4DR1M

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr1M02
1J5EM 4DV2M 3A45A 1L2BA 4GKJM 4JI8M 4DR6M 1Z5AA 3A46A 4OX9M 4G4QA 3C58A 4DUZM 4JI6M 1XNQM 1Q39A 5ITRA 1Q3CA 3U6LA 5ITQA 3U6MA 4LF5M 4DUYM 2F5SA 4B3TM 3GQ4A 1NNJA 5A2QS 4PD2A 3W0FA 1Z5BA 5ITYA 4DV6M 4CISA 2F4VM 4JI1M 1MU5A 1K3WA 3SASA 2Q2EB 2EA0A 3U6CA 5LMUM 4DR5M 4JI3M 4DV1M 2HKJA 4DV0M 4NRVA 3J7AS 3T1HM 4K0KM 2VQEM 4DR7M 2E5LM 3U6PA 3GQ3A 4NXNM 4X62M 3GO8A 4AQYM 3SARA 2F5OA 1K3XA 1EE8A 4JV5M 4LFCM 1PM5A 4GKKM 5BR8M 2ZBKB 4LF8M 4PCZA 4YY3M 2UXBM 1I94M 4G4OA 1N33M 1IBMM 2XZFA 3TWLA 1XMQM 1Q3BA 2ZM6M 3U6EA 1L1TA 4KHPM 4YHHM 2UXCM 1L1ZA 3DOAA 4ITQA 4LF7M 3T1YM 4LFBM 3U6DA 1XC8A 3A42A 3TWKA 2HHHM 4G4RA 4X64M 1FJGM 3J80S 3SAVA 4JI4M 3GQ5A 2OQ4A 3VK8A 1HNWM 3GPXA 4NXMM 3SAWA 1XNRM 1XMOM 4LF9M 2UUCM 4X66M 3GP1A 3VK7A 1MX0A 3JAMS 2UUAM 3U6OA 4JI5M 4PDGA 4DR3M 4LF4M 1N34M 3J81S 4PDIA 5ITTA 1N36M 1L2DA 4JI0M 3U6SA 1N32M 5IT9S 5IWAM 3SAUA 3GPPA 2UU9M 4DV4M 2F5QA 1Z5CA 4DV3M 1TDHA 4DR4M 3TWMA 4DR2M 1K82A 3JR4A 1TDZA 1L2CA 1PJJA 4B3SM 4X65M 4LF6M 5ITUA 4B3RM 5ITXA 4NRWA 4JYAM 1HNXM 2OPFA 1PJIA 4MB7A 1R2ZA 3SATA 4DV5M 1R2YA 4B3MM 1IBLM 4JI7M 5ITXE 2XZUA 2F5PA 2UXDM 1HNZM 5FLXS 2VQFM 5LMNM 1IBKM 4JI2M 3GPUA 4DR1M 2F5NA 4DV7M 3JR5A 3U6QA 2UUBM 1KFVA 3SBJA 1Z59A 1HR0M 4LFAM 3OTOM 4G4NA 3GPYA
chains in the Genus database with same CATH superfamily
4ZPXA 4B08A 1J5EM 4LCBA 3A45A 2KNZA 3UJNA 2I7PA 2R6FA 3LQQA 1OIZA 3I4VA 3V76A 4CGYB 4JI6M 1XNQM 2N35A 3FD9A 1Q3CA 3Q8GA 3HZJA 1G4AE 2QCUA 4NSOB 2XSZD 1QUTA 4QNMA 3HHZA 4RF0A 1Q02A 1XXHA 4GRIA 3E4RA 1TGUA 3HWSA 1G71A 2QENA 3KP1E 1H6UA 4DV6M 3KOYE 5ITYA 3W0FA 2LBCA 3IHPA 1DGHB 4OU7A 1MU5A 3ZCBB 3SASA 3BOSA 4NC6A 3U6CA 3KP0E 1JR3E 4DV1M 2O25A 3AOGA 1QQWA 2KEBA 2JXNA 2ZANA 1MN3A 1NSFA 1UFZA 3FE3A 1QAQA 2QHOB 4I4LA 2B3TA 3SYKA 3GQ3A 2X4AA 2XFTA 4L16A 4REZA 5FTLA 2L2DA 4GC5A 3L2AA 4L15A 4AQYM 1VEJA 2HCBA 1TH2A 1EFUB 1IY1A 1QAMA 1NHGC 1OAOC 3CF0A 3KSJA 4JV5M 3AOEA 2Z4RA 2CV0A 4M0DA 3W0LB 2L09A 4KLNA 4LGMA 3HJ8A 4GITA 2ZTCA 5KPZA 3KXEC 3GLIA 4AI6A 2YQZA 1TF0B 2XZFA 2LHGA 1XMQM 1D0LA 1T3TA 2BJWA 2HWJA 4XBOA 5DFLA 4F2LA 2ZM6M 3I51A 3L25A 1IN6A 3WHLA 4LG2A 1PJSA 4FCWA 3TWKA 3HY5A 4G4RA 2R45A 3QWLA 3J80S 3FUTA 4Z6YA 1CUKA 5EJCA 3HHWA 4B7FA 2OOBA 1GVNA 2BJVA 2DAMA 3U5ZA 2O01F 4LJ7A 4D82A 3SAWA 3E9SA 1XMOM 4UN2B 4RKUF 3KVWA 3NWLA 2M5ZA 1WHCA 1IXZA 2Z4SA 3L29A 8CATA 3VK7A 1DO2A 2EKFA 1OJLA 1WGLA 3UZUA 1ZMVA 4PDGA 4L8RC 3CGWA 3J81S 4P16A 4LJ8A 1XB2B 1L2DA 1DGGA 4MM3B 4JI0M 2XSZA 3SC3A 1N32M 5IT9S 4OVZB 4TUWA 2X8AA 3GLGA 1IY0A 3MJ5A 1Z5CA 2R46A 4DV3M 3CTWB 3SMPA 3SYLA 1GO5A 4MGYE 3PXGA 2D7EA 4QHTA 4B3RM 1GKIA 2G5GX 2DWNA 3J7BA 4OW0A 2OPFA 2J7NA 3VDPA 2H1RA 1R2YA 4B3MM 3FRIA 1IBLM 5L8RF 2DWMA 4LZJA 1AUAA 2KW0A 3L28A 1G3IA 1E9RA 1T43A 4AZFA 2F5PA 2R0IA 4HLQA 2EKKA 1HNZM 1IBKM 3B9PA 4W5WA 4JI2M 3E21A 4R7GA 4DR1M 1R6BX 4QNRA 3TL4X 3U6QA 1OFIA 3PFIA 2FE8A 1J09A 2VF8A 3AV0A 4LFAM 1RU3A 1OKSA 1DGHA 3DZDA 3GRYA 3GPYA 2DVWB 3D8BA 1X37A 2GNOA 1Z5AA 3ILKA 3A46A 1WXQA 3RGPA 5C18A 4G4QA 4DUZM 5FSWA 3FYCA 1EIJA 1IN4A 3VKGA 2KRUA 1E94E 3LVWA 5ITRA 1HT1E 4IBKA 3U6LA 3KOZE 2XEPA 4MGIE 2FH0A 4Y28F 3U6MA 2CWBA 2C9CA 2JZ0A 4FCVA 4NL4H 4Z8XA 1E32A 4DBGB 3L27A 4DUYM 4HEOA 1TH3A 1KSFX 2YR0A 3IG8A 4MH0E 3GQ4A 2GQFA 2Z7JA 5EXTA 4PD2A 4CISA 2F4VM 4S12A 4JI1M 1OFHA 1K3WA 2EA0A 2JY8A 2VF7A 4CIZA 1YE9A 4JI3M 4F1IA 4DV0M 2MJ5B 1MJGM 4FW9A 3LQRA 2R4EA 4KODA 2Z8YM 1C1KA 1DGBA 4LGYA 3T15A 4GIPA 2DAIA 3AOEC 3RGSA 5JI3E 3KOWE 1UM8A 2JNHA 2AHMA 1OIPA 2F5OA 2CHVA 2EJSA 2MGWA 1QUSA 1EE8A 5E26A 1IN5A 2DNAA 1N78A 3C3EA 2D7GA 3VLFB 1PM5A 1SXJD 4R3DA 3T38A 5BR8M 2DWLA 2LWXA 2ZBKB 4LF8M 4PCZA 4G3OA 4YY3M 3QAUA 1SG9A 2KNAA 1IBMM 2WSCF 2XGNA 1Q3BA 5EQTA 3W67A 1VQ1A 3W68A 4FWGA 1L1ZA 3DOAA 3WHKA 2CP8A 2QBYB 3T1YM 1YUBA 2RRUA 3U6DA 3C3DA 4QOZC 1IXSA 1J7KA 2HHHM 2V1UA 1QDRA 1FJGM 3FTFA 2DAEA 4JI4M 2OO9A 