4DR1Q

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr1Q00
1J6QA 2HIVA 3UE0A 4LFBQ 3F2CA 3CP0A 3W1GA 1N36Q 2I0QA 3K7UC 4A3JH 5IYCH 1N33L 1A8VA 1VS0A 4BBRH 3S2DH 3T1HQ 1N33Q 3S1QH 5C0XG 4HIOA 3VDYA 3CPFA 3H0GH 5M5YH 4NXNQ 4DR4Q 5IYBG 2JJQA 4LF5L 3H3VI 1OXXK 2RF4A 4LW1A 2OTLA 3KF6B 3F1ZA 1V43A 2N49A 4GLVB 4YCWA 4L5QA 1XMQL 1PA6A 2PMZE 1P16A 2UUAQ 4GKKL 1N32L 2E8GA 3HKZE 4DV3Q 3HOVH 2R7ZH 4OO1G 4B3ML 4BA2I 3HKZG 4LFAQ 3GTPH 3S1MH 2K50A 2JE6I 2N8NA 4JI3L 3CCJA 4B3MQ 1FJGL 4LNQA 4DR7L 2IHFA 5IP7G 2VQEL 3I4OA 4DR7Q 2VNUD 2F52A 3ICEA 3D0FA 3KF8B 5FLXc 1XNQL 3S24A 4A3GG 4A3EH 1XMOQ 3U4VA 4LFCL 2MNAA 3STBD 5FLMG 4LFCQ 5GAGC 3I4MG 1SMXA 2IX0A 1PH2A 3CAMA 2R93G 2NVYH 5ELNA 5BR8L 5HGQA 4PZ6A 4YY3L 3HOZG 1HJPA 1S72A 4GOPB 4A3FH 5FJ8H 1YEZA 3OYYA 1K73C 2B3GA 1Y1VH 1NY4A 3Q8DA 2I5MX 5C4XH 2CWPA 4QGUA 1S3OA 1A0IA 4YHHL 4QJFA 1VQIA 3M9BA 1PV4A 4YHHQ 1PYSB 4DV4L 2ASBA 2NVXH 1HZBA 2ID0A 2QGQA 5C3EG 1IZ6A 3STBC 3PIPA 1IL2A 3HOYH 4ALPA 5JJIA 1X65A 2RCNA 4JI6L 1GKHA 4A93G 3CC7A 2ATWA 4DUZL 1C7YA 2E2HH 1LUZA 1C0AA 4AYBE 4JI8Q 3HOWG 3RN2A 2B63G 4AYBG 4P75A 1X6OA 4OWXB 4GLAC 4IPDA 2MFIA 4X62L 3JAMi 1X3FA 4AQYQ 4JI5L 4KHPQ 2UXCL 4QL5A 4IOAA 4X66L 4A3IG 3J81c 4PZ8A 1YZ6A 3BZKA 1GO3E 4DV2L 1IBKQ 3GTJH 3B6YA 5AJ3Q 3PF4A 4K0KQ 1L1OB 1CKMA 2MQHA 3UDFA 5GAHC 1H95A 1OTCA 2ZJQA 4P72A 3FKIG 3K8AA 2JA7G 1UE5A 2E2IH 1N34Q 2XGTA 1E7ZA 1HZCA 3CPWA 4B3TQ 4DKAC 2UXBL 2ZM6Q 2UUBQ 3PUYA 1M1KC 2UXDL 3ERSX 1SROA 2Q2IA 4GNXB 1HNXL 1JMCA 3H3VH 2AHOB 3CC2A 2NZHA 1HNZL 4POGA 3I56A 3G48A 3EN2A 1D8LA 4UP9A 2EXDA 3L2PA 3J7A5 1I3QH 1PHJA 4DV1L 1N8RC 4DUYL 1G291 4OXPA 1CSPA 1Q12A 2YTVA 1IBML 2KHIA 3S1NH 4OO1I 1YJNA 3I4NG 1QUQA 4MTNA 1VQBA 1WCMH 4DV6L 1EYGA 2N78A 2A8VA 2OWOA 1QVFA 2VS1A 2LXKA 1BBWA 5C0XI 1ASZA 5IE8A 4JI1L 1XJVA 1PH5A 1WYDA 1PH6A 1SRUA 4LWCA 4LF9Q 2R92H 3RNUA 4UY8C 3CCSA 4JV5L 4A3BG 4LUZA 5LMUQ 4A76A 4DR1L 2GVBA 4A3JG 3L0OA 2I5HA 4BBRG 1R9TH 4MZ9A 4PZ7A 3U4ZA 3S15H 4DAMA 3UDGA 5EAYA 1Q86C 1J5EL 3H0GG 4X65L 1VQ5A 4AH6A 3HOUG 4C3HH 4DR2Q 1WI5A 4DV5Q 1VQ4A 1JJ2A 2JEAI 1CKNB 3PUZA 1TWGH 4LFBL 1N36L 2AMCB 3DLLA 3OW2A 2WB1E 2JA6G 4GN3B 3CMEA 4GS3A 3RN5A 4OX9Q 1OXUA 2WB1G 4BY7G 2OQKA 1AE2A 3I7FA 3UDXA 3UDIA 3RZDH 1SFOH 3T1HL 3NELA 4TQUS 1EQQA 1KD1C 3UE1A 3ULJA 4JI4Q 2YV5A 4JI7Q 1QUQB 3ULPA 4NXNL 4JBMA 1AH9A 3NEMA 3GD7A 1YI2A 3CCVA 4JC0A 2ZTDA 3K7AH 3A0JA 2UUCQ 3RLOA 1VQJA 3OTOQ 4A3DG 1OXSC 3NENA 4POFA 1XPRA 2UUAL 1DGSA 5GROA 1MIUA 2K5VA 5JJLA 3CCLA 2VL6A 3PV0A 4DV3L 4IFDG 4B3RQ 4XIGS 1BBUA 4Y7NH 4GN4B 2KENA 4EX5A 1NMFA 4IPCA 4LFAL 3K81C 1YJ9A 1I94Q 1Y1VG 3CCQA 2D0OA 4OWWB 1AE3A 2V1CC 4YWLA 3PO2G 4ME3A 5C4XG 1A62A 5M3MH 5C0XJ 1XMOL 1HR0Q 2RHSB 4GLXA 2PI2E 4A75A 2ES2A 2JQOA 2Q2TA 2UU9Q 4JYAL 4A3LH 5E7NA 3S14H 4JYAQ 1I6HH 2K14A 1CKOA 5ELOA 4DV7Q 1XPOA 1Y14B 4JI2Q 4LF8Q 2BH8A 4DR5Q 2YTXA 1PH9A 1FVIA 2IX1A 4YWKA 1KAWA 2R7FA 1CSQA 1QZHA 1YNXA 2Z6KA 3PO3G 3AFPA 1V9PA 3AQQA 3KJPA 3RZOH 1JJCB 2AWNA 1I50H 2H5XA 2KHJA 2A1AA 3A74A 4J15A 1QVGA 3S16H 3KDFA 4YCVA 4NXMQ 3GTMH 3K0XA 2F4VQ 1IBLL 4HJ7A 1BVSA 3TRZA 4DAYB 1TWCH 4HIKA 1IBLQ 3GTQH 2JA8H 1ASYA 1YVCA 4QY7A 1E3PA 2DGYA 4R4TA 2NVTH 4BXXG 1YBYA 5GAEC 4JI8L 3KYHC 3AEVA 4X6AH 2BA1A 3AYHB 1PH4A 4R4OA 2GVAA 4TVAB 4AIMA 2VQFQ 3GTKH 1NTGA 4AQYL 3E9IA 4IPHA 4KHPL 1G51A 3ER0A 2E2JH 1EQRA 2PQAA 3T1YQ 2VUMG 2BA0A 3RLFA 4GN5A 2JA5G 3CXCA 2D0PA 3SGIA 5JEAG 1IBKL 2E5LQ 1UE6A 1U0LA 4OWTB 1E22A 3D31A 5AJ3L 5IP7H 3RLNA 2XTIA 4K0KL 1E1OA 1VQAA 3J7ZC 1X56A 1KHIA 1XNRQ 5FLMH 2HIXA 1MJEA 3I4MH 3W5OA 1N34L 1L0WA 3KOJA 2R93H 3PUWA 4JBWA 4B3TL 3HOXG 3J80c 1VQ9A 2ZM6L 2UUBL 3HOZH 2ZTCA 4BA1I 1VQCA 5LMNL 3G6EA 1L2FA 3J81i 2R6GA 2EIFA 5LMNQ 4L5RC 5JEAJ 4LUOA 2L15A 3KFUA 3FHWA 4O0AA 2MO0A 4P71A 2Z6KC 1K8AC 5C3EH 1VQPA 2R92G 4JI0L 1KC8C 4JI0Q 1IYJB 4HJ8A 1JJGA 3GDEA 1Q82C 2GN5A 4A93H 3A5UA 2KCMA 4X64Q 1VQGA 2VW9A 4A3KH 3HOWH 5IWAQ 2IY5B 5IYDG 2LSSA 2PQAB 4RG1A 5IP9G 1VQNA 3AFQA 3M7NA 4A3MG 2RHQB 1MKHA 4BY1G 3TS0A 2JA9A 2YU9H 4PG3A 1YHBA 4LF9L 2CKZB 2OTJA 1GM5A 5LMUL 4FDBA 3CC4A 4HIMA 5C44H 2KCTA 2HQLA 2Z0SA 1YJWA 3PSIA 5IYCG 5M3FH 1B70B 4LF4Q 3FKIH 4IFDI 2JA7H 5DLQE 1EIFA 3G4SA 1LTLA 2JK8A 2WAQE 3BZCA 3F2DA 2JEBI 4DR3Q 2WFWA 3CMAA 2WAQG 4DR2L 3HKSA 2I5LX 2KBNA 4DV5L 1SLJA 2R7DA 4GKJQ 1HZ9A 5C4JH 2CWAA 1Z9FA 1HNWQ 3K80C 4DV0L 2QA4A 4DV0Q 1VQOA 4P73A 1NJIC 4IO9A 1WJJA 3L7ZC 1NMGA 4OX9L 3HOVG 2OQ0A 4B3SQ 2R7ZG 4DR6Q 1RL2A 4LF7Q 4DK6C 1YHAA 1E24A 1K0RA 4JI4L 4JI7L 1S40A 4UPAA 3I4NH 1QVCA 3IRBA 4O2DA 1TWHH 4A3LG 3GO5A 4A3EG 1W2BA 4JOIA 1PH8A 1EUJA 1NE3A 1JB7A 3TQYA 3BJUA 2UUCL 3OTOL 4IPGA 3U58A 3ULLA 1PYBA 4DK3C 1VCIA 4B3RL 1Q7YC 1Q81C 3G71A 1Q8KA 1O7IA 1QZGA 4GOPA 4A3FG 1CUKA 5FJ8G 2IT1A 1UE7A 2K4KA 1WOCA 3J81j 1I94L 5LMNW 1Y1WH 4A3BH 2AWOA 1M90C 4IJLA 2MO1A 3PUXA 3PF5A 3NBHB 1HR0L 3HOYG 1LYLA 2HT1A 2UU9L 5HY6A 4NPSA 3F2BA 1B7YB 3EBEA 1PH7A 2JA8G 4WJ3M 4DV7L 1VQLA 4JI2L 5M5WH 4LF8L 3HOUH 4DR5L 4YCUA 4LF5Q 4BBSH 1HH2P 3TREA 4A3CH 4APVA 1P8LA 3HFZB 3MXNB 1FGUA 4IFDJ 1VQDA 3M4PA 4KHZA 4DPGA 1YIJA 1XMQQ 1N32Q 4GKKQ 1VQ6A 3E0EA 2CCZA 2JA6H 1T9HA 2ZTEA 1D7QA 4HJAA 5K36G 4LF6L 2IHEA 4LUVA 1PH1A 1UWVA 3KLWA 4LF6Q 4BY7H 4NXML 4IJHA 3GTGH 2DUDA 4JI3Q 4JG2A 5H1SE 2F4VL 2ZJRA 1FJGQ 4HJ5A 2VQEQ 4UP8A 1KRSA 1FL0A 4JBKA 4DR4L 4OONA 1L1OA 4YWMA 1XNQQ 1XPUA 2WP8J 5IYBH 2YYZA 1GD7A 4A3DH 2N3SA 1Q1BA 1SR3A 1C9OA 1TWAH 4KLKA 3M85A 2VQFL 1VQFA 4JOIC 2D62A 1SN8A 5BR8Q 3I55A 3T1YL 4YY3Q 1SE8A 1KIXA 1RIPA 3PGZA 4C2MH 1KRTA 3JAMc 1XTDA 2K5NA 1VQ8A 2E5LL 2CFMA 4QIWE 4GNXA 3PO2H 4Y52H 1WFQA 3E9HA 3EIVA 1OXVA 2AKWB 1YITA 3KJOA 4GOPC 1I5FA 4DV4Q 1VQMA 2PI2A 1EFWA 3LGJA 1XNRL 4A3GH 1LM0A 1X9NA 4XTCS 1HZAA 4R4QA 3CW2C 1PH3A 1X3EA 4WJ4A 1N9WA 2C35B 2Y0SE 4JI6Q 1KXLA 3RR5A 4H02A 4DUZQ 1Q1EA 4A3KG 1WCMG 2YTYA 1YHQA 2Y0SG 1UE1A 3CD6A 2LXJA 1EOVA 1NBWA 3FP9A 2CQOA 3PO3H 4X62Q 1B8AA 2UXCQ 2NN6I 1Q46A 4HIDA 4JI5Q 2K75A 4X66Q 3MEFA 1EWIA 3KDFB 5J3BA 1U5KA 4DV2Q 4A4IA 4P74A 3S17H 2ALYB 5IT9c 5C44G 3I2ZA 3CCUA 3BU2A 4DNIA 2K52A 4BXXH 3GTOH 4X64L 1JT8A 1BKBA 5M3FG 5IWAL 5GADC 1G6PA 3J80i 1V1QA 1KQSA 1L1OC 2B63H 2VZAA 3M4OH 1TXYA 1Z47A 1UEBA 2A19A 1HR0W 4C3IH 4L5TA 3A5ZB 4R1JA 2UXBQ 3S2HH 2EQSA 4C3JH 3JC66 3CCRA 3PUVA 5IY0A 4A3IH 2VUMH 2JA5H 2UXDQ 5JJKA 2VY3A 3W1BA 3M3YH 1CKNA 3S1RH 1HNXQ 1TWFH 2NVQH 1K83H 1HNZQ 2F3IA 2OCEA 4NB3A 1JE5A 4GNXC 3F8TA 1K8GA 4LF4L 1KL9A 4DV1Q 4DUYQ 1K3RA 2NN6G 3CCEA 2NZOA 5GQOA 2QEXA 4HJ9A 4R4IA 4DR3L 1PFSA 1IBMQ 1OXTA 4MNOA 3HOXH 1GVPA 4L5SA 1IXRA 1EIYB 4DV6Q 4GKJL 3WWVA 1HNWL 2HHHL 4QQBX 1A63A 2HHHQ 2Q2HA 3DM3A 4PMWA 2BH2A 4KI0A 1K9MC 3KF6A 3H15A 3U50C 1X55A 4B3SL 4DR6L 3TS2A 1W3SA 4JI1Q 1VQ7A 4LF7L 1PVOA 3PCOB 1MJCA 1X54A 3PIOA 1Y1WG 4IOCA 4JV5Q 5M3MG 4DR1Q 1X3GA 4UP7A 3GTLH 2PNHA 3TEHB 5M5XH 4RMFA 2Q2UA 1J5EQ 2K5HA 5IYDH 3M4QA 3ZJYC 2B29A 4X65Q 3CF5A 4EQ5A 1VQHA 5IP9H 3CCMA 1VQKA 4BBSG 4A3CG 1VQEA 3CQZH 4JCVE 2FXQA 4A3MH 2ZJPA 4JBJA 1E1TA 4R4CA 4BY1H
chains in the Genus database with same CATH superfamily
2JYOA 3SR1A 4LFBQ 1DONA 2JA7B 2I0QA 1EY6A 3S2DH 3K0YA 3S1QH 3BYTB 1EU3A 1PFNA 3VDYA 2XRSD 1JWMD 2O2LD 2OTLA 5IGGA 3MHBA 3OWFA 4ZKCB 1XMQL 4L5QA 3NTKA 5CV4A 4IUVA 4DV3Q 2R7ZH 4OL7A 4XYQA 1CQFA 3T53B 4RCNA 2E76C 2LY7A 3JAML 2VNUD 3T51B 3Q6SA 3S24A 4A3GG 1XMOQ 3U4VA 5FLMG 2NZ1D 3I4MG 2R93G 1HPCA 5BR8L 5C3WA 2LMCB 1SYDA 1I4HA 3C2PA 5EPKA 1KDBA 3OYYA 2CWPA 1W6KA 1VQIA 5D14A 2QCPX 5IGCA 2ASBA 2QGQA 5C3EG 1EYCA 3PIPA 5KRUA 1GKHA 2B8GA 2Z9HA 3A8KE 2MP1A 3HOWG 1LTAD 1SNPA 2D2CC 2Z4IA 4O1NA 4AYBG 1X6OA 2A5HA 3GTPB 4IPDA 2L4NA 4BY7B 4QL5A 1B3AA 4A3IG 1DOMA 5K36H 2VB3X 1ML0D 3P1HA 3HS0C 1UAPA 3FEWX 3IFTA 1L1OB 3UDFA 2NVYB 2RBMA 1UE5A 5BN5A 1HZCA 4HCEA 2O5IC 1D2BA 2D5DA 2NVXB 3HOYB 2XWJB 1F9QA 1I4QA 2EXDA 2B2WA 2I46A 3J7A5 3SVMA 4V0BA 5JJZA 2X6LA 1Q12A 3MA2B 1PRTC 5CMDA 1EYAA 2N78A 3H09A 1BOSA 4OGQC 1Y8NB 2K5WA 1QVFA 3GTJB 2LXKA 3HGBA 1F2LA 5C0XI 1ASZA 5IE8A 5FO7B 3S17B 1XJVA 1PZID 1O80A 4LWCA 1RODA 3X3MA 4F87A 4UDUC 1MD2D 4A76A 1AN8A 5E4WC 4HMJA 3E5SA 3U4ZA 1Q86C 1BCPF 3H0GG 2JA5B 4AH6A 1XX8A 1II3A 2JEAI 2R61A 3MXNA 4XQQA 2L9HA 1N36L 5D3DA 3RN5A 2JA6G 1OXUA 2OQKA 3RZDH 3HOXB 2NN6H 3KLSX 5CYUA 4JI4Q 1QUQB 3ULPA 1EIHA 1AH9A 1K8MA 2EPBA 1A2UA 1CTMA 5IODA 4JC0A 