4DR1Q

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr1Q00
2Z0SA 4LF8Q 2F52A 4DR2Q 4A4IA 2UUAL 5LMUL 1M1KC 4GKJL 5GADC 4IPCA 4DV4L 2NN6G 4DKAC 1IBMQ 2ID0A 5LMNL 3HOYG 3W1BA 2YYZA 1W2BA 1M90C 4X66Q 2KHIA 5IP9G 3PV0A 2HIVA 4OONA 4YHHQ 2K5VA 1IBKL 4AQYL 2VUMG 5LMNW 1YIJA 4X66L 1YHAA 3SGIA 3GTMH 2EIFA 3OW2A 2JA7G 3J81j 4GN4B 4LFAL 1J5EL 2PQAA 3H3VH 1N33L 1VQGA 4GKKL 2ZTEA 4O2DA 5FLXc 3GTKH 4JI2Q 2D0OA 4DV2L 2JEAI 3NEMA 3CAMA 4BA1I 3F2BA 2Z6KC 4DR5L 1K83H 4GS3A 2E5LL 3TS2A 4A3BH 1N8RC 4WJ4A 1JT8A 1E1TA 1KAWA 3STBC 2K5HA 1XPUA 1U5KA 1VQAA 1RIPA 2OTLA 4B3SL 4LF9Q 3GD7A 1FJGL 4JI6Q 2ASBA 4HIDA 4YY3L 1CSQA 4A3LG 1K9MC 4C3IH 3OTOQ 1QVFA 2HHHL 4JI4L 2I5MX 2Q2IA 5FJ8H 2YV5A 2YU9H 3ERSX 4DUZL 1KC8C 1QUQB 4NXNL 4LUVA 4DV1Q 5JJKA 2UXDL 3ULLA 3F8TA 2UXCL 1SROA 3K8AA 3J81c 1E3PA 3PUZA 4X6AH 4AIMA 2Y0SG 1XNRL 4AYBE 3CCUA 3PUWA 1I94Q 4DV6Q 4JYAL 2PNHA 3S1NH 5HGQA 2Q2UA 4DK6C 3J80c 4B3TQ 1KXLA 2WB1G 2K5NA 3CC4A 1VQOA 1LTLA 1QUQA 4L5TA 4LF5L 4A3KH 2VQEL 4LF6L 1N36Q 1PA6A 1IBLL 2JA6H 2NZHA 4HJ7A 4J15A 4DR3Q 1VQ7A 4LF4Q 3H3VI 5IWAQ 1PH7A 3D0FA 4GNXA 2DGYA 5IE8A 4DPGA 1WFQA 5BR8Q 2BH2A 3KF6A 3E0EA 3OYYA 3FHWA 4IO9A 4X62Q 4Y7NH 1HNWL 2MFIA 4X64L 1Z47A 3K7AH 1Q81C 1VQKA 2JK8A 3Q8DA 1VS0A 2R93G 4DV1L 1SFOH 2YTVA 4JBWA 2KBNA 4NXNQ 2IX1A 1GO3E 4X62L 1KRSA 3K0XA 3RZOH 2PQAB 4XIGS 2LXJA 1TWCH 1VCIA 3RNUA 3VDYA 1TWFH 2YTXA 4LF7Q 4JI1Q 1MJCA 3AEVA 1UE7A 3CMEA 2RCNA 4WJ3M 4BY7G 4OWTB 2WFWA 2E2JH 4A3FH 3J80i 3DLLA 3A74A 1PH4A 1Y1VH 2K50A 1L1OA 1N36L 4P73A 1E1OA 3M3YH 2A1AA 4JI2L 1HH2P 3GTPH 4A93H 4KLKA 1JB7A 2KHJA 3A5UA 1UE1A 2A19A 2MO1A 1PH1A 4DV6L 1D7QA 2N8NA 1YJWA 4GLAC 3D31A 4GLVB 2PMZE 1ASZA 1S40A 3J7ZC 2Y0SE 1N9WA 1HNWQ 4TQUS 1SN8A 4YHHL 1EWIA 3G6EA 2UXDQ 2I5LX 2KCMA 4GNXB 5JJIA 5C3EH 1EOVA 3CCLA 3LGJA 2WB1E 1YNXA 5IP7G 1K8GA 1U0LA 2LXKA 3HOZH 1V9PA 2UXBL 4GKJQ 1Y1VG 3AFPA 4QJFA 3KJOA 4DR3L 1Y14B 4IFDG 1B70B 2ZM6Q 3U50C 1IBLQ 4JI6L 4POFA 3KF6B 5FJ8G 5H1SE 3HKSA 2E8GA 1Q46A 2CWPA 3PIPA 1A0IA 2E2IH 4BY7H 4B3TL 1HZAA 3S16H 4IJHA 2C35B 3HOXG 1P8LA 1FVIA 2ATWA 1OXVA 4DR6Q 5ELOA 4YWMA 1PH5A 2IX0A 1N33Q 5GAHC 1X54A 4R4OA 3ULJA 2VUMH 2JE6I 2UXCQ 4JI8Q 1JJCB 3K80C 2OCEA 4H02A 5IP9H 2K75A 1IBKQ 4L5QA 4A3JH 1HZBA 2PI2E 3BJUA 3CPWA 5M3FG 4DUYL 4BXXG 1GVPA 4A3GH 1BBWA 3TREA 4KHPQ 3JAMc 1JE5A 2CWAA 3UDIA 1MIUA 2JA6G 4DV3L 4DV5L 3CMAA 2UUAQ 1KHIA 3HOUH 1Q8KA 5C44H 2HIXA 2XGTA 1YBYA 1E24A 4MNOA 3PIOA 4TVAB 3FKIH 3S2DH 1G6PA 3I4MG 1QVCA 2KENA 2IT1A 5IYDG 1D8LA 2QGQA 5JEAG 1XNQQ 3HOVH 1TWHH 1OXXK 4JBMA 4HJ5A 1JMCA 2VNUD 4R4QA 3I2ZA 3HOVG 1EUJA 3H0GG 3S1MH 5FLMH 4GKKQ 5M5XH 1MKHA 3NENA 1EIFA 4GOPC 1GD7A 2MO0A 3HOUG 4QQBX 2AHOB 2FXQA 1X6OA 2N49A 3CP0A 2EQSA 4LFCL 5IY0A 3JC66 2AWOA 1EQRA 5C4XG 4DR4Q 5M5YH 2AMCB 2UUCL 1VQPA 1VQHA 4A3DH 2IHFA 2VY3A 3L2PA 4HJ9A 1JJGA 4OWWB 1LYLA 4IOCA 2R7ZH 4DR6L 1KRTA 1TWGH 2R92H 3RLNA 5IYDH 4NXML 2KCTA 2AKWB 3E9IA 1WYDA 4HJAA 1XJVA 2Z6KA 2UUBL 4HIMA 2CCZA 5C44G 4LW1A 5IYCG 3GO5A 1XMOQ 3M4OH 5IT9c 1JJ2A 5GAGC 4DR1L 5FLMG 4LF5Q 1A62A 4A3IH 2DUDA 3T1YQ 1XMQQ 1GKHA 4B3ML 1VQNA 1VQ4A 4DAMA 5HY6A 4POGA 1EYGA 4LUZA 3S15H 3ULPA 1EFWA 3STBD 4BY1G 1IYJB 1NJIC 4NPSA 5C0XJ 1N34L 2Q2TA 2YTYA 3CC7A 4GOPB 2OQ0A 1PH9A 3RLFA 4L5SA 3CQZH 2UUCQ 2NVTH 1N34Q 4L5RC 4UP8A 4DR4L 5AJ3L 3UE0A 2QEXA 2OTJA 2B29A 4LNQA 1MJEA 2R93H 1UE5A 1NY4A 3GDEA 3IRBA 4DAYB 3T1YL 4B3MQ 1VQDA 5E7NA 5IYCH 1OTCA 4OX9L 4ME3A 1PYBA 3PO3G 3ICEA 4JI7L 1I6HH 1NBWA 1T9HA 4JOIC 4X65L 4DV7Q 3GTOH 3HOWG 4K0KQ 3A5ZB 1OXUA 1L2FA 1V1QA 2GVBA 1WI5A 3EIVA 4DV7L 4A3FG 1RL2A 2B63H 4DR7L 3PUVA 1XNQL 1PH6A 3RLOA 4DV2Q 2WP8J 3I4NH 2D0PA 1HZ9A 1NE3A 3UDGA 2Q2HA 4BBRH 1EQQA 1PH8A 4A3EH 1G51A 1YHBA 3S24A 5M5WH 1CUKA 2ES2A 3HOZG 3W5OA 1A8VA 3I4MH 1CSPA 3KLWA 3F1ZA 4DUYQ 4YWLA 5C0XI 1BBUA 1YEZA 5J3BA 4A3MG 2N78A 3CCEA 3BZKA 5IWAL 1WJJA 4A3EG 3UDXA 4PZ8A 4RMFA 4JI8L 3TEHB 3F2CA 2JA5G 2JA8G 3PCOB 1IBML 4IFDI 1AH9A 3KDFA 5ELNA 4DV4Q 4JI0Q 4R4IA 4R4TA 1L1OC 2IHEA 4A3CG 3PF5A 2CKZB 4LF8L 1CKOA 3FP9A 3M4QA 5GQOA 3HKZE 5GROA 1Y1WG 2JA9A 2A8VA 4JV5L 4KHZA 1C9OA 4EX5A 3L0OA 2R7FA 4GOPA 5EAYA 1XNRQ 3G48A 2JA7H 4IOAA 1VQ8A 3I4OA 3CF5A 2JEBI 3S14H 1I5FA 3BU2A 2ALYB 4HJ8A 4KHPL 1K73C 2UXBQ 2ZJQA 3MXNB 3S1RH 1C0AA 2VQFQ 3CCQA 1HNXQ 3TRZA 3G71A 4DV0Q 2ZTDA 2CFMA 4MZ9A 2VQFL 4PG3A 3CXCA 1HNXL 4YCVA 4BBRG 4JI5Q 1IL2A 4BXXH 3CCVA 4NB3A 1S3OA 1L0WA 3T1HL 1R9TH 2K4KA 2RHQB 5C0XG 3K7UC 3GTLH 4JI3Q 1N32L 1A63A 2NVXH 3L7ZC 1VQJA 4C3HH 4B3RL 1PFSA 2UU9L 1QZGA 3UDFA 2E5LQ 1S72A 1O7IA 1KIXA 1Q82C 1K3RA 1VQ5A 2NVQH 4BA2I 1SLJA 5M3MH 5GAEC 1PVOA 1K0RA 5IP7H 3RN2A 3FKIG 1AE3A 2I5HA 2UU9Q 3S17H 3U4ZA 4JI0L 1J5EQ 1YHQA 1L1OB 4OO1G 3ZJYC 3GTJH 1CKNB 3J7A5 1PYSB 5C4JH 4UP7A 4DV3Q 2NN6I 2WAQG 4JBJA 3CCSA 3KJPA 4JC0A 3T1HQ 4JI1L 4UY8C 3PSIA 3TQYA 3S1QH 3AQQA 3GTGH 2BA1A 4FDBA 4DV0L 1VQFA 2H5XA 4P72A 3I56A 4C3JH 1AE2A 2R7DA 3KOJA 3W1GA 1P16A 4LFBL 2ZTCA 3ER0A 4X64Q 4EQ5A 3PF4A 2K52A 4IPHA 1K8AC 2EXDA 2HQLA 3RR5A 2ZJRA 3GTQH 4OXPA 1VQCA 2VL6A 4HIOA 4QY7A 3F2DA 3S2HH 1VQ9A 4DNIA 1BKBA 1LUZA 1V43A 4JV5Q 4JOIA 1OXSC 1Z9FA 2VZAA 1NMGA 3UE1A 4O0AA 1GM5A 1ASYA 1E7ZA 4X65Q 4K0KL 3PUYA 1CKNA 3JAMi 2ZJPA 4JG2A 1WCMH 2XTIA 4GN5A 4OWXB 1QVGA 1BVSA 4GN3B 1HR0W 4JI7Q 2OQKA 4A3LH 3I7FA 1H95A 4Y52H 4A3BG 1PHJA 4OX9Q 4JI3L 2ZM6L 1N32Q 5DLQE 1YVCA 4OO1I 4YCWA 4HIKA 4LF7L 4DK3C 2F4VQ 2BA0A 3U4VA 1Y1WH 1B8AA 3AYHB 1UE6A 1I94L 1UWVA 2VS1A 4A3CH 2GVAA 1VQEA 3RN5A 3CD6A 1B7YB 1PH3A 3AFQA 2N3SA 2QA4A 2MQHA 5IYBG 4BY1H 4A3JG 1I3QH 1TWAH 4QIWE 5BR8L 1HNZQ 2AWNA 3CW2C 1VQBA 2E2HH 1CKMA 4LWCA 4UP9A 1W3SA 3NELA 4DR1Q 4LF4L 4DR7Q 1PV4A 1E22A 4YCUA 4A75A 3HOWH 3HOYH 5K36G 3I55A 1HR0Q 1WCMG 1I50H 1VQLA 4KI0A 3KDFB 2VQEQ 1FJGQ 4P74A 3HFZB 4B3SQ 3I4NG 4LF9L 4XTCS 1X56A 3DM3A 2I0QA 3PGZA 3M9BA 2WAQE 2B3GA 1XPOA 1SRUA 2MNAA 2VW9A 4DR5Q 1XPRA 2B63G 1Q1BA 4C2MH 1VQMA 4R4CA 4YWKA 1IZ6A 2R6GA 4P71A 2BH8A 3E9HA 1EIYB 4GLXA 2HT1A 1VQIA 2R7ZG 4GNXC 5AJ3Q 1X65A 1Q7YC 4A3MH 1SMXA 4LFAQ 5M3FH 3PO2G 4A3GG 1NTGA 4LFBQ 1X3EA 1HJPA 1YI2A 2JQOA 1YITA 2JA5H 4PZ7A 4BBSH 2JJQA 1J6QA 1HZCA 3WWVA 3U58A 3CCJA 1XTDA 1NMFA 3CCRA 1QZHA 1SE8A 1KQSA 3BZCA 3KF8B 4PZ6A 3M4PA 1YJ9A 1XMQL 3OTOL 2RF4A 4ALPA 1DGSA 2RHSB 4AH6A 5JJLA 3A0JA 1X3GA 3HOXH 4JBKA 3NBHB 4DR2L 1X55A 4A93G 3PUXA 1C7YA 1HR0L 3H0GH 1KL9A 2JA8H 2D62A 3CC2A 4IJLA 4MTNA 1PH2A 2V1CC 1XMOL 4LF6Q 4JCVE 3H15A 3CPFA 2UUBQ 2GN5A 3KFUA 1KD1C 1HNZL 1Q12A 4QL5A 4DV5Q 4NXMQ 1LM0A 3EN2A 3PO2H 4JYAQ 4B3RQ 1FL0A 4UPAA 4RG1A 3CCMA 4A3IG 5C4XH 5C3EG 2IY5B 1OXTA 4AQYQ 3M7NA 3KYHC 2LSSA 4BBSG 2F3IA 4IFDJ 3EBEA 1WOCA 1YJNA 4JI5L 1Q86C 2F4VL 1X9NA 4DUZQ 2NZOA 1TXYA 5LMNQ 2OWOA 4A3KG 4LFCQ 1Q1EA 1SR3A 1X3FA 1YZ6A 2R92G 3TS0A 4IPDA 3K81C 3J81i 3B6YA 1IXRA 2HHHQ 3HKZG 4PMWA 2NVYH 5LMUQ 4JI4Q 2L15A 5M3MG 4A76A 1FGUA 1G291 1UEBA 3RZDH 4YY3Q 1VQ6A 2CQOA 2PI2A 4R1JA 4P75A 4LUOA 4AYBG 3M85A 2K14A 4A3DG 4QGUA 3MEFA 3PO3H 5JEAJ 4IPGA 4APVA 3G4SA 5IYBH
chains in the Genus database with same CATH superfamily
2Z0SA 4LF8Q 1BNZA 1J8IA 2IJ0A 1BQQT 3EROA 5ELDA 4GKJL 1VDZA 4IPCA 5BN4A 4DKAC 1PZID 1WTHA 3HOYG 1KDBA 2R7ZB 3PV0A 1SE3A 1IBKL 1VF5C 4J1MA 2VUMG 1ESRA 4N9TA 3GTMH 2L5TA 4LFAL 2RKSA 1VF7A 3QO2A 3H3VH 1N33L 3WOEA 2ZTEA 1RD9D 4JI2Q 4DV2L 4KY6A 2RA4A 3T56B 3K5OA 3TS2A 4CBVA 2E5LL 4A3BH 4WJ4A 2R61A 1E1TA 4LF9Q 1QCBD 1RIPA 3NTIA 4KKUA 1D2BA 3NPPA 5EPJA 1M4VA 4A3LG 2G5DA 3I72A 2O2LD 1QVFA 4JI4L 1ZXTA 3ERSX 4DUZL 1KC8C 1SYEA 3I90A 4FYDA 1TR5A 3ULLA 2UXCL 1K83B 1SROA 4F87A 3J81c 3PUZA 1GHKA 5COYA 5CYUA 3CCUA 4ABNA 3ONAB 4JYAL 5HGQA 1QNKA 4DK6C 3J80c 1G6ZA 3JAME 2WB1G 2K5NA 1LTLA 3VR5A 4L5TA 4A3KH 4PQXA 2K5WA 2XIWA 3QOJA 1V8QA 4J15A 1TWGB 5TSSA 3NE5B 3H3VI 4GNXA 5IE8A 4DPGA 2DNEA 5BR8Q 2B8GA 1S5BD 2O4XA 1RDPD 3PIP3 1S5DD 4RHRA 4IO9A 2MFIA 4L63B 1Z47A 1Y1VB 3K7AH 4X64L 2RDGA 1XYIA 1Q81C 1VQKA 2B2VC 3BDOA 4JBWA 1SFOH 4NXNQ 2PQAB 1TWCH 2FMMA 2WKDA 4K5WA 3Q23A 3VDYA 1TWFH 4LF7Q 1JE4A 2BDNA 4OWTB 4CKEA 2E2JH 3R93A 4A3FH 3J80i 4KN7C 2K50A 1LLRD 1L1OA 4P73A 1CQVA 2L12A 4JI2L 3DWQA 4JPBW 4A93H 3K0YA 3GTOB 5ELFA 2PZTA 2MO1A 1MBYA 3C2PA 3D31A 1C4QA 1F2LA 2Y0SE 4RAUC 1N9WA 3V2TA 2UXDQ 2BCOA 5BN5A 3PMFA 1SNOA 4PV1C 1YNXA 5IP7G 1XWEA 2LXKA 1E2WA 1V9PA 2UXBL 1GUSA 3U50C 4JI6L 1NAPA 3KF6B 5H1SE 3HKSA 2E8GA 3PIPA 3HOXG 3FPPA 4FF3A 4YWMA 1PH5A 2IX0A 5GAHC 1X54A 3TZUA 4XQNA 3QG1A 2JE6I 1STHA 2A68D 1FGBD 4L5QA 5FKAC 4A3JH 5M3FG 2PI2E 3BJUA 2CW0D 2RSOA 4KHPQ 3D6WA 2JA6G 1YBYA 2EYOA 3S2DH 1QVCA 1HHVA 2EJGC 1TWHH 1OXXK 4JBMA 3MAQA 1RHPA 1MKHA 2WV6D 4ZUIA 1GD7A 2MO0A 5EGTA 1DOMA 2EQSA 1ILQA 3NWTA 3TMEA 2C9OA 2JYOA 4DAPA 2MUYA 1VQPA 1VQHA 5CV9A 2IHFA 4HJ9A 4OWWB 1LYLA 2QF7A 3T4AC 2AKWB 1OO9B 4HIMA 5IOCA 5C44G 1CM9A 5G3LD 1ZYRD 1B3QA 2F0GA 1SNDA 1O78A 1Q8IA 3W3AA 4DR1L 1WTXA 5FLMG 1A62A 4A3IH 1XMQQ 2JSOA 3E5SA 1VQ4A 1SNPA 4POGA 2H4OA 4HN7A 1EYGA 1TWFB 5J1ZA 1N34L 1BXTA 4GOPB 1F9RA 3DHQA 2NVTH 3RLFA 3K57A 5CV6A 4L5RC 2QEXA 2OTJA 1EZ6A 1JB3A 1NY4A 3T1YL 4B3MQ 1VQDA 3K5LA 3OHXC 2EYMA 4A3IB 5CBAE 4X65L 2NTTA 1OXUA 2VB2X 3J81L 1L2FA 1V1QA 1WI5A 3CHBD 5JAVA 2QDLA 1PH6A 2XRSD 3BYTB 2D0PA 3UDGA 2XNAC 1W6KA 5I6YA 1G51A 1YHBA 5M5WH 5JEAH 1CUKA 3HOZG 4IUUA 1A8VA 5M5XB 3ND8A 5DAUA 1T5EA 3Q24A 4YWLA 1LTGD 2N78A 3A7AB 1EU4A 4XYOA 2WIIB 2JA8G 3TZDA 4BS9A 1IBML 4DV4Q 1DYQA 4JI0Q 4PMCA 5IGEA 2CKZB 1DZ1A 