1P3QQ 3GQ5A 4B7HA 1HNWM 3GPXA 3U61A 3D8LA 4LJ4A 1XNRM 3GLFE 3GLHA 2LVQD 2UUCM 3BBZA 2LVPC 3GP1A 2KNVA 1MX0A 3IECA 3AJIB 1ZV1A 3JAMS 2LVNC 3U6OA 3TQSA 2QQ8A 1SXJC 1GL7A 4RF1A 5FTNA 4FCTA 3HHYA 5ITTA 1F4IA 1D0KA 3FTDA 3FUVA 2ZAOA 1PJTA 1QVRA 1T6OA 1YLAA 2Y0QA 5EXSA 4DV4M 2F5QA 3IG5A 4IJFA 4IBDA 3GLFB 4FWDA 1WGNA 5E6JA 1PJJA 1E9SA 1FNNA 3U60A 1HNXM 3J2PB 1NO1A 2DZLA 5DYGA 4MB7A 1JR3D 3SATA 5EP3A 5KPTA 1HQCA 3K1JA 4JI7M 1R5LA 1NNUC 5ITXE 3NBIA 1NY6A 3L26A 2L4FA 2QNJA 2O5RA 1NJFA 1XXHE 2UUBM 2C98A 3E46A 2J5YA 4QHSA 1Z59A 1G41A 2DENA 3I4YA 1HR0M 2DZOB 3U6EA 2KZUA 1AIPC 4GEWA 1L1TA 4IIWA 1XWIA 1HJPA 4BLCA 3GRVA 5BPVA 1NHWC 2M60A 2R18A 2KRKA 3HU1A 1W5SA 3I01M 4DV2M 1L2BA 1SXJA 1NJGA 3ZC7B 4JI8M 4GKJM 4GC9A 4OX9M 1PJQA 2CHGA 3PNYA 1OTRA 3K2LA 1XXHB 3J27B 1DO0A 3A98B 5JI2E 1A5TA 1Y8GA 2H5XA 3F92A 3RFWA 5ITQA 1QANA 4XK8F 1VG5A 3UK6A 2JWSA 4LF5M 3DFZA 2F5SA 1G8PA 4B3TM 2LTUA 1Z5BA 2CEAA 1VDLA 5EXXA 5LMUM 5DNYA 1IXRC 3J7AS 3FRHA 3GLIE 4NRVA 3SFZA 4Q7JA 3T1HM 5IZ7D 4K0KM 2MR9A 3THGA 2ERCA 1PRBA 4DR7M 4B7GA 2E5LM 4AW4A 3U6PA 4JN6A 7CATA 4NXNM 2YFQA 4X62M 4AKIA 1WIVA 2QSFX 2C5RA 1K3XA 2V6ZM 1ZQ9A 2W82A 3R8FA 3GLIB 4GHLA 4GKKM 1QAOA 1GLNA 3LW5F 2RKOA 4P17A 1JR3A 1OQYA 3FUUA 3TPZA 3UGJA 2CHQA 3DA1A 2JZ1A 1L8QA 3TE6A 3TWLA 3MHVC 3SMSA 2MROB 2XF3A 4R71A 4YHHM 4ITQA 2P5TA 2NQ8C 4D81A 4LF7M 4I5SA 3U5ZB 4M9XA 3QYEA 3A42A 1XC8A 3PNVA 4RNAA 2EO2A 4M9SA 1GL6A 2D7HA 4L78A 5IREB 5KQ8A 3GLGE 3FKEA 4MGHA 3GLFA 1DV0A 3VK8A 4AKGA 4L4UA 2DAKA 5EXPA 1R4GA 3FYDA 4WP2A 3M7GA 5KPRA 1PGYA 3HJQA 1Z6TA 4X66M 4BBAA 4QOSA 4XGIA 3AKZA 2UUAM 5DYIA 4JI5M 2I7NA 2R62A 2LHCA 3B74A 1DGFA 3H4MA 3GLGB 4I8OA 4PDIA 3CF2A 1N34M 4LF4M 1NVMA 4LRSA 1N36M 4B3SM 3KS8A 2CV1A 3U6SA 2R44A 3HU3A 3Q8XA 5IWAM 3SAUA 2UU9M 4NSRA 1TDHA 1VEGA 2FS1A 2QZ4A 3TWMA 1K82A 4DR4M 1TDZA 1R7RA 1W5TA 2KXEA 1HQYE 2OOAA 1IN8A 2K47A 4OVZA 1HT2E 5ITXA 4M9ZA 4A3VB 1PJIA 3KOXE 4IBJA 4NRWA 1R2ZA 3VKHA 1TTEA 2APLA 4MGKE 3AFHA 1LTMA 4IBBA 3KW6A 2JY6B 1XHBA 3VFDA 3HKPA 3HGIA 4KO8A 2XH9A 3K92A 4M0WA 4LJAA 4PT5A 2HAKA 2V1CA 2KDLA 3SHFA 4CJ6A 5FLXS 5FTJA 3GPUA 2VQFM 4DV7M 3JR5A 2FFJA 2BWEA 4MGZE 2LVOC 1KFVA 1ZAEA 3KDSE 3ZH9B 3ZQJA 5H37D 2JUJA 2C99A 2JA2A 2K0BX 2RGOA 4G4NA 1IFYA 4IBFA 1OAIA 2KA6B 2Y21A 2XLJA 2CV2A 4DR6M 3K9PA 4LRTA 2DAGA 3AL0C 2J7OA 3GRUA 3C58A 2L6OA 2Z3XA 1ORYB 3M6AA 2K6BA 2R4JA 1V92A 4LY6A 3NBXX 1Q39A 5KQDA 2DXIA 3EIHA 2L4EA 3RE8A 4AG5A 4FWHA 1IY2A 1VEKA 4BB9A 4NOOB 1YSYA 4II7A 4LZZA 1NNJA 5A2QS 1IN7A 1KYIA 1NV9A 2WSFF 2DWZB 5F3WA 2Q2EB 5FTMA 3R9XB 4DR5M 1C7YA 2HKJA 2JY7A 2WSEF 2BNKA 4G6ZA 1IQPA 2Y0TA 3VDUA 3LMMA 1V33A 2LXEA 4EIWA 2K9DA 1S3SA 2Y20A 2VDBB 3FUXA 4HL4A 2VQEM 4GHAA 2LNHC 3T6PA 1LV7A 2WZJA 3LCUA 4GMQA 1QYRA 3GO8A 2A5YB 3B7NA 4IBCA 5EP1A 2VIIA 3LCVB 3FTCA 3SARA 3K9OA 3C9PA 1I4WA 2L7HA 2MH8A 3HU2A 3QYBA 2G3QA 4FD2A 4KT0F 4LJ9A 4LFCM 4I81A 2C96A 3GRRA 1JQJC 1QZMA 1VDDA 3GLHE 2CUZA 2DHYA 1QZEA 2CRUA 3LVVA 1TR8A 1WJ7A 4IBEA 4IBIA 3MK6A 4WW0A 5EP4A 2X49A 3SHGB 1I94M 2UXBM 1GABA 4G4OA 1N33M 2KHHA 4WURA 2JY5A 1IXSB 1GJSA 2LH0A 2R65A 3KSXA 3FTEA 3B89A 2YNMD 4KHPM 2UXCM 5EP2A 4D80A 4LFBM 2XFSA 2QP9X 1D2NA 3U61B 2FNAA 5KO3A 4X64M 2CE7A 2DI0A 3HJSA 2FOIC 3GLHB 3H4JA 3B7ZA 3SAVA 1QDTA 2OQ4A 2QBYA 3HHXA 2C9OA 5FTKA 4NXMM 2QPAA 4FVMA 1BVSA 3KFUG 2DKLA 4IJEA 4LF9M 4AKHA 1JB0F 1NV8A 2ZTDA 5C1BA 1TH4A 3CF6E 3KS4A 1WR1B 4ANRA 4DR3M 2CFOA 4LJ6A 2DHRA 3EIEA 2LVAA 3MMPA 1GJTA 4AG6A 4GH9A 3U60B 3GPPA 1N77A 4CHTB 2DZNB 1V34A 2EUCA 4L6V6 3UMMA 4DR2M 3JR4A 1L2CA 4LF6M 2ZAMA 1NY5A 4X65M 4JYAM 4IBGA 5ITUA 1SXJE 4DV5M 2RGHA 3FUWA 3BXWA 3HX3A 2G8LA 3K8ZA 2XZUA 3M0EA 2UXDM 1IM2A 2JP7A 2KZSA 1ZMWA 3I04M 5LMNM 3B7QA 1N75A 2HL7A 2F5NA 1G59A 5GKNA 3SBJA 2L7IA 3PVSA 4JXJA 1SXJB 1D0MA 2BWBA 3OTOM 1ZMUA 4LJ5A
chains in the Genus database with same CATH topology