3A0JA 4KN7C 3NENA 1G91A 2UUAL 5BN3A 4NW2A 3CCLA 2R92B 5C4ZA 4GZYC 2P5ZX 4IPCA 5LHY1 1I94Q 1Y1VG 1R9TB 3K58A 1AE3A 4K2LA 1A62A 5M5XB 3S15B 3FMCA 4C3HB 4A75A 2UU9Q 2JQOA 1IYUA 3OIPA 4DV7Q 1Y14B 4JI2Q 4JPBW 4DR5Q 1FVIA 2IX1A 1BUVT 1CSQA 1EYDA 1YNXA 3RZOH 3MFGA 1ILQA 1JJCB 2F0HA 4J15A 1QVGA 4FVMA 2EYMA 3KDFA 2OEOA 2SDFA 2QILA 4YCVA 2WAQB 1Z6HA 3R2IA 1SE2A 3I3CA 1E3PA 4X6AH 1YBYA 2QW7A 3KYHC 3AYHB 3HOVB 4C3IG 3ER0A 3PIP3 5CV6A 1YNJD 3WOFA 3T1YQ 3CXCA 3SGIA 1IBKL 1U0LA 4OWTB 1EEFD 5IP7H 4X3SA 3EJIA 2XTIA 4F7XA 1CZWA 1RDPD 5I2XA 4K0KL 1E1OA 3I91A 1KHIA 2HIXA 2F03A 3MXPA 1O78A 1LTGD 2L5TA 3KOJA 2L0CA 4B3TL 2UUBL 1Y8OB 3G6EA 2I07B 4O42A 1SNMA 1YNND 3MWYW 5IGFA 3KFUA 4EVOA 4O0AA 1K8AC 2JA8B 5BN4A 4U68A 1KC8C 2K1BA 4XYOA 3SK5A 3PMFA 3GDEA 3VYRA 1Q82C 4A93H 2B8FA 5ISRA 2F0TA 4RG1A 1VQNA 2OT2A 5IGBA 3AFQA 2PYKA 5IT9E 2CQAA 4A3MG 3DXJC 2IWHA 4DGZA 3ITPA 1GXDC 4KD4A 4LF9L 3MTSA 2CKZB 3D4RA 2B2UA 3CRLC 3DMUA 3RD4A 2K5QA 3CC4A 3I4MB 2HQLA 2R93B 1PDQA 4ZYSA 2WAQE 3BZCA 3TZDA 4JVZA 4DV0L 5DEHA 4DV0Q 5C3EB 1NJIC 4P73A 3C3LA 1WJJA 2R7ZG 3P75A 1RL2A 2EVBA 4DK6C 1K0RA 3HOWB 4HSVA 4JI7L 2FMMA 1ENAA 2MGSA 4AYBB 1AEXA 3I4NH 2RQXA 3FVQA 3IRBA 4O2DA 3GO5A 4Q0FA 1PH8A 4JOIA 1B50A 1NE3A 1V1PB 3BJUA 2UUCL 2A6EC 1G2SA 3Q0AA 5EJWA 3ULLA 1PYBA 1ICWA 4DK3C 1HQMC 1Q81C 1RHPA 5CV8A 1H9MA 1Y1WH 2AWOA 4NMZA 1IHZA 3E0JA 3NBHB 1HR0L 1PZKD 5HY6A 1B7YB 3EBEA 3L9AX 1PH7A 5KNDA 4BBSH 1TKWB 1HH2P 3TREA 1P8LA 3HFZB 2FMCA 3TSSA 4NKLA 3MXNB 4IFDJ 3KK7A 4DPGA 5JAVA 2H4OA 1YIJA 1N32Q 1VQ6A 5EQ0A 4HJAA 5K36G 5C5MA 4LUVA 4NXML 1TWHB 3RMHA 3SK8A 3GTGH 5C6AA 1KRSA 3PQIA 4G7ZC 1XNQQ 2K01A 3NTIA 1JC7A 2N3SA 3D4DA 2F0EA 4LK1C 4I65A 1STAA 3E6ZX 3NBIA 4KKUA 1E2WA 3I55A 2DY8A 1RIPA 3JAMc 2E5LL 3PO2H 2F3WA 1LO5D 1A3VA 3KJOA 1I5FA 4HTHA 2A6HC 1VQMA 5M5WB 1FNWA 5JOBA 2JP1A 4A3GH 4QCLA 1LM0A 1JICA 4ZRZA 3NQTA 4R4QA 1MBYA 2C35B 2Y0SE 3R3OA 5EKKA 1Q1EA 2YTYA 3NK9A 1LTTD 3FP9A 1GUTA 3GQBA 4X62Q 4WFN3 2NN6I 4JI5Q 4HIDA 2K75A 1EWIA 3KDFB 4DV2Q 4RGOS 2ALYB 5C44G 1TWAB 2M2LA 3CCUA 4RHRA 4BXXH 5IWAL 1Y69U 1V1QA 2EY2A 2HCIA 1TS3A 1TXYA 3M4OH 1RJTA 4L5TA 5JJKA 3JC66 3CCRA 4A3IH 3LNNA 3U9SA 2VUMH 5A2QE 5JEAH 3HP3A 1CKNA 3S1RH 4NP5A 1AFPA 1K83H 3V2TA 2OCEA 5I6YA 2RKSA 1B53A 3OPOA 1K8GA 4DV1Q 4DUYQ 1K3RA 1GHJA 2NN6G 3CCEA 4HJ9A 1IBMQ 4R4IA 4V190 1UUPA 4WJWA 1SNCA 4L5SA 4EGVA 1IXRA 4DV6Q 1GJXA 3AB9A 4QQBX 4HR7B 1A63A 2QDBA 2K32A 1SYBA 1SJHD 3I73A 1JB3A 1TQOA 4EQOA 4LF7L 1JOOA 3PCOB 3GTOB 1S5CD 4IOCA 4JV5Q 2JN4A 5HGTA 4UP7A 4DR1Q 3GTLH 3LWUA 2MJ8A 1WTVA 2AQ1B 1U4LA 1J5EQ 2E74C 3CCMA 5IP9H 2F0MA 4HSPA 3CQZH 4JCVE 1E1TA 4K14A 4BY1H 3A8JE 3CP0A 1STEA 3FKIB 4DXFA 5I4DA 1M4VA 5IYCH 1SYGA 3T1HQ 1PMRA 4HIOA 4DNTB 3H0GH 4DAYA 1HRJA 5M5YH 4LF5L 2JJQA 1OXXK 2RF4A 4LW1A 4IQZA 2QEJC 2N49A 4YCWA 2M9VA 1P16A 2PMZE 3TP8A 2KQ3A 4B3ML 4BA2I 3HKZG 4ILWA 4B3MQ 3CCJA 4LNQA 2IHFA 5IP7G 2F52A 3ICEA 4LFCL 4A3MB 3STBD 4LFCQ 3FDTA 5KIXA 1SJED 2IX0A 2PZTA 5HGQA 1MSHA 4A3BB 2RDFA 4A3FH 3S2DB 1Y1VH 1NY4A 3S1QB 1S3OA 1A0IA 4JK1C 4QJFA 1D1KA 4DV4L 2ID0A 3HZXA 1X65A 4A93G 1SEBD 2ATWA 1C7YA 1NCVA 2E2HH 4JI8Q 2B63G 4N9TA 1QZHA 3EQLC 2DJFC 4OWXB 3JAMi 2MFIA 4AQYQ 1X3FA 4IOAA 4G57A 5IGDA 3J81c 1YZ6A 3N6RA 4ZK9B 3GV6A 5AJ3Q 3BVGA 1U4RA 2MQHA 5GAHC 2B2VC 1G8ZD 4B08A 1QE6A 4I7AA 2E2IH 2B2YA 3CPWA 1Q8IA 3E3XA 2UXDL 2N88A 2G9DA 2Q2IA 3H3VH 2AHOB 1HNZL 4POGA 5KNCA 3L2PA 2A73B 1I3QH 2XN9C 4XT3B 1G291 4OXPA 3I4NG 1QUQA 4MTNA 2Z6BA 1WCMH 1EYGA 1STYA 1K3BC 1LT4D 1STHA 5COYA 1WYDA 4CDCC 1BCPB 1UNSA 3CCSA 1K28A 3A56A 4RKBA 1MSGA 5LMUQ 1DD2A 1JR0D 4MN3A 4A3JG 1IL8A 1EOTA 4BBRG 3UDGA 3ND9A 5EAYA 4X65L 1EY7A 4DR2Q 1WI5A 2NUCA 2A6ED 1S5BD 1CKNB 3PUZA 4LFBL 2AMCB 3H3VC 2WB1E 3CMEA 2IPKD 1SFOH 1KD1C 1EQQA 3NELA 4TSSA 2DN8A 1WTPA 2J7ZA 3NEMA 3GD7A 1YI2A 3CCVA 4N8FA 5J22A 3QIAA 5JVH3 3OTOQ 4POFA 2KECA 1XPRA 5GROA 2VL6A 3NHHA 4DV3L 4B3RQ 4XIGS 1BBUA 2N55A 2WV6D 2EOTA 4EX5A 3K81C 3T16A 2K33A 4FF2A 5C4XG 2V1CC 4YWLA 3PO2G 4ME3A 2KOLA 5M3MH 3A55A 5C0XJ 4F8MA 1XMOL 3MC0B 4GLXA 2Q2TA 2MPMA 3TZUA 3S14H 1I6HH 1ENFA 4LF8Q 2BH8A 5EKLA 2L1BA 2YTXA 3WDNA 4YWKA 1KAWA 4OO1H 1A3UA 4CBVA 2EJMA 4K8IA 1EQTA 1T5XD 2Z6KA 3AFPA 1V9PA 3AQQA 3KJPA 3RZDB 2AWNA 2H5XA 3A7LA 3A74A 2A1AA 3K59A 3GTMH 3NTHA 2F4VQ 4HJ7A 1BVSA 4KV6A 4ODGA 1TWCH 4DAYB 4HIKA 3GTQH 4DR4Q 2A6HD 3BVMA 5T1IA 2NVTH 2YU9B 4BXXG 3GV3A 2VQFQ 4CKEA 1G51A 2VUMG 2BA0A 3RLFA 4GN5A 4EQPA 2D0PA 1B9NA 5JEAG 3D31A 1ENCA 3CKIB 2ENBA 3QJYA 3Q23A 1QB5D 1DZ1A 3VYTA 2WINB 1XNRQ 2CHBD 1CHQD 5HURA 3SEBA 5K5PA 3J80c 5FO8B 1Y8PB 2CW0C 2K04A 2ZTCA 2EY6A 3HOZH 1BQQT 3RZOB 1L2FA 3J81i 2JXMB 2D9UA 2KUMA 5CV5A 1CK1A 2PQEA 2L11A 1C48A 1TY0A 3G7LA 2FJ2A 2MUYA 4JI0L 2Z4HA 4JI0Q 1BR9A 1IYJB 3A5UA 2SNSA 3KBXA 4CKBA 1SMYC 4EQNA 5C4HA 2AQ3B 4RGNA 1V1PA 2IX3A 2LSSA 5IP9G 1S5FD 3M7NA 1XYIA 3ERQA 1J9OA 3V05A 4BY1G 2JA9A 1YHBA 2XNAC 1A15A 4XQJA 1JORA 2QKIC 3I8ZA 2OTJA 1GM5A 4FDBA 3EA6A 2EJFC 5C44H 2KCTA 1VMCA 5IYCG 3NBHA 2F0NA 3CRKC 2AQ2B 5KNBA 2JA7H 2DJGC 1O7LA 3F2DA 1OO9B 4DR3Q 2I5LX 5FOBB 1J8IA 3SK4A 2IW3A 1HZ9A 5C4JH 5I9OA 2QA4A 1CZGA 1JCKB 2F1MA 5FKAC 1W6JA 2IJ0A 4FNFA 3U9OA 4H7BA 4DR6Q 1RD9D 4A93B 3S1NB 4JI4L 1S40A 3C1FA 4K6DA 1F2MA 1QVCA 2XVSA 4A3LG 3H6MA 4TRDA 1EUJA 2F0GA 1JB7A 2BE5C 4QB4A 1D5XC 3U58A 2J0TD 3CHBD 1VCIA 1O7IA 1ZYRC 4GOPA 4A3FG 1I94L 3TN2A 1M90C 4HEDA 3VA7A 1WTRA 1JE4A 2PCFB 3ND8A 2UU9L 1NNXA 4C56C 3UI2A 4WJ3M 4DV7L 4JI2L 5EBDA 1DOLA 4YCUA 4DR5L 3HOUH 2F0IA 3QO2A 2NB0A 4KHZA 2PW5A 4ZQ3A 4GKKQ 3LWEA 1EU4A 2Z8LA 2CCZA 1T9HA 1PH1A 3I4NB 4BY7H 4K5WA 5TSSA 4JI3Q 5H1SE 3J81L 2ZJRA 1FJGQ 2B2TA 4HJ5A 2VQEQ 4UP8A 1FL0A 4J6HA 3K7AB 3G6JB 4A3DH 1Q1BA 1R4QB 4B9WA 4KLKA 4RA8A 1G6ZA 4IFDH 1Y1WB 3T1YL 4YY3Q 3TP6A 2KEDA 1PFBA 3J7AF 4GNXA 1DM0B 1OXVA 5EPLA 4M8AA 4BBSB 1X9NA 5ELFA 1X3EA 1SXTA 4JI6Q 1S4ZA 1WTWA 4DUZQ 4A3KG 1WCMG 2Q8TA 4G4KA 3BVZA 1UE1A 3CD6A 1EOVA 1I50B 1QILA 3FPPA 3S16B 4KJOA 1QNKA 3PO3H 3GTGB 3T4AC 2UXCQ 4ZCKA 3QWNA 1Q46A 4X66Q 3MEFA 4RFBA 1A6XA 1PFMA 2EDGA 2SNMA 1QNUA 3TP5A 5CV9A 4X3UA 1DJRD 3S17H 4IUTA 3BU2A 1JT8A 5M3FG 5GADC 2KEEA 1D5ZC 3J80i 1XXGA 2E2JB 1L1OC 2XRQD 4MIUA 2B63H 2OF1A 1UEBA 1LTBD 1HR0W 1CQVA 3I72A 2UXBQ 4QMGA 2EQSA 4C3JH 3PUVA 5IY0A 2JA5H 1I4GA 1AW7A 4RH6A 1LTRD 1HNXQ 4A3GB 1TWFH 1EY9A 3X3NA 3HRZC 1SE4A 5T1GA 4NB3A 1JE5A 2XWBB 4H13C 4HN7A 4XXEA 5GQOA 2RDHA 1PFSA 1EY0A 1OXTA 4MNOA 3HOXH 1GVPA 3WOEA 1EIYB 4G7OC 2HDLA 4PMWA 3MXUA 4KI0A 1CM9A 1KTKA 4JI1Q 1PVOA 2CH4A 1X54A 3DWAA 3PIOA 5M3MG 3M4OB 2PNHA 2K6AA 5M5XH 1LT3D 3A7AB 4OELB 4A3IB 2VUMB 1JWSD 2K5HA 1PTOH 3M4QA 3CF5A 4EQ5A 3S1RB 1VQKA 4A3CG 2L55A 2FXQA 1K83B 4OO1G 1J6QA 2HIVA 4FO2A 3UE0A 3W1GA 1DYQA 2EZVA 5E1FA 2KVMA 2K7VA 4A3JH 4CHTB 1A8VA 1VS0A 3P20A 4HAEA 4BBRH 1B9MA 1ONLA 4DF7A 4NXNQ 1XTCD 1E2ZA 5CV7A 3ZYYX 3KF6B 1PLFA 1PA6A 3EVQA 4GLVB 4HCSA 1N32L 1ESFA 3HOVH 1SNQA 3GTLB 4LFAQ 3S1MH 2K50A 2JE6I 2N8NA 1SBBB 3H91A 3D0FA 3J7YW 5FLXc 1WD0A 1XNQL 4A3EH 1NSNS 1S5DD 3CQZB 4IUUA 2MNAA 2RSNA 5GAGC 2NWGA 1I4XA 1SMXA 1PH2A 1PTOC 3HOZG 5CBAE 1S72A 5EKIA 4GOPB 4IN3A 5FJ8H 1MHWC 3J80L 1K73C 2B3GA 2I5MX 5C4XH 2K5DA 3H0GB 5M5YB 4N8X1 1HZBA 4K5VA 5J1ZA 1IL2A 2RCNA 3D3RA 3KLSA 2Z1CA 4AYBE 5IT9L 3RN2A 2JA6B 1GUGA 1HUNA 4GLAC 4X62L 3OSOA 3VYSA 4JI5L 4KHPQ 4XQNA 2CW0D 1AZQA 1ET9A 4PZ8A 3BZKA 4DV2L 3B6YA 1QCBD 3PF4A 1EFID 5F2DA 3K8AA 2JA7G 1GHKA 1N34Q 1PRTD 2XGTA 1E7ZA 3DM1A 1Y1VB 4CGYB 2ZM6Q 3SXHA 3PUYA 1M1KC 4DNRB 4IALA 4GNXB 1SE3A 2NZHA 3EN2A 1D8LA 4UP9A 1LABA 2EY5A 2E2HB 4DV1L 4DUYL 2FFKB 1IBML 2YTVA 2KHIA 1VQBA 4DV6L 4B9XA 1JOQA 3MZ5A 3GP7A 2OWOA 2VS1A 3SDZA 4J8QA 1PH5A 1F9RA 3RNUA 4JV5L 2V4DA 4DR1L 2GVBA 2E2IB 2XSCA 2I5HA 4MZ9A 4K8JA 4C3IB 3QG1A 1U4PA 4E6IA 1J5EL 5I2YA 4Z9CB 3KUPA 3HOUG 3PIO3 3IAYA 4DV5Q 4QIWB 3MAQA 1TWGH 2F0UA 3T56B 2EJGC 5AFWA 1A2TA 3DLLA 3OW2A 4GN3B 4OX9Q 4GS3A 1ZYRD 1SYCA 2NBFA 4BY7G 1AE2A 3I7FA 3UDXA 3UDIA 1WCMB 3T1HL 4DFAA 3UE1A 3ULJA 1EY5A 2B2WC 4JBMA 3VR4A 2ZTDA 4A3DG 1BO0A 1MIUA 1BNZA 1LTID 3PV0A 4IFDG 4Y7NH 2NYZD 4PMCA 3D6CA 4I7ZC 5I6WA 1KLGD 1F77A 2PPBC 5J39A 2RHSB 4A3LH 4JYAL 1EY8A 4JYAQ 2K14A 1Q3LA 4RAUC 1CKOA 5ELOA 1PH9A 5KEEA 5A35A 3PO3G 3J7AV 1SFOB 1TS5A 2TMPA 4DK1A 2HCCA 2G9HD 3VR6A 1IBLL 1IBLQ 4CDFC 2KA7A 3DHQA 