3M4QA 3J7YW 2JA9A 3M7GA 2A8VA 5EJWA 4KHZA 1C9OA 1ICWA 1XNRQ 2JEBI 1RODA 4H7BA 2UXBQ 2ZJQA 1D5ZC 1IKMA 2D2CC 4I7ZC 1HNXL 4PG3A 4YCVA 5FLXL 1YNJD 2RCFA 3FMCA 1YNND 3GTLH 1A2TA 2F0FA 3OW7A 1KAAA 2RHQB 4BXXH 1U9RA 4JI3Q 2F0OA 3L7ZC 3MTSA 3D4DA 3DWAA 1CA6A 3K5NA 2UU9L 4RA8A 1MD2D 1HFNA 2NVQH 1TS2A 1SLJA 5IP7H 1B1ZA 3S17H 2G9DA 3FDTA 3KBXA 1PTOC 4RFBA 4OO1G 5C4JH 4UP7A 1LT5D 2NN6I 4JI1L 4UHVA 3PSIA 3TQYA 1EYDA 2K33A 3GTGH 2BA1A 4FDBA 2E2DC 4U68A 2R7DA 3DEOA 4RGMA 2CQAA 2X6LA 1U4PA 3KOJA 4KKTA 3W1GA 4X64Q 3PF4A 1B53A 2DJFC 1UEAB 1LUZA 2PW5A 4WJWA 1Z9FA 2VZAA 4G7OC 1ASYA 3T51B 4C3JB 4Z9CB 3PUYA 1CKNA 4IN3A 1I4HA 3NK9A 4GN5A 1X3QA 2DY8A 3I7FA 4A3BG 4JI3L 4BY1B 2E2JB 1YVCA 1LT4D 4HIKA 4DK3C 3QR8A 3TBIB 1B8AA 5D65A 3OWEB 3AFQA 3TSSA 1LTAD 1TVXA 3NWSA 4A3JG 4BY1H 2AWNA 5FLXE 1PZKD 1U4MA 5CV4A 4DR1Q 2F3VA 3SK4A 3HOYH 4A3GB 1VQLA 1NNXA 3J7AV 1HTPA 1LTRD 2J4XA 1CZWA 3I4NG 1JICA 1E2VA 3DM3A 1WTPA 2I0QA 2WAQE 4RKLA 2K01A 1SRUA 2MNAA 1XPRA 2F0KA 2B39A 4I7AA 1VQMA 4P71A 3C1FA 2BH8A 3E9HA 5D3IB 1TWAB 3VR4A 2NWGA 2HT1A 3X3NA 3SEBA 5AJ3Q 4A3GG 1CT1D 5KNCA 2VXWA 2G9HD 2K1BA 1HJPA 1YITA 2AUKA 2E2IB 1HZCA 2K6AA 2PMZB 1XTDA 3CCRA 1QZHA 1A15A 3M4PA 3TP8A 3OTOL 3S9WA 5JJLA 3VA7A 1GJXA 3D4WA 1PDQA 3D3RA 3PUXA 1D6EC 4FXDA 4LF6Q 1EIGA 2V1CC 4FVMA 2B2UC 5CMDA 5I9PA 3J7AF 1ET9A 2GN5A 2R92B 4N8X1 1KD1C 1IW7D 3FRPB 1HNZL 1I6HB 4QL5A 5I6WA 1B9MA 4RGTA 5JVG3 3PO2H 4C3JG 4JYAQ 4B3RQ 4QIWB 3CCMA 1Z6HA 4A3IG 4X3UA 5C3EG 3M3YB 4K5VA 4RGOS 3SK8A 2IY5B 4AQYQ 2F0WA 4IFDJ 2LSSA 2F4VL 4MIUA 4DUZQ 1XXGA 5LMNQ 1TXYA 4BBSG 4KY7A 4C56C 5FOBB 4IPDA 1IXRA 2L15A 4JK1C 2CQOA 2PI2A 3ND9A 4R1JA 4Y7NB 5JEAJ 1LTTD 2ZM6L 4C3IG 4A4IA 2SOBA 2UUAL 5LMUL 1M1KC 2PNRC 3RZDB 1X3PA 3SR1A 2NN6G 1IYUA 5LMNL 3W1BA 4HCEA 1V1PA 4DK1A 4ZK9B 2KHIA 4OONA 4YHHQ 5LMNW 4X66L 4N9PA 3SGIA 3OSOA 3OW2A 3M4OB 5DM63 4OIKA 3J81j 5HURA 1J5EL 1VQGA 2HCCA 2A5HA 3A8IE 3GTKH 1KTKA 1I4QA 4WORA 1E2ZA 4BA1I 4CDCC 1SE4A 3VA5A 1JT8A 1TWCB 1KAWA 2K5HA 3HOVG 2OTLA 5JOBA 4YY3L 4XQQA 1K9MC 3QB3A 2IW3A 2Z8LA 2I5MX 2RDHA 1KNAA 5FJ8H 5D14A 2YU9H 1QUQB 4NXNL 1HUMA 3K8AA 4DN4M 4AIMA 1I94Q 5M3FB 5K36H 2RQXA 4A3KB 4DV6Q 3GTPB 3ZYYX 3S1NH 3NXWA 2Q2UA 1LTID 5EKLA 1PFMA 5C3EB 1KXLA 4IUVA 4IUPA 4FF2A 1D1IA 2F03A 2JA6H 4CJ2C 1N36Q 4KY5A 2QEJC 2X69A 2FFKB 3KK7A 1PH7A 3HEJA 3D0FA 2DGYA 2CHBD 1SJED 1SYDA 1IYVA 2BH2A 4X62Q 2WAQB 4Y7NH 1U4RA 4ID6A 3Q0AA 1AZPA 5C0XH 4DAYA 1GO3E 4X62L 3MXPA 2NN6H 3SHLA 2AQ2B 2K03A 4R8NA 2YTXA 1MJCA 1UE7A 5C6AA 4XDXA 1I4PA 3A74A 4HEDA 3MWYW 4RHSA 4OHJA 1N36L 1KLGD 3M3YH 1BOSA 1HH2P 3P20A 5CV7A 1O7LA 4DV6L 2N8NA 1YJWA 4K6DA 4GLAC 2Z6BA 3NQIA 4KV6A 3J7ZC 3S17B 4TQUS 4C3HG 3H0GB 3D6CA 1U0LA 3HOZH 4GKJQ 3DXJC 5K5PA 1Y1VG 3AFPA 4QJFA 2XWJB 2MHVA 5FJ8G 1Q46A 1A0IA 2J0TD 4A3EB 4B3TL 1WTOA 2QDBA 3D4RA 4A3MB 5G3LF 2ATWA 4DR6Q 5JPMC 5E4WC 4R4OA 1WTRA 2UXCQ 5FO7B 4FXKC 1JJCB 3K80C 5IP9H 4H02A 4ZCKA 2A6EC 4FP5D 4YIJA 1HZBA 4A3GH 1EEID 3E3XA 4B08A 2JA6B 3TREA 1JE5A 3HS0C 2F0DA 3UDIA 3MFYA 4A93B 1PRTC 4DV5L 3CMAA 2UUAQ 3HOUH 2F1MA 2HIXA 3PIOA 4TVAB 3FKIH 3I4MG 5IYDG 2KENA 1XNQQ 2QGQA 5JEAG 3A55A 3S15B 4HJ5A 1JMCA 4B9XA 4R4QA 1WTWA 1EUJA 5M5XH 4CDFC 1UUPA 2K5DA 2H1EA 2B2WC 4DU9A 3ITPA 2NB0A 4QQBX 1STNA 2AHOB 3AU7A 3UI2A 4K8JA 5IY0A 5FK9C 1EQRA 2V4DA 4QUFA 2DNCA 4DR6L 1J9OA 1TWGH 5JJZA 1A3VA 4NXML 1EYCA 3E9IA 3CU7A 1BF4A 4MTKA 1CA5A 1CHQD 1AFPA 5IYCG 3GO5A 1F9SA 4DF7A 1XMOQ 3E0JA 3M4OH 1CTMA 2KHSA 2QKIC 3NTKA 2EYLA 3LX0A 3I3CA 1K0SA 2RVLA 3T16A 3BYYB 1VQNA 1EZ8A 4DAMA 3BDCA 4IZ8A 3SVMA 3S15H 1EFWA 2Q2TA 2JA8B 4K8IA 4NPSA 1CI3M 5I2XA 2OQ0A 1EWHA 3T13A 2UUCQ 4DR4L 3UE0A 1NSNS 4RCNA 3QJYA 1UE5A 3GDEA 4M1UB 5E7NA 5DNFA 1IW7C 4ME3A 1HA5A 1HQRD 3BVZA 3URYA 4JI7L 3ICEA 1NBWA 4JOIC 2FHTA 3HOWG 4K0KQ 3A5ZB 2Y0SB 1HCZA 2A6HC 3EA6A 4DV7L 4A3FG 1RL2A 4DR7L 3CRKC 1L0XB 4DV2Q 1K3BC 3I4NH 1NE3A 4BBRH 5KGUA 4A3EH 4G4KA 1SNQA 1EY8A 2EZVA 3I4MH 3KLWA 3F1ZA 1JWMD 1RKNA 2B2YC 4ZQ3A 3CCEA 4J6HA 1HA6A 2GA4B 4U673 3UDXA 4RMFA 3HRZC 3TEHB 3F2CA 2JA5G 3KDFA 4NMZA 3TP6A 4R4TA 2IHEA 2A74C 1TS4A 5GQOA 4R8IA 1Y1WG 5M5WB 2F0HA 3VYSA 5IGCA 1TKWB 1EWCA 4GOPA 5EAYA 2JA7H 4IOAA 3CRLC 3MHBA 5T1IA 5C44B 1GHJA 3S14H 1I5FA 4HJ8A 4KHPL 2ICIA 1C0AA 2VQFQ 3CCQA 3TRZA 1HQMC 4MZ9A 3CXCA 1CHPD 4BBRG 1D5MC 1JJGA 1S3OA 5C0XG 1KNEA 2PYKA 2NVXH 1DD2A 1Y1WB 1XX8A 2VUMB 4B3RL 1PFSA 2MP1A 4BA2I 3BDLA 1K0RA 2I46A 4OL7A 2UU9Q 3MXUA 1L1OB 1GOZA 4DV3Q 3FEWX 2M2LA 3TN2A 3KJPA 4JC0A 1SSOA 1STGA 3L9AX 4IQZA 3I56A 4C3JH 1AE2A 1TT2A 1F2ZA 4EQNA 2IWHA 5EKIA 3J80E 2HQLA 2ZJRA 2KECA 2ZXOA 4HIOA 4QY7A 3LWEA 4DNIA 3J81E 4JOIA 1OXSC 4ILWA 1Q3LA 1A3UA 4QCLA 3D8GA 4X3TA 2WACA 4IURA 2JA5H 3HOXB 1QVGA 4A3LH 1HR0W 4MN3A 4YCWA 4LF7L 2B8FA 1Y1WH 1MHWC 2R3ZA 2VS1A 3K59A 3A8KE 3RN5A 3CD6A 1PLFA 3MFGA 4DNRB 2NVQB 1I3QH 2ZXRA 5BR8L 1I4XA 1MSGA 3CW2C 3QWNA 2E2HH 3AMUA 1WCMB 5T1GA 4XQJA 3H94A 1W3SA 1FNVA 3NSWA 1LT6D 4DR7Q 3PQIA 4YCUA 3T53B 4C1NK 4A75A 5K36G 3I55A 1WCMG 1I50H 3VYUA 1FYCA 3KDFB 1JC7A 1FJGQ 3GTLB 4B3SQ 4XTCS 1H9RA 3M9BA 2B3GA 3P7JA 2VW9A 4DR5Q 2B63G 3KLSA 2Q8TA 3A7LA 1EIYB 1E0BA 4GLXA 3TDQA 4A3MH 3N52A 4ME5A 4HAEA 2JQOA 1RF2D 1VMCA 2JJQA 3WWVA 3U58A 3M4YA 4KHVA 1KQSA 3KF8B 1YJ9A 1B9NA 2XWBB 2NTSA 4CHTB 1HUNA 2RHSB 4ZRZA 2HDMA 1X3GA 1JOOA 4OELB 1GUNA 5FO8B 4JBKA 4DR2L 1X55A 2JA8H 3H0GH 1KL9A 3CC2A 4IJLA 1PH2A 1XMOL 3H91A 2I07B 1AW7A 2Q8IB 1Q12A 4NXMQ 3VR3A 3EN2A 2C5CA 3NTHA 3MVVA 2EE1A 4UPAA 2WB1B 4RG1A 2BDOA 1I6VC 2F0MA 3M7NA 3KYHC 1PRTB 1YJNA 5KIXA 1K8OA 1Q1EA 4FO2A 2CH4A 3BZDB 2HHHQ 3HKZG 2NVYH 5LMUQ 1NUCA 4LAAA 2D5DA 1FGUA 1G291 1AZQA 2EYPA 4LUOA 2K14A 1YNNC 4A3DG 4QGUA 2F0JA 2F0TA 1F2YA 1PMRA 2A68C 3H3VC 2B2TA 4IPGA 4APVA 3G4SA 2NVTB 2F52A 4DR2Q 4C3HB 5GADC 4DV4L 1IBMQ 2WINB 2EVBA 1W2BA 2YYZA 3K6OA 1STBA 2HIVA 1SJHD 2K5VA 5C4HA 4AQYL 1YIJA 1YHAA 1S4ZA 2JA7G 2EJMA 4XYQA 3GQBA 2PQAA 4WRDA 5C4XB 3EVQA 4O2DA 5FLXc 3RMHA 2D0OA 3NEMA 3F2BA 2Z6KC 1EQTA 1N8RC 1XPUA 1VQAA 4B3SL 3TP5A 3DEPA 2ASBA 5IGGA 5IIFA 4HIDA 3MC0B 2R93B 1DONA 1GUTA 1Y8NB 4C3IH 3OTOQ 2HHHL 3DMUA 4FF4A 1JWUD 4LUVA 5JJKA 2O5IC 5EPLA 3F8TA 5I9OA 1EY0A 1E3PA 2Y0SG 2F0NA 1G2TA 2KCCA 2PNHA 1PFNA 1UNSA 2K28A 5NUCA 1VQOA 1BCPB 4G57A 2VQEL 1ENAA 2NZHA 2DJGC 5JPNC 4HJ7A 3GTQB 4LF4Q 4C1NI 1WFQA 3E0EA 3OYYA 4RWSC 3FHWA 3K58A 1HNWL 1BDOA 4NP5A 3PO3B 2JK8A 3Q8DA 2R93G 4DV1L 2YTVA 1BR9A 2IX1A 1KRSA 4XIGS 2F0LA 1II3A 1VCIA 3VR6A 5C4ZA 1CK1A 3AEVA 5A2QL 2B2YA 3CMEA 2RCNA 4WJ3M 4EVOA 2WFWA 1PH4A 1E1OA 2KCNA 1D1KA 3G7LA 2A1AA 1C8CA 4KLKA 1JB7A 2KHJA 1YNJC 1JR0D 2A19A 1M8AA 3MXNA 1D7QA 4ULLA 1B2TA 4GLVB 1ASZA 1S40A 1SN8A 1EWIA 2KCMA 4GNXB 5JJIA 5C3EH 2BE5D 1EOVA 4KJNA 3LGJA 2WB1E 4C3IB 1K8GA 2X6GA 3BVMA 4ZKCB 4DR3L 1IL8A 5LHY1 1Y14B 1IBLQ 3VR2A 1Y8PB 3VYRA 5ELBA 5IODA 1SDFA 1FD7D 2CWPA 2E2IH 4IJHA 1SFOB 1P8LA 1FVIA 1OXVA 4MHEA 4RKBA 1PRTD 4JI8Q 2KEEA 1PFBA 1NR2A 2HCIA 1SYGA 2K75A 3L3OC 1IBKQ 2Z1CA 3CPWA 2BOSA 4DUYL 1ZKOA 3GTKB 4BXXG 1GVPA 1STAA 2B2VA 3JAMc 1X32A 3X3MA 1KHIA 5DEHA 4MNOA 1E24A 1ICFB 2CH4W 1G6PA 1A2UA 2IT1A 4QB4A 2SDFA 1SNCA 2VNUD 3S1MH 3H0GG 4GKKQ 2NVYB 4E6IA 1EIFA 3HOUG 4OO1H 2MJ8A 2TSSA 4KN4C 2L9HA 4ZKBB 3FKIB 1X6OA 3CP0A 1EOTA 2JN4A 4LFCL 3H6MA 3JC66 1R4QB 2AWOA 2B63B 4DR4Q 3MZ5A 2UUCL 1O7YA 4HCSA 4A3DH 4DNTB 4HTHA 2Z6KA 2UUBL 2K32A 2CCZA 4LW1A 3HZXA 2F0QA 5IT9c 1JJ2A 5E1FA 1EIHA 2HDLA 3GTGB 5CC4A 3FVQA 4DXFA 4LF5Q 1V1OA 2DUDA 3F2UA 3T1YQ 1GKHA 4B3ML 2XN9C 3EFXD 4LUZA 1QILA 3STBD 2AUJD 1IYJB 3CKIB 5M3MB 1BO0A 2OXPA 5C0XJ 4DAVA 1NJIC 4UAIA 1PH9A 5I4DA 4OGQC 1N34Q 5AJ3L 4QMGA 2B29A 4LNQA 1MJEA 2EJFC 4TSSA 4DAYB 2ZXPA 4OX9L 3I4MB 1R9TB 1PYBA 1I6HH 1LTBD 2MGSA 5M5YB 3EIVA 1QG7A 1TU2B 3PUVA 4HMIA 3RLOA 3HGBA 2Q2HA 1S5CD 1B44D 1DOKA 2EYJA 1PH8A 3U9OA 1MI2A 3OWFA 4DA2A 3A8JE 3S24A 5J39A 4F7XA 2QCPX 3W5OA 5ELCA 2OT2A 1FNUA 5KNDA 5EBDA 3J80L 4DUYQ 5C0XI 1YEZA 3HOVB 4A3MG 3BZKA 4A3EG 4HR7B 4JI8L 4L8JA 3S16B 1G91A 5ELNA 2EY2A 2MPMA 1C48A 1L1OC 4LF8L 3FP9A 5F2DA 5FO9B 5CR3A 3HKZE 4QF4A 4UDUC 4JV5L 1SYBA 3L0OA 4FXGC 1RCVD 3U9SA 3G48A 3I4OA 2PW7A 2HQEA 4G7ZC 3I73A 3G71A 4DV0Q 2VQFL 4JI5Q 1NCVA 3Q6SA 1L0WA 3GP7A 3K7UC 1WVLA 1N32L 4L6TB 1A63A 2M00A 1H9MA 2YU9B 1VQJA 4C3HH 1K8MA 3G6JB 1QZGA 1EYAA 1TY0A 4CJ0B 1O7IA 3V05A 1Q82C 1K3RA 1VQ5A 3RN2A 3FKIG 1EQVA 4O1NA 1AE3A 2I5HA 1WD1A 3U4ZA 2NVXB 1J5EQ 1YHQA 3MXGA 2EOTA 4F88A 4RGNA 3J7A5 1CKNB 2B2WA 3QIAA 2WAQG 1LABA 2E75C 1RTNA 3AQQA 2Q8RE 1VQFA 2H5XA 4H44C 4C2MB 4LFBL 2ZTCA 4V0BA 4OXPA 2EY5A 4ZAIA 3F2DA 1LTSD 1BKBA 1V43A 1U4LA 3RZOB 1S5FD 1NMGA 4O0AA 2F3WA 5CV8A 1E7ZA 4JG2A 1JQYD 2XTIA 4OWXB 1BVSA 4GN3B 4RH6A 1TS3A 1PHJA 4OX9Q 1N32Q 4K14A 1ENCA 2F4VQ 3AYHB 2A73B 1EY5A 1Y8OB 3K5MA 1UWVA 4N8FA 1B7YB 2N3SA 2XVSA 2MQHA 1KDAA 2QA4A 1TS5A 5KEEA 1A6XA 3I4NB 3FPUB 1HNZQ 4XT3B 1CFMA 3NELA 1ONLA 4OEMB 1E22A 3PO2B 2XSCA 2EYFA 4KI0A 2D9UA 3OOCA 4A3JB 1X56A 3PGZA 5EBCA 1XPOA 4CDEC 5I2YA 4C2MH 1QE6A 1IZ6A 2A69D 2R6GA 3IFDA 2E2HB 1PXUA 4HSVA 4GNXC 1Q7YC 1X65A 4BY7B 2A6HD 3PO2G 1NTGA 3KBGA 1EY6A 5JVH3 2F0EA 1J6QA 3CCJA 2DY7A 1LV9A 1NMFA 2A69C 1SE8A 4PZ6A 2IL8A 1EFID 1XMQL 4ALPA 2RF4A 1DGSA 4AH6A 4TRDA 3HOXH 4PMBA 2M9VA 1KABA 4A93G 5KRUA 2F0IA 1C7YA 1HR0L 2D62A 4MTNA 2RSNA 2EY1A 3H15A 3CPFA 1PYWD 1G2SA 2L4NA 3KFUA 5IGDA 3A54A 1FL0A 4EQPA 5C4XH 1W6JA 3SXHA 1SEBD 5HGTA 5L37A 2F3IA 3EBEA 1WOCA 4JI5L 