4ZPXA 4B08A 1J5EM 4LCBA 3A45A 3UJNA 2I7PA 3LQQA 3I4VA 4CGYB 4JI6M 1XNQM 3FD9A 1Q3CA 1G4AE 2QCUA 4NSOB 2XSZD 4QNMA 3HHZA 4RF0A 1XXHA 4GRIA 3E4RA 1TGUA 3HWSA 2QENA 3KP1E 1H6UA 4DV6M 3KOYE 5ITYA 3W0FA 4OU7A 1DGHB 1MU5A 3ZCBB 3SASA 3BOSA 3U6CA 3KP0E 4DV1M 3AOGA 1QQWA 2KEBA 2ZANA 1NSFA 4I4LA 1QAQA 3SYKA 3GQ3A 2X4AA 2XFTA 4L16A 4REZA 4GC5A 3L2AA 4L15A 4AQYM 2HCBA 1TH2A 1IY1A 1QAMA 1NHGC 3KSJA 3CF0A 4JV5M 3AOEA 2Z4RA 2CV0A 4M0DA 3W0LB 2L09A 4KLNA 4LGMA 3HJ8A 4GITA 5KPZA 3KXEC 3GLIA 4AI6A 2YQZA 2XZFA 1XMQM 1T3TA 2BJWA 4XBOA 2ZM6M 3I51A 1IN6A 3WHLA 4LG2A 4FCWA 3TWKA 4G4RA 2R45A 3QWLA 3J80S 3FUTA 4Z6YA 5EJCA 3HHWA 4B7FA 1GVNA 2BJVA 3U5ZA 4LJ7A 4D82A 3SAWA 3E9SA 1XMOM 3KVWA 3NWLA 2M5ZA 3VK7A 1IXZA 2Z4SA 3L29A 8CATA 1DO2A 3UZUA 1OJLA 4PDGA 4L8RC 3J81S 4P16A 1L2DA 1DGGA 4MM3B 4JI0M 2XSZA 3SC3A 1N32M 5IT9S 4OVZB 4TUWA 2X8AA 3GLGA 1IY0A 3MJ5A 1Z5CA 2R46A 4DV3M 3CTWB 3SMPA 3SYLA 4MGYE 3PXGA 2D7EA 4QHTA 4B3RM 1GKIA 2G5GX 2DWNA 3J7BA 4OW0A 2OPFA 2J7NA 3VDPA 2H1RA 1R2YA 4B3MM 1IBLM 2DWMA 4LZJA 2KW0A 3L28A 1G3IA 1E9RA 4AZFA 2F5PA 4HLQA 1HNZM 1IBKM 3B9PA 4W5WA 4JI2M 4R7GA 4DR1M 1R6BX 4QNRA 3TL4X 3U6QA 1OFIA 3PFIA 2FE8A 1J09A 3AV0A 4LFAM 3DZDA 3GRYA 1DGHA 3GPYA 2DVWB 3D8BA 1X37A 1Z5AA 3ILKA 3A46A 1WXQA 3RGPA 5C18A 4G4QA 4DUZM 5FSWA 3FYCA 3VKGA 1IN4A 2KRUA 1E94E 3LVWA 5ITRA 1HT1E 4IBKA 3U6LA 3KOZE 2XEPA 4MGIE 3U6MA 4Z8XA 2C9CA 4NL4H 4FCVA 1G59A 1E32A 3L27A 4DUYM 1TH3A 1KSFX 2YR0A 3IG8A 4MH0E 3GQ4A 2Z7JA 5EXTA 4PD2A 4CISA 2F4VM 4S12A 4JI1M 1OFHA 1K3WA 2EA0A 1YE9A 4JI3M 4DV0M 4FW9A 3LQRA 2R4EA 4KODA 1C1KA 1DGBA 4LGYA 3T15A 4GIPA 3RGSA 3AOEC 5JI3E 3KOWE 1UM8A 2AHMA 2F5OA 2CHVA 5E26A 1EE8A 1IN5A 1N78A 3VLFB 2D7GA 1PM5A 1SXJD 4R3DA 3T38A 5BR8M 2DWLA 2LWXA 2ZBKB 4LF8M 4PCZA 4YY3M 3QAUA 1IBMM 2XGNA 1Q3BA 5EQTA 4FWGA 1L1ZA 3DOAA 3WHKA 2QBYB 3T1YM 1YUBA 3U6DA 4QOZC 1J7KA 2HHHM 2V1UA 1FJGM 3FTFA 4JI4M 3GQ5A 1HNWM 4B7HA 3GPXA 3U61A 3D8LA 4LJ4A 1XNRM 3GLHA 2UUCM 3GP1A 1MX0A 3AJIB 3JAMS 3U6OA 3TQSA 1SXJC 1GL7A 4RF1A 5FTNA 4FCTA 3HHYA 5ITTA 3FTDA 3FUVA 2ZAOA 1QVRA 2Y0QA 5EXSA 4DV4M 2F5QA 3IG5A 4IJFA 4IBDA 3GLFB 4FWDA 5E6JA 1PJJA 1E9SA 1FNNA 3U60A 1HNXM 3J2PB 5DYGA 4MB7A 1JR3D 3SATA 5EP3A 5KPTA 1HQCA 3K1JA 4JI7M 1NNUC 5ITXE 3NBIA 1NY6A 3L26A 2O5RA 1NJFA 2UUBM 2C98A 4QHSA 1Z59A 1G41A 3I4YA 1HR0M 2DZOB 3U6EA 2KZUA 1L1TA 4IIWA 1XWIA 4BLCA 3GRVA 5BPVA 1NHWC 2M60A 2R18A 2KRKA 3HU1A 1W5SA 4DV2M 1L2BA 4JI8M 1SXJA 1NJGA 3ZC7B 4GKJM 4GC9A 4OX9M 2CHGA 3PNYA 3K2LA 1XXHB 3J27B 1DO0A 3A98B 5JI2E 3RFWA 5ITQA 1QANA 3UK6A 4LF5M 3DFZA 2F5SA 1G8PA 4B3TM 1Z5BA 2CEAA 5EXXA 5LMUM 5DNYA 1IXRC 3J7AS 4NRVA 3SFZA 3T1HM 5IZ7D 4K0KM 3THGA 2ERCA 4DR7M 4B7GA 2E5LM 4AW4A 3U6PA 4JN6A 7CATA 4NXNM 2YFQA 4X62M 4AKIA 2C5RA 1K3XA 2V6ZM 1ZQ9A 2W82A 3R8FA 3GLIB 4GHLA 4GKKM 1QAOA 1GLNA 2RKOA 1JR3A 3FUUA 3TPZA 3UGJA 2CHQA 3DA1A 3TE6A 1L8QA 3TWLA 3MHVC 3SMSA 4YHHM 2XF3A 4ITQA 2P5TA 2NQ8C 4D81A 4LF7M 4I5SA 3U5ZB 4M9XA 1XC8A 3A42A 3PNVA 4RNAA 2EO2A 4M9SA 1GL6A 2D7HA 4L78A 5IREB 5KQ8A 3FKEA 4MGHA 3GLFA 3VK8A 4AKGA 4L4UA 5EXPA 3FYDA 3M7GA 5KPRA 3HJQA 1Z6TA 4X66M 4BBAA 4QOSA 4XGIA 3AKZA 2UUAM 5DYIA 4JI5M 2I7NA 2R62A 1DGFA 3H4MA 3GLGB 4I8OA 4PDIA 3CF2A 1N34M 4LF4M 1NVMA 4LRSA 1N36M 3KS8A 2CV1A 3U6SA 3HU3A 3Q8XA 5IWAM 3SAUA 2UU9M 4NSRA 1TDHA 2QZ4A 4DR4M 3TWMA 1K82A 1TDZA 1R7RA 1W5TA 2KXEA 1HQYE 4A3VB 1IN8A 2K47A 4OVZA 1HT2E 5ITXA 4M9ZA 4B3SM 1PJIA 3KOXE 4IBJA 4NRWA 1R2ZA 3VKHA 4MGKE 3AFHA 4IBBA 3KW6A 1XHBA 3VFDA 3HKPA 3HGIA 4KO8A 2XH9A 3K92A 4M0WA 4LJAA 4PT5A 3SHFA 2V1CA 5FLXS 2VQFM 5FTJA 3GPUA 4DV7M 3JR5A 2FFJA 4MGZE 1KFVA 1ZAEA 3KDSE 3ZH9B 5H37D 2C99A 2JA2A 4G4NA 2RGOA 4IBFA 2KA6B 2Y21A 2XLJA 2CV2A 4DR6M 4LRTA 3AL0C 2J7OA 3GRUA 3C58A 2L6OA 2Z3XA 1ORYB 3M6AA 2R4JA 4LY6A 5KQDA 2DXIA 1Q39A 3EIHA 3RE8A 4AG5A 4FWHA 1IY2A 4BB9A 4NOOB 1YSYA 4II7A 4LZZA 1NNJA 5A2QS 1IN7A 1KYIA 5F3WA 2DWZB 2Q2EB 5FTMA 3R9XB 4DR5M 2HKJA 2BNKA 4G6ZA 1IQPA 2Y0TA 3VDUA 3LMMA 2LXEA 4EIWA 1S3SA 2Y20A 4HL4A 3FUXA 2VQEM 