1IW7C 1YVCA 4QY7A 2K05A 5E3FA 1ASYA 3Q22A 5GAEC 4JI8L 1VDZA 2R7ZB 3GTKH 3BDLA 5IOCA 4AQYL 3E9IA 1LTSD 3MVVA 4C3JG 3T13A 3RUZA 2JA5G 3BZDB 1V1OA 1E22A 5AJ3L 3S14B 2F0LA 5I9PA 1X56A 4QUCA 1KNEA 3JAME 1L0WA 1LT6D 1K0SA 3HOXG 1X32A 3DEPA 4BA1I 5LMNL 3BYYB 5LMNQ 2R6GA 5JEAJ 4ABNA 3GTMB 1KDCA 2DY7A 3FHWA 3MXGA 2MO0A 3MEHA 1PRTB 1TWCB 2ZXRA 4P71A 2KHSA 4J1MA 2NVTB 2R92G 1R4PB 2F0PA 4S3SA 5EPJA 1EZ8A 4HJ8A 2GN5A 2ICIA 4X64Q 1VQGA 2VW9A 1I4PA 4A3KH 4BS9A 1TR5A 1F2ZA 3DUZA 4LMQD 1U9RA 2PQAB 2RHQB 5LMUL 1I4RA 2G5DA 1CA6A 2Z0SA 3PSIA 5M3FH 2CH4W 4LF4Q 3FKIH 3G4SA 1EIFA 1EWCA 1LTLA 1WTQA 2WFWA 3W3AA 2WAQG 3L3OC 3CMAA 4DR2L 2KBNA 4GKJQ 2R7DA 4U673 3Q24A 4RKLA 5JVG3 1HNWQ 3K80C 1QWYA 1F9PA 4FF3A 3OWEB 5FO9B 2A68C 1FD7D 1FR3A 1NMGA 4C1NI 1IKLA 3HOVG 2OQ0A 4B3SQ 5D65A 1E0BA 1YHAA 3AU7A 5CORA 1SNOA 4UPAA 4MHEA 3KF8A 4A3EG 1W2BA 3OTOL 5FLXL 4IPGA 4FXDA 5ELEA 1FNVA 4G7HC 4B3RL 1Q7YC 2PZWA 1Q8KA 5C44B 5ELDA 1QZGA 1B2TA 1CUKA 5FJ8G 2K4KA 1WOCA 2VXWA 4A3BH 1IYVA 1EEID 5L37A 4IJLA 2A74C 1EY4A 1BXTA 1LYLA 2B2UC 3I90A 2HT1A 3FPUB 5C4JB 3F2BA 2JA8G 1VQLA 4LF8L 1ILPA 4K5XA 4A3CH 1O7YA 4H0LC 4QF4A 3M4PA 1PTOD 1XMQQ 3I4LA 3E0EA 1D7QA 3AMUA 2ZTEA 4YIJA 1LV9A 3A54A 1TT2A 2DUDA 1DOKA 4JG2A 1SDFA 2F4VL 1GOZA 3NWTA 3TMEA 4DR4L 4OONA 2DNCA 1TU2B 4YWMA 1XPUA 2YYZA 4OIJA 4ZUIA 1SR3A 1C9OA 1MI2A 2EYLA 3M85A 2VQFL 1VQFA 1ET6A 3N52A 4JOIC 5BR8Q 2EXZA 4KN4C 3PGZA 4C2MH 1ZEQX 2QF7A 2WACA 4OHJA 2CFMA 2F0QA 4Y52H 1WFQA 2AKWB 1RF2D 1QOHA 2PI2A 1EFWA 3HOUB 1XNRL 2EYHA 4XTCS 1CI3M 1N9WA 1KXLA 1H9SA 2F0DA 4CKCA 1YHQA 2Y0SG 2LXJA 1NBWA 2CQOA 1FGBD 1B8AA 2ZXOA 1S5ED 3SE0A 2JSOA 5CGKA 4QUFA 1Q90A 1U5KA 4KKSA 4A4IA 4UAIA 4A3DB 1L0YB 5IT9c 2K52A 1HA6A 3J81E 1BKBA 1H9RA 1H9KA 4L6TB 1PRTF 1UEAB 1KQSA 3DWQA 4IZ8A 2A19A 3HKZB 1D5MC 2EYPA 3A5ZB 1HXYD 1STBA 3S2HH 1QJOA 3R8BA 3M3YH 3W1BA 3TBIB 2NVQH 4FF4A 3R2TA 4K6LA 1KL9A 1F9SA 4NDXA 1B1ZA 4DR3L 1HTPA 1BBXC 3PO3B 1VF7A 4CJ0B 3I70A 4XT1B 2HHHL 2FHTA 1GUWA 2HHHQ 4PNYA 2Q2HA 2BH2A 3KF6A 2RCFA 1SYFA 3H15A 3U50C 1X55A 2MHVA 4DR6L 1W3SA 2EYFA 1VQ7A 4K2KA 1VF5C 4L8JA 4KY7A 3O13A 1T5EA 2HUGA 2B63B 1BCPC 1K8OA 5DAUA 4C3JB 1SNDA 3VR5A 4RMFA 5IYDH 2B29A 1TWFB 1DCZA 1VQEA 4DA2A 5CC4A 2ZJPA 5LL6X 4R4CA 3VYUA 3F2CA 1N36Q 3K7UC 3K5OA 1N33L 1H9JA 3K6OA 1N33Q 5C0XG 3IFDA 3CPFA 1E2VA 2F0SA 5IYBG 1EL0A 3H3VI 2CVRA 4LJZC 1HUMA 5ELBA 2WIIB 1V43A 3F1ZA 2UUAQ 2YU9H 4GKKL 2E8GA 3HKZE 4FXKC 3GTPH 2B2VA 2OXPA 4JI3L 1FJGL 4DR7L 1RTOA 3CU7A 2VQEL 3I4OA 4DR7Q 3QOLA 4DAVA 3KF8B 1PTOB 1X3PA 1EIGA 4UHVA 2RDGA 3CAMA 1IW7D 3TDQA 2NVYH 3OW7A 4IUNA 5ELNA 4PZ6A 4YY3L 2RSOA 2PZUA 4IUQA 1HJPA 4IURA 5KYIA 1YEZA 4A3JB 1JOKA 4BBRB 3Q8DA 4QGUA 1CFMA 4YHHL 1ICFB 3M9BA 1PV4A 4YHHQ 1B4OA 1PYSB 2NVXH 3C46A 3HOYH 1IZ6A 3STBC 2QDLA 1G2TA 2GA4B 4ALPA 5JJIA 2A69C 4JI6L 2F4IA 3CC7A 3DWPA 4DUZL 1LUZA 1C0AA 4R8IA 4CDDC 3V96A 4P75A 3BDOA 3S1MB 2UXCL 2KJXA 4X66L 1X3QA 3IKJA 1C8CA 3FRPB 4X3KA 1GO3E 1IBKQ 1KLUD 4A3EB 3GTJH 1NAPA 1GUNA 1CKMA 4K0KQ 4FF1A 1H95A 1OTCA 2ZJQA 4P72A 3FKIG 3QOJA 2F0OA 3OHXC 4B3TQ 2UXBL 4DKAC 4FYDA 5C4XB 2UUBQ 3PO2B 2HDMA 3ERSX 1QG7A 1ZXTA 4H44C 4KD3A 5C5LA 3R93A 1SROA 1HNXL 1JMCA 3HEJA 3CC2A 1AP0A 1TS4A 2K28A 3I56A 3G48A 3J80E 5KYLA 1AZPA 1PHJA 1N8RC 1CSPA 1WD1A 3S1NH 4OO1I 1JQYD 3A8IE 1H9SB 1YJNA 5EGTA 2E75C 1C4QA 4WORA 2A8VA 1BBWA 4KY5A 4L63B 4JI1L 4DN4M 3S9WA 3OIQA 4DU9A 1PH6A 1SRUA 3MFYA 4ULLA 4LF9Q 2A68D 4OIKA 4UY8C 2R92H 4A3BG 3K5MA 4LUZA 1JWUD 2RA4A 3L0OA 1R9TH 3K5NA 3VR3A 4PZ7A 3S15H 4DAMA 4CDEC 1VQ5A 5G3LD 4C3HH 2F0FA 1VQ4A 1JJ2A 3NPPA 2PNRC 2B2YC 2LFNA 1KABA 3OOCA 2BOSA 1CHPD 2WB1G 3D8GA 1SAPA 1JJGA 2HQEA 2Y0SB 4TQUS 5IGEA 1GUSA 2PO4A 2YV5A 3ONAB 4JI7Q 2O5JC 4R9WA 4KY6A 4NXNL 2DNEA 1HFGA 1KNAA 1B3QA 2RVLA 3K7AH 2UUCQ 3RLOA 1VQJA 4RCOA 1OXSC 1DGSA 2K5VA 5JJLA 3KBGA 4LAAA 5CR3A 4GN4B 2KENA 4LFAL 1NMFA 2R3ZA 1YJ9A 4OWWB 3CCQA 2D0OA 3IL8A 2ICEC 3F2UA 1HR0Q 2PI2E 1PXUA 2ES2A 5E7NA 1D1IA 2BCOA 4BY1B 1XPOA 1TWGB 1KAAA 5NUCA 1PTOF 2R7FA 4HMIA 1HFNA 3NE5B 5IIFA 4DAPA 1I50H 2KHJA 3S16H 1XWEA 4WRDA 4NXMQ 5EBCA 3K0XA 4RHSA 1DXMA 2L12A 3TRZA 1WTXA 2JA8H 2DGYA 4R4TA 3AEVA 3D4WA 1SYEA 3BS1A 1EWHA 1FYCA 2BA1A 1BDOA 4Y7NB 4R4OA 1PH4A 2GVAA 4TVAB 4AIMA 1NTGA 1EZ6A 4IPHA 4KHPL 5DM73 2E2JH 1EQRA 2PQAA 2ZXPA 1I6VC 5DNFA 5JPNC 2XIWA 4KKTA 5ELCA 2E5LQ 1UE6A 3RLNA 4PQXA 4KTAA 4CJ2C 3OMGA 1VQAA 3J7ZC 5FLMH 1TY2A 1MJEA 3I4MH 3W5OA 1N34L 3URYA 2R93H 3PUWA 4JBWA 4PV1C 4A3FB 1VQ9A 2ZM6L 3VA5A 1VQCA 1LACA 1SMYD 2EIFA 4L5RC 4Q5VA 4LUOA 2L15A 2Z6KC 5M9OA 5C3EH 1VQPA 1O7ZA 4PMBA 4F88A 1WVLA 2E2DC 3GTKB 2KCMA 3HOWH 5IWAQ 4DK0A 2PMZB 2IY5B 5IYDG 2H1EA 3M7GA 3VR2A 3KLRA 1MKHA 2K03A 3TS0A 4PG3A 2Q8IB 4MTKA 2AUKA 2M00A 4KJNA 2C9OA 2IL8A 3SHLA 4HIMA 2F0KA 2X6GA 1YJWA 1WTHA 1B70B 2EY1A 4IFDI 4R8NA 5DLQE 1HA5A 2JK8A 2JEBI 2F0VA 1BCPD 5CBEE 3HKSA 4DV5L 1PZJD 1SLJA 4IUPA 2CWAA 1Z9FA 2BE5D 2EE1A 1HQRD 1VQOA 4IO9A 1I3QB 3NWSA 2LKVA 3L7ZC 4OX9L 4FP5D 4LF7Q 3NUCA 1CA5A 1E24A 4A3KB 4C1NK 4KK7A 1LT5D 1TWHH 3TQYA 3QR8A 4DXGA 1ZKOA 2WKDA 5FK9C 4ZUJA 3G71A 2O4XA 2TSSA 5LL6S 1B44D 5JPMC 2IT1A 1UE7A 3J81j 2SOBA 5LMNW 5M3FB 1RTNA 3NP8A 2MO1A 1LLRD 3PUXA 3PF5A 1NR4A 4KHVA 3HOYG 1TS2A 1IKMA 4NPSA 4ZLTF 5D3IB 2EYOA 2F0JA 5M5WH 4X3TA 4LF5Q 1V8QA 2F0WA 4APVA 1SSOA 1FGUA 1WTOA 1VQDA 1Z7TA 1CT1D 3M4YA 1TIID 2EYJA 1RCVD 1STGA 2F3VA 5KGUA 2JA6H 4LF6L 2IHEA 2PW7A 3NXWA 1UWVA 3C1EA 3KLWA 4LF6Q 4IJHA 3BG3A 1TVXA 4CJ1B 4ME5A 5C0XH 4JBKA 1RKNA 1L1OA 3HG9A 4ZKBB 4OEMB 2WP8J 5IYBH 1GD7A 3P7JA 3NQIA 2A69D 1TWAH 3K57A 5A2QL 3EROA 2D62A 1SN8A 1SE8A 5FLXE 1KIXA 2X69A 1HTLD 1KRTA 5M3MB 1XTDA 2K5NA 4P2CB 1VQ8A 4QIWE 1L0XB 3E9HA 3EIVA 1YITA 1FNUA 5DM63 2LS01 4GOPC 1I6HB 4DV4Q 3LGJA 4RGTA 1A3TA 1EQVA 1HZAA 1NR2A 3CW2C 1ESRA 1PH3A 4WJ4A 1D6EC 2NTTA 3RR5A 4H02A 2WKCA 1YNJC 2WB1B 3SK6A 3K5LA 1STNA 4XDXA 4JW0A 4BWGB 2HD3A 5J3BA 3GTQB 5C3XA 4P74A 2Q8RE 3LX0A 1F2YA 3I2ZA 1U4MA 2KCCA 4ID6A 4DNIA 3GTOH 1VMPA 4X64L 2SEBD 2B2TC 1G6PA 4C2MB 2VZAA 1Z47A 4RGMA 4C3IH 1YNNC 4R1JA 4C3HG 4KMUC 2UXDQ 2VY3A 1HHVA 1HCZA 2BDNA 1HNZQ 2F3IA 3TP7A 1PYWD 4M1UB 4TKOB 3F8TA 4GNXC 2AUJD 4LF4L 2J4XA 2KCNA 4ZAIA 3W2DA 3BDCA 3HOZB 2C5CA 2NZOA 2QEXA 1BF4A 2VB2X 3H94A 3QB3A 4GKJL 3EFXD 3DEOA 3WWVA 1HNWL 3DM3A 1K9MC 4N9PA 4B3SL 3TS2A 1MJCA 1Y1WG 2BDOA 1KDAA 1X3GA 2B39A 3OMCA 1NUCA 1GUOA 3TEHB 2FINB 3S2HB 5G3LF 3NSWA 2ZT9C 2Q2UA 4FXGC 3M3YB 4RWSC 3ZJYC 5E4XA 3D6WA 4X65Q 4BBSG 1MGSA 1VQHA 2NVQB 4A3MH 4JBJA 2NTSA 1M8AA
chains in the Genus database with same CATH topology
1J6QA 2HIVA 3UE0A 4LFBQ 3F2CA 3CP0A 3W1GA 1N36Q 2I0QA 3K7UC 4A3JH 5IYCH 1N33L 1A8VA 1VS0A 4BBRH 3S2DH 3T1HQ 1N33Q 3S1QH 5C0XG 4HIOA 3VDYA 3CPFA 3H0GH 5M5YH 4NXNQ 4DR4Q 5IYBG 2JJQA 4LF5L 3H3VI 1OXXK 2RF4A 4LW1A 2OTLA 3KF6B 3F1ZA 1V43A 2N49A 4GLVB 4YCWA 4L5QA 1XMQL 1PA6A 2PMZE 1P16A 2UUAQ 4GKKL 1N32L 2E8GA 3HKZE 4DV3Q 3HOVH 2R7ZH 4OO1G 4B3ML 4BA2I 3HKZG 4LFAQ 3GTPH 3S1MH 2K50A 2JE6I 2N8NA 4JI3L 3CCJA 4B3MQ 1FJGL 4LNQA 4DR7L 2IHFA 5IP7G 2VQEL 3I4OA 4DR7Q 2VNUD 2F52A 3ICEA 3D0FA 3KF8B 5FLXc 1XNQL 3S24A 4A3GG 4A3EH 1XMOQ 3U4VA 4LFCL 2MNAA 3STBD 5FLMG 4LFCQ 5GAGC 3I4MG 1SMXA 2IX0A 1PH2A 3CAMA 2R93G 2NVYH 5ELNA 5BR8L 5HGQA 4PZ6A 4YY3L 3HOZG 1HJPA 1S72A 4GOPB 4A3FH 5FJ8H 1YEZA 3OYYA 1K73C 2B3GA 1Y1VH 1NY4A 3Q8DA 2I5MX 5C4XH 2CWPA 4QGUA 1S3OA 1A0IA 4YHHL 4QJFA 1VQIA 3M9BA 1PV4A 4YHHQ 1PYSB 4DV4L 2ASBA 2NVXH 1HZBA 2ID0A 2QGQA 5C3EG 1IZ6A 3STBC 3PIPA 1IL2A 3HOYH 4ALPA 5JJIA 1X65A 2RCNA 4JI6L 1GKHA 4A93G 3CC7A 2ATWA 4DUZL 1C7YA 2E2HH 1LUZA 1C0AA 4AYBE 4JI8Q 3HOWG 3RN2A 2B63G 4AYBG 4P75A 1X6OA 4OWXB 4GLAC 4IPDA 2MFIA 4X62L 3JAMi 1X3FA 4AQYQ 4JI5L 4KHPQ 2UXCL 4QL5A 4IOAA 4X66L 4A3IG 3J81c 4PZ8A 1YZ6A 3BZKA 1GO3E 4DV2L 1IBKQ 3GTJH 3B6YA 5AJ3Q 3PF4A 4K0KQ 1L1OB 1CKMA 2MQHA 3UDFA 5GAHC 1H95A 1OTCA 2ZJQA 4P72A 3FKIG 3K8AA 2JA7G 1UE5A 2E2IH 1N34Q 2XGTA 1E7ZA 1HZCA 3CPWA 4B3TQ 4DKAC 2UXBL 2ZM6Q 2UUBQ 3PUYA 1M1KC 2UXDL 3ERSX 1SROA 2Q2IA 4GNXB 1HNXL 1JMCA 3H3VH 2AHOB 3CC2A 2NZHA 1HNZL 4POGA 3I56A 3G48A 3EN2A 1D8LA 4UP9A 2EXDA 3L2PA 3J7A5 1I3QH 1PHJA 4DV1L 1N8RC 4DUYL 1G291 4OXPA 1CSPA 1Q12A 2YTVA 1IBML 2KHIA 3S1NH 4OO1I 1YJNA 3I4NG 1QUQA 4MTNA 1VQBA 1WCMH 4DV6L 1EYGA 2N78A 2A8VA 2OWOA 1QVFA 2VS1A 2LXKA 1BBWA 