1JORA 1X9NA 3KLRA 2NZOA 2OWOA 1SYCA 2R92G 3HG9A 2DN8A 3K81C 3J81i 3B6YA 4J8QA 5D3DA 3I8ZA 2Z9HA 5M3MG 2VB3X 2NUCA 4YY3Q 1VQ6A 4P2CB 2PCFB 2O5JC 3NUCA 1HFGA 2A6ED 1H9KA 2CW0C 2F0VA 4HSPA 1SMYD 2ID0A 1TWHB 4IUQA 1M90C 2L0CA 2SNSA 4X66Q 3SE0A 4F8MA 5IP9G 3S2DB 3NP8A 1PTOD 3P75A 5KNBA 4O42A 2EIFA 1PZJD 5CGKA 2ENBA 1GUOA 4GN4B 3S14B 2QW7A 1SMYC 2JA7B 2EYHA 3NBIA 4GKKL 2JEAI 5A35A 2OF1A 3CAMA 1DM0B 4DR5L 1K83H 1G8ZD 4GS3A 5IGFA 3H09A 3STBC 1U5KA 3BVGA 3GD7A 1FJGL 1XTCD 4JI6Q 1CSQA 2N55A 2WKCA 3V96A 4JVZA 3HOZB 4XT1B 2Q2IA 2B2TC 2RBMA 1HRJA 2YV5A 1TY2A 3IL8A 4DV1Q 4IFDH 3S2HB 2UXDL 3R2IA 2OEOA 4A3BB 3PIO3 4FF1A 4X6AH 4JW0A 1XNRL 4AYBE 3PUWA 4LK1C 1MGSA 4B3TQ 4X3KA 3WDNA 5E4XA 5KYIA 3CC4A 1QUQA 4LF5L 2LKVA 5EPKA 3GTMB 2NZ1D 1B3AA 4LF6L 4KTAA 1PA6A 1IBLL 1KDCA 1VQ7A 4DR3Q 1H9SB 1I50B 3NQTA 5IWAQ 4HMJA 2B2UA 3KF6A 4BWGB 2IX3A 2QILA 1K28A 1VS0A 3DM1A 2KBNA 1A3TA 3DUZA 3K0XA 4NW2A 3RZOH 2LXJA 4LJZC 2KA7A 3RNUA 4JI1Q 3TP7A 3I70A 3JAML 1EY9A 4BY7G 3WOFA 3DLLA 1Y1VH 3K7AB 4GZYC 3EJIA 2KUMA 3GTPH 1TQOA 4H0LC 3A5UA 2KQ3A 1UE1A 1BCPC 1PH1A 3VYTA 5KYLA 4KJOA 3ERQA 2PMZE 3HOYB 1HNWQ 2JP1A 4YHHL 5DM73 3G6EA 2NYZD 2I5LX 1EY4A 2LS01 5LL6X 1BCPD 3CCLA 5ISRA 4ZYSA 4V190 4IFDG 3KJOA 2AQ1B 1B70B 3IFTA 2ZM6Q 3Q22A 2E76C 4POFA 1F9PA 1SAPA 4BBSB 4BY7H 1HZAA 2K5QA 2P5ZX 3S16H 2C35B 1LACA 4CJ1B 1RTOA 3HOUB 4DXGA 5ELOA 1N33Q 1T5XD 1TIID 3ULJA 2VUMH 4ZLTF 2OCEA 5EKKA 3NBHA 1AP0A 4Q5VA 1BBWA 1ML0D 5IT9L 2LY7A 2CWAA 5LL6S 1MIUA 1CZGA 4DV3L 5CBEE 3KUPA 1SBBB 4G7HC 3IAYA 1Q8KA 5C44H 2XGTA 2L55A 3I91A 4CKCA 1D8LA 4WFN3 3OMGA 3HOVH 4FNFA 3I2ZA 5FLMH 3NENA 4GOPC 5CV5A 3P1HA 2FXQA 1LT3D 2N49A 5IGBA 2XRQD 1F77A 5C4XG 1H9JA 5IT9E 5M5YH 2AMCB 2KEDA 2EY6A 4KD4A 2VY3A 5A2QE 3L2PA 5EQ0A 4IOCA 2R7ZH 1KRTA 2LFNA 1WD0A 2R92H 3RLNA 3N6RA 5IYDH 2KCTA 4BBRB 1D5XC 4HJAA 1AN8A 1WYDA 1XJVA 2ZT9C 1I3QB 4K2KA 3E6ZX 1WTVA 4IALA 5GAGC 1QNUA 2NBFA 3A56A 1I4GA 4KMUC 3OPOA 3SDZA 4A3DB 5HY6A 3OMCA 3ULPA 3MEHA 1IL2A 4BY1G 4NDXA 2PZUA 2YTYA 3CC7A 3HKZB 1GUWA 1SE2A 4L5SA 2IPKD 3CQZH 2JA5B 2Z4IA 4UP8A 1GXDC 4RCOA 2R93H 5C3WA 3IRBA 1JWSD 2RDFA 4PNYA 3HP3A 4KKSA 5IYCH 1OTCA 5M9OA 2SEBD 3S1MB 1QOHA 1PTOF 3PO3G 4DV7Q 1F9QA 1T9HA 2FJ2A 3GTOH 1ZEQX 3R3OA 1EU3A 1QJOA 5C5LA 4DFAA 1GUGA 2E74C 2GVBA 1S5ED 1H9SA 1DJRD 3I4LA 2B63H 4LMQD 1STEA 4EQOA 1XNQL 2WP8J 1EEFD 2K04A 4A3FB 1HZ9A 3S1NB 1EQQA 5ELEA 1L0YB 2KJXA 2ES2A 1R4PB 1CSPA 4ZUJA 5CORA 3GV3A 1BBUA 4NKLA 5J3BA 1DOLA 3KF8A 4M8AA 5IWAL 2SNMA 1WJJA 3W2DA 4PZ8A 1Q90A 4DGZA 3PCOB 4IFDI 1AH9A 2PO4A 2TMPA 4R4IA 1PTOB 1RJTA 4A3CG 5BN3A 3PF5A 2BE5C 4CKBA 1CKOA 1JOKA 3C1EA 1I4RA 5GROA 2EXZA 3LWUA 1KLUD 3MA2B 2L1BA 4EX5A 2R7FA 3OIPA 1SNMA 1NR4A 3C46A 1VMPA 4EGVA 1VQ8A 3SK5A 3CF5A 3R2TA 3BU2A 2ALYB 1K73C 3MXNB 3S1RH 1HNXQ 2ZTDA 2CFMA 3CCVA 4NB3A 1R9TH 3T1HL 2K4KA 5C4JB 1ILPA 1O7ZA 4S3SA 1V1PB 3UDFA 4KD3A 2E5LQ 1S72A 1KIXA 2LMCB 1EL0A 5M3MH 5GAEC 1PVOA 1Y69U 4K6LA 1ENFA 2ICEC 1BUVT 3SK6A 4JI0L 1DCZA 1WTQA 3ZJYC 3GTJH 1PYSB 1BBXC 4B9WA 4JBJA 3CCSA 2HUGA 1JOQA 3NHHA 3T1HQ 4UY8C 1B4OA 1HPCA 3S1QH 2AQ3B 4DV0L 1IHZA 4P72A 1P16A 3AB9A 3ER0A 3S1QB 2Z4HA 4EQ5A 2K52A 4IPHA 1K8AC 2EXDA 3RR5A 3GTQH 1VQCA 2VL6A 3O13A 3GTJB 3S2HH 5E3FA 1BCPF 4DK0A 1VQ9A 2L11A 2F4IA 4JV5Q 2F0SA 3UE1A 1GM5A 4K0KL 4X65Q 2HD3A 3JAMi 2ZJPA 4JI7Q 1WCMH 1H95A 2J7ZA 2OQKA 4Y52H 1QB5D 5DLQE 4K2LA 4OO1I 4K5XA 2BA0A 3U4VA 4ODGA 1UE6A 4KK7A 2K7VA 1I94L 4A3CH 2GVAA 1VQEA 1PTOH 2PQEA 3EQLC 1PH3A 4IUNA 5IYBG 4I65A 4H13C 1TWAH 4QIWE 3S1RB 1HXYD 1VQBA 1CKMA 4LWCA 4UP9A 5J22A 4LF4L 1PV4A 2PPBC 3HOWH 1HR0Q 2F0UA 2VQEQ 4P74A 3HFZB 4CDDC 2FINB 4LF9L 3LNNA 1ET6A 4XXEA 4OIJA 1EY7A 3BS1A 1SXTA 1Q1BA 4R4CA 4YWKA 1UAPA 1B50A 4QUCA 3OIQA 1F2MA 1VQIA 2R7ZG 2JXMB 1ZYRC 1DXMA 1SMXA 4LFAQ 5M3FH 4R9WA 4LFBQ 1X3EA 3C3LA 1YI2A 3BG3A 2KVMA 1Z7TA 4PZ7A 4BBSH 1QWYA 4TKOB 2PZWA 3BZCA 5C5MA 1JCKB 2N88A 3DWPA 3A0JA 1FR3A 3CQZB 4AYBB 3NBHB 2FMCA 1O80A 5AFWA 3IKJA 4JCVE 1MSHA 2UUBQ 2KOLA 2K05A 4DV5Q 3GV6A 1LM0A 1PRTF 1CQFA 3HOWB 1STYA 3QOLA 4Q0FA 1HTLD 1ESFA 1OXTA 3R8BA 2F0PA 1IKLA 3RUZA 1SYFA 1AEXA 1Q86C 2EDGA 4LFCQ 4A3KG 1SR3A 1X3FA 1YZ6A 3TS0A 1FNWA 4X3SA 4JI4Q 4IUTA 4PMWA 2CVRA 1LO5D 4A76A 3RD4A 1UEBA 3RZDH 5C3XA 4AYBG 4P75A 4CGYB 3M85A 3PO3H 3MEFA 3KLSX 2EPBA 5IYBH
chains in the Genus database with same CATH topology
2Z0SA 4LF8Q 2F52A 4DR2Q 4A4IA 2UUAL 5LMUL 1M1KC 4GKJL 5GADC 4IPCA 4DV4L 2NN6G 4DKAC 1IBMQ 2ID0A 5LMNL 3HOYG 3W1BA 2YYZA 1W2BA 1M90C 4X66Q 2KHIA 5IP9G 3PV0A 2HIVA 4OONA 4YHHQ 2K5VA 1IBKL 4AQYL 2VUMG 5LMNW 1YIJA 4X66L 1YHAA 3SGIA 3GTMH 2EIFA 3OW2A 2JA7G 3J81j 4GN4B 4LFAL 1J5EL 2PQAA 3H3VH 1N33L 1VQGA 4GKKL 2ZTEA 4O2DA 5FLXc 3GTKH 4JI2Q 2D0OA 4DV2L 2JEAI 3NEMA 3CAMA 4BA1I 3F2BA 2Z6KC 4DR5L 1K83H 4GS3A 2E5LL 3TS2A 4A3BH 1N8RC 4WJ4A 1JT8A 1E1TA 1KAWA 3STBC 2K5HA 1XPUA 1U5KA 1VQAA 1RIPA 2OTLA 4B3SL 4LF9Q 3GD7A 1FJGL 4JI6Q 2ASBA 4HIDA 4YY3L 1CSQA 4A3LG 1K9MC 4C3IH 3OTOQ 1QVFA 2HHHL 4JI4L 2I5MX 2Q2IA 5FJ8H 2YV5A 2YU9H 3ERSX 4DUZL 1KC8C 1QUQB 4NXNL 4LUVA 4DV1Q 5JJKA 2UXDL 3ULLA 3F8TA 2UXCL 1SROA 3K8AA 3J81c 1E3PA 3PUZA 4X6AH 4AIMA 2Y0SG 1XNRL 4AYBE 3CCUA 3PUWA 1I94Q 4DV6Q 4JYAL 2PNHA 3S1NH 5HGQA 2Q2UA 4DK6C 3J80c 4B3TQ 1KXLA 2WB1G 2K5NA 3CC4A 1VQOA 1LTLA 1QUQA 4L5TA 4LF5L 4A3KH 2VQEL 4LF6L 1N36Q 1PA6A 1IBLL 2JA6H 2NZHA 4HJ7A 4J15A 4DR3Q 1VQ7A 4LF4Q 3H3VI 5IWAQ 1PH7A 3D0FA 4GNXA 2DGYA 5IE8A 4DPGA 1WFQA 5BR8Q 2BH2A 3KF6A 3E0EA 3OYYA 3FHWA 4IO9A 4X62Q 4Y7NH 1HNWL 2MFIA 4X64L 1Z47A 3K7AH 1Q81C 1VQKA 2JK8A 3Q8DA 1VS0A 2R93G 4DV1L 1SFOH 2YTVA 4JBWA 2KBNA 4NXNQ 2IX1A 1GO3E 4X62L 1KRSA 3K0XA 3RZOH 2PQAB 4XIGS 2LXJA 1TWCH 1VCIA 3RNUA 3VDYA 1TWFH 2YTXA 4LF7Q 4JI1Q 1MJCA 3AEVA 1UE7A 3CMEA 2RCNA 4WJ3M 4BY7G 4OWTB 2WFWA 2E2JH 4A3FH 3J80i 3DLLA 3A74A 1PH4A 1Y1VH 2K50A 1L1OA 1N36L 4P73A 1E1OA 3M3YH 2A1AA 4JI2L 1HH2P 3GTPH 4A93H 4KLKA 1JB7A 2KHJA 3A5UA 1UE1A 2A19A 2MO1A 1PH1A 4DV6L 1D7QA 2N8NA 1YJWA 4GLAC 3D31A 4GLVB 2PMZE 1ASZA 1S40A 3J7ZC 2Y0SE 1N9WA 1HNWQ 4TQUS 1SN8A 4YHHL 1EWIA 3G6EA 2UXDQ 2I5LX 2KCMA 4GNXB 5JJIA 5C3EH 1EOVA 3CCLA 3LGJA 2WB1E 1YNXA 5IP7G 1K8GA 1U0LA 2LXKA 3HOZH 1V9PA 2UXBL 4GKJQ 1Y1VG 3AFPA 4QJFA 3KJOA 4DR3L 1Y14B 4IFDG 1B70B 2ZM6Q 3U50C 1IBLQ 4JI6L 4POFA 3KF6B 5FJ8G 5H1SE 3HKSA 2E8GA 1Q46A 2CWPA 3PIPA 1A0IA 2E2IH 4BY7H 4B3TL 1HZAA 3S16H 4IJHA 2C35B 3HOXG 1P8LA 1FVIA 2ATWA 1OXVA 4DR6Q 5ELOA 4YWMA 1PH5A 2IX0A 1N33Q 5GAHC 1X54A 4R4OA 3ULJA 2VUMH 2JE6I 2UXCQ 4JI8Q 1JJCB 3K80C 2OCEA 4H02A 5IP9H 2K75A 1IBKQ 4L5QA 4A3JH 1HZBA 2PI2E 3BJUA 3CPWA 5M3FG 4DUYL 4BXXG 1GVPA 4A3GH 1BBWA 3TREA 4KHPQ 3JAMc 1JE5A 2CWAA 3UDIA 1MIUA 2JA6G 4DV3L 4DV5L 3CMAA 2UUAQ 1KHIA 3HOUH 1Q8KA 5C44H 2HIXA 2XGTA 1YBYA 1E24A 4MNOA 3PIOA 4TVAB 3FKIH 3S2DH 1G6PA 3I4MG 1QVCA 2KENA 2IT1A 5IYDG 1D8LA 2QGQA 5JEAG 1XNQQ 3HOVH 1TWHH 1OXXK 4JBMA 4HJ5A 1JMCA 2VNUD 4R4QA 3I2ZA 3HOVG 1EUJA 3H0GG 3S1MH 5FLMH 4GKKQ 5M5XH 1MKHA 3NENA 1EIFA 4GOPC 1GD7A 2MO0A 3HOUG 4QQBX 2AHOB 2FXQA 1X6OA 2N49A 3CP0A 2EQSA 4LFCL 5IY0A 3JC66 2AWOA 1EQRA 5C4XG 4DR4Q 5M5YH 2AMCB 2UUCL 1VQPA 1VQHA 4A3DH 2IHFA 2VY3A 3L2PA 4HJ9A 1JJGA 4OWWB 1LYLA 4IOCA 2R7ZH 4DR6L 1KRTA 1TWGH 2R92H 3RLNA 5IYDH 4NXML 2KCTA 2AKWB 3E9IA 1WYDA 4HJAA 1XJVA 2Z6KA 2UUBL 4HIMA 2CCZA 5C44G 4LW1A 5IYCG 3GO5A 1XMOQ 3M4OH 5IT9c 1JJ2A 5GAGC 4DR1L 5FLMG 4LF5Q 1A62A 4A3IH 2DUDA 3T1YQ 1XMQQ 1GKHA 4B3ML 1VQNA 1VQ4A 4DAMA 5HY6A 4POGA 1EYGA 4LUZA 3S15H 3ULPA 1EFWA 3STBD 4BY1G 1IYJB 1NJIC 4NPSA 5C0XJ 1N34L 2Q2TA 2YTYA 3CC7A 4GOPB 2OQ0A 1PH9A 3RLFA 4L5SA 3CQZH 2UUCQ 2NVTH 1N34Q 4L5RC 4UP8A 4DR4L 5AJ3L 3UE0A 2QEXA 2OTJA 2B29A 4LNQA 1MJEA 2R93H 1UE5A 1NY4A 3GDEA 3IRBA 4DAYB 3T1YL 4B3MQ 1VQDA 5E7NA 5IYCH 1OTCA 4OX9L 4ME3A 1PYBA 3PO3G 3ICEA 4JI7L 1I6HH 1NBWA 1T9HA 4JOIC 4X65L 4DV7Q 3GTOH 3HOWG 4K0KQ 3A5ZB 1OXUA 1L2FA 1V1QA 2GVBA 1WI5A 3EIVA 4DV7L 4A3FG 1RL2A 2B63H 4DR7L 3PUVA 1XNQL 1PH6A 3RLOA 4DV2Q 2WP8J 3I4NH 2D0PA 1HZ9A 1NE3A 3UDGA 2Q2HA 4BBRH 1EQQA 1PH8A 4A3EH 1G51A 1YHBA 3S24A 5M5WH 1CUKA 2ES2A 3HOZG 3W5OA 1A8VA 3I4MH 1CSPA 3KLWA 3F1ZA 4DUYQ 4YWLA 5C0XI 1BBUA 1YEZA 5J3BA 4A3MG 2N78A 3CCEA 3BZKA 5IWAL 1WJJA 4A3EG 3UDXA 4PZ8A 4RMFA 4JI8L 3TEHB 3F2CA 2JA5G 2JA8G 3PCOB 1IBML 4IFDI 1AH9A 3KDFA 5ELNA 4DV4Q 4JI0Q 4R4IA 4R4TA 1L1OC 2IHEA 4A3CG 3PF5A 2CKZB 4LF8L 1CKOA 3FP9A 3M4QA 5GQOA 3HKZE 5GROA 1Y1WG 2JA9A 2A8VA 4JV5L 4KHZA 1C9OA 4EX5A 3L0OA 2R7FA 4GOPA 5EAYA 1XNRQ 3G48A 2JA7H 4IOAA 1VQ8A 3I4OA 3CF5A 2JEBI 3S14H 1I5FA 3BU2A 2ALYB 4HJ8A 4KHPL 1K73C 2UXBQ 2ZJQA 3MXNB 3S1RH 1C0AA 2VQFQ 3CCQA 1HNXQ 3TRZA 3G71A 4DV0Q 2ZTDA 2CFMA 4MZ9A 2VQFL 4PG3A 3CXCA 1HNXL 4YCVA 4BBRG 4JI5Q 1IL2A 4BXXH 3CCVA 4NB3A 1S3OA 1L0WA 3T1HL 1R9TH 2K4KA 2RHQB 5C0XG 3K7UC 3GTLH 4JI3Q 1N32L 1A63A 2NVXH 3L7ZC 1VQJA 4C3HH 4B3RL 1PFSA 2UU9L 1QZGA 3UDFA 2E5LQ 1S72A 1O7IA 1KIXA 1Q82C 1K3RA 1VQ5A 2NVQH 4BA2I 1SLJA 5M3MH 5GAEC 1PVOA 1K0RA 5IP7H 3RN2A 3FKIG 1AE3A 2I5HA 2UU9Q 3S17H 3U4ZA 4JI0L 1J5EQ 1YHQA 1L1OB 4OO1G 3ZJYC 3GTJH 1CKNB 3J7A5 1PYSB 5C4JH 4UP7A 4DV3Q 2NN6I 2WAQG 4JBJA 3CCSA 3KJPA 4JC0A 3T1HQ 4JI1L 4UY8C 3PSIA 3TQYA 3S1QH 3AQQA 3GTGH 2BA1A 4FDBA 4DV0L 1VQFA 2H5XA 4P72A 3I56A 4C3JH 1AE2A 2R7DA 3KOJA 3W1GA 1P16A 4LFBL 2ZTCA 3ER0A 4X64Q 4EQ5A 3PF4A 2K52A 4IPHA 1K8AC 2EXDA 2HQLA 3RR5A 2ZJRA 3GTQH 4OXPA 1VQCA 2VL6A 4HIOA 4QY7A 3F2DA 3S2HH 1VQ9A 4DNIA 1BKBA 