4GHAA 2LNHC 1LV7A 4GMQA 1QYRA 3GO8A 2A5YB 4IBCA 5EP1A 2VIIA 3FTCA 3SARA 1I4WA 2L7HA 3HU2A 4FD2A 4LJ9A 4LFCM 4I81A 2C96A 3GRRA 1JQJC 1QZMA 1VDDA 3LVVA 2CUZA 4LJ8A 4WW0A 5FTLA 4IBEA 5EP4A 3L25A 4IBIA 3MK6A 3SHGB 2UXBM 2X49A 1I94M 4G4OA 1N33M 4WURA 1IXSB 2LH0A 2R65A 3KSXA 3FTEA 4KHPM 2YNMD 2UXCM 5EP2A 4D80A 4LFBM 2XFSA 2QP9X 1D2NA 3U61B 2FNAA 5KO3A 4X64M 2CE7A 3HJSA 3SAVA 2FOIC 3GLHB 2OQ4A 2QBYA 3HHXA 2C9OA 5FTKA 4NXMM 2QPAA 4FVMA 3KFUG 4IJEA 4LF9M 4AKHA 5C1BA 1TH4A 3CF6E 3KS4A 4DR3M 2CFOA 4LJ6A 2DHRA 3EIEA 4AG6A 3U60B 4GH9A 3GPPA 1N77A 4CHTB 2DZNB 3UMMA 2EUCA 4DR2M 1L2CA 3JR4A 4LF6M 4JYAM 2ZAMA 1NY5A 4X65M 4IBGA 5ITUA 1SXJE 4DV5M 2RGHA 3FUWA 3K8ZA 2G8LA 2XZUA 3M0EA 2UXDM 1IM2A 2KZSA 5LMNM 1N75A 2HL7A 2F5NA 5GKNA 3SBJA 2L7IA 3PVSA 4JXJA 1SXJB 3OTOM 4LJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E M;  4DV2 M;  3A45 A;  1L2B A;  4GKJ M;  4JI8 M;  4DR6 M;  1Z5A A;  3A46 A;  4OX9 M;  4G4Q A;  3C58 A;  4DUZ M;  4JI6 M;  1XNQ M;  1Q39 A;  5ITR A;  1Q3C A;  3U6L A;  5ITQ A;  3U6M A;  4LF5 M;  4DUY M;  2F5S A;  4B3T M;  3GQ4 A;  1NNJ A;  5A2Q S;  4PD2 A;  3W0F A;  1Z5B A;  5ITY A;  4DV6 M;  4CIS A;  2F4V M;  4JI1 M;  1MU5 A;  1K3W A;  3SAS A;  2Q2E B;  2EA0 A;  3U6C A;  5LMU M;  4DR5 M;  4JI3 M;  4DV1 M;  2HKJ A;  4DV0 M;  4NRV A;  3J7A S;  3T1H M;  4K0K M;  2VQE M;  4DR7 M;  2E5L M;  3U6P A;  3GQ3 A;  4NXN M;  4X62 M;  3GO8 A;  4AQY M;  3SAR A;  2F5O A;  1K3X A;  1EE8 A;  4JV5 M;  4LFC M;  1PM5 A;  4GKK M;  5BR8 M;  2ZBK B;  4LF8 M;  4PCZ A;  4YY3 M;  2UXB M;  1I94 M;  4G4O A;  1N33 M;  1IBM M;  2XZF A;  3TWL A;  1XMQ M;  1Q3B A;  2ZM6 M;  3U6E A;  1L1T A;  4KHP M;  4YHH M;  2UXC M;  1L1Z A;  3DOA A;  4ITQ A;  4LF7 M;  3T1Y M;  4LFB M;  3U6D A;  1XC8 A;  3A42 A;  3TWK A;  2HHH M;  4G4R A;  4X64 M;  1FJG M;  3J80 S;  3SAV A;  4JI4 M;  3GQ5 A;  2OQ4 A;  3VK8 A;  1HNW M;  3GPX A;  4NXM M;  3SAW A;  1XNR M;  1XMO M;  4LF9 M;  2UUC M;  4X66 M;  3GP1 A;  3VK7 A;  1MX0 A;  3JAM S;  2UUA M;  3U6O A;  4JI5 M;  4PDG A;  4DR3 M;  4LF4 M;  1N34 M;  3J81 S;  4PDI A;  5ITT A;  1N36 M;  1L2D A;  4JI0 M;  3U6S A;  1N32 M;  5IT9 S;  5IWA M;  3SAU A;  3GPP A;  2UU9 M;  4DV4 M;  2F5Q A;  1Z5C A;  4DV3 M;  1TDH A;  4DR4 M;  3TWM A;  4DR2 M;  1K82 A;  3JR4 A;  1TDZ A;  1L2C A;  1PJJ A;  4B3S M;  4X65 M;  4LF6 M;  5ITU A;  4B3R M;  5ITX A;  4NRW A;  4JYA M;  1HNX M;  2OPF A;  1PJI A;  4MB7 A;  1R2Z A;  3SAT A;  4DV5 M;  1R2Y A;  4B3M M;  1IBL M;  4JI7 M;  5ITX E;  2XZU A;  2F5P A;  2UXD M;  1HNZ M;  5FLX S;  2VQF M;  5LMN M;  1IBK M;  4JI2 M;  3GPU A;  4DR1 M;  2F5N A;  4DV7 M;  3JR5 A;  3U6Q A;  2UUB M;  1KFV A;  3SBJ A;  1Z59 A;  1HR0 M;  4LFA M;  3OTO M;  4G4N A;  3GPY A; 
#chains in the Genus database with same CATH topology
 4ZPX A;  4B08 A;  1J5E M;  4LCB A;  3A45 A;  2KNZ A;  3UJN A;  2I7P A;  2R6F A;  3LQQ A;  1OIZ A;  3I4V A;  3V76 A;  4CGY B;  4JI6 M;  1XNQ M;  2N35 A;  3FD9 A;  1Q3C A;  3Q8G A;  3HZJ A;  1G4A E;  2QCU A;  4NSO B;  2XSZ D;  1QUT A;  4QNM A;  3HHZ A;  4RF0 A;  1Q02 A;  1XXH A;  4GRI A;  3E4R A;  1TGU A;  3HWS A;  1G71 A;  2QEN A;  3KP1 E;  1H6U A;  4DV6 M;  3KOY E;  5ITY A;  3W0F A;  2LBC A;  3IHP A;  1DGH B;  4OU7 A;  1MU5 A;  3ZCB B;  3SAS A;  3BOS A;  4NC6 A;  3U6C A;  3KP0 E;  1JR3 E;  4DV1 M;  2O25 A;  3AOG A;  1QQW A;  2KEB A;  2JXN A;  2ZAN A;  1MN3 A;  1NSF A;  1UFZ A;  3FE3 A;  1QAQ A;  2QHO B;  4I4L A;  2B3T A;  3SYK A;  3GQ3 A;  2X4A A;  2XFT A;  4L16 A;  4REZ A;  5FTL A;  2L2D A;  4GC5 A;  3L2A A;  4L15 A;  4AQY M;  1VEJ A;  2HCB A;  1TH2 A;  1EFU B;  1IY1 A;  1QAM A;  1NHG C;  1OAO C;  3CF0 A;  3KSJ A;  4JV5 M;  3AOE A;  2Z4R A;  2CV0 A;  4M0D A;  3W0L B;  2L09 A;  4KLN A;  4LGM A;  3HJ8 A;  4GIT A;  2ZTC A;  5KPZ A;  3KXE C;  3GLI A;  4AI6 A;  2YQZ A;  1TF0 B;  2XZF A;  2LHG A;  1XMQ M;  1D0L A;  1T3T A;  2BJW A;  