5C0XI 1ASZA 5IE8A 4JI1L 1XJVA 1PH5A 1WYDA 1PH6A 1SRUA 4LWCA 4LF9Q 2R92H 3RNUA 4UY8C 3CCSA 4JV5L 4A3BG 4LUZA 5LMUQ 4A76A 4DR1L 2GVBA 4A3JG 3L0OA 2I5HA 4BBRG 1R9TH 4MZ9A 4PZ7A 3U4ZA 3S15H 4DAMA 3UDGA 5EAYA 1Q86C 1J5EL 3H0GG 4X65L 1VQ5A 4AH6A 3HOUG 4C3HH 4DR2Q 1WI5A 4DV5Q 1VQ4A 1JJ2A 2JEAI 1CKNB 3PUZA 1TWGH 4LFBL 1N36L 2AMCB 3DLLA 3OW2A 2WB1E 2JA6G 4GN3B 3CMEA 4GS3A 3RN5A 4OX9Q 1OXUA 2WB1G 4BY7G 2OQKA 1AE2A 3I7FA 3UDXA 3UDIA 3RZDH 1SFOH 3T1HL 3NELA 4TQUS 1EQQA 1KD1C 3UE1A 3ULJA 4JI4Q 2YV5A 4JI7Q 1QUQB 3ULPA 4NXNL 4JBMA 1AH9A 3NEMA 3GD7A 1YI2A 3CCVA 4JC0A 2ZTDA 3K7AH 3A0JA 2UUCQ 3RLOA 1VQJA 3OTOQ 4A3DG 1OXSC 3NENA 4POFA 1XPRA 2UUAL 1DGSA 5GROA 1MIUA 2K5VA 5JJLA 3CCLA 2VL6A 3PV0A 4DV3L 4IFDG 4B3RQ 4XIGS 1BBUA 4Y7NH 4GN4B 2KENA 4EX5A 1NMFA 4IPCA 4LFAL 3K81C 1YJ9A 1I94Q 1Y1VG 3CCQA 2D0OA 4OWWB 1AE3A 2V1CC 4YWLA 3PO2G 4ME3A 5C4XG 1A62A 5M3MH 5C0XJ 1XMOL 1HR0Q 2RHSB 4GLXA 2PI2E 4A75A 2ES2A 2JQOA 2Q2TA 2UU9Q 4JYAL 4A3LH 5E7NA 3S14H 4JYAQ 1I6HH 2K14A 1CKOA 5ELOA 4DV7Q 1XPOA 1Y14B 4JI2Q 4LF8Q 2BH8A 4DR5Q 2YTXA 1PH9A 1FVIA 2IX1A 4YWKA 1KAWA 2R7FA 1CSQA 1QZHA 1YNXA 2Z6KA 3PO3G 3AFPA 1V9PA 3AQQA 3KJPA 3RZOH 1JJCB 2AWNA 1I50H 2H5XA 2KHJA 2A1AA 3A74A 4J15A 1QVGA 3S16H 3KDFA 4YCVA 4NXMQ 3GTMH 3K0XA 2F4VQ 1IBLL 4HJ7A 1BVSA 3TRZA 4DAYB 1TWCH 4HIKA 1IBLQ 3GTQH 2JA8H 1ASYA 1YVCA 4QY7A 1E3PA 2DGYA 4R4TA 2NVTH 4BXXG 1YBYA 5GAEC 4JI8L 3KYHC 3AEVA 4X6AH 2BA1A 3AYHB 1PH4A 4R4OA 2GVAA 4TVAB 4AIMA 2VQFQ 3GTKH 1NTGA 4AQYL 3E9IA 4IPHA 4KHPL 1G51A 3ER0A 2E2JH 1EQRA 2PQAA 3T1YQ 2VUMG 2BA0A 3RLFA 4GN5A 2JA5G 3CXCA 2D0PA 3SGIA 5JEAG 1IBKL 2E5LQ 1UE6A 1U0LA 4OWTB 1E22A 3D31A 5AJ3L 5IP7H 3RLNA 2XTIA 4K0KL 1E1OA 1VQAA 3J7ZC 1X56A 1KHIA 1XNRQ 5FLMH 2HIXA 1MJEA 3I4MH 3W5OA 1N34L 1L0WA 3KOJA 2R93H 3PUWA 4JBWA 4B3TL 3HOXG 3J80c 1VQ9A 2ZM6L 2UUBL 3HOZH 2ZTCA 4BA1I 1VQCA 5LMNL 3G6EA 1L2FA 3J81i 2R6GA 2EIFA 5LMNQ 4L5RC 5JEAJ 4LUOA 2L15A 3KFUA 3FHWA 4O0AA 2MO0A 4P71A 2Z6KC 1K8AC 5C3EH 1VQPA 2R92G 4JI0L 1KC8C 4JI0Q 1IYJB 4HJ8A 1JJGA 3GDEA 1Q82C 2GN5A 4A93H 3A5UA 2KCMA 4X64Q 1VQGA 2VW9A 4A3KH 3HOWH 5IWAQ 2IY5B 5IYDG 2LSSA 2PQAB 4RG1A 5IP9G 1VQNA 3AFQA 3M7NA 4A3MG 2RHQB 1MKHA 4BY1G 3TS0A 2JA9A 2YU9H 4PG3A 1YHBA 4LF9L 2CKZB 2OTJA 1GM5A 5LMUL 4FDBA 3CC4A 4HIMA 5C44H 2KCTA 2HQLA 2Z0SA 1YJWA 3PSIA 5IYCG 5M3FH 1B70B 4LF4Q 3FKIH 4IFDI 2JA7H 5DLQE 1EIFA 3G4SA 1LTLA 2JK8A 2WAQE 3BZCA 3F2DA 2JEBI 4DR3Q 2WFWA 3CMAA 2WAQG 4DR2L 3HKSA 2I5LX 2KBNA 4DV5L 1SLJA 2R7DA 4GKJQ 1HZ9A 5C4JH 2CWAA 1Z9FA 1HNWQ 3K80C 4DV0L 2QA4A 4DV0Q 1VQOA 4P73A 1NJIC 4IO9A 1WJJA 3L7ZC 1NMGA 4OX9L 3HOVG 2OQ0A 4B3SQ 2R7ZG 4DR6Q 1RL2A 4LF7Q 4DK6C 1YHAA 1E24A 1K0RA 4JI4L 4JI7L 1S40A 4UPAA 3I4NH 1QVCA 3IRBA 4O2DA 1TWHH 4A3LG 3GO5A 4A3EG 1W2BA 4JOIA 1PH8A 1EUJA 1NE3A 1JB7A 3TQYA 3BJUA 2UUCL 3OTOL 4IPGA 3U58A 3ULLA 1PYBA 4DK3C 1VCIA 4B3RL 1Q7YC 1Q81C 3G71A 1Q8KA 1O7IA 1QZGA 4GOPA 4A3FG 1CUKA 5FJ8G 2IT1A 1UE7A 2K4KA 1WOCA 3J81j 1I94L 5LMNW 1Y1WH 4A3BH 2AWOA 1M90C 4IJLA 2MO1A 3PUXA 3PF5A 3NBHB 1HR0L 3HOYG 1LYLA 2HT1A 2UU9L 5HY6A 4NPSA 3F2BA 1B7YB 3EBEA 1PH7A 2JA8G 4WJ3M 4DV7L 1VQLA 4JI2L 5M5WH 4LF8L 3HOUH 4DR5L 4YCUA 4LF5Q 4BBSH 1HH2P 3TREA 4A3CH 4APVA 1P8LA 3HFZB 3MXNB 1FGUA 4IFDJ 1VQDA 3M4PA 4KHZA 4DPGA 1YIJA 1XMQQ 1N32Q 4GKKQ 1VQ6A 3E0EA 2CCZA 2JA6H 1T9HA 2ZTEA 1D7QA 4HJAA 5K36G 4LF6L 2IHEA 4LUVA 1PH1A 1UWVA 3KLWA 4LF6Q 4BY7H 4NXML 4IJHA 3GTGH 2DUDA 4JI3Q 4JG2A 5H1SE 2F4VL 2ZJRA 1FJGQ 4HJ5A 2VQEQ 4UP8A 1KRSA 1FL0A 4JBKA 4DR4L 4OONA 1L1OA 4YWMA 1XNQQ 1XPUA 2WP8J 5IYBH 2YYZA 1GD7A 4A3DH 2N3SA 1Q1BA 1SR3A 1C9OA 1TWAH 4KLKA 3M85A 2VQFL 1VQFA 4JOIC 2D62A 1SN8A 5BR8Q 3I55A 3T1YL 4YY3Q 1SE8A 1KIXA 1RIPA 3PGZA 4C2MH 1KRTA 3JAMc 1XTDA 2K5NA 1VQ8A 2E5LL 2CFMA 4QIWE 4GNXA 3PO2H 4Y52H 1WFQA 3E9HA 3EIVA 1OXVA 2AKWB 1YITA 3KJOA 4GOPC 1I5FA 4DV4Q 1VQMA 2PI2A 1EFWA 3LGJA 1XNRL 4A3GH 1LM0A 1X9NA 4XTCS 1HZAA 4R4QA 3CW2C 1PH3A 1X3EA 4WJ4A 1N9WA 2C35B 2Y0SE 4JI6Q 1KXLA 3RR5A 4H02A 4DUZQ 1Q1EA 4A3KG 1WCMG 2YTYA 1YHQA 2Y0SG 1UE1A 3CD6A 2LXJA 1EOVA 1NBWA 3FP9A 2CQOA 3PO3H 4X62Q 1B8AA 2UXCQ 2NN6I 1Q46A 4HIDA 4JI5Q 2K75A 4X66Q 3MEFA 1EWIA 3KDFB 5J3BA 1U5KA 4DV2Q 4A4IA 4P74A 3S17H 2ALYB 5IT9c 5C44G 3I2ZA 3CCUA 3BU2A 4DNIA 2K52A 4BXXH 3GTOH 4X64L 1JT8A 1BKBA 5M3FG 5IWAL 5GADC 1G6PA 3J80i 1V1QA 1KQSA 1L1OC 2B63H 2VZAA 3M4OH 1TXYA 1Z47A 1UEBA 2A19A 1HR0W 4C3IH 4L5TA 3A5ZB 4R1JA 2UXBQ 3S2HH 2EQSA 4C3JH 3JC66 3CCRA 3PUVA 5IY0A 4A3IH 2VUMH 2JA5H 2UXDQ 5JJKA 2VY3A 3W1BA 3M3YH 1CKNA 3S1RH 1HNXQ 1TWFH 2NVQH 1K83H 1HNZQ 2F3IA 2OCEA 4NB3A 1JE5A 4GNXC 3F8TA 1K8GA 4LF4L 1KL9A 4DV1Q 4DUYQ 1K3RA 2NN6G 3CCEA 2NZOA 5GQOA 2QEXA 4HJ9A 4R4IA 4DR3L 1PFSA 1IBMQ 1OXTA 4MNOA 3HOXH 1GVPA 4L5SA 1IXRA 1EIYB 4DV6Q 4GKJL 3WWVA 1HNWL 2HHHL 4QQBX 1A63A 2HHHQ 2Q2HA 3DM3A 4PMWA 2BH2A 4KI0A 1K9MC 3KF6A 3H15A 3U50C 1X55A 4B3SL 4DR6L 3TS2A 1W3SA 4JI1Q 1VQ7A 4LF7L 1PVOA 3PCOB 1MJCA 1X54A 3PIOA 1Y1WG 4IOCA 4JV5Q 5M3MG 4DR1Q 1X3GA 4UP7A 3GTLH 2PNHA 3TEHB 5M5XH 4RMFA 2Q2UA 1J5EQ 2K5HA 5IYDH 3M4QA 3ZJYC 2B29A 4X65Q 3CF5A 4EQ5A 1VQHA 5IP9H 3CCMA 1VQKA 4BBSG 4A3CG 1VQEA 3CQZH 4JCVE 2FXQA 4A3MH 2ZJPA 4JBJA 1E1TA 4R4CA 4BY1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  2HIV A;  3UE0 A;  4LFB Q;  3F2C A;  3CP0 A;  3W1G A;  1N36 Q;  2I0Q A;  3K7U C;  4A3J H;  5IYC H;  1N33 L;  1A8V A;  1VS0 A;  4BBR H;  3S2D H;  3T1H Q;  1N33 Q;  3S1Q H;  5C0X G;  4HIO A;  3VDY A;  3CPF A;  3H0G H;  5M5Y H;  4NXN Q;  4DR4 Q;  5IYB G;  2JJQ A;  4LF5 L;  3H3V I;  1OXX K;  2RF4 A;  4LW1 A;  2OTL A;  3KF6 B;  3F1Z A;  1V43 A;  2N49 A;  4GLV B;  4YCW A;  4L5Q A;  1XMQ L;  1PA6 A;  2PMZ E;  1P16 A;  2UUA Q;  4GKK L;  1N32 L;  2E8G A;  3HKZ E;  4DV3 Q;  3HOV H;  2R7Z H;  4OO1 G;  4B3M L;  4BA2 I;  3HKZ G;  4LFA Q;  3GTP H;  3S1M H;  2K50 A;  2JE6 I;  2N8N A;  4JI3 L;  3CCJ A;  4B3M Q;  1FJG L;  4LNQ A;  4DR7 L;  2IHF A;  5IP7 G;  2VQE L;  3I4O A;  4DR7 Q;  2VNU D;  2F52 A;  3ICE A;  3D0F A;  3KF8 B;  5FLX c;  1XNQ L;  3S24 A;  4A3G G;  4A3E H;  1XMO Q;  3U4V A;  4LFC L;  2MNA A;  3STB D;  5FLM G;  4LFC Q;  5GAG C;  3I4M G;  1SMX A;  2IX0 A;  1PH2 A;  3CAM A;  2R93 G;  2NVY H;  5ELN A;  5BR8 L;  5HGQ A;  4PZ6 A;  4YY3 L;  3HOZ G;  1HJP A;  1S72 A;  4GOP B;  4A3F H;  5FJ8 H;  1YEZ A;  3OYY A;  1K73 C;  2B3G A;  1Y1V H;  1NY4 A;  3Q8D A;  2I5M X;  5C4X H;  2CWP A;  4QGU A;  1S3O A;  1A0I A;  4YHH L;  4QJF A;  1VQI A;  3M9B A;  1PV4 A;  4YHH Q;  1PYS B;  4DV4 L;  2ASB A;  2NVX H;  1HZB A;  2ID0 A;  2QGQ A;  5C3E G;  1IZ6 A;  3STB C;  3PIP A;  1IL2 A;  3HOY H;  4ALP A;  5JJI A;  1X65 A;  2RCN A;  4JI6 L;  1GKH A;  4A93 G;  3CC7 A;  2ATW A;  4DUZ L;  1C7Y A;  2E2H H;  1LUZ A;  1C0A A;  4AYB E;  4JI8 Q;  3HOW G;  3RN2 A;  2B63 G;  4AYB G;  4P75 A;  1X6O A;  4OWX B;  4GLA C;  4IPD A;  2MFI A;  4X62 L;  3JAM i;  1X3F A;  4AQY Q;  4JI5 L;  4KHP Q;  2UXC L;  4QL5 A;  4IOA A;  4X66 L;  4A3I G;  3J81 c;  4PZ8 A;  1YZ6 A;  3BZK A;  1GO3 E;  4DV2 L;  1IBK Q;  3GTJ H;  3B6Y A;  5AJ3 Q;  3PF4 A;  4K0K Q;  1L1O B;  1CKM A;  2MQH A;  3UDF A;  5GAH C;  1H95 A;  1OTC A;  2ZJQ A;  4P72 A;  3FKI G;  3K8A A;  2JA7 G;  1UE5 A;  2E2I H;  1N34 Q;  2XGT A;  1E7Z A;  1HZC A;  3CPW A;  4B3T Q;  4DKA C;  2UXB L;  2ZM6 Q;  2UUB Q;  3PUY A;  1M1K C;  2UXD L;  3ERS X;  1SRO A;  2Q2I A;  4GNX B;  1HNX L;  1JMC A;  3H3V H;  2AHO B;  3CC2 A;  2NZH A;  1HNZ L;  4POG A;  3I56 A;  3G48 A;  3EN2 A;  1D8L A;  4UP9 A;  2EXD A;  3L2P A;  3J7A 5;  1I3Q H;  1PHJ A;  4DV1 L;  1N8R C;  4DUY L;  1G29 1;  4OXP A;  1CSP A;  1Q12 A;  2YTV A;  1IBM L;  2KHI A;  3S1N H;  4OO1 I;  1YJN A;  3I4N G;  1QUQ A;  4MTN A;  1VQB A;  1WCM H;  4DV6 L;  1EYG A;  2N78 A;  2A8V A;  2OWO A;  1QVF A;  2VS1 A;  2LXK A;  1BBW A;  5C0X I;  1ASZ A;  5IE8 A;  4JI1 L;  1XJV A;  1PH5 A;  1WYD A;  1PH6 A;  1SRU A;  4LWC A;  4LF9 Q;  2R92 H;  3RNU A;  4UY8 C;  3CCS A;  4JV5 L;  4A3B G;  4LUZ A;  5LMU Q;  4A76 A;  4DR1 L;  2GVB A;  4A3J G;  3L0O A;  2I5H A;  4BBR G;  1R9T H;  4MZ9 A;  4PZ7 A;  3U4Z A;  3S15 H;  4DAM A;  3UDG A;  5EAY A;  1Q86 C;  1J5E L;  3H0G G;  4X65 L;  1VQ5 A;  4AH6 A;  3HOU G;  4C3H H;  4DR2 Q;  1WI5 A;  4DV5 Q;  1VQ4 A;  1JJ2 A;  2JEA I;  