBA 3I51A 2VIIA 2LWXA 2RKOA 3PFIA 3QYEA 2CE7A 2M5ZA 4D81A 4L78A 4LF7M 3JR5A 4LJAA 2C9OA 4Q7JA 3SASA 4MGHA 5F3WA 3AOEC 3HJ8A 4MM3B 2OQ4A 2XF3A 1SXJC 2QZ4A 3AL0C 2ZTDA 5FTMA 4DR5M 2LVPC 2QP9X 3B9PA 2C9CA 1E9RA 4DV1M 3K8ZA 2QHOB 3U60B 3U6QA 4GKJM 4Z8XA 4LJ6A 3KP1E 2MH8A 4FVMA 4RF1A 1V34A 1BVSA 1DO2A 1IN5A 4B7HA 1R4GA 2ZBKB 2OOBA 3K2LA 3FYDA 4G3OA 1HNWM 2C99A 5C18A 2I7NA 4X62M 4NRWA 4NSRA 3C9PA 3GRRA 4L15A 2WZJA 2G3QA 4LJ4A 2J7OA 3UZUA 4IBJA 3KXEC 3L26A 1MX0A 3PXGA 5L8RF 4JI7M 5EXXA 4PCZA 3TWMA 2JNHA 2R0IA 2R44A 1RU3A 2KNAA 4LGMA 5DFLA 1HR0M 3AJIB 4JXJA 2LXEA 1R6BX 3J80S 4S12A 3FUVA 4I8OA 4GC5A 3BOSA 2BWEA 3VDPA 3TWLA 4R71A 5A2QS 3MK6A 3GLIE 1JB0F 3GLIA 2CHGA 2O01F 1TDHA 4JI8M 1GABA 3SYLA 4IIWA 3MHVC 1L2DA 2CV0A 2B3TA 2C98A 3K92A 4QNMA 4DV7M 2Z4RA 4IBFA 2KZUA 2KRKA 3B74A 2XLJA 3ZH9B 4DUZM 2KXEA 2UXCM 4M9ZA 1A5TA 2VF8A 4JN6A 3SHFA 1UM8A 8CATA 1QUTA 4MH0E 4NSOB 1E94E 3R9XB 3K9PA 4ZPXA 2FOIC 3GQ3A 1Z5AA 2RRUA 3GLFE 3FYCA 2CV2A 3GLFA 2UXBM 3I4VA 2DZLA 3VK8A 1DV0A 1D0KA 4UN2B 2L7IA 3HY5A 1NVMA 4KLNA 3U6LA 4MGYE 2UUAM 3GLIB 4GC9A 3VK7A 2V6ZM 2L7HA 1DGHB 4B7FA 1QDRA 1IY2A 4F1IA 4DV0M 4LY6A 4OVZA 2VQEM 1TGUA 2G8LA 4NRVA 3WHKA 2ERCA 4QOZC 3RE8A 3WHLA 2QCUA 2LHGA 4EIWA 4WURA 2XFTA 2FFJA 1QQWA 1V33A 1L1ZA 2H1RA 1PJQA 4QHTA 3HHZA 1TH2A 1FNNA 1EFUB 1N32M 4KT0F 3GLFB 3RGPA 5DNYA 1N34M 1GO5A 1IN8A 3KDSE 1IXSA 3SC3A 1IN6A 1GJTA 2CUZA 3FD9A 1W5TA 2LVOC 3SMPA 3SYKA 4JYAM 1C1KA 4OVZB 3LQQA 5KO3A 2L4FA 2N35A 4LRTA 4YHHM 4JI2M 1PJSA 4GHLA 2CHQA 3HU3A 5EP3A 4DV4M 4B7GA 2JY7A 5GKNA 3IG8A 4AW4A 1QAMA 4JI1M 3L29A 3QYBA 2FNAA 1NHWC 3GQ4A 5EJCA 2BNKA 2EO2A 3FUXA 3M7GA 4L4UA 4LFBM 2L4EA 2ZANA 4LZJA 4QOSA 1G4AE 3V76A 1IXSB 2P5TA 1QAQA 1KYIA 4IJEA 4BB9A 3U6OA 3T1YM 4LJ9A 1H6UA 1VEGA 1I94M 2DAIA 2XH9A 1QANA 3HJQA 1QVRA 3GPXA 1X37A 2DHYA 4GH9A 1QAOA 5DYGA 4DR6M 3KOWE 4AKHA 2NQ8C 2DVWB 2JY5A 2LHCA 5EXSA 3VDUA 1V92A 1OIZA 3LVWA 2WSCF 2Y21A 3HWSA 2XSZA 1PJJA 2F5SA 1DGGA 1ZV1A 1OAIA 4NXMM 2CEAA 2DENA 5EP2A 3CF0A 2LVNC 1Y8GA 1GKIA 4I81A 4LZZA 3FUUA 1EE8A 3SAVA 4DR4M 2LH0A 1XNQM 1VQ1A 3PNYA 3B7QA 2R4JA 5KQ8A 4DR3M 1L8QA 2GNOA 2K9DA 2DNAA 4M0DA 2W82A 1ORYB 1OTRA 1VDDA 2EKKA 7CATA 1YUBA 1JR3E 3A42A 4HLQA 4L16A 5FTLA 1JR3A 1ZMWA 1Q02A 3LVVA 3GQ5A 3AKZA 1VG5A 2FH0A 4IBBA 2EUCA 2K0BX 4G4RA 4RNAA 2QENA 2MROB 1T3TA 1J5EM 1R2ZA 1KFVA 3C58A 2LBCA 2CWBA 4X65M 2V1UA 3F92A 1ZMUA 4XK8F 2JY8A 3MJ5A 1YSYA 1K3XA 1PJTA 4JI3M 1IBMM 3EIHA 2JP7A 2KNZA 1FJGM 3W0LB 2R4EA 4PDGA 3I04M 2ZAOA 3UJNA 1N33M 2F5OA 5FTJA 3SAWA 1WR1B 1OFHA 3FRHA 3PVSA 4FWHA 3HHYA 3THGA 2QPAA 4IJFA 3SARA 4K0KM 3B7NA 4DR1M 5FTKA 1TR8A 4AI6A 3KS8A 2Z4SA 1ZAEA 3GRVA 4IBCA 5E26A 2J7NA 2A5YB 1IN4A 3LCVB 3ZQJA 3LQRA 3E4RA 5ITUA 3T15A 5ITTA 1IBKM 2R18A 3AFHA 4GHAA 3CF6E 4LFAM 5C1BA 4DV6M 2LVQD 3KOXE 4M0WA 4OW0A 2Z7JA 2OOAA 1GJSA 4TUWA 4DV3M 2O25A 1NJGA 3U6PA 1DO0A 1NSFA 1P3QQ 1DGHA 3SMSA 1GVNA 1Q3CA 3A45A 2XSZD 1EIJA 4M9XA 2JZ1A 1G8PA 2HL7A 3OTOM 1NO1A 3Q8XA 1E32A 3NBXX 4CJ6A 4GEWA 4D80A 2K47A 2KEBA 4WW0A 2BJWA 1NV8A 2MGWA 5IWAM 2LTUA 3D8LA 1MN3A 4NL4H 4LJ7A 2BWBA 2L2DA 4FCWA 2EJSA 3J81S 3FRIA 4B3TM 3I01M 5EQTA 1JR3D 1J09A 2R65A 4KODA 1PM5A 4QNRA 3KOYE 4QHSA 1G71A 2JUJA 3AOEA 4IBGA 4YY3M 1TTEA 1SXJE 2R6FA 3FTDA 2JZ0A 3I4YA 1SXJA 3SHGB 2J5YA 2L6OA 2YNMD 4IBKA 3AOGA 4JI0M 1HNZM 1XC8A 4L6V6 1MU5A 3U6SA 3U5ZA 3MMPA 3J27B 4LF8M 1MJGM 4P16A 5BR8M 2VF7A 1WGNA 2G5GX 1HT2E 4W5WA 4AQYM 1Z6TA