1LUZA 1V43A 4JV5Q 4JOIA 1OXSC 1Z9FA 2VZAA 1NMGA 3UE1A 4O0AA 1GM5A 1ASYA 1E7ZA 4X65Q 4K0KL 3PUYA 1CKNA 3JAMi 2ZJPA 4JG2A 1WCMH 2XTIA 4GN5A 4OWXB 1QVGA 1BVSA 4GN3B 1HR0W 4JI7Q 2OQKA 4A3LH 3I7FA 1H95A 4Y52H 4A3BG 1PHJA 4OX9Q 4JI3L 2ZM6L 1N32Q 5DLQE 1YVCA 4OO1I 4YCWA 4HIKA 4LF7L 4DK3C 2F4VQ 2BA0A 3U4VA 1Y1WH 1B8AA 3AYHB 1UE6A 1I94L 1UWVA 2VS1A 4A3CH 2GVAA 1VQEA 3RN5A 3CD6A 1B7YB 1PH3A 3AFQA 2N3SA 2QA4A 2MQHA 5IYBG 4BY1H 4A3JG 1I3QH 1TWAH 4QIWE 5BR8L 1HNZQ 2AWNA 3CW2C 1VQBA 2E2HH 1CKMA 4LWCA 4UP9A 1W3SA 3NELA 4DR1Q 4LF4L 4DR7Q 1PV4A 1E22A 4YCUA 4A75A 3HOWH 3HOYH 5K36G 3I55A 1HR0Q 1WCMG 1I50H 1VQLA 4KI0A 3KDFB 2VQEQ 1FJGQ 4P74A 3HFZB 4B3SQ 3I4NG 4LF9L 4XTCS 1X56A 3DM3A 2I0QA 3PGZA 3M9BA 2WAQE 2B3GA 1XPOA 1SRUA 2MNAA 2VW9A 4DR5Q 1XPRA 2B63G 1Q1BA 4C2MH 1VQMA 4R4CA 4YWKA 1IZ6A 2R6GA 4P71A 2BH8A 3E9HA 1EIYB 4GLXA 2HT1A 1VQIA 2R7ZG 4GNXC 5AJ3Q 1X65A 1Q7YC 4A3MH 1SMXA 4LFAQ 5M3FH 3PO2G 4A3GG 1NTGA 4LFBQ 1X3EA 1HJPA 1YI2A 2JQOA 1YITA 2JA5H 4PZ7A 4BBSH 2JJQA 1J6QA 1HZCA 3WWVA 3U58A 3CCJA 1XTDA 1NMFA 3CCRA 1QZHA 1SE8A 1KQSA 3BZCA 3KF8B 4PZ6A 3M4PA 1YJ9A 1XMQL 3OTOL 2RF4A 4ALPA 1DGSA 2RHSB 4AH6A 5JJLA 3A0JA 1X3GA 3HOXH 4JBKA 3NBHB 4DR2L 1X55A 4A93G 3PUXA 1C7YA 1HR0L 3H0GH 1KL9A 2JA8H 2D62A 3CC2A 4IJLA 4MTNA 1PH2A 2V1CC 1XMOL 4LF6Q 4JCVE 3H15A 3CPFA 2UUBQ 2GN5A 3KFUA 1KD1C 1HNZL 1Q12A 4QL5A 4DV5Q 4NXMQ 1LM0A 3EN2A 3PO2H 4JYAQ 4B3RQ 1FL0A 4UPAA 4RG1A 3CCMA 4A3IG 5C4XH 5C3EG 2IY5B 1OXTA 4AQYQ 3M7NA 3KYHC 2LSSA 4BBSG 2F3IA 4IFDJ 3EBEA 1WOCA 1YJNA 4JI5L 1Q86C 2F4VL 1X9NA 4DUZQ 2NZOA 1TXYA 5LMNQ 2OWOA 4A3KG 4LFCQ 1Q1EA 1SR3A 1X3FA 1YZ6A 2R92G 3TS0A 4IPDA 3K81C 3J81i 3B6YA 1IXRA 2HHHQ 3HKZG 4PMWA 2NVYH 5LMUQ 4JI4Q 2L15A 5M3MG 4A76A 1FGUA 1G291 1UEBA 3RZDH 4YY3Q 1VQ6A 2CQOA 2PI2A 4R1JA 4P75A 4LUOA 4AYBG 3M85A 2K14A 4A3DG 4QGUA 3MEFA 3PO3H 5JEAJ 4IPGA 4APVA 3G4SA 5IYBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0S A;  4LF8 Q;  2F52 A;  4DR2 Q;  4A4I A;  2UUA L;  5LMU L;  1M1K C;  4GKJ L;  5GAD C;  4IPC A;  4DV4 L;  2NN6 G;  4DKA C;  1IBM Q;  2ID0 A;  5LMN L;  3HOY G;  3W1B A;  2YYZ A;  1W2B A;  1M90 C;  4X66 Q;  2KHI A;  5IP9 G;  3PV0 A;  2HIV A;  4OON A;  4YHH Q;  2K5V A;  1IBK L;  4AQY L;  2VUM G;  5LMN W;  1YIJ A;  4X66 L;  1YHA A;  3SGI A;  3GTM H;  2EIF A;  3OW2 A;  2JA7 G;  3J81 j;  4GN4 B;  4LFA L;  1J5E L;  2PQA A;  3H3V H;  1N33 L;  1VQG A;  4GKK L;  2ZTE A;  4O2D A;  5FLX c;  3GTK H;  4JI2 Q;  2D0O A;  4DV2 L;  2JEA I;  3NEM A;  3CAM A;  4BA1 I;  3F2B A;  2Z6K C;  4DR5 L;  1K83 H;  4GS3 A;  2E5L L;  3TS2 A;  4A3B H;  1N8R C;  4WJ4 A;  1JT8 A;  1E1T A;  1KAW A;  3STB C;  2K5H A;  1XPU A;  1U5K A;  1VQA A;  1RIP A;  2OTL A;  4B3S L;  4LF9 Q;  3GD7 A;  1FJG L;  4JI6 Q;  2ASB A;  4HID A;  4YY3 L;  1CSQ A;  4A3L G;  1K9M C;  4C3I H;  3OTO Q;  1QVF A;  2HHH L;  4JI4 L;  2I5M X;  2Q2I A;  5FJ8 H;  2YV5 A;  2YU9 H;  3ERS X;  4DUZ L;  1KC8 C;  1QUQ B;  4NXN L;  4LUV A;  4DV1 Q;  5JJK A;  2UXD L;  3ULL A;  3F8T A;  2UXC L;  1SRO A;  3K8A A;  3J81 c;  1E3P A;  3PUZ A;  4X6A H;  4AIM A;  2Y0S G;  1XNR L;  4AYB E;  3CCU A;  3PUW A;  1I94 Q;  4DV6 Q;  4JYA L;  2PNH A;  3S1N H;  5HGQ A;  2Q2U A;  4DK6 C;  3J80 c;  4B3T Q;  1KXL A;  2WB1 G;  2K5N A;  3CC4 A;  1VQO A;  1LTL A;  1QUQ A;  4L5T A;  4LF5 L;  4A3K H;  2VQE L;  4LF6 L;  1N36 Q;  1PA6 A;  1IBL L;  2JA6 H;  2NZH A;  4HJ7 A;  4J15 A;  4DR3 Q;  1VQ7 A;  4LF4 Q;  3H3V I;  5IWA Q;  1PH7 A;  3D0F A;  4GNX A;  2DGY A;  5IE8 A;  4DPG A;  1WFQ A;  5BR8 Q;  2BH2 A;  3KF6 A;  3E0E A;  3OYY A;  3FHW A;  4IO9 A;  4X62 Q;  4Y7N H;  1HNW L;  2MFI A;  4X64 L;  1Z47 A;  3K7A H;  1Q81 C;  1VQK A;  2JK8 A;  3Q8D A;  1VS0 A;  2R93 G;  4DV1 L;  1SFO H;  2YTV A;  4JBW A;  2KBN A;  4NXN Q;  2IX1 A;  1GO3 E;  4X62 L;  1KRS A;  3K0X A;  3RZO H;  2PQA B;  4XIG S;  2LXJ A;  1TWC H;  1VCI A;  3RNU A;  3VDY A;  1TWF H;  2YTX A;  4LF7 Q;  4JI1 Q;  1MJC A;  3AEV A;  1UE7 A;  3CME A;  2RCN A;  4WJ3 M;  4BY7 G;  4OWT B;  2WFW A;  2E2J H;  4A3F H;  3J80 i;  3DLL A;  3A74 A;  1PH4 A;  1Y1V H;  2K50 A;  1L1O A;  1N36 L;  4P73 A;  1E1O A;  3M3Y H;  2A1A A;  4JI2 L;  1HH2 P;  3GTP H;  4A93 H;  4KLK A;  1JB7 A;  2KHJ A;  3A5U A;  1UE1 A;  2A19 A;  2MO1 A;  1PH1 A;  4DV6 L;  1D7Q A;  2N8N A;  1YJW A;  4GLA C;  3D31 A;  4GLV B;  2PMZ E;  1ASZ A;  1S40 A;  3J7Z C;  2Y0S E;  1N9W A;  1HNW Q;  4TQU S;  1SN8 A;  4YHH L;  1EWI A;  3G6E A;  2UXD Q;  2I5L X;  2KCM A;  4GNX B;  5JJI A;  5C3E H;  1EOV A;  3CCL A;  3LGJ A;  2WB1 E;  1YNX A;  5IP7 G;  1K8G A;  1U0L A;  2LXK A;  3HOZ H;  1V9P A;  2UXB L;  4GKJ Q;  1Y1V G;  3AFP A;  4QJF A;  3KJO A;  4DR3 L;  1Y14 B;  4IFD G;  1B70 B;  2ZM6 Q;  3U50 C;  1IBL Q;  4JI6 L;  4POF A;  3KF6 B;  5FJ8 G;  5H1S E;  3HKS A;  2E8G A;  1Q46 A;  2CWP A;  3PIP A;  1A0I A;  2E2I H;  4BY7 H;  4B3T L;  1HZA A;  3S16 H;  4IJH A;  2C35 B;  3HOX G;  1P8L A;  1FVI A;  2ATW A;  1OXV A;  4DR6 Q;  5ELO A;  4YWM A;  1PH5 A;  2IX0 A;  1N33 Q;  5GAH C;  1X54 A;  4R4O A;  3ULJ A;  2VUM H;  2JE6 I;  2UXC Q;  4JI8 Q;  1JJC B;  3K80 C;  2OCE A;  4H02 A;  5IP9 H;  2K75 A;  1IBK Q;  4L5Q A;  4A3J H;  1HZB A;  2PI2 E;  3BJU A;  3CPW A;  5M3F G;  4DUY L;  4BXX G;  1GVP A;  4A3G H;  1BBW A;  3TRE A;  4KHP Q;  3JAM c;  1JE5 A;  2CWA A;  3UDI A;  1MIU A;  2JA6 G;  4DV3 L;  4DV5 L;  3CMA A;  2UUA Q;  1KHI A;  3HOU H;  1Q8K A;  5C44 H;  2HIX A;  2XGT A;  1YBY A;  1E24 A;  4MNO A;  3PIO A;  4TVA B;  3FKI H;  3S2D H;  1G6P A;  3I4M G;  1QVC A;  2KEN A;  2IT1 A;  5IYD G;  1D8L A;  2QGQ A;  5JEA G;  1XNQ Q;  3HOV H;  1TWH H;  1OXX K;  4JBM A;  4HJ5 A;  1JMC A;  2VNU D;  4R4Q A;  3I2Z A;  3HOV G;  1EUJ A;  3H0G G;  3S1M H;  5FLM H;  4GKK Q;  5M5X H;  1MKH A;  3NEN A;  1EIF A;  4GOP C;  1GD7 A;  2MO0 A;  3HOU G;  4QQB X;  2AHO B;  2FXQ A;  1X6O A;  2N49 A;  3CP0 A;  2EQS A;  4LFC L;  5IY0 A;  3JC6 6;  2AWO A;  1EQR A;  5C4X G;  4DR4 Q;  5M5Y H;  2AMC B;  2UUC L;  1VQP A;  1VQH A;  4A3D H;  2IHF A;  2VY3 A;  3L2P A;  4HJ9 A;  1JJG A;  4OWW B;  1LYL A;  4IOC A;  2R7Z H;  4DR6 L;  1KRT A;  1TWG H;  2R92 H;  3RLN A;  5IYD H;  4NXM L;  2KCT A;  2AKW B;  3E9I A;  1WYD A;  4HJA A;  1XJV A;  2Z6K A;  2UUB L;  4HIM A;  2CCZ A;  5C44 G;  4LW1 A;  5IYC G;  3GO5 A;  1XMO Q;  3M4O H;  5IT9 c;  1JJ2 A;  5GAG C;  4DR1 L;  5FLM G;  4LF5 Q;  1A62 A;  4A3I H;  2DUD A;  3T1Y Q;  1XMQ Q;  1GKH A;  4B3M L;  1VQN A;  1VQ4 A;  4DAM A;  5HY6 A;  4POG A;  1EYG A;  4LUZ A;  3S15 H;  3ULP A;  1EFW A;  3STB D;  4BY1 G;  1IYJ B;  1NJI C;  4NPS A;  5C0X J;  1N34 L;  2Q2T A;  2YTY A;  3CC7 A;  4GOP B;  2OQ0 A;  1PH9 A;  3RLF A;  4L5S A;  3CQZ H;  2UUC Q;  2NVT H;  1N34 Q;  4L5R C;  4UP8 A;  4DR4 L;  5AJ3 L;  3UE0 A;  2QEX A;  2OTJ A;  2B29 A;  4LNQ A;  1MJE A;  2R93 H;  1UE5 A;  1NY4 A;  3GDE A;  3IRB A;  4DAY B;  3T1Y L;  4B3M Q;  1VQD A;  5E7N A;  5IYC H;  1OTC A;  4OX9 L;  4ME3 A;  1PYB A;  3PO3 G;  3ICE A;  4JI7 L;  1I6H H;  1NBW A;  1T9H A;  4JOI C;  4X65 L;  4DV7 Q;  3GTO H;  3HOW G;  4K0K Q;  3A5Z B;  1OXU A;  1L2F A;  1V1Q A;  2GVB A;  1WI5 A;  3EIV A;  4DV7 L;  4A3F G;  1RL2 A;  2B63 H;  4DR7 L;  3PUV A;  1XNQ L;  1PH6 A;  3RLO A;  4DV2 Q;  2WP8 J;  3I4N H;  2D0P A;  1HZ9 A;  1NE3 A;  3UDG A;  2Q2H A;  4BBR H;  1EQQ A;  1PH8 A;  4A3E H;  1G51 A;  1YHB A;  3S24 A;  5M5W H;  1CUK A;  2ES2 A;  3HOZ G;  3W5O A;  1A8V A;  3I4M H;  1CSP A;  3KLW A;  3F1Z A;  4DUY Q;  4YWL A;  5C0X I;  1BBU A;  1YEZ A;  5J3B A;  4A3M G;  2N78 A;  3CCE A;  3BZK A;  5IWA L;  1WJJ A;  4A3E G;  3UDX A;  4PZ8 A;  4RMF A;  4JI8 L;  3TEH B;  3F2C A;  2JA5 G;  2JA8 G;  3PCO B;  1IBM L;  4IFD I;  1AH9 A;  3KDF A;  5ELN A;  4DV4 Q;  4JI0 Q;  4R4I A;  4R4T A;  1L1O C;  2IHE A;  4A3C G;  3PF5 A;  2CKZ B;  4LF8 L;  1CKO A;  3FP9 A;  3M4Q A;  5GQO A;  3HKZ E;  5GRO A;  1Y1W G;  2JA9 A;  2A8V A;  4JV5 L;  4KHZ A;  1C9O A;  4EX5 A;  3L0O A;  2R7F A;  4GOP A;  5EAY A;  1XNR Q;  3G48 A;  2JA7 H;  4IOA A;  1VQ8 A;  3I4O A;  3CF5 A;  2JEB I;  3S14 H;  1I5F A;  3BU2 A;  2ALY B;  4HJ8 A;  4KHP L;  1K73 C;  2UXB Q;  2ZJQ A;  3MXN B;  3S1R H;  1C0A A;  2VQF Q;  3CCQ A;  1HNX Q;  3TRZ A;  3G71 A;  4DV0 Q;  2ZTD A;  2CFM A;  4MZ9 A;  2VQF L;  4PG3 A;  3CXC A;  1HNX L;  4YCV A;  4BBR G;  4JI5 Q;  1IL2 A;  4BXX H;  3CCV A;  4NB3 A;  1S3O A;  1L0W A;  3T1H L;  1R9T H;  2K4K A;  2RHQ B;  5C0X G;  3K7U C;  3GTL H;  4JI3 Q;  1N32 L;  1A63 A;  2NVX H;  3L7Z C;  1VQJ A;  4C3H H;  4B3R L;  1PFS A;  2UU9 L;  1QZG A;  3UDF A;  2E5L Q;  1S72 A;  1O7I A;  1KIX A;  1Q82 C;  1K3R A;  1VQ5 A;  2NVQ H;  4BA2 I;  1SLJ A;  5M3M H;  5GAE C;  1PVO A;  1K0R A;  5IP7 H;  3RN2 A;  3FKI G;  1AE3 A;  2I5H A;  2UU9 Q;  3S17 H;  3U4Z A;  4JI0 L;  1J5E Q;  1YHQ A;  1L1O B;  4OO1 G;  3ZJY C;  3GTJ H;  1CKN B;  3J7A 5;  1PYS B;  5C4J H;  4UP7 A;  4DV3 Q;  2NN6 I;  2WAQ G;  4JBJ A;  3CCS A;  3KJP A;  4JC0 A;  3T1H Q;  4JI1 L;  4UY8 C;  3PSI A;  3TQY A;  3S1Q H;  3AQQ A;  3GTG H;  2BA1 A;  4FDB A;  4DV0 L;  1VQF A;  2H5X A;  4P72 A;  3I56 A;  4C3J H;  1AE2 A;  2R7D A;  3KOJ A;  3W1G A;  1P16 A;  4LFB L;  2ZTC A;  3ER0 A;  4X64 Q;  4EQ5 A;  3PF4 A;  2K52 A;  4IPH A;  1K8A C;  2EXD A;  2HQL A;  3RR5 A;  2ZJR A;  3GTQ H;  4OXP