1CKN B;  3PUZ A;  1TWG H;  4LFB L;  1N36 L;  2AMC B;  3DLL A;  3OW2 A;  2WB1 E;  2JA6 G;  4GN3 B;  3CME A;  4GS3 A;  3RN5 A;  4OX9 Q;  1OXU A;  2WB1 G;  4BY7 G;  2OQK A;  1AE2 A;  3I7F A;  3UDX A;  3UDI A;  3RZD H;  1SFO H;  3T1H L;  3NEL A;  4TQU S;  1EQQ A;  1KD1 C;  3UE1 A;  3ULJ A;  4JI4 Q;  2YV5 A;  4JI7 Q;  1QUQ B;  3ULP A;  4NXN L;  4JBM A;  1AH9 A;  3NEM A;  3GD7 A;  1YI2 A;  3CCV A;  4JC0 A;  2ZTD A;  3K7A H;  3A0J A;  2UUC Q;  3RLO A;  1VQJ A;  3OTO Q;  4A3D G;  1OXS C;  3NEN A;  4POF A;  1XPR A;  2UUA L;  1DGS A;  5GRO A;  1MIU A;  2K5V A;  5JJL A;  3CCL A;  2VL6 A;  3PV0 A;  4DV3 L;  4IFD G;  4B3R Q;  4XIG S;  1BBU A;  4Y7N H;  4GN4 B;  2KEN A;  4EX5 A;  1NMF A;  4IPC A;  4LFA L;  3K81 C;  1YJ9 A;  1I94 Q;  1Y1V G;  3CCQ A;  2D0O A;  4OWW B;  1AE3 A;  2V1C C;  4YWL A;  3PO2 G;  4ME3 A;  5C4X G;  1A62 A;  5M3M H;  5C0X J;  1XMO L;  1HR0 Q;  2RHS B;  4GLX A;  2PI2 E;  4A75 A;  2ES2 A;  2JQO A;  2Q2T A;  2UU9 Q;  4JYA L;  4A3L H;  5E7N A;  3S14 H;  4JYA Q;  1I6H H;  2K14 A;  1CKO A;  5ELO A;  4DV7 Q;  1XPO A;  1Y14 B;  4JI2 Q;  4LF8 Q;  2BH8 A;  4DR5 Q;  2YTX A;  1PH9 A;  1FVI A;  2IX1 A;  4YWK A;  1KAW A;  2R7F A;  1CSQ A;  1QZH A;  1YNX A;  2Z6K A;  3PO3 G;  3AFP A;  1V9P A;  3AQQ A;  3KJP A;  3RZO H;  1JJC B;  2AWN A;  1I50 H;  2H5X A;  2KHJ A;  2A1A A;  3A74 A;  4J15 A;  1QVG A;  3S16 H;  3KDF A;  4YCV A;  4NXM Q;  3GTM H;  3K0X A;  2F4V Q;  1IBL L;  4HJ7 A;  1BVS A;  3TRZ A;  4DAY B;  1TWC H;  4HIK A;  1IBL Q;  3GTQ H;  2JA8 H;  1ASY A;  1YVC A;  4QY7 A;  1E3P A;  2DGY A;  4R4T A;  2NVT H;  4BXX G;  1YBY A;  5GAE C;  4JI8 L;  3KYH C;  3AEV A;  4X6A H;  2BA1 A;  3AYH B;  1PH4 A;  4R4O A;  2GVA A;  4TVA B;  4AIM A;  2VQF Q;  3GTK H;  1NTG A;  4AQY L;  3E9I A;  4IPH A;  4KHP L;  1G51 A;  3ER0 A;  2E2J H;  1EQR A;  2PQA A;  3T1Y Q;  2VUM G;  2BA0 A;  3RLF A;  4GN5 A;  2JA5 G;  3CXC A;  2D0P A;  3SGI A;  5JEA G;  1IBK L;  2E5L Q;  1UE6 A;  1U0L A;  4OWT B;  1E22 A;  3D31 A;  5AJ3 L;  5IP7 H;  3RLN A;  2XTI A;  4K0K L;  1E1O A;  1VQA A;  3J7Z C;  1X56 A;  1KHI A;  1XNR Q;  5FLM H;  2HIX A;  1MJE A;  3I4M H;  3W5O A;  1N34 L;  1L0W A;  3KOJ A;  2R93 H;  3PUW A;  4JBW A;  4B3T L;  3HOX G;  3J80 c;  1VQ9 A;  2ZM6 L;  2UUB L;  3HOZ H;  2ZTC A;  4BA1 I;  1VQC A;  5LMN L;  3G6E A;  1L2F A;  3J81 i;  2R6G A;  2EIF A;  5LMN Q;  4L5R C;  5JEA J;  4LUO A;  2L15 A;  3KFU A;  3FHW A;  4O0A A;  2MO0 A;  4P71 A;  2Z6K C;  1K8A C;  5C3E H;  1VQP A;  2R92 G;  4JI0 L;  1KC8 C;  4JI0 Q;  1IYJ B;  4HJ8 A;  1JJG A;  3GDE A;  1Q82 C;  2GN5 A;  4A93 H;  3A5U A;  2KCM A;  4X64 Q;  1VQG A;  2VW9 A;  4A3K H;  3HOW H;  5IWA Q;  2IY5 B;  5IYD G;  2LSS A;  2PQA B;  4RG1 A;  5IP9 G;  1VQN A;  3AFQ A;  3M7N A;  4A3M G;  2RHQ B;  1MKH A;  4BY1 G;  3TS0 A;  2JA9 A;  2YU9 H;  4PG3 A;  1YHB A;  4LF9 L;  2CKZ B;  2OTJ A;  1GM5 A;  5LMU L;  4FDB A;  3CC4 A;  4HIM A;  5C44 H;  2KCT A;  2HQL A;  2Z0S A;  1YJW A;  3PSI A;  5IYC G;  5M3F H;  1B70 B;  4LF4 Q;  3FKI H;  4IFD I;  2JA7 H;  5DLQ E;  1EIF A;  3G4S A;  1LTL A;  2JK8 A;  2WAQ E;  3BZC A;  3F2D A;  2JEB I;  4DR3 Q;  2WFW A;  3CMA A;  2WAQ G;  4DR2 L;  3HKS A;  2I5L X;  2KBN A;  4DV5 L;  1SLJ A;  2R7D A;  4GKJ Q;  1HZ9 A;  5C4J H;  2CWA A;  1Z9F A;  1HNW Q;  3K80 C;  4DV0 L;  2QA4 A;  4DV0 Q;  1VQO A;  4P73 A;  1NJI C;  4IO9 A;  1WJJ A;  3L7Z C;  1NMG A;  4OX9 L;  3HOV G;  2OQ0 A;  4B3S Q;  2R7Z G;  4DR6 Q;  1RL2 A;  4LF7 Q;  4DK6 C;  1YHA A;  1E24 A;  1K0R A;  4JI4 L;  4JI7 L;  1S40 A;  4UPA A;  3I4N H;  1QVC A;  3IRB A;  4O2D A;  1TWH H;  4A3L G;  3GO5 A;  4A3E G;  1W2B A;  4JOI A;  1PH8 A;  1EUJ A;  1NE3 A;  1JB7 A;  3TQY A;  3BJU A;  2UUC L;  3OTO L;  4IPG A;  3U58 A;  3ULL A;  1PYB A;  4DK3 C;  1VCI A;  4B3R L;  1Q7Y C;  1Q81 C;  3G71 A;  1Q8K A;  1O7I A;  1QZG A;  4GOP A;  4A3F G;  1CUK A;  5FJ8 G;  2IT1 A;  1UE7 A;  2K4K A;  1WOC A;  3J81 j;  1I94 L;  5LMN W;  1Y1W H;  4A3B H;  2AWO A;  1M90 C;  4IJL A;  2MO1 A;  3PUX A;  3PF5 A;  3NBH B;  1HR0 L;  3HOY G;  1LYL A;  2HT1 A;  2UU9 L;  5HY6 A;  4NPS A;  3F2B A;  1B7Y B;  3EBE A;  1PH7 A;  2JA8 G;  4WJ3 M;  4DV7 L;  1VQL A;  4JI2 L;  5M5W H;  4LF8 L;  3HOU H;  4DR5 L;  4YCU A;  4LF5 Q;  4BBS H;  1HH2 P;  3TRE A;  4A3C H;  4APV A;  1P8L A;  3HFZ B;  3MXN B;  1FGU A;  4IFD J;  1VQD A;  3M4P A;  4KHZ A;  4DPG A;  1YIJ A;  1XMQ Q;  1N32 Q;  4GKK Q;  1VQ6 A;  3E0E A;  2CCZ A;  2JA6 H;  1T9H A;  2ZTE A;  1D7Q A;  4HJA A;  5K36 G;  4LF6 L;  2IHE A;  4LUV A;  1PH1 A;  1UWV A;  3KLW A;  4LF6 Q;  4BY7 H;  4NXM L;  4IJH A;  3GTG H;  2DUD A;  4JI3 Q;  4JG2 A;  5H1S E;  2F4V L;  2ZJR A;  1FJG Q;  4HJ5 A;  2VQE Q;  4UP8 A;  1KRS A;  1FL0 A;  4JBK A;  4DR4 L;  4OON A;  1L1O A;  4YWM A;  1XNQ Q;  1XPU A;  2WP8 J;  5IYB H;  2YYZ A;  1GD7 A;  4A3D H;  2N3S A;  1Q1B A;  1SR3 A;  1C9O A;  1TWA H;  4KLK A;  3M85 A;  2VQF L;  1VQF A;  4JOI C;  2D62 A;  1SN8 A;  5BR8 Q;  3I55 A;  3T1Y L;  4YY3 Q;  1SE8 A;  1KIX A;  1RIP A;  3PGZ A;  4C2M H;  1KRT A;  3JAM c;  1XTD A;  2K5N A;  1VQ8 A;  2E5L L;  2CFM A;  4QIW E;  4GNX A;  3PO2 H;  4Y52 H;  1WFQ A;  3E9H A;  3EIV A;  1OXV A;  2AKW B;  1YIT A;  3KJO A;  4GOP C;  1I5F A;  4DV4 Q;  1VQM A;  2PI2 A;  1EFW A;  3LGJ A;  1XNR L;  4A3G H;  1LM0 A;  1X9N A;  4XTC S;  1HZA A;  4R4Q A;  3CW2 C;  1PH3 A;  1X3E A;  4WJ4 A;  1N9W A;  2C35 B;  2Y0S E;  4JI6 Q;  1KXL A;  3RR5 A;  4H02 A;  4DUZ Q;  1Q1E A;  4A3K G;  1WCM G;  2YTY A;  1YHQ A;  2Y0S G;  1UE1 A;  3CD6 A;  2LXJ A;  1EOV A;  1NBW A;  3FP9 A;  2CQO A;  3PO3 H;  4X62 Q;  1B8A A;  2UXC Q;  2NN6 I;  1Q46 A;  4HID A;  4JI5 Q;  2K75 A;  4X66 Q;  3MEF A;  1EWI A;  3KDF B;  5J3B A;  1U5K A;  4DV2 Q;  4A4I A;  4P74 A;  3S17 H;  2ALY B;  5IT9 c;  5C44 G;  3I2Z A;  3CCU A;  3BU2 A;  4DNI A;  2K52 A;  4BXX H;  3GTO H;  4X64 L;  1JT8 A;  1BKB A;  5M3F G;  5IWA L;  5GAD C;  1G6P A;  3J80 i;  1V1Q A;  1KQS A;  1L1O C;  2B63 H;  2VZA A;  3M4O H;  1TXY A;  1Z47 A;  1UEB A;  2A19 A;  1HR0 W;  4C3I H;  4L5T A;  3A5Z B;  4R1J A;  2UXB Q;  3S2H H;  2EQS A;  4C3J H;  3JC6 6;  3CCR A;  3PUV A;  5IY0 A;  4A3I H;  2VUM H;  2JA5 H;  2UXD Q;  5JJK A;  2VY3 A;  3W1B A;  3M3Y H;  1CKN A;  3S1R H;  1HNX Q;  1TWF H;  2NVQ H;  1K83 H;  1HNZ Q;  2F3I A;  2OCE A;  4NB3 A;  1JE5 A;  4GNX C;  3F8T A;  1K8G A;  4LF4 L;  1KL9 A;  4DV1 Q;  4DUY Q;  1K3R A;  2NN6 G;  3CCE A;  2NZO A;  5GQO A;  2QEX A;  4HJ9 A;  4R4I A;  4DR3 L;  1PFS A;  1IBM Q;  1OXT A;  4MNO A;  3HOX H;  1GVP A;  4L5S A;  1IXR A;  1EIY B;  4DV6 Q;  4GKJ L;  3WWV A;  1HNW L;  2HHH L;  4QQB X;  1A63 A;  2HHH Q;  2Q2H A;  3DM3 A;  4PMW A;  2BH2 A;  4KI0 A;  1K9M C;  3KF6 A;  3H15 A;  3U50 C;  1X55 A;  4B3S L;  4DR6 L;  3TS2 A;  1W3S A;  4JI1 Q;  1VQ7 A;  4LF7 L;  1PVO A;  3PCO B;  1MJC A;  1X54 A;  3PIO A;  1Y1W G;  4IOC A;  4JV5 Q;  5M3M G;  4DR1 Q;  1X3G A;  4UP7 A;  3GTL H;  2PNH A;  3TEH B;  5M5X H;  4RMF A;  2Q2U A;  1J5E Q;  2K5H A;  5IYD H;  3M4Q A;  3ZJY C;  2B29 A;  4X65 Q;  3CF5 A;  4EQ5 A;  1VQH A;  5IP9 H;  3CCM A;  1VQK A;  4BBS G;  4A3C G;  1VQE A;  3CQZ H;  4JCV E;  2FXQ A;  4A3M H;  2ZJP A;  4JBJ A;  1E1T A;  4R4C A;  4BY1 H; 
#chains in the Genus database with same CATH topology