2HWJ A;  4XBO A;  5DFL A;  4F2L A;  2ZM6 M;  3I51 A;  3L25 A;  1IN6 A;  3WHL A;  4LG2 A;  1PJS A;  4FCW A;  3TWK A;  3HY5 A;  4G4R A;  2R45 A;  3QWL A;  3J80 S;  3FUT A;  4Z6Y A;  1CUK A;  5EJC A;  3HHW A;  4B7F A;  2OOB A;  1GVN A;  2BJV A;  2DAM A;  3U5Z A;  2O01 F;  4LJ7 A;  4D82 A;  3SAW A;  3E9S A;  1XMO M;  4UN2 B;  4RKU F;  3KVW A;  3NWL A;  2M5Z A;  1WHC A;  1IXZ A;  2Z4S A;  3L29 A;  8CAT A;  3VK7 A;  1DO2 A;  2EKF A;  1OJL A;  1WGL A;  3UZU A;  1ZMV A;  4PDG A;  4L8R C;  3CGW A;  3J81 S;  4P16 A;  4LJ8 A;  1XB2 B;  1L2D A;  1DGG A;  4MM3 B;  4JI0 M;  2XSZ A;  3SC3 A;  1N32 M;  5IT9 S;  4OVZ B;  4TUW A;  2X8A A;  3GLG A;  1IY0 A;  3MJ5 A;  1Z5C A;  2R46 A;  4DV3 M;  3CTW B;  3SMP A;  3SYL A;  1GO5 A;  4MGY E;  3PXG A;  2D7E A;  4QHT A;  4B3R M;  1GKI A;  2G5G X;  2DWN A;  3J7B A;  4OW0 A;  2OPF A;  2J7N A;  3VDP A;  2H1R A;  1R2Y A;  4B3M M;  3FRI A;  1IBL M;  5L8R F;  2DWM A;  4LZJ A;  1AUA A;  2KW0 A;  3L28 A;  1G3I A;  1E9R A;  1T43 A;  4AZF A;  2F5P A;  2R0I A;  4HLQ A;  2EKK A;  1HNZ M;  1IBK M;  3B9P A;  4W5W A;  4JI2 M;  3E21 A;  4R7G A;  4DR1 M;  1R6B X;  4QNR A;  3TL4 X;  3U6Q A;  1OFI A;  3PFI A;  2FE8 A;  1J09 A;  2VF8 A;  3AV0 A;  4LFA M;  1RU3 A;  1OKS A;  1DGH A;  3DZD A;  3GRY A;  3GPY A;  2DVW B;  3D8B A;  1X37 A;  2GNO A;  1Z5A A;  3ILK A;  3A46 A;  1WXQ A;  3RGP A;  5C18 A;  4G4Q A;  4DUZ M;  5FSW A;  3FYC A;  1EIJ A;  1IN4 A;  3VKG A;  2KRU A;  1E94 E;  3LVW A;  5ITR A;  1HT1 E;  4IBK A;  3U6L A;  3KOZ E;  2XEP A;  4MGI E;  2FH0 A;  4Y28 F;  3U6M A;  2CWB A;  2C9C A;  2JZ0 A;  4FCV A;  4NL4 H;  4Z8X A;  1E32 A;  4DBG B;  3L27 A;  4DUY M;  4HEO A;  1TH3 A;  1KSF X;  2YR0 A;  3IG8 A;  4MH0 E;  3GQ4 A;  2GQF A;  2Z7J A;  5EXT A;  4PD2 A;  4CIS A;  2F4V M;  4S12 A;  4JI1 M;  1OFH A;  1K3W A;  2EA0 A;  2JY8 A;  2VF7 A;  4CIZ A;  1YE9 A;  4JI3 M;  4F1I A;  4DV0 M;  2MJ5 B;  1MJG M;  4FW9 A;  3LQR A;  2R4E A;  4KOD A;  2Z8Y M;  1C1K A;  1DGB A;  4LGY A;  3T15 A;  4GIP A;  2DAI A;  3AOE C;  3RGS A;  5JI3 E;  3KOW E;  1UM8 A;  2JNH A;  2AHM A;  1OIP A;  2F5O A;  2CHV A;  2EJS A;  2MGW A;  1QUS A;  1EE8 A;  5E26 A;  1IN5 A;  2DNA A;  1N78 A;  3C3E A;  2D7G A;  3VLF B;  1PM5 A;  1SXJ D;  4R3D A;  3T38 A;  5BR8 M;  2DWL A;  2LWX A;  2ZBK B;  4LF8 M;  4PCZ A;  4G3O A;  4YY3 M;  3QAU A;  1SG9 A;  2KNA A;  1IBM M;  2WSC F;  2XGN A;  1Q3B A;  5EQT A;  3W67 A;  1VQ1 A;  3W68 A;  4FWG A;  1L1Z A;  3DOA A;  3WHK A;  2CP8 A;  2QBY B;  3T1Y M;  1YUB A;  2RRU A;  3U6D A;  3C3D A;  4QOZ C;  1IXS A;  1J7K A;  2HHH M;  2V1U A;  1QDR A;  1FJG M;  3FTF A;  2DAE A;  4JI4 M;  2OO9 A;  1P3Q Q;  3GQ5 A;  4B7H A;  1HNW M;  3GPX A;  3U61 A;  3D8L A;  4LJ4 A;  1XNR M;  3GLF E;  3GLH A;  2LVQ D;  2UUC M;  3BBZ A;  2LVP C;  3GP1 A;  2KNV A;  1MX0 A;  3IEC A;  3AJI B;  1ZV1 A;  3JAM S;  2LVN C;  3U6O A;  3TQS A;  2QQ8 A;  1SXJ C;  1GL7 A;  4RF1 A;  5FTN A;  4FCT A;  3HHY A;  5ITT A;  1F4I A;  1D0K A;  3FTD A;  3FUV A;  2ZAO A;  1PJT A;  1QVR A;  1T6O A;  1YLA A;  2Y0Q A;  5EXS A;  4DV4 M;  2F5Q A;  3IG5 A;  4IJF A;  4IBD A;  3GLF B;  4FWD A;  1WGN A;  5E6J A;  1PJJ A;  1E9S A;  1FNN A;  3U60 A;  1HNX M;  3J2P B;  1NO1 A;  2DZL A;  5DYG A;  4MB7 A;  1JR3 D;  3SAT A;  5EP3 A;  5KPT A;  1HQC A;  3K1J A;  4JI7 M;  1R5L A;  1NNU C;  5ITX E;  3NBI A;  1NY6 A;  3L26 A;  2L4F A;  2QNJ A;  2O5R A;  1NJF A;  1XXH E;  2UUB M;  2C98 A;  3E46 A;  2J5Y A;  4QHS A;  1Z59 A;  1G41 A;  2DEN A;  3I4Y A;  1HR0 M;  2DZO B;  3U6E A;  2KZU A;  1AIP C;  4GEW A;  1L1T A;  4IIW A;  1XWI A;  1HJP A;  4BLC A;  3GRV A;  5BPV A;  1NHW C;  2M60 A;  2R18 A;  2KRK A;  3HU1 A;  1W5S A;  3I01 M;  4DV2 M;  1L2B A;  1SXJ A;  1NJG A;  3ZC7 B;  4JI8 M;  4GKJ M;  4GC9 A;  4OX9 M;  1PJQ A;  2CHG A;  3PNY A;  1OTR A;  3K2L A;  1XXH B;  3J27 B;  1DO0 A;  3A98 B;  5JI2 E;  1A5T A;  