A;  1VQC A;  2VL6 A;  4HIO A;  4QY7 A;  3F2D A;  3S2H H;  1VQ9 A;  4DNI A;  1BKB A;  1LUZ A;  1V43 A;  4JV5 Q;  4JOI A;  1OXS C;  1Z9F A;  2VZA A;  1NMG A;  3UE1 A;  4O0A A;  1GM5 A;  1ASY A;  1E7Z A;  4X65 Q;  4K0K L;  3PUY A;  1CKN A;  3JAM i;  2ZJP A;  4JG2 A;  1WCM H;  2XTI A;  4GN5 A;  4OWX B;  1QVG A;  1BVS A;  4GN3 B;  1HR0 W;  4JI7 Q;  2OQK A;  4A3L H;  3I7F A;  1H95 A;  4Y52 H;  4A3B G;  1PHJ A;  4OX9 Q;  4JI3 L;  2ZM6 L;  1N32 Q;  5DLQ E;  1YVC A;  4OO1 I;  4YCW A;  4HIK A;  4LF7 L;  4DK3 C;  2F4V Q;  2BA0 A;  3U4V A;  1Y1W H;  1B8A A;  3AYH B;  1UE6 A;  1I94 L;  1UWV A;  2VS1 A;  4A3C H;  2GVA A;  1VQE A;  3RN5 A;  3CD6 A;  1B7Y B;  1PH3 A;  3AFQ A;  2N3S A;  2QA4 A;  2MQH A;  5IYB G;  4BY1 H;  4A3J G;  1I3Q H;  1TWA H;  4QIW E;  5BR8 L;  1HNZ Q;  2AWN A;  3CW2 C;  1VQB A;  2E2H H;  1CKM A;  4LWC A;  4UP9 A;  1W3S A;  3NEL A;  4DR1 Q;  4LF4 L;  4DR7 Q;  1PV4 A;  1E22 A;  4YCU A;  4A75 A;  3HOW H;  3HOY H;  5K36 G;  3I55 A;  1HR0 Q;  1WCM G;  1I50 H;  1VQL A;  4KI0 A;  3KDF B;  2VQE Q;  1FJG Q;  4P74 A;  3HFZ B;  4B3S Q;  3I4N G;  4LF9 L;  4XTC S;  1X56 A;  3DM3 A;  2I0Q A;  3PGZ A;  3M9B A;  2WAQ E;  2B3G A;  1XPO A;  1SRU A;  2MNA A;  2VW9 A;  4DR5 Q;  1XPR A;  2B63 G;  1Q1B A;  4C2M H;  1VQM A;  4R4C A;  4YWK A;  1IZ6 A;  2R6G A;  4P71 A;  2BH8 A;  3E9H A;  1EIY B;  4GLX A;  2HT1 A;  1VQI A;  2R7Z G;  4GNX C;  5AJ3 Q;  1X65 A;  1Q7Y C;  4A3M H;  1SMX A;  4LFA Q;  5M3F H;  3PO2 G;  4A3G G;  1NTG A;  4LFB Q;  1X3E A;  1HJP A;  1YI2 A;  2JQO A;  1YIT A;  2JA5 H;  4PZ7 A;  4BBS H;  2JJQ A;  1J6Q A;  1HZC A;  3WWV A;  3U58 A;  3CCJ A;  1XTD A;  1NMF A;  3CCR A;  1QZH A;  1SE8 A;  1KQS A;  3BZC A;  3KF8 B;  4PZ6 A;  3M4P A;  1YJ9 A;  1XMQ L;  3OTO L;  2RF4 A;  4ALP A;  1DGS A;  2RHS B;  4AH6 A;  5JJL A;  3A0J A;  1X3G A;  3HOX H;  4JBK A;  3NBH B;  4DR2 L;  1X55 A;  4A93 G;  3PUX A;  1C7Y A;  1HR0 L;  3H0G H;  1KL9 A;  2JA8 H;  2D62 A;  3CC2 A;  4IJL A;  4MTN A;  1PH2 A;  2V1C C;  1XMO L;  4LF6 Q;  4JCV E;  3H15 A;  3CPF A;  2UUB Q;  2GN5 A;  3KFU A;  1KD1 C;  1HNZ L;  1Q12 A;  4QL5 A;  4DV5 Q;  4NXM Q;  1LM0 A;  3EN2 A;  3PO2 H;  4JYA Q;  4B3R Q;  1FL0 A;  4UPA A;  4RG1 A;  3CCM A;  4A3I G;  5C4X H;  5C3E G;  2IY5 B;  1OXT A;  4AQY Q;  3M7N A;  3KYH C;  2LSS A;  4BBS G;  2F3I A;  4IFD J;  3EBE A;  1WOC A;  1YJN A;  4JI5 L;  1Q86 C;  2F4V L;  1X9N A;  4DUZ Q;  2NZO A;  1TXY A;  5LMN Q;  2OWO A;  4A3K G;  4LFC Q;  1Q1E A;  1SR3 A;  1X3F A;  1YZ6 A;  2R92 G;  3TS0 A;  4IPD A;  3K81 C;  3J81 i;  3B6Y A;  1IXR A;  2HHH Q;  3HKZ G;  4PMW A;  2NVY H;  5LMU Q;  4JI4 Q;  2L15 A;  5M3M G;  4A76 A;  1FGU A;  1G29 1;  1UEB A;  3RZD H;  4YY3 Q;  1VQ6 A;  2CQO A;  2PI2 A;  4R1J A;  4P75 A;  4LUO A;  4AYB G;  3M85 A;  2K14 A;  4A3D G;  4QGU A;  3MEF A;  3PO3 H;  5JEA J;  4IPG A;  4APV A;  3G4S A;  5IYB H; 
#chains in the Genus database with same CATH topology
 2Z0S A;  4LF8 Q;  1BNZ A;  1J8I A;  2IJ0 A;  1BQQ T;  3ERO A;  5ELD A;  4GKJ L;  1VDZ A;  4IPC A;  5BN4 A;  4DKA C;  1PZI D;  1WTH A;  3HOY G;  1KDB A;  2R7Z B;  3PV0 A;  1SE3 A;  1IBK L;  1VF5 C;  4J1M A;  2VUM G;  1ESR A;  4N9T A;  3GTM H;  2L5T A;  4LFA L;  2RKS A;  1VF7 A;  3QO2 A;  3H3V H;  1N33 L;  3WOE A;  2ZTE A;  1RD9 D;  4JI2 Q;  4DV2 L;  4KY6 A;  2RA4 A;  3T56 B;  3K5O A;  3TS2 A;  4CBV A;  2E5L L;  4A3B H;  4WJ4 A;  2R61 A;  1E1T A;  4LF9 Q;  1QCB D;  1RIP A;  3NTI A;  4KKU A;  1D2B A;  3NPP A;  5EPJ A;  1M4V A;  4A3L G;  2G5D A;  3I72 A;  2O2L D;  1QVF A;  4JI4 L;  1ZXT A;  3ERS X;  4DUZ L;  1KC8 C;  1SYE A;  3I90 A;  4FYD A;  1TR5 A;  3ULL A;  2UXC L;  1K83 B;  1SRO A;  4F87 A;  3J81 c;  3PUZ A;  1GHK A;  5COY A;  5CYU A;  3CCU A;  4ABN A;  3ONA B;  4JYA L;  5HGQ A;  1QNK A;  4DK6 C;  3J80 c;  1G6Z A;  3JAM E;  2WB1 G;  2K5N A;  1LTL A;  3VR5 A;  4L5T A;  4A3K H;  4PQX A;  2K5W A;  2XIW A;  3QOJ A;  1V8Q A;  4J15 A;  1TWG B;  5TSS A;  3NE5 B;  3H3V I;  4GNX A;  5IE8 A;  4DPG A;  2DNE A;  5BR8 Q;  2B8G A;  1S5B D;  2O4X A;  1RDP D;  3PIP 3;  1S5D D;  4RHR A;  4IO9 A;  2MFI A;  4L63 B;  1Z47 A;  1Y1V B;  3K7A H;  4X64 L;  2RDG A;  1XYI A;  1Q81 C;  1VQK A;  2B2V C;  3BDO A;  4JBW A;  1SFO H;  4NXN Q;  2PQA B;  1TWC H;  2FMM A;  2WKD A;  4K5W A;  3Q23 A;  3VDY A;  1TWF H;  4LF7 Q;  1JE4 A;  2BDN A;  4OWT B;  4CKE A;  2E2J H;  3R93 A;  4A3F H;  3J80 i;  4KN7 C;  2K50 A;  1LLR D;  1L1O A;  4P73 A;  1CQV A;  2L12 A;  4JI2 L;  3DWQ A;  4JPB W;  4A93 H;  3K0Y A;  3GTO B;  5ELF A;  2PZT A;  2MO1 A;  1MBY A;  3C2P A;  3D31 A;  1C4Q A;  1F2L A;  2Y0S E;  4RAU C;  1N9W A;  3V2T A;  2UXD Q;  2BCO A;  5BN5 A;  3PMF A;  1SNO A;  4PV1 C;  1YNX A;  5IP7 G;  1XWE A;  2LXK A;  1E2W A;  1V9P A;  2UXB L;  1GUS A;  3U50 C;  4JI6 L;  1NAP A;  3KF6 B;  5H1S E;  3HKS A;  2E8G A;  3PIP A;  3HOX G;  3FPP A;  4FF3 A;  4YWM A;  1PH5 A;  2IX0 A;  5GAH C;  1X54 A;  3TZU A;  4XQN A;  3QG1 A;  2JE6 I;  1STH A;  2A68 D;  1FGB D;  4L5Q A;  5FKA C;  4A3J H;  5M3F G;  2PI2 E;  3BJU A;  2CW0 D;  2RSO A;  4KHP Q;  3D6W A;  2JA6 G;  1YBY A;  2EYO A;  3S2D H;  1QVC A;  1HHV A;  2EJG C;  1TWH H;  1OXX K;  4JBM A;  3MAQ A;  1RHP A;  1MKH A;  2WV6 D;  4ZUI A;  1GD7 A;  2MO0 A;  5EGT A;  1DOM A;  2EQS A;  1ILQ A;  3NWT A;  3TME A;  2C9O A;  2JYO A;  4DAP A;  2MUY A;  1VQP A;  1VQH A;  5CV9 A;  2IHF A;  4HJ9 A;  4OWW B;  1LYL A;  2QF7 A;  3T4A C;  2AKW B;  1OO9 B;  4HIM A;  5IOC A;  5C44 G;  1CM9 A;  5G3L D;  1ZYR D;  1B3Q A;  2F0G A;  1SND A;  1O78 A;  1Q8I A;  3W3A A;  4DR1 L;  1WTX A;  5FLM G;  1A62 A;  4A3I H;  1XMQ Q;  2JSO A;  3E5S A;  1VQ4 A;  1SNP A;  4POG A;  2H4O A;  4HN7 A;  1EYG A;  1TWF B;  5J1Z A;  1N34 L;  1BXT A;  4GOP B;  1F9R A;  3DHQ A;  2NVT H;  3RLF A;  3K57 A;  5CV6 A;  4L5R C;  2QEX A;  2OTJ A;  1EZ6 A;  1JB3 A;  1NY4 A;  3T1Y L;  4B3M Q;  1VQD A;  3K5L A;  3OHX C;  2EYM A;  4A3I B;  5CBA E;  4X65 L;  2NTT A;  1OXU A;  2VB2 X;  3J81 L;  1L2F A;  1V1Q A;  1WI5 A;  3CHB D;  5JAV A;  2QDL A;  1PH6 A;  2XRS D;  3BYT B;  2D0P A;  3UDG A;  2XNA C;  1W6K A;  5I6Y A;  1G51 A;  1YHB A;  5M5W H;  5JEA H;  1CUK A;  3HOZ G;  4IUU A;  1A8V A;  5M5X B;  3ND8 A;  5DAU A;  1T5E A;  3Q24 A;  4YWL A;  1LTG D;  2N78 A;  3A7A B;  1EU4 A;  4XYO A;  2WII B;  2JA8 G;  3TZD A;  4BS9 A;  1IBM L;  4DV4 Q;  1DYQ A;  4JI0 Q;  4PMC A;  5IGE A;  2CKZ B;  1DZ1 A;  3M4Q A;  3J7Y W;  2JA9 A;  3M7G A;  2A8V A;  5EJW A;  4KHZ A;  1C9O A;  1ICW A;  1XNR Q;  2JEB I;  1ROD A;  4H7B A;  2UXB Q;  2ZJQ A;  1D5Z C;  1IKM A;  2D2C C;  4I7Z C;  1HNX L;  4PG3 A;  4YCV A;  5FLX L;  1YNJ D;  2RCF A;  3FMC A;  1YNN D;  3GTL H;  1A2T A;  2F0F A;  3OW7 A;  1KAA A;  2RHQ B;  4BXX H;  1U9R A;  4JI3 Q;  2F0O A;  3L7Z C;  3MTS A;  3D4D A;  3DWA A;  1CA6 A;  3K5N A;  2UU9 L;  4RA8 A;  1MD2 D;  1HFN A;  2NVQ H;  1TS2 A;  1SLJ A;  5IP7 H;  1B1Z A;  3S17 H;  2G9D A;  3FDT A;  3KBX A;  1PTO C;  4RFB A;  4OO1 G;  5C4J H;  4UP7 A;  1LT5 D;  2NN6 I;  4JI1 L;  4UHV A;  3PSI A;  3TQY A;  1EYD A;  2K33 A;  3GTG H;  2BA1 A;  4FDB A;  2E2D C;  4U68 A;  2R7D A;  3DEO A;  4RGM A;  2CQA A;  2X6L A;  1U4P A;  3KOJ A;  4KKT A;  3W1G A;  4X64 Q;  3PF4 A;  1B53 A;  2DJF C;  1UEA B;  1LUZ A;  2PW5 A;  4WJW A;  1Z9F A;  2VZA A;  4G7O C;  1ASY A;  3T51 B;  4C3J B;  4Z9C B;  3PUY A;  1CKN A;  4IN3 A;  1I4H A;  3NK9 A;  4GN5 A;  1X3Q A;  2DY8 A;  3I7F A;  4A3B G;  4JI3 L;  4BY1 B;  2E2J B;  1YVC A;  1LT4 D;  4HIK A;  4DK3 C;  3QR8 A;  3TBI B;  1B8A A;  5D65 A;  3OWE B;  3AFQ A;  3TSS A;  1LTA D;  1TVX A;  3NWS A;  4A3J G;  4BY1 H;  2AWN A;  5FLX E;  1PZK D;  1U4M A;  5CV4 A;  4DR1 Q;  2F3V A;  3SK4 A;  3HOY H;  4A3G B;  1VQL A;  1NNX A;  3J7A V;  1HTP A;  1LTR D;  2J4X A;  1CZW A;  3I4N G;  1JIC A;  1E2V A;  3DM3 A;  1WTP A;  2I0Q A;  2WAQ E;  4RKL A;  2K01 A;  1SRU A;  2MNA A;  1XPR A;  2F0K A;  2B39 A;  4I7A A;  1VQM A;  4P71 A;  3C1F A;  2BH8 A;  3E9H A;  5D3I B;  1TWA B;  3VR4 A;  2NWG A;  2HT1 A;  3X3N A;  3SEB A;  5AJ3 Q;  4A3G G;  1CT1 D;  5KNC A;  2VXW A;  2G9H D;  2K1B A;  1HJP A;  1YIT A;  2AUK A;  2E2I B;  1HZC A;  2K6A A;  2PMZ B;  1XTD A;  3CCR A;  1QZH A;  1A15 A;  3M4P A;  3TP8 A;  3OTO L;  3S9W A;  5JJL A;  3VA7 A;  1GJX A;  3D4W A;  1PDQ A;  3D3R A;  3PUX A;  1D6E C;  4FXD A;  4LF6 Q;  1EIG A;  2V1C C;  4FVM A;  2B2U C;  5CMD A;  5I9P A;  3J7A F;  1ET9 A;  2GN5 A;  2R92 B;  4N8X 1;  1KD1 C;  1IW7 D;  3FRP B;  1HNZ L;  1I6H B;  4QL5 A;  5I6W A;  1B9M A;  4RGT A;  5JVG 3;  3PO2 H;  4C3J G;  4JYA Q;  4B3R Q;  4QIW B;  3CCM A;  1Z6H A;  4A3I G;  4X3U A;  5C3E G;  3M3Y B;  4K5V A;  4RGO S;  3SK8 A;  2IY5 B;  4AQY Q;  2F0W A;  4IFD J;  2LSS A;  2F4V L;  4MIU A;  4DUZ Q;  1XXG A;  5LMN Q;  1TXY A;  4BBS G;  4KY7 A;  4C56 C;  5FOB B;  4IPD A;  1IXR A;  2L15 A;  4JK1 C;  2CQO A;  2PI2 A;  3ND9 A;  4R1J A;  4Y7N B;  5JEA J;  1LTT D;  2ZM6 L;  4C3I G;  4A4I A;  2SOB A;  2UUA L;  5LMU L;  1M1K C;  2PNR C;  3RZD B;  1X3P A;  3SR1 A;  2NN6 G;  1IYU A;  5LMN L;  3W1B A;  4HCE A;  1V1P A;  4DK1 A;  4ZK9 B;  2KHI A;  4OON A;  4YHH Q;  5LMN W;  4X66 L;  4N9P A;  3SGI A;  3OSO A;  3OW2 A;  3M4O B;  5DM6 3;  4OIK A;  3J81 j;  5HUR A;  1J5E L;  1VQG A;  