 2JYO A;  3SR1 A;  4LFB Q;  1DON A;  2JA7 B;  2I0Q A;  1EY6 A;  3S2D H;  3K0Y A;  3S1Q H;  3BYT B;  1EU3 A;  1PFN A;  3VDY A;  2XRS D;  1JWM D;  2O2L D;  2OTL A;  5IGG A;  3MHB A;  3OWF A;  4ZKC B;  1XMQ L;  4L5Q A;  3NTK A;  5CV4 A;  4IUV A;  4DV3 Q;  2R7Z H;  4OL7 A;  4XYQ A;  1CQF A;  3T53 B;  4RCN A;  2E76 C;  2LY7 A;  3JAM L;  2VNU D;  3T51 B;  3Q6S A;  3S24 A;  4A3G G;  1XMO Q;  3U4V A;  5FLM G;  2NZ1 D;  3I4M G;  2R93 G;  1HPC A;  5BR8 L;  5C3W A;  2LMC B;  1SYD A;  1I4H A;  3C2P A;  5EPK A;  1KDB A;  3OYY A;  2CWP A;  1W6K A;  1VQI A;  5D14 A;  2QCP X;  5IGC A;  2ASB A;  2QGQ A;  5C3E G;  1EYC A;  3PIP A;  5KRU A;  1GKH A;  2B8G A;  2Z9H A;  3A8K E;  2MP1 A;  3HOW G;  1LTA D;  1SNP A;  2D2C C;  2Z4I A;  4O1N A;  4AYB G;  1X6O A;  2A5H A;  3GTP B;  4IPD A;  2L4N A;  4BY7 B;  4QL5 A;  1B3A A;  4A3I G;  1DOM A;  5K36 H;  2VB3 X;  1ML0 D;  3P1H A;  3HS0 C;  1UAP A;  3FEW X;  3IFT A;  1L1O B;  3UDF A;  2NVY B;  2RBM A;  1UE5 A;  5BN5 A;  1HZC A;  4HCE A;  2O5I C;  1D2B A;  2D5D A;  2NVX B;  3HOY B;  2XWJ B;  1F9Q A;  1I4Q A;  2EXD A;  2B2W A;  2I46 A;  3J7A 5;  3SVM A;  4V0B A;  5JJZ A;  2X6L A;  1Q12 A;  3MA2 B;  1PRT C;  5CMD A;  1EYA A;  2N78 A;  3H09 A;  1BOS A;  4OGQ C;  1Y8N B;  2K5W A;  1QVF A;  3GTJ B;  2LXK A;  3HGB A;  1F2L A;  5C0X I;  1ASZ A;  5IE8 A;  5FO7 B;  3S17 B;  1XJV A;  1PZI D;  1O80 A;  4LWC A;  1ROD A;  3X3M A;  4F87 A;  4UDU C;  1MD2 D;  4A76 A;  1AN8 A;  5E4W C;  4HMJ A;  3E5S A;  3U4Z A;  1Q86 C;  1BCP F;  3H0G G;  2JA5 B;  4AH6 A;  1XX8 A;  1II3 A;  2JEA I;  2R61 A;  3MXN A;  4XQQ A;  2L9H A;  1N36 L;  5D3D A;  3RN5 A;  2JA6 G;  1OXU A;  2OQK A;  3RZD H;  3HOX B;  2NN6 H;  3KLS X;  5CYU A;  4JI4 Q;  1QUQ B;  3ULP A;  1EIH A;  1AH9 A;  1K8M A;  2EPB A;  1A2U A;  1CTM A;  5IOD A;  4JC0 A;  3A0J A;  4KN7 C;  3NEN A;  1G91 A;  2UUA L;  5BN3 A;  4NW2 A;  3CCL A;  2R92 B;  5C4Z A;  4GZY C;  2P5Z X;  4IPC A;  5LHY 1;  1I94 Q;  1Y1V G;  1R9T B;  3K58 A;  1AE3 A;  4K2L A;  1A62 A;  5M5X B;  3S15 B;  3FMC A;  4C3H B;  4A75 A;  2UU9 Q;  2JQO A;  1IYU A;  3OIP A;  4DV7 Q;  1Y14 B;  4JI2 Q;  4JPB W;  4DR5 Q;  1FVI A;  2IX1 A;  1BUV T;  1CSQ A;  1EYD A;  1YNX A;  3RZO H;  3MFG A;  1ILQ A;  1JJC B;  2F0H A;  4J15 A;  1QVG A;  4FVM A;  2EYM A;  3KDF A;  2OEO A;  2SDF A;  2QIL A;  4YCV A;  2WAQ B;  1Z6H A;  3R2I A;  1SE2 A;  3I3C A;  1E3P A;  4X6A H;  1YBY A;  2QW7 A;  3KYH C;  3AYH B;  3HOV B;  4C3I G;  3ER0 A;  3PIP 3;  5CV6 A;  1YNJ D;  3WOF A;  3T1Y Q;  3CXC A;  3SGI A;  1IBK L;  1U0L A;  4OWT B;  1EEF D;  5IP7 H;  4X3S A;  3EJI A;  2XTI A;  4F7X A;  1CZW A;  1RDP D;  5I2X A;  4K0K L;  1E1O A;  3I91 A;  1KHI A;  2HIX A;  2F03 A;  3MXP A;  1O78 A;  1LTG D;  2L5T A;  3KOJ A;  2L0C A;  4B3T L;  2UUB L;  1Y8O B;  3G6E A;  2I07 B;  4O42 A;  1SNM A;  1YNN D;  3MWY W;  5IGF A;  3KFU A;  4EVO A;  4O0A A;  1K8A C;  2JA8 B;  5BN4 A;  4U68 A;  1KC8 C;  2K1B A;  4XYO A;  3SK5 A;  3PMF A;  3GDE A;  3VYR A;  1Q82 C;  4A93 H;  2B8F A;  5ISR A;  2F0T A;  4RG1 A;  1VQN A;  2OT2 A;  5IGB A;  3AFQ A;  2PYK A;  5IT9 E;  2CQA A;  4A3M G;  3DXJ C;  2IWH A;  4DGZ A;  3ITP A;  1GXD C;  4KD4 A;  4LF9 L;  3MTS A;  2CKZ B;  3D4R A;  2B2U A;  3CRL C;  3DMU A;  3RD4 A;  2K5Q A;  3CC4 A;  3I4M B;  2HQL A;  2R93 B;  1PDQ A;  4ZYS A;  2WAQ E;  3BZC A;  3TZD A;  4JVZ A;  4DV0 L;  5DEH A;  4DV0 Q;  5C3E B;  1NJI C;  4P73 A;  3C3L A;  1WJJ A;  2R7Z G;  3P75 A;  1RL2 A;  2EVB A;  4DK6 C;  1K0R A;  3HOW B;  4HSV A;  4JI7 L;  2FMM A;  1ENA A;  2MGS A;  4AYB B;  1AEX A;  3I4N H;  2RQX A;  3FVQ A;  3IRB A;  4O2D A;  3GO5 A;  4Q0F A;  1PH8 A;  4JOI A;  1B50 A;  1NE3 A;  1V1P B;  3BJU A;  2UUC L;  2A6E C;  1G2S A;  3Q0A A;  5EJW A;  3ULL A;  1PYB A;  1ICW A;  4DK3 C;  1HQM C;  1Q81 C;  1RHP A;  5CV8 A;  1H9M A;  1Y1W H;  2AWO A;  4NMZ A;  1IHZ A;  3E0J A;  3NBH B;  1HR0 L;  1PZK D;  5HY6 A;  1B7Y B;  3EBE A;  3L9A X;  1PH7 A;  5KND A;  4BBS H;  1TKW B;  1HH2 P;  3TRE A;  1P8L A;  3HFZ B;  2FMC A;  3TSS A;  4NKL A;  3MXN B;  4IFD J;  3KK7 A;  4DPG A;  5JAV A;  2H4O A;  1YIJ A;  1N32 Q;  1VQ6 A;  5EQ0 A;  4HJA A;  5K36 G;  5C5M A;  4LUV A;  4NXM L;  1TWH B;  3RMH A;  3SK8 A;  3GTG H;  5C6A A;  1KRS A;  3PQI A;  4G7Z C;  1XNQ Q;  2K01 A;  3NTI A;  1JC7 A;  2N3S A;  3D4D A;  2F0E A;  4LK1 C;  4I65 A;  1STA A;  3E6Z X;  3NBI A;  4KKU A;  1E2W A;  3I55 A;  2DY8 A;  1RIP A;  3JAM c;  2E5L L;  3PO2 H;  2F3W A;  1LO5 D;  1A3V A;  3KJO A;  1I5F A;  4HTH A;  2A6H C;  1VQM A;  5M5W B;  1FNW A;  5JOB A;  2JP1 A;  4A3G H;  4QCL A;  1LM0 A;  1JIC A;  4ZRZ A;  3NQT A;  4R4Q A;  1MBY A;  2C35 B;  2Y0S E;  3R3O A;  5EKK A;  1Q1E A;  2YTY A;  3NK9 A;  1LTT D;  3FP9 A;  1GUT A;  3GQB A;  4X62 Q;  4WFN 3;  2NN6 I;  4JI5 Q;  4HID A;  2K75 A;  1EWI A;  3KDF B;  4DV2 Q;  4RGO S;  2ALY B;  5C44 G;  1TWA B;  2M2L A;  3CCU A;  4RHR A;  4BXX H;  5IWA L;  1Y69 U;  1V1Q A;  2EY2 A;  2HCI A;  1TS3 A;  1TXY A;  3M4O H;  1RJT A;  4L5T A;  5JJK A;  3JC6 6;  3CCR A;  4A3I H;  3LNN A;  3U9S A;  2VUM H;  5A2Q E;  5JEA H;  3HP3 A;  1CKN A;  3S1R H;  4NP5 A;  1AFP A;  1K83 H;  3V2T A;  2OCE A;  5I6Y A;  2RKS A;  1B53 A;  3OPO A;  1K8G A;  4DV1 Q;  4DUY Q;  1K3R A;  1GHJ A;  2NN6 G;  3CCE A;  4HJ9 A;  1IBM Q;  4R4I A;  4V19 0;  1UUP A;  4WJW A;  1SNC A;  4L5S A;  4EGV A;  1IXR A;  4DV6 Q;  1GJX A;  3AB9 A;  4QQB X;  4HR7 B;  1A63 A;  2QDB A;  2K32 A;  1SYB A;  1SJH D;  3I73 A;  1JB3 A;  1TQO A;  4EQO A;  4LF7 L;  1JOO A;  3PCO B;  3GTO B;  1S5C D;  4IOC A;  4JV5 Q;  2JN4 A;  5HGT A;  4UP7 A;  4DR1 Q;  3GTL H;  3LWU A;  2MJ8 A;  1WTV A;  2AQ1 B;  1U4L A;  1J5E Q;  2E74 C;  3CCM A;  5IP9 H;  2F0M A;  4HSP A;  3CQZ H;  4JCV E;  1E1T A;  4K14 A;  4BY1 H;  3A8J E;  3CP0 A;  1STE A;  3FKI B;  4DXF A;  5I4D A;  1M4V A;  5IYC H;  1SYG A;  3T1H Q;  1PMR A;  4HIO A;  4DNT B;  3H0G H;  4DAY A;  1HRJ A;  5M5Y H;  4LF5 L;  2JJQ A;  1OXX K;  2RF4 A;  4LW1 A;  4IQZ A;  2QEJ C;  2N49 A;  4YCW A;  2M9V A;  1P16 A;  2PMZ E;  3TP8 A;  2KQ3 A;  4B3M L;  4BA2 I;  3HKZ G;  4ILW A;  4B3M Q;  3CCJ A;  4LNQ A;  2IHF A;  5IP7 G;  2F52 A;  3ICE A;  4LFC L;  4A3M B;  3STB D;  4LFC Q;  3FDT A;  5KIX A;  1SJE D;  2IX0 A;  2PZT A;  5HGQ A;  1MSH A;  4A3B B;  2RDF A;  4A3F H;  3S2D B;  1Y1V H;  1NY4 A;  3S1Q B;  1S3O A;  1A0I A;  4JK1 C;  4QJF A;  1D1K A;  4DV4 L;  2ID0 A;  3HZX A;  1X65 A;  4A93 G;  1SEB D;  2ATW A;  1C7Y A;  1NCV A;  2E2H H;  4JI8 Q;  2B63 G;  4N9T A;  1QZH A;  3EQL C;  2DJF C;  4OWX B;  3JAM i;  2MFI A;  4AQY Q;  1X3F A;  4IOA A;  4G57 A;  5IGD A;  3J81 c;  1YZ6 A;  3N6R A;  4ZK9 B;  3GV6 A;  5AJ3 Q;  3BVG A;  1U4R A;  2MQH A;  5GAH C;  2B2V C;  1G8Z D;  4B08 A;  1QE6 A;  4I7A A;  2E2I H;  2B2Y A;  3CPW A;  1Q8I A;  3E3X A;  2UXD L;  2N88 A;  2G9D A;  2Q2I A;  3H3V H;  2AHO B;  1HNZ L;  4POG A;  5KNC A;  3L2P A;  2A73 B;  1I3Q H;  2XN9 C;  4XT3 B;  1G29 1;  4OXP A;  3I4N G;  1QUQ A;  4MTN A;  2Z6B A;  1WCM H;  1EYG A;  1STY A;  1K3B C;  1LT4 D;  1STH A;  5COY A;  1WYD A;  4CDC C;  1BCP B;  1UNS A;  3CCS A;  1K28 A;  3A56 A;  4RKB A;  1MSG A;  5LMU Q;  1DD2 A;  1JR0 D;  4MN3 A;  4A3J G;  1IL8 A;  1EOT A;  4BBR G;  3UDG A;  3ND9 A;  5EAY A;  4X65 L;  1EY7 A;  4DR2 Q;  1WI5 A;  2NUC A;  2A6E D;  1S5B D;  1CKN B;  3PUZ A;  4LFB L;  2AMC B;  3H3V C;  2WB1 E;  3CME A;  2IPK D;  1SFO H;  1KD1 C;  1EQQ A;  3NEL A;  4TSS A;  2DN8 A;  1WTP A;  2J7Z A;  3NEM A;  3GD7 A;  1YI2 A;  3CCV A;  4N8F A;  5J22 A;  3QIA A;  5JVH 3;  3OTO Q;  4POF A;  2KEC A;  1XPR A;  5GRO A;  2VL6 A;  3NHH A;  4DV3 L;  4B3R Q;  4XIG S;  1BBU A;  2N55 A;  2WV6 D;  2EOT A;  4EX5 A;  3K81 C;  3T16 A;  2K33 A;  4FF2 A;  5C4X G;  2V1C C;  4YWL A;  3PO2 G;  4ME3 A;  2KOL A;  5M3M H;  3A55 A;  5C0X J;  4F8M A;  1XMO L;  3MC0 B;  4GLX A;  2Q2T A;  2MPM A;  3TZU A;  3S14 H;  1I6H H;  1ENF A;  4LF8 Q;  2BH8 A;  5EKL A;  2L1B A;  2YTX A;  3WDN A;  4YWK A;  1KAW A;  4OO1 H;  1A3U A;  4CBV A;  2EJM A;  4K8I A;  1EQT A;  1T5X D;  2Z6K A;  3AFP A;  1V9P A;  3AQQ A;  3KJP A;  3RZD B;  2AWN A;  2H5X A;  3A7L A;  3A74 A;  2A1A A;  3K59 A;  3GTM H;  3NTH A;  2F4V Q;  4HJ7 A;  1BVS A;  4KV6 A;  4ODG A;  1TWC H;  4DAY B;  4HIK A;  3GTQ H;  4DR4 Q;  2A6H D;  3BVM A;  5T1I A;  2NVT H;  2YU9 B;  4BXX G;  3GV3 A;  2VQF Q;  4CKE A;  1G51 A;  2VUM G;  2BA0 A;  3RLF A;  4GN5 A;  4EQP A;  2D0P A;  1B9N A;  5JEA G;  3D31 A;  1ENC A;  3CKI B;  2ENB A;  3QJY A;  3Q23 A;  1QB5 D;  1DZ1 A;  3VYT A;  2WIN B;  1XNR Q;  2CHB D;  1CHQ D;  5HUR A;  3SEB A;  5K5P A;  3J80 c;  5FO8 B;  1Y8P B;  2CW0 C;  2K04 A;  2ZTC A;  2EY6 A;  3HOZ H;  1BQQ T;  3RZO B;  1L2F A;  3J81 i;  2JXM B;  2D9U A;  2KUM A;  5CV5 A;  1CK1 A;  2PQE A;  2L11 A;  1C48 A;  1TY0 A;  3G7L A;  2FJ2 A;  2MUY A;  4JI0 L;  2Z4H A;  4JI0 Q;  1BR9 A;  1IYJ B;  3A5U A;  2SNS A;  3KBX A;  4CKB A;  1SMY C;  4EQN A;  5C4H A;  2AQ3 B;  4RGN A;  1V1P A;  2IX3 A;  2LSS A;  5IP9 G;  1S5F D;  3M7N A;  1XYI A;  3ERQ A;  1J9O A;  3V05 A;  