1Y8G A;  2H5X A;  3F92 A;  3RFW A;  5ITQ A;  1QAN A;  4XK8 F;  1VG5 A;  3UK6 A;  2JWS A;  4LF5 M;  3DFZ A;  2F5S A;  1G8P A;  4B3T M;  2LTU A;  1Z5B A;  2CEA A;  1VDL A;  5EXX A;  5LMU M;  5DNY A;  1IXR C;  3J7A S;  3FRH A;  3GLI E;  4NRV A;  3SFZ A;  4Q7J A;  3T1H M;  5IZ7 D;  4K0K M;  2MR9 A;  3THG A;  2ERC A;  1PRB A;  4DR7 M;  4B7G A;  2E5L M;  4AW4 A;  3U6P A;  4JN6 A;  7CAT A;  4NXN M;  2YFQ A;  4X62 M;  4AKI A;  1WIV A;  2QSF X;  2C5R A;  1K3X A;  2V6Z M;  1ZQ9 A;  2W82 A;  3R8F A;  3GLI B;  4GHL A;  4GKK M;  1QAO A;  1GLN A;  3LW5 F;  2RKO A;  4P17 A;  1JR3 A;  1OQY A;  3FUU A;  3TPZ A;  3UGJ A;  2CHQ A;  3DA1 A;  2JZ1 A;  1L8Q A;  3TE6 A;  3TWL A;  3MHV C;  3SMS A;  2MRO B;  2XF3 A;  4R71 A;  4YHH M;  4ITQ A;  2P5T A;  2NQ8 C;  4D81 A;  4LF7 M;  4I5S A;  3U5Z B;  4M9X A;  3QYE A;  3A42 A;  1XC8 A;  3PNV A;  4RNA A;  2EO2 A;  4M9S A;  1GL6 A;  2D7H A;  4L78 A;  5IRE B;  5KQ8 A;  3GLG E;  3FKE A;  4MGH A;  3GLF A;  1DV0 A;  3VK8 A;  4AKG A;  4L4U A;  2DAK A;  5EXP A;  1R4G A;  3FYD A;  4WP2 A;  3M7G A;  5KPR A;  1PGY A;  3HJQ A;  1Z6T A;  4X66 M;  4BBA A;  4QOS A;  4XGI A;  3AKZ A;  2UUA M;  5DYI A;  4JI5 M;  2I7N A;  2R62 A;  2LHC A;  3B74 A;  1DGF A;  3H4M A;  3GLG B;  4I8O A;  4PDI A;  3CF2 A;  1N34 M;  4LF4 M;  1NVM A;  4LRS A;  1N36 M;  4B3S M;  3KS8 A;  2CV1 A;  3U6S A;  2R44 A;  3HU3 A;  3Q8X A;  5IWA M;  3SAU A;  2UU9 M;  4NSR A;  1TDH A;  1VEG A;  2FS1 A;  2QZ4 A;  3TWM A;  1K82 A;  4DR4 M;  1TDZ A;  1R7R A;  1W5T A;  2KXE A;  1HQY E;  2OOA A;  1IN8 A;  2K47 A;  4OVZ A;  1HT2 E;  5ITX A;  4M9Z A;  4A3V B;  1PJI A;  3KOX E;  4IBJ A;  4NRW A;  1R2Z A;  3VKH A;  1TTE A;  2APL A;  4MGK E;  3AFH A;  1LTM A;  4IBB A;  3KW6 A;  2JY6 B;  1XHB A;  3VFD A;  3HKP A;  3HGI A;  4KO8 A;  2XH9 A;  3K92 A;  4M0W A;  4LJA A;  4PT5 A;  2HAK A;  2V1C A;  2KDL A;  3SHF A;  4CJ6 A;  5FLX S;  5FTJ A;  3GPU A;  2VQF M;  4DV7 M;  3JR5 A;  2FFJ A;  2BWE A;  4MGZ E;  2LVO C;  1KFV A;  1ZAE A;  3KDS E;  3ZH9 B;  3ZQJ A;  5H37 D;  2JUJ A;  2C99 A;  2JA2 A;  2K0B X;  2RGO A;  4G4N A;  1IFY A;  4IBF A;  1OAI A;  2KA6 B;  2Y21 A;  2XLJ A;  2CV2 A;  4DR6 M;  3K9P A;  4LRT A;  2DAG A;  3AL0 C;  2J7O A;  3GRU A;  3C58 A;  2L6O A;  2Z3X A;  1ORY B;  3M6A A;  2K6B A;  2R4J A;  1V92 A;  4LY6 A;  3NBX X;  1Q39 A;  5KQD A;  2DXI A;  3EIH A;  2L4E A;  3RE8 A;  4AG5 A;  4FWH A;  1IY2 A;  1VEK A;  4BB9 A;  4NOO B;  1YSY A;  4II7 A;  4LZZ A;  1NNJ A;  5A2Q S;  1IN7 A;  1KYI A;  1NV9 A;  2WSF F;  2DWZ B;  5F3W A;  2Q2E B;  5FTM A;  3R9X B;  4DR5 M;  1C7Y A;  2HKJ A;  2JY7 A;  2WSE F;  2BNK A;  4G6Z A;  1IQP A;  2Y0T A;  3VDU A;  3LMM A;  1V33 A;  2LXE A;  4EIW A;  2K9D A;  1S3S A;  2Y20 A;  2VDB B;  3FUX A;  4HL4 A;  2VQE M;  4GHA A;  2LNH C;  3T6P A;  1LV7 A;  2WZJ A;  3LCU A;  4GMQ A;  1QYR A;  3GO8 A;  2A5Y B;  3B7N A;  4IBC A;  5EP1 A;  2VII A;  3LCV B;  3FTC A;  3SAR A;  3K9O A;  3C9P A;  1I4W A;  2L7H A;  2MH8 A;  3HU2 A;  3QYB A;  2G3Q A;  4FD2 A;  4KT0 F;  4LJ9 A;  4LFC M;  4I81 A;  2C96 A;  3GRR A;  1JQJ C;  1QZM A;  1VDD A;  3GLH E;  2CUZ A;  2DHY A;  1QZE A;  2CRU A;  3LVV A;  1TR8 A;  1WJ7 A;  4IBE A;  4IBI A;  3MK6 A;  4WW0 A;  5EP4 A;  2X49 A;  3SHG B;  1I94 M;  2UXB M;  1GAB A;  4G4O A;  1N33 M;  2KHH A;  4WUR A;  2JY5 A;  1IXS B;  1GJS A;  2LH0 A;  2R65 A;  3KSX A;  3FTE A;  3B89 A;  2YNM D;  4KHP M;  2UXC M;  5EP2 A;  4D80 A;  4LFB M;  2XFS A;  2QP9 X;  1D2N A;  3U61 B;  2FNA A;  5KO3 A;  4X64 M;  2CE7 A;  2DI0 A;  3HJS A;  2FOI C;  3GLH B;  3H4J A;  3B7Z A;  3SAV A;  1QDT A;  2OQ4 A;  2QBY A;  3HHX A;  2C9O A;  5FTK A;  4NXM M;  2QPA A;  4FVM A;  1BVS A;  3KFU G;  2DKL A;  4IJE A;  4LF9 M;  4AKH A;  1JB0 F;  1NV8 A;  2ZTD A;  5C1B A;  1TH4 A;  3CF6 E;  3KS4 A;  1WR1 B;  4ANR A;  4DR3 M;  2CFO A;  4LJ6 A;  2DHR A;  3EIE A;  2LVA A;  3MMP A;  1GJT A;  4AG6 A;  4GH9 A;  3U60 B;  3GPP A;  1N77 A;  4CHT B;  2DZN B;  1V34 A;  2EUC A;  4L6V 6;  3UMM A;  4DR2 M;  3JR4 A;  1L2C A;  4LF6 M;  2ZAM A;  1NY5 A;  4X65 M;  4JYA M;  4IBG A;  5ITU A;  1SXJ E;  4DV5 M;  2RGH A;  3FUW A;  3BXW A;  3HX3 A;  2G8L A;  3K8Z A;  2XZU A;  3M0E A;  2UXD M;  1IM2 A;  2JP7 A;  2KZS A;  1ZMW A;  3I04 M;  5LMN M;  3B7Q A;  1N75 A;  2HL7 A;  2F5N A;  1G59 A;  5GKN A;  3SBJ A;  2L7I A;  3PVS A;  4JXJ A;  1SXJ B;  1D0M A;  2BWB A;  3OTO M;  1ZMU A;  4LJ5 A; 