chains in the Genus database with same CATH topology
3QAUA 3L2AA 2R45A 2OPFA 1J7KA 2D7HA 3KW6A 4L8RC 3GO8A 4BBAA 5FSWA 4CGYB 3HU2A 1SXJB 1PJIA 1IM2A 2CFOA 1Z5BA 3HKPA 5LMUM 1IQPA 1XXHA 4X66M 3U5ZB 2XFSA 2F5QA 2E5LM 4OU7A 1N77A 1K3WA 3AV0A 1IY1A 2FE8A 4I5SA 4BLCA 3A98B 3KSJA 4D82A 5ITXA 4AZFA 3ZC7B 1NY6A 4AG5A 5FLXS 3GRYA 4FWGA 5H37D 2AHMA 4M9SA 4Z6YA 4AKGA 3M6AA 3U6CA 1GLNA 4JV5M 4OX9M 3KOZE 3PNVA 3FTCA 2Y20A 1XMQM 2Z3XA 1TDZA 4PD2A 3K1JA 4LCBA 2O5RA 1XXHB 3GLHA 2HCBA 3E9SA 4HL4A 3U61A 4LG2A 1L1TA 4GRIA 5KQDA 4DUYM 1N78A 1SXJD 2KA6B 4B3MM 3L25A 1R2YA 5IREB 4X64M 1LV7A 2EA0A 4CISA 3DA1A 4LF5M 3JAMS 3TPZA 3JR4A 4R7GA 2XGNA 2DWZB 1G59A 1IXZA 3SBJA 4XGIA 3TWKA 2ZAMA 4NOOB 1G41A 4G4OA 1L2CA 3T1HM 5KPZA 3GLHB 3QWLA 3U61B 3DZDA 4LF6M 3T38A 4PDIA 2F4VM 4FCTA 4FWDA 1XNRM 3D8BA 4G6ZA 3SATA 5EP1A 1DGFA 3DFZA 3U6MA 4LJ5A 5FTNA 1NJFA 4GIPA 1TH3A 4LRSA 2YR0A 2Y0TA 2R46A 1KSFX 3TE6A 2CHVA 2DWMA 2XZFA 4DV5M 4DR2M 4IBDA 5DYIA 2DWLA 1E9SA 4PT5A 2DZOB 2HHHM 2JA2A 3GPUA 4JI6M 4LFCM 2C5RA 1Q3BA 1R7RA 3VFDA 5KPRA 3CTWB 3UMMA 3UGJA 4LJ8A 2KW0A 4JI4M 4B3RM 5KPTA 4FW9A 4MGKE 4I4LA 3R8FA 1Z59A 3FUWA 2UUCM 2D7EA 1TH4A 4MB7A 4MGIE 2DWNA 4FCVA 3HJSA 1QYRA 3TL4X 1S3SA 3UK6A 5LMNM 3VKGA 1NNJA 3ZCBB 3KVWA 3DOAA 4CHTB 1XMOM 3U6EA 3HHXA 1HQYE 1Z5CA 3L28A 4B3SM 3FKEA 3GPPA 2F5NA 3RFWA 5EP4A 4KHPM 4DV2M 2RGHA 2L09A 1OJLA 3FTFA 1D2NA 3GP1A 2X4AA 3GRUA 4A3VB 1NY5A 2X49A 3VLFB 1HNXM 4II7A 2Q2EB 3KP0E 1K82A 3LMMA 5JI2E 3CF2A 4MGZE 4AG6A 1NHGC 1Q39A 4G4QA 1L2BA 2QBYA 2M60A 2ZM6M 1N75A 2CV1A 2BJVA 5EXTA 2KZSA 3KS4A 1N36M 2F5PA 1YE9A 4JI5M 4LGYA 5ITYA 5ITRA 2DXIA 1JQJC 4LF9M 1WXQA 3A46A 2HKJA 4FD2A 4ITQA 5JI3E 3KFUG 3KSXA 4RF0A 3FUTA 3GLGA 2XZUA 2C96A 3NBIA 3HU1A 3L27A 2Y0QA 4KO8A 1GL6A 2QBYB 3HGIA 2R62A 2UXDM 2VQFM 4R3DA 5ITXE 2X8AA 1I4WA 3RGSA 2YFQA 1OFIA 4XBOA 1IXRC 3H4MA 3ILKA 4GKKM 3J2PB 3SFZA 1G3IA 4REZA 4G4NA 1QZMA 5E6JA 3NWLA 4IBIA 3U6DA 3FTEA 4NXNM 4AKIA 2I7PA 2UUBM 2V1CA 4GITA 3GLGB 1XWIA 5ITQA 4GMQA 3M0EA 1IBLM 5IZ7D 3J7AS 1XHBA 5IT9S 1HT1E 2RGOA 3IG5A 1NNUC 3VKHA 3GPYA 4DR7M 1ZQ9A 2D7GA 3SAUA 2DZNB 2UU9M 2XEPA 2DHRA 3J7BA 1GL7A 3TQSA 1IN7A 1W5SA 2LNHC 4LF4M 4IBEA 3HHWA 5BPVA 3EIEA 5EXPA 3U60A 2YQZA 3W0FA 1HQCA 2KRUA 4B08A 1IY0A 1DGBA 3I51A 2VIIA 2LWXA 2RKOA 3PFIA 2CE7A 2M5ZA 4D81A 4L78A 4LF7M 3JR5A 4LJAA 2C9OA 3SASA 4MGHA 5F3WA 3AOEC 3HJ8A 4MM3B 2OQ4A 2XF3A 1SXJC 2QZ4A 3AL0C 5FTMA 4DR5M 2QP9X 3B9PA 2C9CA 1E9RA 4DV1M 3K8ZA 3U60B 3U6QA 4GKJM 4Z8XA 4LJ6A 3KP1E 4FVMA 4RF1A 1DO2A 1IN5A 4B7HA 2ZBKB 3K2LA 3FYDA 1HNWM 2C99A 5C18A 2I7NA 4X62M 4NRWA 4NSRA 4L15A 3GRRA 4LJ4A 2J7OA 3UZUA 4IBJA 3KXEC 3L26A 1MX0A 3PXGA 4JI7M 5EXXA 4PCZA 3TWMA 1HR0M 4LGMA 3AJIB 4JXJA 2LXEA 1R6BX 3J80S 4S12A 3FUVA 4I8OA 4GC5A 3BOSA 3VDPA 3TWLA 5A2QS 3MK6A 3GLIA 2CHGA 4JI8M 1TDHA 3SYLA 4IIWA 3MHVC 1L2DA 2C98A 3K92A 4QNMA 4DV7M 2Z4RA 4IBFA 2KZUA 2KRKA 2XLJA 4DUZM 3ZH9B 2KXEA 2UXCM 4M9ZA 4JN6A 3SHFA 1UM8A 8CATA 4MH0E 4NSOB 1E94E 3R9XB 4ZPXA 2FOIC 3GQ3A 1Z5AA 2CV2A 3FYCA 3GLFA 2UXBM 3I4VA 3VK8A 2L7IA 3U6LA 1NVMA 4KLNA 4MGYE 2UUAM 3GLIB 4GC9A 3VK7A 2V6ZM 2L7HA 1DGHB 4B7FA 1IY2A 4DV0M 4LY6A 4OVZA 2VQEM 1TGUA 2G8LA 4NRVA 3WHKA 2ERCA 4QOZC 3RE8A 3WHLA 2QCUA 4EIWA 4WURA 2XFTA 2FFJA 1QQWA 1L1ZA 2H1RA 4QHTA 3HHZA 1TH2A 1FNNA 1N32M 3GLFB 3RGPA 5DNYA 1N34M 1IN8A 3KDSE 