4BY1 G;  2JA9 A;  1YHB A;  2XNA C;  1A15 A;  4XQJ A;  1JOR A;  2QKI C;  3I8Z A;  2OTJ A;  1GM5 A;  4FDB A;  3EA6 A;  2EJF C;  5C44 H;  2KCT A;  1VMC A;  5IYC G;  3NBH A;  2F0N A;  3CRK C;  2AQ2 B;  5KNB A;  2JA7 H;  2DJG C;  1O7L A;  3F2D A;  1OO9 B;  4DR3 Q;  2I5L X;  5FOB B;  1J8I A;  3SK4 A;  2IW3 A;  1HZ9 A;  5C4J H;  5I9O A;  2QA4 A;  1CZG A;  1JCK B;  2F1M A;  5FKA C;  1W6J A;  2IJ0 A;  4FNF A;  3U9O A;  4H7B A;  4DR6 Q;  1RD9 D;  4A93 B;  3S1N B;  4JI4 L;  1S40 A;  3C1F A;  4K6D A;  1F2M A;  1QVC A;  2XVS A;  4A3L G;  3H6M A;  4TRD A;  1EUJ A;  2F0G A;  1JB7 A;  2BE5 C;  4QB4 A;  1D5X C;  3U58 A;  2J0T D;  3CHB D;  1VCI A;  1O7I A;  1ZYR C;  4GOP A;  4A3F G;  1I94 L;  3TN2 A;  1M90 C;  4HED A;  3VA7 A;  1WTR A;  1JE4 A;  2PCF B;  3ND8 A;  2UU9 L;  1NNX A;  4C56 C;  3UI2 A;  4WJ3 M;  4DV7 L;  4JI2 L;  5EBD A;  1DOL A;  4YCU A;  4DR5 L;  3HOU H;  2F0I A;  3QO2 A;  2NB0 A;  4KHZ A;  2PW5 A;  4ZQ3 A;  4GKK Q;  3LWE A;  1EU4 A;  2Z8L A;  2CCZ A;  1T9H A;  1PH1 A;  3I4N B;  4BY7 H;  4K5W A;  5TSS A;  4JI3 Q;  5H1S E;  3J81 L;  2ZJR A;  1FJG Q;  2B2T A;  4HJ5 A;  2VQE Q;  4UP8 A;  1FL0 A;  4J6H A;  3K7A B;  3G6J B;  4A3D H;  1Q1B A;  1R4Q B;  4B9W A;  4KLK A;  4RA8 A;  1G6Z A;  4IFD H;  1Y1W B;  3T1Y L;  4YY3 Q;  3TP6 A;  2KED A;  1PFB A;  3J7A F;  4GNX A;  1DM0 B;  1OXV A;  5EPL A;  4M8A A;  4BBS B;  1X9N A;  5ELF A;  1X3E A;  1SXT A;  4JI6 Q;  1S4Z A;  1WTW A;  4DUZ Q;  4A3K G;  1WCM G;  2Q8T A;  4G4K A;  3BVZ A;  1UE1 A;  3CD6 A;  1EOV A;  1I50 B;  1QIL A;  3FPP A;  3S16 B;  4KJO A;  1QNK A;  3PO3 H;  3GTG B;  3T4A C;  2UXC Q;  4ZCK A;  3QWN A;  1Q46 A;  4X66 Q;  3MEF A;  4RFB A;  1A6X A;  1PFM A;  2EDG A;  2SNM A;  1QNU A;  3TP5 A;  5CV9 A;  4X3U A;  1DJR D;  3S17 H;  4IUT A;  3BU2 A;  1JT8 A;  5M3F G;  5GAD C;  2KEE A;  1D5Z C;  3J80 i;  1XXG A;  2E2J B;  1L1O C;  2XRQ D;  4MIU A;  2B63 H;  2OF1 A;  1UEB A;  1LTB D;  1HR0 W;  1CQV A;  3I72 A;  2UXB Q;  4QMG A;  2EQS A;  4C3J H;  3PUV A;  5IY0 A;  2JA5 H;  1I4G A;  1AW7 A;  4RH6 A;  1LTR D;  1HNX Q;  4A3G B;  1TWF H;  1EY9 A;  3X3N A;  3HRZ C;  1SE4 A;  5T1G A;  4NB3 A;  1JE5 A;  2XWB B;  4H13 C;  4HN7 A;  4XXE A;  5GQO A;  2RDH A;  1PFS A;  1EY0 A;  1OXT A;  4MNO A;  3HOX H;  1GVP A;  3WOE A;  1EIY B;  4G7O C;  2HDL A;  4PMW A;  3MXU A;  4KI0 A;  1CM9 A;  1KTK A;  4JI1 Q;  1PVO A;  2CH4 A;  1X54 A;  3DWA A;  3PIO A;  5M3M G;  3M4O B;  2PNH A;  2K6A A;  5M5X H;  1LT3 D;  3A7A B;  4OEL B;  4A3I B;  2VUM B;  1JWS D;  2K5H A;  1PTO H;  3M4Q A;  3CF5 A;  4EQ5 A;  3S1R B;  1VQK A;  4A3C G;  2L55 A;  2FXQ A;  1K83 B;  4OO1 G;  1J6Q A;  2HIV A;  4FO2 A;  3UE0 A;  3W1G A;  1DYQ A;  2EZV A;  5E1F A;  2KVM A;  2K7V A;  4A3J H;  4CHT B;  1A8V A;  1VS0 A;  3P20 A;  4HAE A;  4BBR H;  1B9M A;  1ONL A;  4DF7 A;  4NXN Q;  1XTC D;  1E2Z A;  5CV7 A;  3ZYY X;  3KF6 B;  1PLF A;  1PA6 A;  3EVQ A;  4GLV B;  4HCS A;  1N32 L;  1ESF A;  3HOV H;  1SNQ A;  3GTL B;  4LFA Q;  3S1M H;  2K50 A;  2JE6 I;  2N8N A;  1SBB B;  3H91 A;  3D0F A;  3J7Y W;  5FLX c;  1WD0 A;  1XNQ L;  4A3E H;  1NSN S;  1S5D D;  3CQZ B;  4IUU A;  2MNA A;  2RSN A;  5GAG C;  2NWG A;  1I4X A;  1SMX A;  1PH2 A;  1PTO C;  3HOZ G;  5CBA E;  1S72 A;  5EKI A;  4GOP B;  4IN3 A;  5FJ8 H;  1MHW C;  3J80 L;  1K73 C;  2B3G A;  2I5M X;  5C4X H;  2K5D A;  3H0G B;  5M5Y B;  4N8X 1;  1HZB A;  4K5V A;  5J1Z A;  1IL2 A;  2RCN A;  3D3R A;  3KLS A;  2Z1C A;  4AYB E;  5IT9 L;  3RN2 A;  2JA6 B;  1GUG A;  1HUN A;  4GLA C;  4X62 L;  3OSO A;  3VYS A;  4JI5 L;  4KHP Q;  4XQN A;  2CW0 D;  1AZQ A;  1ET9 A;  4PZ8 A;  3BZK A;  4DV2 L;  3B6Y A;  1QCB D;  3PF4 A;  1EFI D;  5F2D A;  3K8A A;  2JA7 G;  1GHK A;  1N34 Q;  1PRT D;  2XGT A;  1E7Z A;  3DM1 A;  1Y1V B;  4CGY B;  2ZM6 Q;  3SXH A;  3PUY A;  1M1K C;  4DNR B;  4IAL A;  4GNX B;  1SE3 A;  2NZH A;  3EN2 A;  1D8L A;  4UP9 A;  1LAB A;  2EY5 A;  2E2H B;  4DV1 L;  4DUY L;  2FFK B;  1IBM L;  2YTV A;  2KHI A;  1VQB A;  4DV6 L;  4B9X A;  1JOQ A;  3MZ5 A;  3GP7 A;  2OWO A;  2VS1 A;  3SDZ A;  4J8Q A;  1PH5 A;  1F9R A;  3RNU A;  4JV5 L;  2V4D A;  4DR1 L;  2GVB A;  2E2I B;  2XSC A;  2I5H A;  4MZ9 A;  4K8J A;  4C3I B;  3QG1 A;  1U4P A;  4E6I A;  1J5E L;  5I2Y A;  4Z9C B;  3KUP A;  3HOU G;  3PIO 3;  3IAY A;  4DV5 Q;  4QIW B;  3MAQ A;  1TWG H;  2F0U A;  3T56 B;  2EJG C;  5AFW A;  1A2T A;  3DLL A;  3OW2 A;  4GN3 B;  4OX9 Q;  4GS3 A;  1ZYR D;  1SYC A;  2NBF A;  4BY7 G;  1AE2 A;  3I7F A;  3UDX A;  3UDI A;  1WCM B;  3T1H L;  4DFA A;  3UE1 A;  3ULJ A;  1EY5 A;  2B2W C;  4JBM A;  3VR4 A;  2ZTD A;  4A3D G;  1BO0 A;  1MIU A;  1BNZ A;  1LTI D;  3PV0 A;  4IFD G;  4Y7N H;  2NYZ D;  4PMC A;  3D6C A;  4I7Z C;  5I6W A;  1KLG D;  1F77 A;  2PPB C;  5J39 A;  2RHS B;  4A3L H;  4JYA L;  1EY8 A;  4JYA Q;  2K14 A;  1Q3L A;  4RAU C;  1CKO A;  5ELO A;  1PH9 A;  5KEE A;  5A35 A;  3PO3 G;  3J7A V;  1SFO B;  1TS5 A;  2TMP A;  4DK1 A;  2HCC A;  2G9H D;  3VR6 A;  1IBL L;  1IBL Q;  4CDF C;  2KA7 A;  3DHQ A;  1IW7 C;  1YVC A;  4QY7 A;  2K05 A;  5E3F A;  1ASY A;  3Q22 A;  5GAE C;  4JI8 L;  1VDZ A;  2R7Z B;  3GTK H;  3BDL A;  5IOC A;  4AQY L;  3E9I A;  1LTS D;  3MVV A;  4C3J G;  3T13 A;  3RUZ A;  2JA5 G;  3BZD B;  1V1O A;  1E22 A;  5AJ3 L;  3S14 B;  2F0L A;  5I9P A;  1X56 A;  4QUC A;  1KNE A;  3JAM E;  1L0W A;  1LT6 D;  1K0S A;  3HOX G;  1X32 A;  3DEP A;  4BA1 I;  5LMN L;  3BYY B;  5LMN Q;  2R6G A;  5JEA J;  4ABN A;  3GTM B;  1KDC A;  2DY7 A;  3FHW A;  3MXG A;  2MO0 A;  3MEH A;  1PRT B;  1TWC B;  2ZXR A;  4P71 A;  2KHS A;  4J1M A;  2NVT B;  2R92 G;  1R4P B;  2F0P A;  4S3S A;  5EPJ A;  1EZ8 A;  4HJ8 A;  2GN5 A;  2ICI A;  4X64 Q;  1VQG A;  2VW9 A;  1I4P A;  4A3K H;  4BS9 A;  1TR5 A;  1F2Z A;  3DUZ A;  4LMQ D;  1U9R A;  2PQA B;  2RHQ B;  5LMU L;  1I4R A;  2G5D A;  1CA6 A;  2Z0S A;  3PSI A;  5M3F H;  2CH4 W;  4LF4 Q;  3FKI H;  3G4S A;  1EIF A;  1EWC A;  1LTL A;  1WTQ A;  2WFW A;  3W3A A;  2WAQ G;  3L3O C;  3CMA A;  4DR2 L;  2KBN A;  4GKJ Q;  2R7D A;  4U67 3;  3Q24 A;  4RKL A;  5JVG 3;  1HNW Q;  3K80 C;  1QWY A;  1F9P A;  4FF3 A;  3OWE B;  5FO9 B;  2A68 C;  1FD7 D;  1FR3 A;  1NMG A;  4C1N I;  1IKL A;  3HOV G;  2OQ0 A;  4B3S Q;  5D65 A;  1E0B A;  1YHA A;  3AU7 A;  5COR A;  1SNO A;  4UPA A;  4MHE A;  3KF8 A;  4A3E G;  1W2B A;  3OTO L;  5FLX L;  4IPG A;  4FXD A;  5ELE A;  1FNV A;  4G7H C;  4B3R L;  1Q7Y C;  2PZW A;  1Q8K A;  5C44 B;  5ELD A;  1QZG A;  1B2T A;  1CUK A;  5FJ8 G;  2K4K A;  1WOC A;  2VXW A;  4A3B H;  1IYV A;  1EEI D;  5L37 A;  4IJL A;  2A74 C;  1EY4 A;  1BXT A;  1LYL A;  2B2U C;  3I90 A;  2HT1 A;  3FPU B;  5C4J B;  3F2B A;  2JA8 G;  1VQL A;  4LF8 L;  1ILP A;  4K5X A;  4A3C H;  1O7Y A;  4H0L C;  4QF4 A;  3M4P A;  1PTO D;  1XMQ Q;  3I4L A;  3E0E A;  1D7Q A;  3AMU A;  2ZTE A;  4YIJ A;  1LV9 A;  3A54 A;  1TT2 A;  2DUD A;  1DOK A;  4JG2 A;  1SDF A;  2F4V L;  1GOZ A;  3NWT A;  3TME A;  4DR4 L;  4OON A;  2DNC A;  1TU2 B;  4YWM A;  1XPU A;  2YYZ A;  4OIJ A;  4ZUI A;  1SR3 A;  1C9O A;  1MI2 A;  2EYL A;  3M85 A;  2VQF L;  1VQF A;  1ET6 A;  3N52 A;  4JOI C;  5BR8 Q;  2EXZ A;  4KN4 C;  3PGZ A;  4C2M H;  1ZEQ X;  2QF7 A;  2WAC A;  4OHJ A;  2CFM A;  2F0Q A;  4Y52 H;  1WFQ A;  2AKW B;  1RF2 D;  1QOH A;  2PI2 A;  1EFW A;  3HOU B;  1XNR L;  2EYH A;  4XTC S;  1CI3 M;  1N9W A;  1KXL A;  1H9S A;  2F0D A;  4CKC A;  1YHQ A;  2Y0S G;  2LXJ A;  1NBW A;  2CQO A;  1FGB D;  1B8A A;  2ZXO A;  1S5E D;  3SE0 A;  2JSO A;  5CGK A;  4QUF A;  1Q90 A;  1U5K A;  4KKS A;  4A4I A;  4UAI A;  4A3D B;  1L0Y B;  5IT9 c;  2K52 A;  1HA6 A;  3J81 E;  1BKB A;  1H9R A;  1H9K A;  4L6T B;  1PRT F;  1UEA B;  1KQS A;  3DWQ A;  4IZ8 A;  2A19 A;  3HKZ B;  1D5M C;  2EYP A;  3A5Z B;  1HXY D;  1STB A;  3S2H H;  1QJO A;  3R8B A;  3M3Y H;  3W1B A;  3TBI B;  2NVQ H;  4FF4 A;  3R2T A;  4K6L A;  1KL9 A;  1F9S A;  4NDX A;  1B1Z A;  4DR3 L;  1HTP A;  1BBX C;  3PO3 B;  1VF7 A;  4CJ0 B;  3I70 A;  4XT1 B;  2HHH L;  2FHT A;  1GUW A;  2HHH Q;  4PNY A;  2Q2H A;  2BH2 A;  3KF6 A;  2RCF A;  1SYF A;  3H15 A;  3U50 C;  1X55 A;  2MHV A;  4DR6 L;  1W3S A;  2EYF A;  1VQ7 A;  4K2K A;  1VF5 C;  4L8J A;  4KY7 