2HCC A;  2A5H A;  3A8I E;  3GTK H;  1KTK A;  1I4Q A;  4WOR A;  1E2Z A;  4BA1 I;  4CDC C;  1SE4 A;  3VA5 A;  1JT8 A;  1TWC B;  1KAW A;  2K5H A;  3HOV G;  2OTL A;  5JOB A;  4YY3 L;  4XQQ A;  1K9M C;  3QB3 A;  2IW3 A;  2Z8L A;  2I5M X;  2RDH A;  1KNA A;  5FJ8 H;  5D14 A;  2YU9 H;  1QUQ B;  4NXN L;  1HUM A;  3K8A A;  4DN4 M;  4AIM A;  1I94 Q;  5M3F B;  5K36 H;  2RQX A;  4A3K B;  4DV6 Q;  3GTP B;  3ZYY X;  3S1N H;  3NXW A;  2Q2U A;  1LTI D;  5EKL A;  1PFM A;  5C3E B;  1KXL A;  4IUV A;  4IUP A;  4FF2 A;  1D1I A;  2F03 A;  2JA6 H;  4CJ2 C;  1N36 Q;  4KY5 A;  2QEJ C;  2X69 A;  2FFK B;  3KK7 A;  1PH7 A;  3HEJ A;  3D0F A;  2DGY A;  2CHB D;  1SJE D;  1SYD A;  1IYV A;  2BH2 A;  4X62 Q;  2WAQ B;  4Y7N H;  1U4R A;  4ID6 A;  3Q0A A;  1AZP A;  5C0X H;  4DAY A;  1GO3 E;  4X62 L;  3MXP A;  2NN6 H;  3SHL A;  2AQ2 B;  2K03 A;  4R8N A;  2YTX A;  1MJC A;  1UE7 A;  5C6A A;  4XDX A;  1I4P A;  3A74 A;  4HED A;  3MWY W;  4RHS A;  4OHJ A;  1N36 L;  1KLG D;  3M3Y H;  1BOS A;  1HH2 P;  3P20 A;  5CV7 A;  1O7L A;  4DV6 L;  2N8N A;  1YJW A;  4K6D A;  4GLA C;  2Z6B A;  3NQI A;  4KV6 A;  3J7Z C;  3S17 B;  4TQU S;  4C3H G;  3H0G B;  3D6C A;  1U0L A;  3HOZ H;  4GKJ Q;  3DXJ C;  5K5P A;  1Y1V G;  3AFP A;  4QJF A;  2XWJ B;  2MHV A;  5FJ8 G;  1Q46 A;  1A0I A;  2J0T D;  4A3E B;  4B3T L;  1WTO A;  2QDB A;  3D4R A;  4A3M B;  5G3L F;  2ATW A;  4DR6 Q;  5JPM C;  5E4W C;  4R4O A;  1WTR A;  2UXC Q;  5FO7 B;  4FXK C;  1JJC B;  3K80 C;  5IP9 H;  4H02 A;  4ZCK A;  2A6E C;  4FP5 D;  4YIJ A;  1HZB A;  4A3G H;  1EEI D;  3E3X A;  4B08 A;  2JA6 B;  3TRE A;  1JE5 A;  3HS0 C;  2F0D A;  3UDI A;  3MFY A;  4A93 B;  1PRT C;  4DV5 L;  3CMA A;  2UUA Q;  3HOU H;  2F1M A;  2HIX A;  3PIO A;  4TVA B;  3FKI H;  3I4M G;  5IYD G;  2KEN A;  1XNQ Q;  2QGQ A;  5JEA G;  3A55 A;  3S15 B;  4HJ5 A;  1JMC A;  4B9X A;  4R4Q A;  1WTW A;  1EUJ A;  5M5X H;  4CDF C;  1UUP A;  2K5D A;  2H1E A;  2B2W C;  4DU9 A;  3ITP A;  2NB0 A;  4QQB X;  1STN A;  2AHO B;  3AU7 A;  3UI2 A;  4K8J A;  5IY0 A;  5FK9 C;  1EQR A;  2V4D A;  4QUF A;  2DNC A;  4DR6 L;  1J9O A;  1TWG H;  5JJZ A;  1A3V A;  4NXM L;  1EYC A;  3E9I A;  3CU7 A;  1BF4 A;  4MTK A;  1CA5 A;  1CHQ D;  1AFP A;  5IYC G;  3GO5 A;  1F9S A;  4DF7 A;  1XMO Q;  3E0J A;  3M4O H;  1CTM A;  2KHS A;  2QKI C;  3NTK A;  2EYL A;  3LX0 A;  3I3C A;  1K0S A;  2RVL A;  3T16 A;  3BYY B;  1VQN A;  1EZ8 A;  4DAM A;  3BDC A;  4IZ8 A;  3SVM A;  3S15 H;  1EFW A;  2Q2T A;  2JA8 B;  4K8I A;  4NPS A;  1CI3 M;  5I2X A;  2OQ0 A;  1EWH A;  3T13 A;  2UUC Q;  4DR4 L;  3UE0 A;  1NSN S;  4RCN A;  3QJY A;  1UE5 A;  3GDE A;  4M1U B;  5E7N A;  5DNF A;  1IW7 C;  4ME3 A;  1HA5 A;  1HQR D;  3BVZ A;  3URY A;  4JI7 L;  3ICE A;  1NBW A;  4JOI C;  2FHT A;  3HOW G;  4K0K Q;  3A5Z B;  2Y0S B;  1HCZ A;  2A6H C;  3EA6 A;  4DV7 L;  4A3F G;  1RL2 A;  4DR7 L;  3CRK C;  1L0X B;  4DV2 Q;  1K3B C;  3I4N H;  1NE3 A;  4BBR H;  5KGU A;  4A3E H;  4G4K A;  1SNQ A;  1EY8 A;  2EZV A;  3I4M H;  3KLW A;  3F1Z A;  1JWM D;  1RKN A;  2B2Y C;  4ZQ3 A;  3CCE A;  4J6H A;  1HA6 A;  2GA4 B;  4U67 3;  3UDX A;  4RMF A;  3HRZ C;  3TEH B;  3F2C A;  2JA5 G;  3KDF A;  4NMZ A;  3TP6 A;  4R4T A;  2IHE A;  2A74 C;  1TS4 A;  5GQO A;  4R8I A;  1Y1W G;  5M5W B;  2F0H A;  3VYS A;  5IGC A;  1TKW B;  1EWC A;  4GOP A;  5EAY A;  2JA7 H;  4IOA A;  3CRL C;  3MHB A;  5T1I A;  5C44 B;  1GHJ A;  3S14 H;  1I5F A;  4HJ8 A;  4KHP L;  2ICI A;  1C0A A;  2VQF Q;  3CCQ A;  3TRZ A;  1HQM C;  4MZ9 A;  3CXC A;  1CHP D;  4BBR G;  1D5M C;  1JJG A;  1S3O A;  5C0X G;  1KNE A;  2PYK A;  2NVX H;  1DD2 A;  1Y1W B;  1XX8 A;  2VUM B;  4B3R L;  1PFS A;  2MP1 A;  4BA2 I;  3BDL A;  1K0R A;  2I46 A;  4OL7 A;  2UU9 Q;  3MXU A;  1L1O B;  1GOZ A;  4DV3 Q;  3FEW X;  2M2L A;  3TN2 A;  3KJP A;  4JC0 A;  1SSO A;  1STG A;  3L9A X;  4IQZ A;  3I56 A;  4C3J H;  1AE2 A;  1TT2 A;  1F2Z A;  4EQN A;  2IWH A;  5EKI A;  3J80 E;  2HQL A;  2ZJR A;  2KEC A;  2ZXO A;  4HIO A;  4QY7 A;  3LWE A;  4DNI A;  3J81 E;  4JOI A;  1OXS C;  4ILW A;  1Q3L A;  1A3U A;  4QCL A;  3D8G A;  4X3T A;  2WAC A;  4IUR A;  2JA5 H;  3HOX B;  1QVG A;  4A3L H;  1HR0 W;  4MN3 A;  4YCW A;  4LF7 L;  2B8F A;  1Y1W H;  1MHW C;  2R3Z A;  2VS1 A;  3K59 A;  3A8K E;  3RN5 A;  3CD6 A;  1PLF A;  3MFG A;  4DNR B;  2NVQ B;  1I3Q H;  2ZXR A;  5BR8 L;  1I4X A;  1MSG A;  3CW2 C;  3QWN A;  2E2H H;  3AMU A;  1WCM B;  5T1G A;  4XQJ A;  3H94 A;  1W3S A;  1FNV A;  3NSW A;  1LT6 D;  4DR7 Q;  3PQI A;  4YCU A;  3T53 B;  4C1N K;  4A75 A;  5K36 G;  3I55 A;  1WCM G;  1I50 H;  3VYU A;  1FYC A;  3KDF B;  1JC7 A;  1FJG Q;  3GTL B;  4B3S Q;  4XTC S;  1H9R A;  3M9B A;  2B3G A;  3P7J A;  2VW9 A;  4DR5 Q;  2B63 G;  3KLS A;  2Q8T A;  3A7L A;  1EIY B;  1E0B A;  4GLX A;  3TDQ A;  4A3M H;  3N52 A;  4ME5 A;  4HAE A;  2JQO A;  1RF2 D;  1VMC A;  2JJQ A;  3WWV A;  3U58 A;  3M4Y A;  4KHV A;  1KQS A;  3KF8 B;  1YJ9 A;  1B9N A;  2XWB B;  2NTS A;  4CHT B;  1HUN A;  2RHS B;  4ZRZ A;  2HDM A;  1X3G A;  1JOO A;  4OEL B;  1GUN A;  5FO8 B;  4JBK A;  4DR2 L;  1X55 A;  2JA8 H;  3H0G H;  1KL9 A;  3CC2 A;  4IJL A;  1PH2 A;  1XMO L;  3H91 A;  2I07 B;  1AW7 A;  2Q8I B;  1Q12 A;  4NXM Q;  3VR3 A;  3EN2 A;  2C5C A;  3NTH A;  3MVV A;  2EE1 A;  4UPA A;  2WB1 B;  4RG1 A;  2BDO A;  1I6V C;  2F0M A;  3M7N A;  3KYH C;  1PRT B;  1YJN A;  5KIX A;  1K8O A;  1Q1E A;  4FO2 A;  2CH4 A;  3BZD B;  2HHH Q;  3HKZ G;  2NVY H;  5LMU Q;  1NUC A;  4LAA A;  2D5D A;  1FGU A;  1G29 1;  1AZQ A;  2EYP A;  4LUO A;  2K14 A;  1YNN C;  4A3D G;  4QGU A;  2F0J A;  2F0T A;  1F2Y A;  1PMR A;  2A68 C;  3H3V C;  2B2T A;  4IPG A;  4APV A;  3G4S A;  2NVT B;  2F52 A;  4DR2 Q;  4C3H B;  5GAD C;  4DV4 L;  1IBM Q;  2WIN B;  2EVB A;  1W2B A;  2YYZ A;  3K6O A;  1STB A;  2HIV A;  1SJH D;  2K5V A;  5C4H A;  4AQY L;  1YIJ A;  1YHA A;  1S4Z A;  2JA7 G;  2EJM A;  4XYQ A;  3GQB A;  2PQA A;  4WRD A;  5C4X B;  3EVQ A;  4O2D A;  5FLX c;  3RMH A;  2D0O A;  3NEM A;  3F2B A;  2Z6K C;  1EQT A;  1N8R C;  1XPU A;  1VQA A;  4B3S L;  3TP5 A;  3DEP A;  2ASB A;  5IGG A;  5IIF A;  4HID A;  3MC0 B;  2R93 B;  1DON A;  1GUT A;  1Y8N B;  4C3I H;  3OTO Q;  2HHH L;  3DMU A;  4FF4 A;  1JWU D;  4LUV A;  5JJK A;  2O5I C;  5EPL A;  3F8T A;  5I9O A;  1EY0 A;  1E3P A;  2Y0S G;  2F0N A;  1G2T A;  2KCC A;  2PNH A;  1PFN A;  1UNS A;  2K28 A;  5NUC A;  1VQO A;  1BCP B;  4G57 A;  2VQE L;  1ENA A;  2NZH A;  2DJG C;  5JPN C;  4HJ7 A;  3GTQ B;  4LF4 Q;  4C1N I;  1WFQ A;  3E0E A;  3OYY A;  4RWS C;  3FHW A;  3K58 A;  1HNW L;  1BDO A;  4NP5 A;  3PO3 B;  2JK8 A;  3Q8D A;  2R93 G;  4DV1 L;  2YTV A;  1BR9 A;  2IX1 A;  1KRS A;  4XIG S;  2F0L A;  1II3 A;  1VCI A;  3VR6 A;  5C4Z A;  1CK1 A;  3AEV A;  5A2Q L;  2B2Y A;  3CME A;  2RCN A;  4WJ3 M;  4EVO A;  2WFW A;  1PH4 A;  1E1O A;  2KCN A;  1D1K A;  3G7L A;  2A1A A;  1C8C A;  4KLK A;  1JB7 A;  2KHJ A;  1YNJ C;  1JR0 D;  2A19 A;  1M8A A;  3MXN A;  1D7Q A;  4ULL A;  1B2T A;  4GLV B;  1ASZ A;  1S40 A;  1SN8 A;  1EWI A;  2KCM A;  4GNX B;  5JJI A;  5C3E H;  2BE5 D;  1EOV A;  4KJN A;  3LGJ A;  2WB1 E;  4C3I B;  1K8G A;  2X6G A;  3BVM A;  4ZKC B;  4DR3 L;  1IL8 A;  5LHY 1;  1Y14 B;  1IBL Q;  3VR2 A;  1Y8P B;  3VYR A;  5ELB A;  5IOD A;  1SDF A;  1FD7 D;  2CWP A;  2E2I H;  4IJH A;  1SFO B;  1P8L A;  1FVI A;  1OXV A;  4MHE A;  4RKB A;  1PRT D;  4JI8 Q;  2KEE A;  1PFB A;  1NR2 A;  2HCI A;  1SYG A;  2K75 A;  3L3O C;  1IBK Q;  2Z1C A;  3CPW A;  2BOS A;  4DUY L;  1ZKO A;  3GTK B;  4BXX G;  1GVP A;  1STA A;  2B2V A;  3JAM c;  1X32 A;  3X3M A;  1KHI A;  5DEH A;  4MNO A;  1E24 A;  1ICF B;  2CH4 W;  1G6P A;  1A2U A;  2IT1 A;  4QB4 A;  2SDF A;  1SNC A;  2VNU D;  3S1M H;  3H0G G;  4GKK Q;  2NVY B;  4E6I A;  1EIF A;  3HOU G;  4OO1 H;  2MJ8 A;  2TSS A;  4KN4 C;  2L9H A;  4ZKB B;  3FKI B;  1X6O A;  3CP0 A;  1EOT A;  2JN4 A;  4LFC L;  3H6M A;  3JC6 6;  1R4Q B;  2AWO A;  2B63 B;  4DR4 Q;  3MZ5 A;  2UUC L;  1O7Y A;  4HCS A;  4A3D H;  4DNT B;  4HTH A;  2Z6K A;  2UUB L;  2K32 A;  2CCZ A;  4LW1 A;  3HZX A;  2F0Q A;  5IT9 c;  1JJ2 A;  5E1F A;  1EIH A;  2HDL A;  3GTG B;  5CC4 A;  3FVQ A;  4DXF A;  4LF5 Q;  1V1O A;  2DUD A;  3F2U A;  3T1Y Q;  1GKH A;  4B3M L;  2XN9 C;  3EFX D;  4LUZ A;  1QIL A;  3STB D;  2AUJ D;  1IYJ B;  3CKI B;  5M3M B;  1BO0 A;  2OXP A;  5C0X J;  4DAV A;  1NJI C;  4UAI A;  1PH9 A;  5I4D A;  4OGQ C;  1N34 Q;  5AJ3 L;  4QMG A;  2B29 A;  4LNQ A;  1MJE A;  2EJF C;  4TSS A;  4DAY B;  2ZXP A;  4OX9 L;  3I4M B;  1R9T B;  1PYB A;  1I6H H;  1LTB D;  2MGS A;  5M5Y B;  3EIV A;  1QG7 A;  1TU2 B;  3PUV A;  4HMI A;  3RLO A;  3HGB A;  2Q2H A;  1S5C D;  1B44 D;  1DOK A;  2EYJ A;  1PH8 A;  3U9O A;  1MI2 A;  3OWF A;  4DA2 A;  3A8J E;  3S24 A;  5J39 A;  4F7X A;  2QCP X;  3W5O A;  5ELC A;  2OT2 A;  1FNU A;  5KND A;  5EBD A;  3J80 L;  4DUY Q;  5C0X I;  1YEZ A;  3HOV B;  4A3M G;  3BZK A;  4A3E G;  4HR7 B;  4JI8 L;  4L8J A;  3S16 B;  1G91 A;  5ELN A;  2EY2 A;  2MPM A;  1C48 A;  1L1O C;  4LF8 L;  3FP9 A;  5F2D A;  5FO9 B;  5CR3 A;  3HKZ E;  4QF4 A;  4UDU C;  4JV5 L;  1SYB A;  3L0O A;  4FXG C;  1RCV D;  3U9S A;  3G48 A;  3I4O A;  2PW7 A;  2HQE A;  4G7Z C;  3I73 A;  3G71 A;  4DV0 Q;  2VQF L;  4JI5 Q;  1NCV A;  3Q6S A;  1L0W A;  3GP7 A;  3K7U