3SC3A 1IN6A 2CUZA 3FD9A 1W5TA 3SMPA 3SYKA 4JYAM 1C1KA 4OVZB 3LQQA 5KO3A 4JI2M 4LRTA 4YHHM 4GHLA 2CHQA 3HU3A 5EP3A 4DV4M 4B7GA 5GKNA 3IG8A 4AW4A 1QAMA 4JI1M 3L29A 3GQ4A 2FNAA 1NHWC 5EJCA 2BNKA 2EO2A 3FUXA 3M7GA 4L4UA 4LFBM 2ZANA 4LZJA 4QOSA 1G4AE 2P5TA 1IXSB 1QAQA 1KYIA 4IJEA 4BB9A 3U6OA 3T1YM 4LJ9A 1H6UA 1I94M 2XH9A 3HJQA 1QANA 1QVRA 3GPXA 1X37A 4GH9A 4AKHA 1QAOA 5DYGA 4DR6M 3KOWE 2NQ8C 2DVWB 5EXSA 3VDUA 3LVWA 2Y21A 3HWSA 2XSZA 1PJJA 2F5SA 1DGGA 4NXMM 2CEAA 5EP2A 3CF0A 1GKIA 4I81A 4LZZA 3FUUA 1EE8A 3SAVA 4DR4M 2LH0A 1XNQM 3PNYA 5KQ8A 2R4JA 4DR3M 1L8QA 4M0DA 2W82A 1ORYB 1VDDA 7CATA 1YUBA 3A42A 4HLQA 4L16A 5FTLA 3GQ5A 1JR3A 3LVVA 2CV0A 3AKZA 4IBBA 2EUCA 4G4RA 4RNAA 2QENA 1T3TA 1J5EM 1R2ZA 1KFVA 3C58A 2V1UA 4X65M 3MJ5A 1IBMM 1YSYA 1K3XA 4JI3M 3EIHA 1FJGM 3W0LB 2R4EA 4PDGA 2ZAOA 3UJNA 1N33M 2F5OA 5FTJA 3SAWA 3HHYA 1OFHA 3PVSA 4FWHA 3THGA 3SARA 4K0KM 2QPAA 4IJFA 4DR1M 5FTKA 4AI6A 3KS8A 2Z4SA 1ZAEA 3GRVA 4IBCA 5E26A 2J7NA 2A5YB 1IN4A 3LQRA 3E4RA 5ITUA 3T15A 5ITTA 1IBKM 2R18A 3AFHA 4GHAA 3CF6E 4LFAM 5C1BA 4DV6M 3KOXE 4M0WA 4OW0A 2Z7JA 4TUWA 4DV3M 1NJGA 3U6PA 1DO0A 1NSFA 1DGHA 3SMSA 1GVNA 1Q3CA 3A45A 2XSZD 4M9XA 1G8PA 2HL7A 3OTOM 3Q8XA 1E32A 4D80A 2K47A 2KEBA 4WW0A 2BJWA 5IWAM 3D8LA 4NL4H 4LJ7A 4B3TM 4FCWA 3J81S 5EQTA 1JR3D 1J09A 2R65A 4KODA 1PM5A 4QNRA 3KOYE 4QHSA 3AOEA 4IBGA 4YY3M 1SXJE 3FTDA 3I4YA 3SHGB 1SXJA 2L6OA 2YNMD 4IBKA 3AOGA 4JI0M 1HNZM 1XC8A 1MU5A 3U6SA 3U5ZA 3J27B 4LF8M 4P16A 5BR8M 2G5GX 1HT2E 4W5WA 4AQYM 1Z6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 M;  3U6Q A;  4GKJ M;  1I94 M;  2OPF A;  3GPX A;  5LMN M;  1NNJ A;  4DR6 M;  3GO8 A;  3DOA A;  1XMO M;  1PJJ A;  3U6E A;  1PJI A;  2F5S A;  2ZBK B;  4NXM M;  1Z5C A;  4B3S M;  1HNW M;  1Z5B A;  3GPP A;  2F5N A;  5LMU M;  4KHP M;  4X66 M;  4DV2 M;  4X62 M;  4NRW A;  2F5Q A;  2E5L M;  1EE8 A;  3SAV A;  3GP1 A;  4DR4 M;  1K3W A;  1XNQ M;  1HNX M;  1MX0 A;  4JI7 M;  2Q2E B;  4DR3 M;  1K82 A;  4PCZ A;  3TWM A;  5ITX A;  1Q39 A;  4G4Q A;  1L2B A;  3A42 A;  3GQ5 A;  2ZM6 M;  1HR0 M;  5FLX S;  3J80 S;  4G4R A;  3U6C A;  1J5E M;  1N36 M;  1R2Z A;  2F5P A;  1KFV A;  4JV5 M;  4OX9 M;  4JI5 M;  3TWL A;  5ITY A;  5A2Q S;  5ITR A;  3C58 A;  4LF9 M;  1XMQ M;  3A46 A;  4X65 M;  4JI8 M;  1TDH A;  2HKJ A;  4PD2 A;  1TDZ A;  1IBM M;  1K3X A;  4JI3 M;  1L2D A;  4ITQ A;  4DV7 M;  1FJG M;  2XZU A;  1L1T A;  4PDG A;  4DUY M;  4DUZ M;  1N33 M;  2F5O A;  3SAW A;  4B3M M;  1R2Y A;  3SAR A;  4K0K M;  4X64 M;  2UXC M;  2EA0 A;  4DR1 M;  4CIS A;  2UXD M;  2VQF M;  4LF5 M;  5ITX E;  3JAM S;  3GQ3 A;  3JR4 A;  1Z5A A;  5ITU A;  4GKK M;  2UXB M;  5ITT A;  3SBJ A;  3VK8 A;  1IBK M;  4G4N A;  4LFA M;  3U6L A;  4DV6 M;  2UUA M;  3TWK A;  3VK7 A;  4G4O A;  3U6D A;  1L2C A;  3T1H M;  4NXN M;  4DV3 M;  2UUB M;  4DV0 M;  2VQE M;  5ITQ A;  3U6P A;  4PDI A;  4LF6 M;  4NRV A;  1IBL M;  2F4V M;  1Q3C A;  3A45 A;  1XNR M;  3J7A S;  5IT9 S;  3SAT A;  3OTO M;  1L1Z A;  3GPY A;  3U6M A;  4DR7 M;  3SAU A;  2UU9 M;  1N32 M;  1N34 M;  5IWA M;  4LF4 M;  2XZF A;  4DV5 M;  4DR2 M;  4B3T M;  3J81 S;  3W0F A;  1PM5 A;  4JYA M;  2HHH M;  3GPU A;  4JI2 M;  4YY3 M;  4JI6 M;  4YHH M;  4LFC M;  1Q3B A;  4DV4 M;  4LF7 M;  3JR5 A;  4JI0 M;  1HNZ M;  3SAS A;  1XC8 A;  3GQ4 A;  4JI1 M;  1MU5 A;  4JI4 M;  3U6S A;  4B3R M;  2OQ4 A;  4LFB M;  4LF8 M;  5BR8 M;  4DR5 M;  1Z59 A;  2UUC M;  4MB7 A;  4AQY M;  3U6O A;  3T1Y M; 