#chains in the Genus database with same CATH homology
 4ZPX A;  4B08 A;  1J5E M;  4LCB A;  3A45 A;  3UJN A;  2I7P A;  3LQQ A;  3I4V A;  4CGY B;  4JI6 M;  1XNQ M;  3FD9 A;  1Q3C A;  1G4A E;  2QCU A;  4NSO B;  2XSZ D;  4QNM A;  3HHZ A;  4RF0 A;  1XXH A;  4GRI A;  3E4R A;  1TGU A;  3HWS A;  2QEN A;  3KP1 E;  1H6U A;  4DV6 M;  3KOY E;  5ITY A;  3W0F A;  4OU7 A;  1DGH B;  1MU5 A;  3ZCB B;  3SAS A;  3BOS A;  3U6C A;  3KP0 E;  4DV1 M;  3AOG A;  1QQW A;  2KEB A;  2ZAN A;  1NSF A;  4I4L A;  1QAQ A;  3SYK A;  3GQ3 A;  2X4A A;  2XFT A;  4L16 A;  4REZ A;  4GC5 A;  3L2A A;  4L15 A;  4AQY M;  2HCB A;  1TH2 A;  1IY1 A;  1QAM A;  1NHG C;  3KSJ A;  3CF0 A;  4JV5 M;  3AOE A;  2Z4R A;  2CV0 A;  4M0D A;  3W0L B;  2L09 A;  4KLN A;  4LGM A;  3HJ8 A;  4GIT A;  5KPZ A;  3KXE C;  3GLI A;  4AI6 A;  2YQZ A;  2XZF A;  1XMQ M;  1T3T A;  2BJW A;  4XBO A;  2ZM6 M;  3I51 A;  1IN6 A;  3WHL A;  4LG2 A;  4FCW A;  3TWK A;  4G4R A;  2R45 A;  3QWL A;  3J80 S;  3FUT A;  4Z6Y A;  5EJC A;  3HHW A;  4B7F A;  1GVN A;  2BJV A;  3U5Z A;  4LJ7 A;  4D82 A;  3SAW A;  3E9S A;  1XMO M;  3KVW A;  3NWL A;  2M5Z A;  3VK7 A;  1IXZ A;  2Z4S A;  3L29 A;  8CAT A;  1DO2 A;  3UZU A;  1OJL A;  4PDG A;  4L8R C;  3J81 S;  4P16 A;  1L2D A;  1DGG A;  4MM3 B;  4JI0 M;  2XSZ A;  3SC3 A;  1N32 M;  5IT9 S;  4OVZ B;  4TUW A;  2X8A A;  3GLG A;  1IY0 A;  3MJ5 A;  1Z5C A;  2R46 A;  4DV3 M;  3CTW B;  3SMP A;  3SYL A;  4MGY E;  3PXG A;  2D7E A;  4QHT A;  4B3R M;  1GKI A;  2G5G X;  2DWN A;  3J7B A;  4OW0 A;  2OPF A;  2J7N A;  3VDP A;  2H1R A;  1R2Y A;  4B3M M;  1IBL M;  2DWM A;  4LZJ A;  2KW0 A;  3L28 A;  1G3I A;  1E9R A;  4AZF A;  2F5P A;  4HLQ A;  1HNZ M;  1IBK M;  3B9P A;  4W5W A;  4JI2 M;  4R7G A;  4DR1 M;  1R6B X;  4QNR A;  3TL4 X;  3U6Q A;  1OFI A;  3PFI A;  2FE8 A;  1J09 A;  3AV0 A;  4LFA M;  3DZD A;  3GRY A;  1DGH A;  3GPY A;  2DVW B;  3D8B A;  1X37 A;  1Z5A A;  3ILK A;  3A46 A;  1WXQ A;  3RGP A;  5C18 A;  4G4Q A;  4DUZ M;  5FSW A;  3FYC A;  3VKG A;  1IN4 A;  2KRU A;  1E94 E;  3LVW A;  5ITR A;  1HT1 E;  4IBK A;  3U6L A;  3KOZ E;  2XEP A;  4MGI E;  3U6M A;  4Z8X A;  2C9C A;  4NL4 H;  4FCV A;  1G59 A;  1E32 A;  3L27 A;  4DUY M;  1TH3 A;  1KSF X;  2YR0 A;  3IG8 A;  4MH0 E;  3GQ4 A;  2Z7J A;  5EXT A;  4PD2 A;  4CIS A;  2F4V M;  4S12 A;  4JI1 M;  1OFH A;  1K3W A;  2EA0 A;  1YE9 A;  4JI3 M;  4DV0 M;  4FW9 A;  3LQR A;  2R4E A;  4KOD A;  1C1K A;  1DGB A;  4LGY A;  3T15 A;  4GIP A;  3RGS A;  3AOE C;  5JI3 E;  3KOW E;  1UM8 A;  2AHM A;  2F5O A;  2CHV A;  5E26 A;  1EE8 A;  1IN5 A;  1N78 A;  3VLF B;  2D7G A;  1PM5 A;  1SXJ D;  4R3D A;  3T38 A;  5BR8 M;  2DWL A;  2LWX A;  2ZBK B;  4LF8 M;  4PCZ A;  4YY3 M;  3QAU A;  1IBM M;  2XGN A;  1Q3B A;  5EQT A;  4FWG A;  1L1Z A;  3DOA A;  3WHK A;  2QBY B;  3T1Y M;  1YUB A;  3U6D A;  4QOZ C;  1J7K A;  2HHH M;  2V1U A;  1FJG M;  3FTF A;  4JI4 M;  3GQ5 A;  1HNW M;  4B7H A;  3GPX A;  3U61 A;  3D8L A;  4LJ4 A;  1XNR M;  3GLH A;  2UUC M;  3GP1 A;  1MX0 A;  3AJI B;  3JAM S;  3U6O A;  3TQS A;  1SXJ C;  1GL7 A;  4RF1 A;  5FTN A;  4FCT A;  3HHY A;  5ITT A;  3FTD A;  3FUV A;  2ZAO A;  1QVR A;  2Y0Q A;  5EXS A;  4DV4 M;  2F5Q A;  3IG5 A;  4IJF A;  4IBD A;  3GLF B;  4FWD A;  5E6J A;  1PJJ A;  1E9S A;  1FNN A;  3U60 A;  1HNX M;  3J2P B;  5DYG A;  4MB7 A;  1JR3 D;  3SAT A;  5EP3 A;  5KPT A;  1HQC A;  3K1J