C;  1WVL A;  1N32 L;  4L6T B;  1A63 A;  2M00 A;  1H9M A;  2YU9 B;  1VQJ A;  4C3H H;  1K8M A;  3G6J B;  1QZG A;  1EYA A;  1TY0 A;  4CJ0 B;  1O7I A;  3V05 A;  1Q82 C;  1K3R A;  1VQ5 A;  3RN2 A;  3FKI G;  1EQV A;  4O1N A;  1AE3 A;  2I5H A;  1WD1 A;  3U4Z A;  2NVX B;  1J5E Q;  1YHQ A;  3MXG A;  2EOT A;  4F88 A;  4RGN A;  3J7A 5;  1CKN B;  2B2W A;  3QIA A;  2WAQ G;  1LAB A;  2E75 C;  1RTN A;  3AQQ A;  2Q8R E;  1VQF A;  2H5X A;  4H44 C;  4C2M B;  4LFB L;  2ZTC A;  4V0B A;  4OXP A;  2EY5 A;  4ZAI A;  3F2D A;  1LTS D;  1BKB A;  1V43 A;  1U4L A;  3RZO B;  1S5F D;  1NMG A;  4O0A A;  2F3W A;  5CV8 A;  1E7Z A;  4JG2 A;  1JQY D;  2XTI A;  4OWX B;  1BVS A;  4GN3 B;  4RH6 A;  1TS3 A;  1PHJ A;  4OX9 Q;  1N32 Q;  4K14 A;  1ENC A;  2F4V Q;  3AYH B;  2A73 B;  1EY5 A;  1Y8O B;  3K5M A;  1UWV A;  4N8F A;  1B7Y B;  2N3S A;  2XVS A;  2MQH A;  1KDA A;  2QA4 A;  1TS5 A;  5KEE A;  1A6X A;  3I4N B;  3FPU B;  1HNZ Q;  4XT3 B;  1CFM A;  3NEL A;  1ONL A;  4OEM B;  1E22 A;  3PO2 B;  2XSC A;  2EYF A;  4KI0 A;  2D9U A;  3OOC A;  4A3J B;  1X56 A;  3PGZ A;  5EBC A;  1XPO A;  4CDE C;  5I2Y A;  4C2M H;  1QE6 A;  1IZ6 A;  2A69 D;  2R6G A;  3IFD A;  2E2H B;  1PXU A;  4HSV A;  4GNX C;  1Q7Y C;  1X65 A;  4BY7 B;  2A6H D;  3PO2 G;  1NTG A;  3KBG A;  1EY6 A;  5JVH 3;  2F0E A;  1J6Q A;  3CCJ A;  2DY7 A;  1LV9 A;  1NMF A;  2A69 C;  1SE8 A;  4PZ6 A;  2IL8 A;  1EFI D;  1XMQ L;  4ALP A;  2RF4 A;  1DGS A;  4AH6 A;  4TRD A;  3HOX H;  4PMB A;  2M9V A;  1KAB A;  4A93 G;  5KRU A;  2F0I A;  1C7Y A;  1HR0 L;  2D62 A;  4MTN A;  2RSN A;  2EY1 A;  3H15 A;  3CPF A;  1PYW D;  1G2S A;  2L4N A;  3KFU A;  5IGD A;  3A54 A;  1FL0 A;  4EQP A;  5C4X H;  1W6J A;  3SXH A;  1SEB D;  5HGT A;  5L37 A;  2F3I A;  3EBE A;  1WOC A;  4JI5 L;  1JOR A;  1X9N A;  3KLR A;  2NZO A;  2OWO A;  1SYC A;  2R92 G;  3HG9 A;  2DN8 A;  3K81 C;  3J81 i;  3B6Y A;  4J8Q A;  5D3D A;  3I8Z A;  2Z9H A;  5M3M G;  2VB3 X;  2NUC A;  4YY3 Q;  1VQ6 A;  4P2C B;  2PCF B;  2O5J C;  3NUC A;  1HFG A;  2A6E D;  1H9K A;  2CW0 C;  2F0V A;  4HSP A;  1SMY D;  2ID0 A;  1TWH B;  4IUQ A;  1M90 C;  2L0C A;  2SNS A;  4X66 Q;  3SE0 A;  4F8M A;  5IP9 G;  3S2D B;  3NP8 A;  1PTO D;  3P75 A;  5KNB A;  4O42 A;  2EIF A;  1PZJ D;  5CGK A;  2ENB A;  1GUO A;  4GN4 B;  3S14 B;  2QW7 A;  1SMY C;  2JA7 B;  2EYH A;  3NBI A;  4GKK L;  2JEA I;  5A35 A;  2OF1 A;  3CAM A;  1DM0 B;  4DR5 L;  1K83 H;  1G8Z D;  4GS3 A;  5IGF A;  3H09 A;  3STB C;  1U5K A;  3BVG A;  3GD7 A;  1FJG L;  1XTC D;  4JI6 Q;  1CSQ A;  2N55 A;  2WKC A;  3V96 A;  4JVZ A;  3HOZ B;  4XT1 B;  2Q2I A;  2B2T C;  2RBM A;  1HRJ A;  2YV5 A;  1TY2 A;  3IL8 A;  4DV1 Q;  4IFD H;  3S2H B;  2UXD L;  3R2I A;  2OEO A;  4A3B B;  3PIO 3;  4FF1 A;  4X6A H;  4JW0 A;  1XNR L;  4AYB E;  3PUW A;  4LK1 C;  1MGS A;  4B3T Q;  4X3K A;  3WDN A;  5E4X A;  5KYI A;  3CC4 A;  1QUQ A;  4LF5 L;  2LKV A;  5EPK A;  3GTM B;  2NZ1 D;  1B3A A;  4LF6 L;  4KTA A;  1PA6 A;  1IBL L;  1KDC A;  1VQ7 A;  4DR3 Q;  1H9S B;  1I50 B;  3NQT A;  5IWA Q;  4HMJ A;  2B2U A;  3KF6 A;  4BWG B;  2IX3 A;  2QIL A;  1K28 A;  1VS0 A;  3DM1 A;  2KBN A;  1A3T A;  3DUZ A;  3K0X A;  4NW2 A;  3RZO H;  2LXJ A;  4LJZ C;  2KA7 A;  3RNU A;  4JI1 Q;  3TP7 A;  3I70 A;  3JAM L;  1EY9 A;  4BY7 G;  3WOF A;  3DLL A;  1Y1V H;  3K7A B;  4GZY C;  3EJI A;  2KUM A;  3GTP H;  1TQO A;  4H0L C;  3A5U A;  2KQ3 A;  1UE1 A;  1BCP C;  1PH1 A;  3VYT A;  5KYL A;  4KJO A;  3ERQ A;  2PMZ E;  3HOY B;  1HNW Q;  2JP1 A;  4YHH L;  5DM7 3;  3G6E A;  2NYZ D;  2I5L X;  1EY4 A;  2LS0 1;  5LL6 X;  1BCP D;  3CCL A;  5ISR A;  4ZYS A;  4V19 0;  4IFD G;  3KJO A;  2AQ1 B;  1B70 B;  3IFT A;  2ZM6 Q;  3Q22 A;  2E76 C;  4POF A;  1F9P A;  1SAP A;  4BBS B;  4BY7 H;  1HZA A;  2K5Q A;  2P5Z X;  3S16 H;  2C35 B;  1LAC A;  4CJ1 B;  1RTO A;  3HOU B;  4DXG A;  5ELO A;  1N33 Q;  1T5X D;  1TII D;  3ULJ A;  2VUM H;  4ZLT F;  2OCE A;  5EKK A;  3NBH A;  1AP0 A;  4Q5V A;  1BBW A;  1ML0 D;  5IT9 L;  2LY7 A;  2CWA A;  5LL6 S;  1MIU A;  1CZG A;  4DV3 L;  5CBE E;  3KUP A;  1SBB B;  4G7H C;  3IAY A;  1Q8K A;  5C44 H;  2XGT A;  2L55 A;  3I91 A;  4CKC A;  1D8L A;  4WFN 3;  3OMG A;  3HOV H;  4FNF A;  3I2Z A;  5FLM H;  3NEN A;  4GOP C;  5CV5 A;  3P1H A;  2FXQ A;  1LT3 D;  2N49 A;  5IGB A;  2XRQ D;  1F77 A;  5C4X G;  1H9J A;  5IT9 E;  5M5Y H;  2AMC B;  2KED A;  2EY6 A;  4KD4 A;  2VY3 A;  5A2Q E;  3L2P A;  5EQ0 A;  4IOC A;  2R7Z H;  1KRT A;  2LFN A;  1WD0 A;  2R92 H;  3RLN A;  3N6R A;  5IYD H;  2KCT A;  4BBR B;  1D5X C;  4HJA A;  1AN8 A;  1WYD A;  1XJV A;  2ZT9 C;  1I3Q B;  4K2K A;  3E6Z X;  1WTV A;  4IAL A;  5GAG C;  1QNU A;  2NBF A;  3A56 A;  1I4G A;  4KMU C;  3OPO A;  3SDZ A;  4A3D B;  5HY6 A;  3OMC A;  3ULP A;  3MEH A;  1IL2 A;  4BY1 G;  4NDX A;  2PZU A;  2YTY A;  3CC7 A;  3HKZ B;  1GUW A;  1SE2 A;  4L5S A;  2IPK D;  3CQZ H;  2JA5 B;  2Z4I A;  4UP8 A;  1GXD C;  4RCO A;  2R93 H;  5C3W A;  3IRB A;  1JWS D;  2RDF A;  4PNY A;  3HP3 A;  4KKS A;  5IYC H;  1OTC A;  5M9O A;  2SEB D;  3S1M B;  1QOH A;  1PTO F;  3PO3 G;  4DV7 Q;  1F9Q A;  1T9H A;  2FJ2 A;  3GTO H;  1ZEQ X;  3R3O A;  1EU3 A;  1QJO A;  5C5L A;  4DFA A;  1GUG A;  2E74 C;  2GVB A;  1S5E D;  1H9S A;  1DJR D;  3I4L A;  2B63 H;  4LMQ D;  1STE A;  4EQO A;  1XNQ L;  2WP8 J;  1EEF D;  2K04 A;  4A3F B;  1HZ9 A;  3S1N B;  1EQQ A;  5ELE A;  1L0Y B;  2KJX A;  2ES2 A;  1R4P B;  1CSP A;  4ZUJ A;  5COR A;  3GV3 A;  1BBU A;  4NKL A;  5J3B A;  1DOL A;  3KF8 A;  4M8A A;  5IWA L;  2SNM A;  1WJJ A;  3W2D A;  4PZ8 A;  1Q90 A;  4DGZ A;  3PCO B;  4IFD I;  1AH9 A;  2PO4 A;  2TMP A;  4R4I A;  1PTO B;  1RJT A;  4A3C G;  5BN3 A;  3PF5 A;  2BE5 C;  4CKB A;  1CKO A;  1JOK A;  3C1E A;  1I4R A;  5GRO A;  2EXZ A;  3LWU A;  1KLU D;  3MA2 B;  2L1B A;  4EX5 A;  2R7F A;  3OIP A;  1SNM A;  1NR4 A;  3C46 A;  1VMP A;  4EGV A;  1VQ8 A;  3SK5 A;  3CF5 A;  3R2T A;  3BU2 A;  2ALY B;  1K73 C;  3MXN B;  3S1R H;  1HNX Q;  2ZTD A;  2CFM A;  3CCV A;  4NB3 A;  1R9T H;  3T1H L;  2K4K A;  5C4J B;  1ILP A;  1O7Z A;  4S3S A;  1V1P B;  3UDF A;  4KD3 A;  2E5L Q;  1S72 A;  1KIX A;  2LMC B;  1EL0 A;  5M3M H;  5GAE C;  1PVO A;  1Y69 U;  4K6L A;  1ENF A;  2ICE C;  1BUV T;  3SK6 A;  4JI0 L;  1DCZ A;  1WTQ A;  3ZJY C;  3GTJ H;  1PYS B;  1BBX C;  4B9W A;  4JBJ A;  3CCS A;  2HUG A;  1JOQ A;  3NHH A;  3T1H Q;  4UY8 C;  1B4O A;  1HPC A;  3S1Q H;  2AQ3 B;  4DV0 L;  1IHZ A;  4P72 A;  1P16 A;  3AB9 A;  3ER0 A;  3S1Q B;  2Z4H A;  4EQ5 A;  2K52 A;  4IPH A;  1K8A C;  2EXD A;  3RR5 A;  3GTQ H;  1VQC A;  2VL6 A;  3O13 A;  3GTJ B;  3S2H H;  5E3F A;  1BCP F;  4DK0 A;  1VQ9 A;  2L11 A;  2F4I A;  4JV5 Q;  2F0S A;  3UE1 A;  1GM5 A;  4K0K L;  4X65 Q;  2HD3 A;  3JAM i;  2ZJP A;  4JI7 Q;  1WCM H;  1H95 A;  2J7Z A;  2OQK A;  4Y52 H;  1QB5 D;  5DLQ E;  4K2L A;  4OO1 I;  4K5X A;  2BA0 A;  3U4V A;  4ODG A;  1UE6 A;  4KK7 A;  2K7V A;  1I94 L;  4A3C H;  2GVA A;  1VQE A;  1PTO H;  2PQE A;  3EQL C;  1PH3 A;  4IUN A;  5IYB G;  4I65 A;  4H13 C;  1TWA H;  4QIW E;  3S1R B;  1HXY D;  1VQB A;  1CKM A;  4LWC A;  4UP9 A;  5J22 A;  4LF4 L;  1PV4 A;  2PPB C;  3HOW H;  1HR0 Q;  2F0U A;  2VQE Q;  4P74 A;  3HFZ B;  4CDD C;  2FIN B;  4LF9 L;  3LNN A;  1ET6 A;  4XXE A;  4OIJ A;  1EY7 A;  3BS1 A;  1SXT A;  1Q1B A;  4R4C A;  4YWK A;  1UAP A;  1B50 A;  4QUC A;  3OIQ A;  1F2M A;  1VQI A;  2R7Z G;  2JXM B;  1ZYR C;  1DXM A;  1SMX A;  4LFA Q;  5M3F H;  4R9W A;  4LFB Q;  1X3E A;  3C3L A;  1YI2 A;  3BG3 A;  2KVM A;  1Z7T A;  4PZ7 A;  4BBS H;  1QWY A;  4TKO B;  2PZW A;  3BZC A;  5C5M A;  1JCK B;  2N88 A;  3DWP A;  3A0J A;  1FR3 A;  3CQZ B;  4AYB B;  3NBH B;  2FMC A;  1O80 A;  5AFW A;  3IKJ A;  4JCV E;  1MSH A;  2UUB Q;  2KOL A;  2K05 A;  4DV5 Q;  3GV6 A;  1LM0 A;  1PRT F;  1CQF A;  3HOW B;  1STY A;  3QOL A;  4Q0F A;  1HTL D;  1ESF A;  1OXT A;  3R8B A;  2F0P A;  1IKL A;  3RUZ A;  1SYF A;  1AEX A;  1Q86 C;  2EDG A;  4LFC Q;  4A3K G;  1SR3 A;  1X3F A;  1YZ6 A;  3TS0 A;  1FNW A;  4X3S A;  4JI4 Q;  4IUT A;  4PMW A;  2CVR A;  1LO5 D;  4A76 A;  3RD4 A;  1UEB A;  3RZD H;  5C3X A;  4AYB G;  4P75 A;  4CGY B;  3M85 A;  3PO3 H;  3MEF A;  3KLS X;  2EPB A;  5IYB H; 
#chains in the Genus database with same CATH homology