#chains in the Genus database with same CATH topology
 1T43 A;  3QAU A;  3L2A A;  2R45 A;  2OPF A;  2DAK A;  1J7K A;  2D7H A;  3KW6 A;  4L8R C;  3GO8 A;  4BBA A;  5FSW A;  1WJ7 A;  4CGY B;  3HU2 A;  2QNJ A;  1SXJ B;  1PJI A;  2DAE A;  1IM2 A;  1HJP A;  2CFO A;  1LTM A;  1Z5B A;  2LVA A;  3HKP A;  5LMU M;  1XXH E;  2JWS A;  1IQP A;  1XXH A;  3C3D A;  4X66 M;  4CIZ A;  2XFS A;  3U5Z B;  2E5L M;  2F5Q A;  1SG9 A;  4OU7 A;  3E21 A;  1N77 A;  1K3W A;  3AV0 A;  1YLA A;  1IY1 A;  2FE8 A;  4I5S A;  4BLC A;  3A98 B;  3KSJ A;  4D82 A;  5ITX A;  2DAM A;  4AZF A;  3ZC7 B;  1NY6 A;  4AG5 A;  5FLX S;  3GRY A;  4FWG A;  5H37 D;  2AHM A;  4M9S A;  4Z6Y A;  4AKG A;  3M6A A;  3U6C A;  1GLN A;  4JV5 M;  4OX9 M;  3KOZ E;  3PNV A;  3FTC A;  2Y20 A;  1XMQ M;  3T6P A;  3Q8G A;  2Z3X A;  1TDZ A;  4PD2 A;  3K1J A;  4LCB A;  2O5R A;  1XXH B;  3H4J A;  1AIP C;  3GLH A;  2HCB A;  2Z8Y M;  3E9S A;  4HL4 A;  3U61 A;  4LG2 A;  1L1T A;  4GRI A;  5KQD A;  4DUY M;  1N78 A;  1SXJ D;  2KA6 B;  1PRB A;  4B3M M;  3K9O A;  1R2Y A;  3L25 A;  5IRE B;  1D0L A;  4X64 M;  1LV7 A;  2EA0 A;  4CIS A;  3DA1 A;  2FS1 A;  2GQF A;  1OQY A;  1WHC A;  4LF5 M;  3JAM S;  3TPZ A;  3JR4 A;  4R7G A;  2XGN A;  2DWZ B;  1G59 A;  1IXZ A;  3SBJ A;  2WSE F;  4XGI A;  3B7Z A;  2ZAM A;  3TWK A;  4NOO B;  1G41 A;  4G4O A;  1L2C A;  2APL A;  3T1H M;  5KPZ A;  3GLH B;  3QWL A;  3U61 B;  3DZD A;  2KNV A;  3T38 A;  4PDI A;  4LF6 M;  4Y28 F;  2F4V M;  4FCT A;  4FWD A;  1XNR M;  3D8B A;  4G6Z A;  3SAT A;  2DI0 A;  1DGF A;  2HWJ A;  3DFZ A;  3C3E A;  3LCU A;  1T6O A;  5EP1 A;  1OAO C;  3U6M A;  4LJ5 A;  5FTN A;  1NJF A;  3HZJ A;  4GIP A;  1TH3 A;  2CRU A;  4LRS A;  1OKS A;  2YR0 A;  2Y0T A;  1OIP A;  2R46 A;  1QDT A;  2OO9 A;  1KSF X;  3TE6 A;  2CHV A;  2DWM A;  2XZF A;  4DV5 M;  4DR2 M;  1XB2 B;  2CP8 A;  4IBD A;  5DYI A;  2DWL A;  1E9S A;  2JXN A;  1R5L A;  4PT5 A;  3W67 A;  2DZO B;  2HHH M;  1F4I A;  2JA2 A;  3GPU A;  4JI6 M;  4WP2 A;  4LFC M;  2C5R A;  1Q3B A;  1R7R A;  3VFD A;  5KPR A;  3CTW B;  4HEO A;  3UMM A;  3UGJ A;  4LJ8 A;  2KW0 A;  4JI4 M;  4B3R M;  5KPT A;  2MJ5 B;  4FW9 A;  4MGK E;  4I4L A;  3R8F A;  1Z59 A;  3FUW A;  2UUC M;  3HX3 A;  2D7E A;  1TH4 A;  4MB7 A;  4MGI E;  2DWN A;  1ZMV A;  1D0M A;  4FCV A;  3E46 A;  3HJS A;  1QYR A;  3TL4 X;  4RKU F;  4F2L A;  1S3S A;  3UK6 A;  5LMN M;  3VKG A;  1NNJ A;  3ZCB B;  3KVW A;  1VEJ A;  3CGW A;  3DOA A;  1AUA A;  4CHT B;  1XMO M;  3U6E A;  3HHX A;  1TF0 B;  1HQY E;  1WIV A;  1Z5C A;  3IEC A;  3L28 A;  3FKE A;  3GPP A;  2F5N A;  4B3S M;  1IFY A;  3RFW A;  1VDL A;  5EP4 A;  1UFZ A;  4P17 A;  4DV2 M;  2RGH A;  2L09 A;  4KHP M;  1OJL A;  3FTF A;  3FE3 A;  1D2N A;  2KDL A;  2X4A A;  3GRU A;  3GP1 A;  4A3V B;  1NY5 A;  2X49 A;  3VLF B;  1HNX M;  4II7 A;  2Q2E B;  3KP0 E;  1K82 A;  2MR9 A;  3LMM A;  4ANR A;  5JI2 E;  3CF2 A;  4MGZ E;  4AG6 A;  1NHG C;  1Q39 A;  4G4Q A;  1L2B A;  2QBY A;  2M60 A;  2ZM6 M;  1N75 A;  2CV1 A;  2BJV A;  5EXT A;  2KZS A;  2JY6 B;  2HAK A;  2WSF F;  1QUS A;  1YE9 A;  3BBZ A;  3KS4 A;  4LGY A;  1N36 M;  5ITY A;  2F5P A;  5ITR A;  4JI5 M;  2DXI A;  1JQJ C;  4LF9 M;  1WXQ A;  3A46 A;  2HKJ A;  4FD2 A;  4ITQ A;  5JI3 E;  3KFU G;  3KSX A;  4RF0 A;  3FUT A;  