A;  4JI7 M;  1NNU C;  5ITX E;  3NBI A;  1NY6 A;  3L26 A;  2O5R A;  1NJF A;  2UUB M;  2C98 A;  4QHS A;  1Z59 A;  1G41 A;  3I4Y A;  1HR0 M;  2DZO B;  3U6E A;  2KZU A;  1L1T A;  4IIW A;  1XWI A;  4BLC A;  3GRV A;  5BPV A;  1NHW C;  2M60 A;  2R18 A;  2KRK A;  3HU1 A;  1W5S A;  4DV2 M;  1L2B A;  4JI8 M;  1SXJ A;  1NJG A;  3ZC7 B;  4GKJ M;  4GC9 A;  4OX9 M;  2CHG A;  3PNY A;  3K2L A;  1XXH B;  3J27 B;  1DO0 A;  3A98 B;  5JI2 E;  3RFW A;  5ITQ A;  1QAN A;  3UK6 A;  4LF5 M;  3DFZ A;  2F5S A;  1G8P A;  4B3T M;  1Z5B A;  2CEA A;  5EXX A;  5LMU M;  5DNY A;  1IXR C;  3J7A S;  4NRV A;  3SFZ A;  3T1H M;  5IZ7 D;  4K0K M;  3THG A;  2ERC A;  4DR7 M;  4B7G A;  2E5L M;  4AW4 A;  3U6P A;  4JN6 A;  7CAT A;  4NXN M;  2YFQ A;  4X62 M;  4AKI A;  2C5R A;  1K3X A;  2V6Z M;  1ZQ9 A;  2W82 A;  3R8F A;  3GLI B;  4GHL A;  4GKK M;  1QAO A;  1GLN A;  2RKO A;  1JR3 A;  3FUU A;  3TPZ A;  3UGJ A;  2CHQ A;  3DA1 A;  3TE6 A;  1L8Q A;  3TWL A;  3MHV C;  3SMS A;  4YHH M;  2XF3 A;  4ITQ A;  2P5T A;  2NQ8 C;  4D81 A;  4LF7 M;  4I5S A;  3U5Z B;  4M9X A;  1XC8 A;  3A42 A;  3PNV A;  4RNA A;  2EO2 A;  4M9S A;  1GL6 A;  2D7H A;  4L78 A;  5IRE B;  5KQ8 A;  3FKE A;  4MGH A;  3GLF A;  3VK8 A;  4AKG A;  4L4U A;  5EXP A;  3FYD A;  3M7G A;  5KPR A;  3HJQ A;  1Z6T A;  4X66 M;  4BBA A;  4QOS A;  4XGI A;  3AKZ A;  2UUA M;  5DYI A;  4JI5 M;  2I7N A;  2R62 A;  1DGF A;  3H4M A;  3GLG B;  4I8O A;  4PDI A;  3CF2 A;  1N34 M;  4LF4 M;  1NVM A;  4LRS A;  1N36 M;  3KS8 A;  2CV1 A;  3U6S A;  3HU3 A;  3Q8X A;  5IWA M;  3SAU A;  2UU9 M;  4NSR A;  1TDH A;  2QZ4 A;  4DR4 M;  3TWM A;  1K82 A;  1TDZ A;  1R7R A;  1W5T A;  2KXE A;  1HQY E;  4A3V B;  1IN8 A;  2K47 A;  4OVZ A;  1HT2 E;  5ITX A;  4M9Z A;  4B3S M;  1PJI A;  3KOX E;  4IBJ A;  4NRW A;  1R2Z A;  3VKH A;  4MGK E;  3AFH A;  4IBB A;  3KW6 A;  1XHB A;  3VFD A;  3HKP A;  3HGI A;  4KO8 A;  2XH9 A;  3K92 A;  4M0W A;  4LJA A;  4PT5 A;  3SHF A;  2V1C A;  5FLX S;  2VQF M;  5FTJ A;  3GPU A;  4DV7 M;  3JR5 A;  2FFJ A;  4MGZ E;  1KFV A;  1ZAE A;  3KDS E;  3ZH9 B;  5H37 D;  2C99 A;  2JA2 A;  4G4N A;  2RGO A;  4IBF A;  2KA6 B;  2Y21 A;  2XLJ A;  2CV2 A;  4DR6 M;  4LRT A;  3AL0 C;  2J7O A;  3GRU A;  3C58 A;  2L6O A;  2Z3X A;  1ORY B;  3M6A A;  2R4J A;  4LY6 A;  5KQD A;  2DXI A;  1Q39 A;  3EIH A;  3RE8 A;  4AG5 A;  4FWH A;  1IY2 A;  4BB9 A;  4NOO B;  1YSY A;  4II7 A;  4LZZ A;  1NNJ A;  5A2Q S;  1IN7 A;  1KYI A;  5F3W A;  2DWZ B;  2Q2E B;  5FTM A;  3R9X B;  4DR5 M;  2HKJ A;  2BNK A;  4G6Z A;  1IQP A;  2Y0T A;  3VDU A;  3LMM A;  2LXE A;  4EIW A;  1S3S A;  2Y20 A;  4HL4 A;  3FUX A;  2VQE M;  4GHA A;  2LNH C;  1LV7 A;  4GMQ A;  1QYR A;  3GO8 A;  2A5Y B;  4IBC A;  5EP1 A;  2VII A;  3FTC A;  3SAR A;  1I4W A;  2L7H A;  3HU2 A;  4FD2 A;  4LJ9 A;  4LFC M;  4I81 A;  2C96 A;  3GRR A;  1JQJ C;  1QZM A;  1VDD A;  3LVV A;  2CUZ A;  4LJ8 A;  4WW0 A;  5FTL A;  4IBE A;  5EP4 A;  3L25 A;  4IBI A;  3MK6 A;  3SHG B;  2UXB M;  2X49 A;  1I94 M;  4G4O A;  1N33 M;  4WUR A;  1IXS B;  2LH0 A;  2R65 A;  3KSX A;  3FTE A;  4KHP M;  2YNM D;  2UXC M;  5EP2 A;  4D80 A;  4LFB M;  2XFS A;  2QP9 X;  1D2N A;  3U61 B;  2FNA A;  5KO3 A;  4X64 M;  2CE7 A;  3HJS A;  3SAV A;  2FOI C;  3GLH B;  2OQ4 A;  2QBY A;  3HHX A;  2C9O A;  5FTK A;  4NXM M;  2QPA A;  4FVM A;  3KFU G;  4IJE A;  4LF9 M;  4AKH A;  5C1B A;  1TH4 A;  3CF6 E;  3KS4 A;  4DR3 M;  2CFO A;  4LJ6 A;  2DHR A;  3EIE A;  4AG6 A;  3U60 B;  4GH9 A;  3GPP A;  1N77 A;  4CHT B;  2DZN B;  3UMM A;  2EUC A;  4DR2 M;  1L2C A;  3JR4 A;  4LF6 M;  4JYA M;  2ZAM A;  1NY5 A;  4X65 M;  4IBG A;  5ITU A;  1SXJ E;  4DV5 M;  2RGH A;  3FUW A;  3K8Z A;  2G8L A;  2XZU A;  3M0E A;  2UXD M;  1IM2 A;  2KZS A;  5LMN M;  1N75 A;  2HL7 A;  2F5N A;  5GKN A;  3SBJ A;  2L7I A;  3PVS A;  4JXJ A;  1SXJ B;  3OTO M;  4LJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...