 2Z0S A;  4LF8 Q;  2F52 A;  4DR2 Q;  4A4I A;  2UUA L;  5LMU L;  1M1K C;  4GKJ L;  5GAD C;  4IPC A;  4DV4 L;  2NN6 G;  4DKA C;  1IBM Q;  2ID0 A;  5LMN L;  3HOY G;  3W1B A;  2YYZ A;  1W2B A;  1M90 C;  4X66 Q;  2KHI A;  5IP9 G;  3PV0 A;  2HIV A;  4OON A;  4YHH Q;  2K5V A;  1IBK L;  4AQY L;  2VUM G;  5LMN W;  1YIJ A;  4X66 L;  1YHA A;  3SGI A;  3GTM H;  2EIF A;  3OW2 A;  2JA7 G;  3J81 j;  4GN4 B;  4LFA L;  1J5E L;  2PQA A;  3H3V H;  1N33 L;  1VQG A;  4GKK L;  2ZTE A;  4O2D A;  5FLX c;  3GTK H;  4JI2 Q;  2D0O A;  4DV2 L;  2JEA I;  3NEM A;  3CAM A;  4BA1 I;  3F2B A;  2Z6K C;  4DR5 L;  1K83 H;  4GS3 A;  2E5L L;  3TS2 A;  4A3B H;  1N8R C;  4WJ4 A;  1JT8 A;  1E1T A;  1KAW A;  3STB C;  2K5H A;  1XPU A;  1U5K A;  1VQA A;  1RIP A;  2OTL A;  4B3S L;  4LF9 Q;  3GD7 A;  1FJG L;  4JI6 Q;  2ASB A;  4HID A;  4YY3 L;  1CSQ A;  4A3L G;  1K9M C;  4C3I H;  3OTO Q;  1QVF A;  2HHH L;  4JI4 L;  2I5M X;  2Q2I A;  5FJ8 H;  2YV5 A;  2YU9 H;  3ERS X;  4DUZ L;  1KC8 C;  1QUQ B;  4NXN L;  4LUV A;  4DV1 Q;  5JJK A;  2UXD L;  3ULL A;  3F8T A;  2UXC L;  1SRO A;  3K8A A;  3J81 c;  1E3P A;  3PUZ A;  4X6A H;  4AIM A;  2Y0S G;  1XNR L;  4AYB E;  3CCU A;  3PUW A;  1I94 Q;  4DV6 Q;  4JYA L;  2PNH A;  3S1N H;  5HGQ A;  2Q2U A;  4DK6 C;  3J80 c;  4B3T Q;  1KXL A;  2WB1 G;  2K5N A;  3CC4 A;  1VQO A;  1LTL A;  1QUQ A;  4L5T A;  4LF5 L;  4A3K H;  2VQE L;  4LF6 L;  1N36 Q;  1PA6 A;  1IBL L;  2JA6 H;  2NZH A;  4HJ7 A;  4J15 A;  4DR3 Q;  1VQ7 A;  4LF4 Q;  3H3V I;  5IWA Q;  1PH7 A;  3D0F A;  4GNX A;  2DGY A;  5IE8 A;  4DPG A;  1WFQ A;  5BR8 Q;  2BH2 A;  3KF6 A;  3E0E A;  3OYY A;  3FHW A;  4IO9 A;  4X62 Q;  4Y7N H;  1HNW L;  2MFI A;  4X64 L;  1Z47 A;  3K7A H;  1Q81 C;  1VQK A;  2JK8 A;  3Q8D A;  1VS0 A;  2R93 G;  4DV1 L;  1SFO H;  2YTV A;  4JBW A;  2KBN A;  4NXN Q;  2IX1 A;  1GO3 E;  4X62 L;  1KRS A;  3K0X A;  3RZO H;  2PQA B;  4XIG S;  2LXJ A;  1TWC H;  1VCI A;  3RNU A;  3VDY A;  1TWF H;  2YTX A;  4LF7 Q;  4JI1 Q;  1MJC A;  3AEV A;  1UE7 A;  3CME A;  2RCN A;  4WJ3 M;  4BY7 G;  4OWT B;  2WFW A;  2E2J H;  4A3F H;  3J80 i;  3DLL A;  3A74 A;  1PH4 A;  1Y1V H;  2K50 A;  1L1O A;  1N36 L;  4P73 A;  1E1O A;  3M3Y H;  2A1A A;  4JI2 L;  1HH2 P;  3GTP H;  4A93 H;  4KLK A;  1JB7 A;  2KHJ A;  3A5U A;  1UE1 A;  2A19 A;  2MO1 A;  1PH1 A;  4DV6 L;  1D7Q A;  2N8N A;  1YJW A;  4GLA C;  3D31 A;  4GLV B;  2PMZ E;  1ASZ A;  1S40 A;  3J7Z C;  2Y0S E;  1N9W A;  1HNW Q;  4TQU S;  1SN8 A;  4YHH L;  1EWI A;  3G6E A;  2UXD Q;  2I5L X;  2KCM A;  4GNX B;  5JJI A;  5C3E H;  1EOV A;  3CCL A;  3LGJ A;  2WB1 E;  1YNX A;  5IP7 G;  1K8G A;  1U0L A;  2LXK A;  3HOZ H;  1V9P A;  2UXB L;  4GKJ Q;  1Y1V G;  3AFP A;  4QJF A;  3KJO A;  4DR3 L;  1Y14 B;  4IFD G;  1B70 B;  2ZM6 Q;  3U50 C;  1IBL Q;  4JI6 L;  4POF A;  3KF6 B;  5FJ8 G;  5H1S E;  3HKS A;  2E8G A;  1Q46 A;  2CWP A;  3PIP A;  1A0I A;  2E2I H;  4BY7 H;  4B3T L;  1HZA A;  3S16 H;  4IJH A;  2C35 B;  3HOX G;  1P8L A;  1FVI A;  2ATW A;  1OXV A;  4DR6 Q;  5ELO A;  4YWM A;  1PH5 A;  2IX0 A;  1N33 Q;  5GAH C;  1X54 A;  4R4O A;  3ULJ A;  2VUM H;  2JE6 I;  2UXC Q;  4JI8 Q;  1JJC B;  3K80 C;  2OCE A;  4H02 A;  5IP9 H;  2K75 A;  1IBK Q;  4L5Q A;  4A3J H;  1HZB A;  2PI2 E;  3BJU A;  3CPW A;  5M3F G;  4DUY L;  4BXX G;  1GVP A;  4A3G H;  1BBW A;  3TRE A;  4KHP Q;  3JAM c;  1JE5 A;  2CWA A;  3UDI A;  1MIU A;  2JA6 G;  4DV3 L;  4DV5 L;  3CMA A;  2UUA Q;  1KHI A;  3HOU H;  1Q8K A;  5C44 H;  2HIX A;  2XGT A;  1YBY A;  1E24 A;  4MNO A;  3PIO A;  4TVA B;  3FKI H;  3S2D H;  1G6P A;  3I4M G;  1QVC A;  2KEN A;  2IT1 A;  5IYD G;  1D8L A;  2QGQ A;  5JEA G;  1XNQ Q;  3HOV H;  1TWH H;  1OXX K;  4JBM A;  4HJ5 A;  1JMC A;  2VNU D;  4R4Q A;  3I2Z A;  3HOV G;  1EUJ A;  3H0G G;  3S1M H;  5FLM H;  4GKK Q;  5M5X H;  1MKH A;  3NEN A;  1EIF A;  4GOP C;  1GD7 A;  2MO0 A;  3HOU G;  4QQB X;  2AHO B;  2FXQ A;  1X6O A;  2N49 A;  3CP0 A;  2EQS A;  4LFC L;  5IY0 A;  3JC6 6;  2AWO A;  1EQR A;  5C4X G;  4DR4 Q;  5M5Y H;  2AMC B;  2UUC L;  1VQP A;  1VQH A;  4A3D H;  2IHF A;  2VY3 A;  3L2P A;  4HJ9 A;  1JJG A;  4OWW B;  1LYL A;  4IOC A;  2R7Z H;  4DR6 L;  1KRT A;  1TWG H;  2R92 H;  3RLN A;  5IYD H;  4NXM L;  2KCT A;  2AKW B;  3E9I A;  1WYD A;  4HJA A;  1XJV A;  2Z6K A;  2UUB L;  4HIM A;  2CCZ A;  5C44 G;  4LW1 A;  5IYC G;  3GO5 A;  1XMO Q;  3M4O H;  5IT9 c;  1JJ2 A;  5GAG C;  4DR1 L;  5FLM G;  4LF5 Q;  1A62 A;  4A3I H;  2DUD A;  3T1Y Q;  1XMQ Q;  1GKH A;  4B3M L;  1VQN A;  1VQ4 A;  4DAM A;  5HY6 A;  4POG A;  1EYG A;  4LUZ A;  3S15 H;  3ULP A;  1EFW A;  3STB D;  4BY1 G;  1IYJ B;  1NJI C;  4NPS A;  5C0X J;  1N34 L;  2Q2T A;  2YTY A;  3CC7 A;  4GOP B;  2OQ0 A;  1PH9 A;  3RLF A;  4L5S A;  3CQZ H;  2UUC Q;  2NVT H;  1N34 Q;  4L5R C;  4UP8 A;  4DR4 L;  5AJ3 L;  3UE0 A;  2QEX A;  2OTJ A;  2B29 A;  4LNQ A;  1MJE A;  2R93 H;  1UE5 A;  1NY4 A;  3GDE A;  3IRB A;  4DAY B;  3T1Y L;  4B3M Q;  1VQD A;  5E7N A;  5IYC H;  1OTC A;  4OX9 L;  4ME3 A;  1PYB A;  3PO3 G;  3ICE A;  4JI7 L;  1I6H H;  1NBW A;  1T9H A;  4JOI C;  4X65 L;  4DV7 Q;  3GTO H;  3HOW G;  4K0K Q;  3A5Z B;  1OXU A;  1L2F A;  1V1Q A;  2GVB A;  1WI5 A;  3EIV A;  4DV7 L;  4A3F G;  1RL2 A;  2B63 H;  4DR7 L;  3PUV A;  1XNQ L;  1PH6 A;  3RLO A;  4DV2 Q;  2WP8 J;  3I4N H;  2D0P A;  1HZ9 A;  1NE3 A;  3UDG A;  2Q2H A;  4BBR H;  1EQQ A;  1PH8 A;  4A3E H;  1G51 A;  1YHB A;  3S24 A;  5M5W H;  1CUK A;  2ES2 A;  3HOZ G;  3W5O A;  1A8V A;  3I4M H;  1CSP A;  3KLW A;  3F1Z A;  4DUY Q;  4YWL A;  5C0X I;  1BBU A;  1YEZ A;  5J3B A;  4A3M G;  2N78 A;  3CCE A;  3BZK A;  5IWA L;  1WJJ A;  4A3E G;  3UDX A;  4PZ8 A;  4RMF A;  4JI8 L;  3TEH B;  3F2C A;  2JA5 G;  2JA8 G;  3PCO B;  1IBM L;  4IFD I;  1AH9 A;  3KDF A;  5ELN A;  4DV4 Q;  4JI0 Q;  4R4I A;  4R4T A;  1L1O C;  2IHE A;  4A3C G;  3PF5 A;  2CKZ B;  4LF8 L;  1CKO A;  3FP9 A;  3M4Q A;  5GQO A;  3HKZ E;  5GRO A;  1Y1W G;  2JA9 A;  2A8V A;  4JV5 L;  4KHZ A;  1C9O A;  4EX5 A;  3L0O A;  2R7F A;  4GOP A;  5EAY A;  1XNR Q;  3G48 A;  2JA7 H;  4IOA A;  1VQ8 A;  3I4O A;  3CF5 A;  2JEB I;  3S14 H;  1I5F A;  3BU2 A;  2ALY B;  4HJ8 A;  4KHP L;  1K73 C;  2UXB Q;  2ZJQ A;  3MXN B;  3S1R H;  1C0A A;  2VQF Q;  3CCQ A;  1HNX Q;  3TRZ A;  3G71 A;  4DV0 Q;  2ZTD A;  2CFM A;  4MZ9 A;  2VQF L;  4PG3 A;  3CXC A;  1HNX L;  4YCV A;  4BBR G;  4JI5 Q;  1IL2 A;  4BXX H;  3CCV A;  4NB3 A;  1S3O A;  1L0W A;  3T1H L;  1R9T H;  2K4K A;  2RHQ B;  5C0X G;  3K7U C;  3GTL H;  4JI3 Q;  1N32 L;  1A63 A;  2NVX H;  3L7Z C;  1VQJ A;  4C3H H;  4B3R L;  1PFS A;  2UU9 L;  1QZG A;  3UDF A;  2E5L Q;  1S72 A;  1O7I A;  1KIX A;  1Q82 C;  1K3R A;  1VQ5 A;  2NVQ H;  4BA2 I;  1SLJ A;  5M3M H;  5GAE C;  1PVO A;  1K0R A;  5IP7 H;  3RN2 A;  3FKI G;  1AE3 A;  2I5H A;  2UU9 Q;  3S17 H;  3U4Z A;  4JI0 L;  1J5E Q;  1YHQ A;  1L1O B;  4OO1 G;  3ZJY C;  3GTJ H;  1CKN B;  3J7A 5;  1PYS B;  5C4J H;  4UP7 A;  4DV3 Q;  2NN6 I;  2WAQ G;  4JBJ A;  3CCS A;  3KJP A;  4JC0 A;  3T1H Q;  4JI1 L;  4UY8 C;  3PSI A;  3TQY A;  3S1Q H;  3AQQ A;  3GTG H;  2BA1 A;  4FDB A;  4DV0 L;  1VQF A;  2H5X A;  4P72 A;  3I56 A;  4C3J H;  1AE2 A;  2R7D A;  3KOJ A;  3W1G A;  1P16 A;  4LFB L;  2ZTC A;  3ER0 A;  4X64 Q;  4EQ5 A;  3PF4 A;  2K52 A;  4IPH A;  1K8A C;  2EXD A;  2HQL A;  3RR5 A;  2ZJR A;  3GTQ H;  4OXP A;  1VQC A;  2VL6 A;  4HIO A;  4QY7 A;  3F2D A;  3S2H H;  1VQ9 A;  4DNI A;  1BKB A;  1LUZ A;  1V43 A;  4JV5 Q;  4JOI A;  1OXS C;  1Z9F A;  2VZA A;  1NMG A;  3UE1 A;  4O0A A;  1GM5 A;  1ASY A;  1E7Z A;  4X65 Q;  4K0K L;  3PUY A;  1CKN A;  3JAM i;  2ZJP A;  4JG2 A;  1WCM H;  2XTI A;  4GN5 A;  4OWX B;  1QVG A;  1BVS A;  4GN3 B;  1HR0 W;  4JI7 Q;  2OQK A;  4A3L H;  3I7F A;  1H95 A;  4Y52 H;  4A3B G;  1PHJ A;  4OX9 Q;  4JI3 L;  2ZM6 L;  1N32 Q;  5DLQ E;  1YVC A;  4OO1 I;  4YCW A;  4HIK A;  4LF7 L;  4DK3 C;  2F4V Q;  2BA0 A;  3U4V A;  1Y1W H;  1B8A A;  3AYH B;  1UE6 A;  1I94 L;  1UWV A;  2VS1 A;  4A3C H;  2GVA A;  1VQE A;  3RN5 A;  3CD6 A;  1B7Y B;  1PH3 A;  3AFQ A;  2N3S A;  2QA4 A;  2MQH A;  5IYB G;  4BY1 H;  4A3J G;  1I3Q H;  1TWA H;  4QIW E;  5BR8 L;  1HNZ Q;  2AWN A;  3CW2 C;  1VQB A;  2E2H H;  1CKM A;  4LWC A;  4UP9 A;  1W3S A;  3NEL A;  4DR1 Q;  4LF4 L;  4DR7 Q;  1PV4 A;  1E22 A;  4YCU A;  4A75 A;  3HOW H;  3HOY H;  5K36 G;  3I55 A;  1HR0 Q;  1WCM G;  1I50 H;  1VQL A;  4KI0 A;  3KDF B;  2VQE Q;  1FJG Q;  4P74 A;  3HFZ B;  4B3S Q;  3I4N G;  4LF9 L;  4XTC S;  1X56 A;  3DM3 A;  2I0Q A;  3PGZ A;  3M9B A;  2WAQ E;  2B3G A;  1XPO A;  1SRU A;  2MNA A;  2VW9 A;  4DR5 Q;  1XPR A;  2B63 G;  1Q1B A;  4C2M H;  1VQM A;  4R4C A;  4YWK A;  1IZ6 A;  2R6G A;  4P71 A;  2BH8 A;  3E9H A;  1EIY B;  4GLX A;  2HT1 A;  1VQI A;  2R7Z G;  4GNX C;  5AJ3 Q;  1X65 A;  1Q7Y C;  4A3M H;  1SMX A;  4LFA Q;  5M3F H;  3PO2 G;  4A3G G;  1NTG A;  4LFB Q;  1X3E A;  1HJP A;  1YI2 A;  2JQO A;  1YIT A;  2JA5 H;  4PZ7 A;  4BBS H;  2JJQ A;  1J6Q A;  1HZC A;  3WWV A;  3U58 A;  3CCJ A;  1XTD A;  1NMF A;  3CCR A;  1QZH A;  1SE8 A;  1KQS A;  3BZC A;  3KF8 B;  4PZ6 A;  3M4P A;  1YJ9 A;  1XMQ L;  3OTO L;  2RF4 A;  4ALP A;  1DGS A;  2RHS B;  4AH6 A;  5JJL A;  3A0J A;  1X3G A;  3HOX H;  4JBK A;  3NBH B;  4DR2 L;  1X55 A;  4A93 G;  3PUX A;  1C7Y A;  1HR0 L;  3H0G H;  1KL9 A;  2JA8 H;  2D62 A;  3CC2 A;  4IJL A;  4MTN A;  1PH2 A;  2V1C C;  1XMO L;  4LF6 Q;  4JCV E;  3H15 A;  3CPF A;  2UUB Q;  2GN5 A;  3KFU A;  1KD1 C;  1HNZ L;  1Q12 A;  4QL5 A;  4DV5 Q;  4NXM Q;  1LM0 A;  3EN2 A;  3PO2 H;  4JYA Q;  4B3R Q;  1FL0 A;  4UPA A;  4RG1 A;  3CCM A;  4A3I G;  5C4X H;  5C3E G;  2IY5 B;  1OXT A;  4AQY Q;  3M7N A;  3KYH C;  2LSS A;  4BBS G;  2F3I A;  4IFD J;  3EBE A;  1WOC A;  1YJN A;  4JI5 L;  1Q86 C;  2F4V L;  1X9N A;  4DUZ Q;  2NZO A;  1TXY A;  5LMN Q;  2OWO A;  4A3K G;  4LFC Q;  1Q1E A;  1SR3 A;  1X3F A;  1YZ6 A;  2R92 G;  3TS0 A;  4IPD A;  3K81 C;  3J81 i;  3B6Y A;  1IXR A;  2HHH Q;  3HKZ G;  4PMW A;  2NVY H;  5LMU Q;  4JI4 Q;  2L15 A;  5M3M G;  4A76 A;  1FGU A;  1G29 1;  1UEB A;  3RZD H;  4YY3 Q;  1VQ6 A;  2CQO A;  2PI2 A;  4R1J A;  4P75 A;  4LUO A;  4AYB G;  3M85 A;  2K14 A;  4A3D G;  4QGU A;  3MEF A;  3PO3 H;  5JEA J;  4IPG A;  4APV A;  3G4S A;  5IYB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...