3GLG E;  3GLG A;  2XZU A;  2K6B A;  2VDB B;  2C96 A;  3NBI A;  3HU1 A;  4DBG B;  3L27 A;  2Y0Q A;  4KO8 A;  1GL6 A;  2QBY B;  3HGI A;  2R62 A;  3IHP A;  2VQF M;  2UXD M;  3B89 A;  4R3D A;  5ITX E;  2X8A A;  1I4W A;  3RGS A;  2YFQ A;  1OFI A;  4XBO A;  1CUK A;  1IXR C;  3H4M A;  3ILK A;  2EKF A;  4GKK M;  3J2P B;  3SFZ A;  1G3I A;  4REZ A;  1NV9 A;  4G4N A;  1QZM A;  5E6J A;  1QZE A;  3NWL A;  4IBI A;  3U6D A;  3FTE A;  4NXN M;  4AKI A;  2H5X A;  2I7P A;  2UUB M;  2V1C A;  4GIT A;  2KHH A;  1XWI A;  5ITQ A;  3GLG B;  4GMQ A;  3M0E A;  1IBL M;  5IZ7 D;  3GLH E;  3J7A S;  1XHB A;  5IT9 S;  1HT1 E;  1WGL A;  2RGO A;  3IG5 A;  1NNU C;  1C7Y A;  1PGY A;  2DAG A;  3GPY A;  4DR7 M;  3VKH A;  1ZQ9 A;  2D7G A;  2DKL A;  3SAU A;  2DZN B;  3LW5 F;  2UU9 M;  2XEP A;  2DHR A;  2QSF X;  2ZTC A;  3J7B A;  4NC6 A;  1GL7 A;  3TQS A;  1IN7 A;  1W5S A;  2QQ8 A;  3BXW A;  2LNH C;  4LF4 M;  4IBE A;  3HHW A;  5BPV A;  3EIE A;  5EXP A;  3U60 A;  3W68 A;  1VEK A;  2YQZ A;  3W0F A;  1HQC A;  2KRU A;  4B08 A;  1IY0 A;  1DGB A;  3I51 A;  2VII A;  2LWX A;  2RKO A;  3PFI A;  3QYE A;  2CE7 A;  2M5Z A;  4D81 A;  4L78 A;  4LF7 M;  3JR5 A;  4LJA A;  2C9O A;  4Q7J A;  3SAS A;  4MGH A;  5F3W A;  3AOE C;  3HJ8 A;  4MM3 B;  2OQ4 A;  2XF3 A;  1SXJ C;  2QZ4 A;  3AL0 C;  2ZTD A;  5FTM A;  4DR5 M;  2LVP C;  2QP9 X;  3B9P A;  2C9C A;  1E9R A;  4DV1 M;  3K8Z A;  2QHO B;  3U60 B;  3U6Q A;  4GKJ M;  4Z8X A;  4LJ6 A;  3KP1 E;  2MH8 A;  4FVM A;  4RF1 A;  1V34 A;  1BVS A;  1DO2 A;  1IN5 A;  4B7H A;  1R4G A;  2ZBK B;  2OOB A;  3K2L A;  3FYD A;  4G3O A;  1HNW M;  2C99 A;  5C18 A;  2I7N A;  4X62 M;  4NRW A;  4NSR A;  3C9P A;  3GRR A;  4L15 A;  2WZJ A;  2G3Q A;  4LJ4 A;  2J7O A;  3UZU A;  4IBJ A;  3KXE C;  3L26 A;  1MX0 A;  3PXG A;  5L8R F;  4JI7 M;  5EXX A;  4PCZ A;  3TWM A;  2JNH A;  2R0I A;  2R44 A;  1RU3 A;  2KNA A;  4LGM A;  5DFL A;  1HR0 M;  3AJI B;  4JXJ A;  2LXE A;  1R6B X;  3J80 S;  4S12 A;  3FUV A;  4I8O A;  4GC5 A;  3BOS A;  2BWE A;  3VDP A;  3TWL A;  4R71 A;  5A2Q S;  3MK6 A;  3GLI E;  1JB0 F;  3GLI A;  2CHG A;  2O01 F;  1TDH A;  4JI8 M;  1GAB A;  3SYL A;  4IIW A;  3MHV C;  1L2D A;  2CV0 A;  2B3T A;  2C98 A;  3K92 A;  4QNM A;  4DV7 M;  2Z4R A;  4IBF A;  2KZU A;  2KRK A;  3B74 A;  2XLJ A;  3ZH9 B;  4DUZ M;  2KXE A;  2UXC M;  4M9Z A;  1A5T A;  2VF8 A;  4JN6 A;  3SHF A;  1UM8 A;  8CAT A;  1QUT A;  4MH0 E;  4NSO B;  1E94 E;  3R9X B;  3K9P A;  4ZPX A;  2FOI C;  3GQ3 A;  1Z5A A;  2RRU A;  3GLF E;  3FYC A;  2CV2 A;  3GLF A;  2UXB M;  3I4V A;  2DZL A;  3VK8 A;  1DV0 A;  1D0K A;  4UN2 B;  2L7I A;  3HY5 A;  1NVM A;  4KLN A;  3U6L A;  4MGY E;  2UUA M;  3GLI B;  4GC9 A;  3VK7 A;  2V6Z M;  2L7H A;  1DGH B;  4B7F A;  1QDR A;  1IY2 A;  4F1I A;  4DV0 M;  4LY6 A;  4OVZ A;  2VQE M;  1TGU A;  2G8L A;  4NRV A;  3WHK A;  2ERC A;  4QOZ C;  3RE8 A;  3WHL A;  2QCU A;  2LHG A;  4EIW A;  4WUR A;  2XFT A;  2FFJ A;  1QQW A;  1V33 A;  1L1Z A;  2H1R A;  1PJQ A;  4QHT A;  3HHZ A;  1TH2 A;  1FNN A;  1EFU B;  1N32 M;  4KT0 F;  3GLF B;  3RGP A;  5DNY A;  1N34 M;  1GO5 A;  1IN8 A;  3KDS E;  1IXS A;  3SC3 A;  1IN6 A;  1GJT A;  2CUZ A;  3FD9 A;  1W5T A;  2LVO C;  3SMP A;  3SYK A;  4JYA M;  1C1K A;  4OVZ B;  3LQQ A;  5KO3 A;  2L4F A;  2N35 A;  4LRT A;  4YHH M;  4JI2 M;  1PJS A;  4GHL A;  2CHQ A;  3HU3 A;  5EP3 A;  4DV4 M;  4B7G A;  2JY7 A;  5GKN A;  3IG8 A;  4AW4 A;  1QAM A;  4JI1 M;  3L29 A;  3QYB A;  2FNA A;  1NHW C;  3GQ4 A;  5EJC A;  2BNK A;  2EO2 A;  3FUX A;  3M7G A;  4L4U A;  4LFB M;  2L4E A;  2ZAN A;  4LZJ A;  4QOS A;  1G4A E;  3V76 A;  1IXS B;  2P5T A;  1QAQ A;  1KYI A;  4IJE A;  4BB9 A;  3U6O A;  3T1Y M;  4LJ9 A;  1H6U A;  1VEG A;  1I94 M;  2DAI A;  2XH9 A;  1QAN A;  3HJQ A;  1QVR A;  3GPX A;  1X37 A;  2DHY A;  4GH9 A;  1QAO A;  5DYG A;  4DR6 M;  3KOW E;  4AKH A;  2NQ8 C;  2DVW B;  2JY5 A;  2LHC A;  5EXS A;  3VDU A;  1V92 A;  1OIZ A;  3LVW A;  2WSC F;  2Y21 A;  3HWS A;  2XSZ A;  1PJJ A;  2F5S A;  1DGG A;  1ZV1 A;  1OAI A;  4NXM M;  2CEA A;  2DEN A;  5EP2 A;  3CF0 A;  2LVN C;  1Y8G A;  1GKI A;  4I81 A;  4LZZ A;  3FUU A;  1EE8 A;  3SAV A;  4DR4 M;  2LH0 A;  1XNQ M;  1VQ1 A;  3PNY A;  3B7Q A;  2R4J A;  5KQ8 A;  4DR3 M;  1L8Q A;  2GNO A;  2K9D A;  2DNA A;  4M0D A;  2W82 A;  1ORY B;  1OTR A;  1VDD A;  2EKK A;  7CAT A;  1YUB A;  1JR3 E;  3A42 A;  4HLQ A;  4L16 A;  5FTL A;  1JR3 A;  1ZMW A;  1Q02 A;  3LVV A;  3GQ5 A;  3AKZ A;  1VG5 A;  2FH0 A;  4IBB A;  2EUC A;  2K0B X;  4G4R A;  4RNA A;  2QEN A;  2MRO B;  1T3T A;  1J5E M;  1R2Z A;  1KFV A;  3C58 A;  2LBC A;  2CWB A;  4X65 M;  2V1U A;  3F92 A;  1ZMU A;  4XK8 F;  2JY8 A;  3MJ5 A;  1YSY A;  1K3X A;  1PJT A;  4JI3 M;  1IBM M;  3EIH A;  2JP7 A;  2KNZ A;  1FJG M;  3W0L B;  2R4E A;  4PDG A;  3I04 M;  2ZAO A;  3UJN A;  1N33 M;  2F5O A;  5FTJ A;  3SAW A;  1WR1 B;  1OFH A;  3FRH A;  3PVS A;  4FWH A;  3HHY A;  3THG A;  2QPA A;  4IJF A;  3SAR A;  4K0K M;  3B7N A;  4DR1 M;  5FTK A;  1TR8 A;  4AI6 A;  3KS8 A;  2Z4S A;  1ZAE A;  3GRV A;  4IBC A;  5E26 A;  2J7N A;  2A5Y B;  1IN4 A;  3LCV B;  3ZQJ A;  3LQR A;  3E4R A;  5ITU A;  3T15 A;  5ITT A;  1IBK M;  2R18 A;  3AFH A;  4GHA A;  3CF6 E;  4LFA M;  5C1B A;  4DV6 M;  2LVQ D;  3KOX E;  4M0W A;  4OW0 A;  2Z7J A;  2OOA A;  1GJS A;  4TUW A;  4DV3 M;  2O25 A;  1NJG A;  3U6P A;  1DO0 A;  1NSF A;  1P3Q Q;  1DGH A;  3SMS A;  1GVN A;  1Q3C A;  3A45 A;  2XSZ D;  1EIJ A;  4M9X A;  2JZ1 A;  1G8P A;  2HL7 A;  3OTO M;  1NO1 A;  3Q8X A;  1E32 A;  3NBX X;  4CJ6 A;  4GEW A;  4D80 A;  2K47 A;  2KEB A;  4WW0 A;  2BJW A;  1NV8 A;  2MGW A;  5IWA M;  2LTU A;  3D8L A;  1MN3 A;  4NL4 H;  4LJ7 A;  2BWB A;  2L2D A;  4FCW A;  2EJS A;  3J81 S;  3FRI A;  4B3T M;  3I01 M;  5EQT A;  1JR3 D;  1J09 A;  2R65 A;  4KOD A;  1PM5 A;  4QNR A;  3KOY E;  4QHS A;  1G71 A;  2JUJ A;  3AOE A;  4IBG A;  4YY3 M;  1TTE A;  1SXJ E;  2R6F A;  3FTD A;  2JZ0 A;  3I4Y A;  1SXJ A;  3SHG B;  2J5Y A;  2L6O A;  2YNM D;  4IBK A;  3AOG A;  4JI0 M;  1HNZ M;  1XC8 A;  4L6V 6;  1MU5 A;  3U6S A;  3U5Z A;  3MMP A;  3J27 B;  4LF8 M;  1MJG M;  4P16 A;  5BR8 M;  2VF7 A;  1WGN A;  2G5G X;  1HT2 E;  4W5W A;  4AQY M;  1Z6T A; 
#chains in the Genus database with same CATH homology
 3QAU A;  3L2A A;  2R45 A;  2OPF A;  1J7K A;  2D7H A;  3KW6 A;  4L8R C;  3GO8 A;  4BBA A;  5FSW A;  4CGY B;  3HU2 A;  1SXJ B;  1PJI A;  1IM2 A;  2CFO A;  1Z5B A;  3HKP A;  5LMU M;  1IQP A;  1XXH A;  4X66 M;  3U5Z B;  2XFS A;  2F5Q A;  2E5L M;  4OU7 A;  1N77 A;  1K3W A;  3AV0 A;  1IY1 A;  2FE8 A;  4I5S A;  4BLC A;  3A98 B;  3KSJ A;  4D82 A;  5ITX A;  4AZF A;  3ZC7 B;  1NY6 A;  4AG5 A;  5FLX S;  3GRY A;  4FWG A;  5H37 D;  2AHM A;  4M9S A;  4Z6Y A;  4AKG A;  3M6A A;  3U6C A;  1GLN A;  4JV5 M;  4OX9 M;  3KOZ E;  3PNV A;  3FTC A;  2Y20 A;  1XMQ M;  2Z3X A;  1TDZ A;  4PD2 A;  3K1J A;  4LCB A;  2O5R A;  1XXH B;  3GLH A;  2HCB A;  3E9S A;  4HL4 A;  3U61 A;  4LG2 A;  1L1T A;  4GRI A;  5KQD A;  4DUY M;  1N78 A;  1SXJ D;  2KA6 B;  4B3M M;  3L25 A;  1R2Y A;  5IRE B;  4X64 M;  1LV7 A;  2EA0 A;  4CIS A;  3DA1 A;  4LF5 M;  3JAM S;  3TPZ A;  3JR4 A;  4R7G A;  2XGN A;  2DWZ B;  1G59 A;  1IXZ A;  3SBJ A;  4XGI A;  3TWK A;  2ZAM A;  4NOO B;  1G41 A;  4G4O A;  1L2C A;  3T1H M;  5KPZ A;  3GLH B;  3QWL A;  3U61 B;  3DZD A;  4LF6 M;  3T38 A;  4PDI A;  2F4V M;  4FCT A;  4FWD A;  1XNR M;  3D8B A;  4G6Z A;  3SAT A;  5EP1 A;  1DGF A;  3DFZ A;  3U6M A;  4LJ5 A;  5FTN A;  1NJF A;  4GIP A;  1TH3 A;  4LRS A;  2YR0 A;  2Y0T A;  2R46 A;  1KSF X;  3TE6 A;  2CHV A;  2DWM A;  2XZF A;  4DV5 M;  4DR2 M;  4IBD A;  5DYI A;  2DWL A;  1E9S A;  4PT5 A;  2DZO B;  2HHH M;  2JA2 A;  3GPU A;  4JI6 M;  4LFC M;  2C5R A;  1Q3B A;  1R7R A;  3VFD A;  5KPR A;  3CTW B;  3UMM A;  3UGJ A;  4LJ8 A;  2KW0 A;  4JI4 M;  4B3R M;  5KPT A;  4FW9 A;  4MGK E;  4I4L A;  3R8F A;  1Z59 A;  3FUW A;  2UUC M;  2D7E A;  1TH4 A;  4MB7 A;  4MGI E;  2DWN A;  4FCV A;  3HJS A;  1QYR A;  3TL4 X;  1S3S A;  3UK6 A;  5LMN M;  3VKG A;  1NNJ A;  3ZCB B;  3KVW A;  3DOA A;  4CHT B;  1XMO M;  3U6E A;  3HHX A;  1HQY E;  1Z5C A;  3L28 A;  4B3S M;  3FKE A;  3GPP A;  2F5N A;  3RFW A;  5EP4 A;  4KHP M;  4DV2 M;  2RGH A;  2L09 A;  1OJL A;  3FTF A;  1D2N A;  3GP1 A;  2X4A A;  3GRU A;  4A3V B;  1NY5 A;  2X49 A;  3VLF B;  1HNX M;  4II7 A;  2Q2E B;  3KP0 E;  1K82 A;  3LMM A;  5JI2 E;  3CF2 A;  4MGZ E;  4AG6 A;  1NHG C;  1Q39 A;  4G4Q A;  1L2B A;  2QBY A;  2M60 A;  2ZM6 M;  1N75 A;  2CV1 A;  2BJV A;  5EXT A;  2KZS A;  3KS4 A;  1N36 M;  2F5P A;  1YE9 A;  4JI5 M;  4LGY A;  5ITY A;  5ITR A;  2DXI A;  1JQJ C;  4LF9 M;  1WXQ A;  3A46 A;  2HKJ A;  4FD2 A;  4ITQ A;  5JI3 E;  3KFU G;  3KSX A;  4RF0 A;  3FUT A;  3GLG A;  2XZU A;  2C96 A;  3NBI A;  3HU1 A;  3L27 A;  2Y0Q A;  4KO8 A;  1GL6 A;  2QBY B;  3HGI A;  2R62 A;  2UXD M;  2VQF M;  4R3D A;  5ITX E;  2X8A A;  1I4W A;  3RGS A;  2YFQ A;  1OFI A;  4XBO A;  1IXR C;  3H4M A;  3ILK A;  4GKK M;  3J2P B;  3SFZ A;  1G3I A;  4REZ A;  4G4N A;  1QZM A;  5E6J A;  3NWL A;  4IBI A;  3U6D A;  3FTE A;  4NXN M;  4AKI A;  2I7P A;  2UUB M;  2V1C A;  4GIT A;  3GLG B;  1XWI A;  5ITQ A;  4GMQ A;  3M0E A;  1IBL M;  5IZ7 D;  3J7A S;  1XHB A;  5IT9 S;  1HT1 E;  2RGO A;  3IG5 A;  1NNU C;  3VKH A;  3GPY A;  4DR7 M;  1ZQ9 A;  2D7G A;  3SAU A;  2DZN B;  2UU9 M;  2XEP A;  2DHR A;  3J7B A;  1GL7 A;  3TQS A;  1IN7 A;  1W5S A;  2LNH C;  4LF4 M;  4IBE A;  3HHW A;  5BPV A;  3EIE A;  5EXP A;  3U60 A;  2YQZ A;  3W0F A;  1HQC A;  2KRU A;  4B08 A;  1IY0 A;  1DGB A;  3I51 A;  2VII A;  2LWX A;  2RKO A;  3PFI A;  2CE7 A;  2M5Z A;  4D81 A;  4L78 A;  4LF7 M;  3JR5 A;  4LJA A;  2C9O A;  3SAS A;  4MGH A;  5F3W A;  3AOE C;  3HJ8 A;  4MM3 B;  2OQ4 A;  2XF3 A;  1SXJ C;  2QZ4 A;  3AL0 C;  5FTM A;  4DR5 M;  2QP9 X;  3B9P A;  2C9C A;  1E9R A;  4DV1 M;  3K8Z A;  3U60 B;  3U6Q A;  4GKJ M;  4Z8X A;  4LJ6 A;  3KP1 E;  4FVM A;  4RF1 A;  1DO2 A;  1IN5 A;  4B7H A;  2ZBK B;  3K2L A;  3FYD A;  1HNW M;  2C99 A;  5C18 A;  2I7N A;  4X62 M;  4NRW A;  4NSR A;  4L15 A;  3GRR A;  4LJ4 A;  2J7O A;  3UZU A;  4IBJ A;  3KXE C;  3L26 A;  1MX0 A;  3PXG A;  4JI7 M;  5EXX A;  4PCZ A;  3TWM A;  1HR0 M;  4LGM A;  3AJI B;  4JXJ A;  2LXE A;  1R6B X;  3J80 S;  4S12 A;  3FUV A;  4I8O A;  4GC5 A;  3BOS A;  3VDP A;  3TWL A;  5A2Q S;  3MK6 A;  3GLI A;  2CHG A;  4JI8 M;  1TDH A;  3SYL A;  4IIW A;  3MHV C;  1L2D A;  2C98 A;  3K92 A;  4QNM A;  4DV7 M;  2Z4R A;  4IBF A;  2KZU A;  2KRK A;  2XLJ A;  4DUZ M;  3ZH9 B;  2KXE A;  2UXC M;  4M9Z A;  4JN6 A;  3SHF A;  1UM8 A;  8CAT A;  4MH0 E;  4NSO B;  1E94 E;  3R9X B;  4ZPX A;  2FOI C;  3GQ3 A;  1Z5A A;  2CV2 A;  3FYC A;  3GLF A;  2UXB M;  3I4V A;  3VK8 A;  2L7I A;  3U6L A;  1NVM A;  4KLN A;  4MGY E;  2UUA M;  3GLI B;  4GC9 A;  3VK7 A;  2V6Z M;  2L7H A;  1DGH B;  4B7F A;  1IY2 A;  4DV0 M;  4LY6 A;  4OVZ A;  2VQE M;  1TGU A;  2G8L A;  4NRV A;  3WHK A;  2ERC A;  4QOZ C;  3RE8 A;  3WHL A;  2QCU A;  4EIW A;  4WUR A;  2XFT A;  2FFJ A;  1QQW A;  1L1Z A;  2H1R A;  4QHT A;  3HHZ A;  1TH2 A;  1FNN A;  1N32 M;  3GLF B;  3RGP A;  5DNY A;  1N34 M;  1IN8 A;  3KDS E;  3SC3 A;  1IN6 A;  2CUZ A;  3FD9 A;  1W5T A;  3SMP A;  3SYK A;  4JYA M;  1C1K A;  4OVZ B;  3LQQ A;  5KO3 A;  4JI2 M;  4LRT A;  4YHH M;  4GHL A;  2CHQ A;  3HU3 A;  5EP3 A;  4DV4 M;  4B7G A;  5GKN A;  3IG8 A;  4AW4 A;  1QAM A;  4JI1 M;  3L29 A;  3GQ4 A;  2FNA A;  1NHW C;  5EJC A;  2BNK A;  2EO2 A;  3FUX A;  3M7G A;  4L4U A;  4LFB M;  2ZAN A;  4LZJ A;  4QOS A;  1G4A E;  2P5T A;  1IXS B;  1QAQ A;  1KYI A;  4IJE A;  4BB9 A;  3U6O A;  3T1Y M;  4LJ9 A;  1H6U A;  1I94 M;  2XH9 A;  3HJQ A;  1QAN A;  1QVR A;  3GPX A;  1X37 A;  4GH9 A;  4AKH A;  1QAO A;  5DYG A;  4DR6 M;  3KOW E;  2NQ8 C;  2DVW B;  5EXS A;  3VDU A;  3LVW A;  2Y21 A;  3HWS A;  2XSZ A;  1PJJ A;  2F5S A;  1DGG A;  4NXM M;  2CEA A;  5EP2 A;  3CF0 A;  1GKI A;  4I81 A;  4LZZ A;  3FUU A;  1EE8 A;  3SAV A;  4DR4 M;  2LH0 A;  1XNQ M;  3PNY A;  5KQ8 A;  2R4J A;  4DR3 M;  1L8Q A;  4M0D A;  2W82 A;  1ORY B;  1VDD A;  7CAT A;  1YUB A;  3A42 A;  4HLQ A;  4L16 A;  5FTL A;  3GQ5 A;  1JR3 A;  3LVV A;  2CV0 A;  3AKZ A;  4IBB A;  2EUC A;  4G4R A;  4RNA A;  2QEN A;  1T3T A;  1J5E M;  1R2Z A;  1KFV A;  3C58 A;  2V1U A;  4X65 M;  3MJ5 A;  1IBM M;  1YSY A;  1K3X A;  4JI3 M;  3EIH A;  1FJG M;  3W0L B;  2R4E A;  4PDG A;  2ZAO A;  3UJN A;  1N33 M;  2F5O A;  5FTJ A;  3SAW A;  3HHY A;  1OFH A;  3PVS A;  4FWH A;  3THG A;  3SAR A;  4K0K M;  2QPA A;  4IJF A;  4DR1 M;  5FTK A;  4AI6 A;  3KS8 A;  2Z4S A;  1ZAE A;  3GRV A;  4IBC A;  5E26 A;  2J7N A;  2A5Y B;  1IN4 A;  3LQR A;  3E4R A;  5ITU A;  3T15 A;  5ITT A;  1IBK M;  2R18 A;  3AFH A;  4GHA A;  3CF6 E;  4LFA M;  5C1B A;  4DV6 M;  3KOX E;  4M0W A;  4OW0 A;  2Z7J A;  4TUW A;  4DV3 M;  1NJG A;  3U6P A;  1DO0 A;  1NSF A;  1DGH A;  3SMS A;  1GVN A;  1Q3C A;  3A45 A;  2XSZ D;  4M9X A;  1G8P A;  2HL7 A;  3OTO M;  3Q8X A;  1E32 A;  4D80 A;  2K47 A;  2KEB A;  4WW0 A;  2BJW A;  5IWA M;  3D8L A;  4NL4 H;  4LJ7 A;  4B3T M;  4FCW A;  3J81 S;  5EQT A;  1JR3 D;  1J09 A;  2R65 A;  4KOD A;  1PM5 A;  4QNR A;  3KOY E;  4QHS A;  3AOE A;  4IBG A;  4YY3 M;  1SXJ E;  3FTD A;  3I4Y A;  3SHG B;  1SXJ A;  2L6O A;  2YNM D;  4IBK A;  3AOG A;  4JI0 M;  1HNZ M;  1XC8 A;  1MU5 A;  3U6S A;  3U5Z A;  3J27 B;  4LF8 M;  4P16 A;  5BR8 M;  2G5G X;  1HT2 E;  4W5W A;  4AQY M;  1Z6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...