A;  3O13 A;  1T5E A;  2HUG A;  2B63 B;  1BCP C;  1K8O A;  5DAU A;  4C3J B;  1SND A;  3VR5 A;  4RMF A;  5IYD H;  2B29 A;  1TWF B;  1DCZ A;  1VQE A;  4DA2 A;  5CC4 A;  2ZJP A;  5LL6 X;  4R4C A;  3VYU A;  3F2C A;  1N36 Q;  3K7U C;  3K5O A;  1N33 L;  1H9J A;  3K6O A;  1N33 Q;  5C0X G;  3IFD A;  3CPF A;  1E2V A;  2F0S A;  5IYB G;  1EL0 A;  3H3V I;  2CVR A;  4LJZ C;  1HUM A;  5ELB A;  2WII B;  1V43 A;  3F1Z A;  2UUA Q;  2YU9 H;  4GKK L;  2E8G A;  3HKZ E;  4FXK C;  3GTP H;  2B2V A;  2OXP A;  4JI3 L;  1FJG L;  4DR7 L;  1RTO A;  3CU7 A;  2VQE L;  3I4O A;  4DR7 Q;  3QOL A;  4DAV A;  3KF8 B;  1PTO B;  1X3P A;  1EIG A;  4UHV A;  2RDG A;  3CAM A;  1IW7 D;  3TDQ A;  2NVY H;  3OW7 A;  4IUN A;  5ELN A;  4PZ6 A;  4YY3 L;  2RSO A;  2PZU A;  4IUQ A;  1HJP A;  4IUR A;  5KYI A;  1YEZ A;  4A3J B;  1JOK A;  4BBR B;  3Q8D A;  4QGU A;  1CFM A;  4YHH L;  1ICF B;  3M9B A;  1PV4 A;  4YHH Q;  1B4O A;  1PYS B;  2NVX H;  3C46 A;  3HOY H;  1IZ6 A;  3STB C;  2QDL A;  1G2T A;  2GA4 B;  4ALP A;  5JJI A;  2A69 C;  4JI6 L;  2F4I A;  3CC7 A;  3DWP A;  4DUZ L;  1LUZ A;  1C0A A;  4R8I A;  4CDD C;  3V96 A;  4P75 A;  3BDO A;  3S1M B;  2UXC L;  2KJX A;  4X66 L;  1X3Q A;  3IKJ A;  1C8C A;  3FRP B;  4X3K A;  1GO3 E;  1IBK Q;  1KLU D;  4A3E B;  3GTJ H;  1NAP A;  1GUN A;  1CKM A;  4K0K Q;  4FF1 A;  1H95 A;  1OTC A;  2ZJQ A;  4P72 A;  3FKI G;  3QOJ A;  2F0O A;  3OHX C;  4B3T Q;  2UXB L;  4DKA C;  4FYD A;  5C4X B;  2UUB Q;  3PO2 B;  2HDM A;  3ERS X;  1QG7 A;  1ZXT A;  4H44 C;  4KD3 A;  5C5L A;  3R93 A;  1SRO A;  1HNX L;  1JMC A;  3HEJ A;  3CC2 A;  1AP0 A;  1TS4 A;  2K28 A;  3I56 A;  3G48 A;  3J80 E;  5KYL A;  1AZP A;  1PHJ A;  1N8R C;  1CSP A;  1WD1 A;  3S1N H;  4OO1 I;  1JQY D;  3A8I E;  1H9S B;  1YJN A;  5EGT A;  2E75 C;  1C4Q A;  4WOR A;  2A8V A;  1BBW A;  4KY5 A;  4L63 B;  4JI1 L;  4DN4 M;  3S9W A;  3OIQ A;  4DU9 A;  1PH6 A;  1SRU A;  3MFY A;  4ULL A;  4LF9 Q;  2A68 D;  4OIK A;  4UY8 C;  2R92 H;  4A3B G;  3K5M A;  4LUZ A;  1JWU D;  2RA4 A;  3L0O A;  1R9T H;  3K5N A;  3VR3 A;  4PZ7 A;  3S15 H;  4DAM A;  4CDE C;  1VQ5 A;  5G3L D;  4C3H H;  2F0F A;  1VQ4 A;  1JJ2 A;  3NPP A;  2PNR C;  2B2Y C;  2LFN A;  1KAB A;  3OOC A;  2BOS A;  1CHP D;  2WB1 G;  3D8G A;  1SAP A;  1JJG A;  2HQE A;  2Y0S B;  4TQU S;  5IGE A;  1GUS A;  2PO4 A;  2YV5 A;  3ONA B;  4JI7 Q;  2O5J C;  4R9W A;  4KY6 A;  4NXN L;  2DNE A;  1HFG A;  1KNA A;  1B3Q A;  2RVL A;  3K7A H;  2UUC Q;  3RLO A;  1VQJ A;  4RCO A;  1OXS C;  1DGS A;  2K5V A;  5JJL A;  3KBG A;  4LAA A;  5CR3 A;  4GN4 B;  2KEN A;  4LFA L;  1NMF A;  2R3Z A;  1YJ9 A;  4OWW B;  3CCQ A;  2D0O A;  3IL8 A;  2ICE C;  3F2U A;  1HR0 Q;  2PI2 E;  1PXU A;  2ES2 A;  5E7N A;  1D1I A;  2BCO A;  4BY1 B;  1XPO A;  1TWG B;  1KAA A;  5NUC A;  1PTO F;  2R7F A;  4HMI A;  1HFN A;  3NE5 B;  5IIF A;  4DAP A;  1I50 H;  2KHJ A;  3S16 H;  1XWE A;  4WRD A;  4NXM Q;  5EBC A;  3K0X A;  4RHS A;  1DXM A;  2L12 A;  3TRZ A;  1WTX A;  2JA8 H;  2DGY A;  4R4T A;  3AEV A;  3D4W A;  1SYE A;  3BS1 A;  1EWH A;  1FYC A;  2BA1 A;  1BDO A;  4Y7N B;  4R4O A;  1PH4 A;  2GVA A;  4TVA B;  4AIM A;  1NTG A;  1EZ6 A;  4IPH A;  4KHP L;  5DM7 3;  2E2J H;  1EQR A;  2PQA A;  2ZXP A;  1I6V C;  5DNF A;  5JPN C;  2XIW A;  4KKT A;  5ELC A;  2E5L Q;  1UE6 A;  3RLN A;  4PQX A;  4KTA A;  4CJ2 C;  3OMG A;  1VQA A;  3J7Z C;  5FLM H;  1TY2 A;  1MJE A;  3I4M H;  3W5O A;  1N34 L;  3URY A;  2R93 H;  3PUW A;  4JBW A;  4PV1 C;  4A3F B;  1VQ9 A;  2ZM6 L;  3VA5 A;  1VQC A;  1LAC A;  1SMY D;  2EIF A;  4L5R C;  4Q5V A;  4LUO A;  2L15 A;  2Z6K C;  5M9O A;  5C3E H;  1VQP A;  1O7Z A;  4PMB A;  4F88 A;  1WVL A;  2E2D C;  3GTK B;  2KCM A;  3HOW H;  5IWA Q;  4DK0 A;  2PMZ B;  2IY5 B;  5IYD G;  2H1E A;  3M7G A;  3VR2 A;  3KLR A;  1MKH A;  2K03 A;  3TS0 A;  4PG3 A;  2Q8I B;  4MTK A;  2AUK A;  2M00 A;  4KJN A;  2C9O A;  2IL8 A;  3SHL A;  4HIM A;  2F0K A;  2X6G A;  1YJW A;  1WTH A;  1B70 B;  2EY1 A;  4IFD I;  4R8N A;  5DLQ E;  1HA5 A;  2JK8 A;  2JEB I;  2F0V A;  1BCP D;  5CBE E;  3HKS A;  4DV5 L;  1PZJ D;  1SLJ A;  4IUP A;  2CWA A;  1Z9F A;  2BE5 D;  2EE1 A;  1HQR D;  1VQO A;  4IO9 A;  1I3Q B;  3NWS A;  2LKV A;  3L7Z C;  4OX9 L;  4FP5 D;  4LF7 Q;  3NUC A;  1CA5 A;  1E24 A;  4A3K B;  4C1N K;  4KK7 A;  1LT5 D;  1TWH H;  3TQY A;  3QR8 A;  4DXG A;  1ZKO A;  2WKD A;  5FK9 C;  4ZUJ A;  3G71 A;  2O4X A;  2TSS A;  5LL6 S;  1B44 D;  5JPM C;  2IT1 A;  1UE7 A;  3J81 j;  2SOB A;  5LMN W;  5M3F B;  1RTN A;  3NP8 A;  2MO1 A;  1LLR D;  3PUX A;  3PF5 A;  1NR4 A;  4KHV A;  3HOY G;  1TS2 A;  1IKM A;  4NPS A;  4ZLT F;  5D3I B;  2EYO A;  2F0J A;  5M5W H;  4X3T A;  4LF5 Q;  1V8Q A;  2F0W A;  4APV A;  1SSO A;  1FGU A;  1WTO A;  1VQD A;  1Z7T A;  1CT1 D;  3M4Y A;  1TII D;  2EYJ A;  1RCV D;  1STG A;  2F3V A;  5KGU A;  2JA6 H;  4LF6 L;  2IHE A;  2PW7 A;  3NXW A;  1UWV A;  3C1E A;  3KLW A;  4LF6 Q;  4IJH A;  3BG3 A;  1TVX A;  4CJ1 B;  4ME5 A;  5C0X H;  4JBK A;  1RKN A;  1L1O A;  3HG9 A;  4ZKB B;  4OEM B;  2WP8 J;  5IYB H;  1GD7 A;  3P7J A;  3NQI A;  2A69 D;  1TWA H;  3K57 A;  5A2Q L;  3ERO A;  2D62 A;  1SN8 A;  1SE8 A;  5FLX E;  1KIX A;  2X69 A;  1HTL D;  1KRT A;  5M3M B;  1XTD A;  2K5N A;  4P2C B;  1VQ8 A;  4QIW E;  1L0X B;  3E9H A;  3EIV A;  1YIT A;  1FNU A;  5DM6 3;  2LS0 1;  4GOP C;  1I6H B;  4DV4 Q;  3LGJ A;  4RGT A;  1A3T A;  1EQV A;  1HZA A;  1NR2 A;  3CW2 C;  1ESR A;  1PH3 A;  4WJ4 A;  1D6E C;  2NTT A;  3RR5 A;  4H02 A;  2WKC A;  1YNJ C;  2WB1 B;  3SK6 A;  3K5L A;  1STN A;  4XDX A;  4JW0 A;  4BWG B;  2HD3 A;  5J3B A;  3GTQ B;  5C3X A;  4P74 A;  2Q8R E;  3LX0 A;  1F2Y A;  3I2Z A;  1U4M A;  2KCC A;  4ID6 A;  4DNI A;  3GTO H;  1VMP A;  4X64 L;  2SEB D;  2B2T C;  1G6P A;  4C2M B;  2VZA A;  1Z47 A;  4RGM A;  4C3I H;  1YNN C;  4R1J A;  4C3H G;  4KMU C;  2UXD Q;  2VY3 A;  1HHV A;  1HCZ A;  2BDN A;  1HNZ Q;  2F3I A;  3TP7 A;  1PYW D;  4M1U B;  4TKO B;  3F8T A;  4GNX C;  2AUJ D;  4LF4 L;  2J4X A;  2KCN A;  4ZAI A;  3W2D A;  3BDC A;  3HOZ B;  2C5C A;  2NZO A;  2QEX A;  1BF4 A;  2VB2 X;  3H94 A;  3QB3 A;  4GKJ L;  3EFX D;  3DEO A;  3WWV A;  1HNW L;  3DM3 A;  1K9M C;  4N9P A;  4B3S L;  3TS2 A;  1MJC A;  1Y1W G;  2BDO A;  1KDA A;  1X3G A;  2B39 A;  3OMC A;  1NUC A;  1GUO A;  3TEH B;  2FIN B;  3S2H B;  5G3L F;  3NSW A;  2ZT9 C;  2Q2U A;  4FXG C;  3M3Y B;  4RWS C;  3ZJY C;  5E4X A;  3D6W A;  4X65 Q;  4BBS G;  1MGS A;  1VQH A;  2NVQ B;  4A3M H;  4JBJ A;  2NTS A;  1M8A A; 
#chains in the Genus database with same CATH homology
 1J6Q A;  2HIV A;  3UE0 A;  4LFB Q;  3F2C A;  3CP0 A;  3W1G A;  1N36 Q;  2I0Q A;  3K7U C;  4A3J H;  5IYC H;  1N33 L;  1A8V A;  1VS0 A;  4BBR H;  3S2D H;  3T1H Q;  1N33 Q;  3S1Q H;  5C0X G;  4HIO A;  3VDY A;  3CPF A;  3H0G H;  5M5Y H;  4NXN Q;  4DR4 Q;  5IYB G;  2JJQ A;  4LF5 L;  3H3V I;  1OXX K;  2RF4 A;  4LW1 A;  2OTL A;  3KF6 B;  3F1Z A;  1V43 A;  2N49 A;  4GLV B;  4YCW A;  4L5Q A;  1XMQ L;  1PA6 A;  2PMZ E;  1P16 A;  2UUA Q;  4GKK L;  1N32 L;  2E8G A;  3HKZ E;  4DV3 Q;  3HOV H;  2R7Z H;  4OO1 G;  4B3M L;  4BA2 I;  3HKZ G;  4LFA Q;  3GTP H;  3S1M H;  2K50 A;  2JE6 I;  2N8N A;  4JI3 L;  3CCJ A;  4B3M Q;  1FJG L;  4LNQ A;  4DR7 L;  2IHF A;  5IP7 G;  2VQE L;  3I4O A;  4DR7 Q;  2VNU D;  2F52 A;  3ICE A;  3D0F A;  3KF8 B;  5FLX c;  1XNQ L;  3S24 A;  4A3G G;  4A3E H;  1XMO Q;  3U4V A;  4LFC L;  2MNA A;  3STB D;  5FLM G;  4LFC Q;  5GAG C;  3I4M G;  1SMX A;  2IX0 A;  1PH2 A;  3CAM A;  2R93 G;  2NVY H;  5ELN A;  5BR8 L;  5HGQ A;  4PZ6 A;  4YY3 L;  3HOZ G;  1HJP A;  1S72 A;  4GOP B;  4A3F H;  5FJ8 H;  1YEZ A;  3OYY A;  1K73 C;  2B3G A;  1Y1V H;  1NY4 A;  3Q8D A;  2I5M X;  5C4X H;  2CWP A;  4QGU A;  1S3O A;  1A0I A;  4YHH L;  4QJF A;  1VQI A;  3M9B A;  1PV4 A;  4YHH Q;  1PYS B;  4DV4 L;  2ASB A;  2NVX H;  1HZB A;  2ID0 A;  2QGQ A;  5C3E G;  1IZ6 A;  3STB C;  3PIP A;  1IL2 A;  3HOY H;  4ALP A;  5JJI A;  1X65 A;  2RCN A;  4JI6 L;  1GKH A;  4A93 G;  3CC7 A;  2ATW A;  4DUZ L;  1C7Y A;  2E2H H;  1LUZ A;  1C0A A;  4AYB E;  4JI8 Q;  3HOW G;  3RN2 A;  2B63 G;  4AYB G;  4P75 A;  1X6O A;  4OWX B;  4GLA C;  4IPD A;  2MFI A;  4X62 L;  3JAM i;  1X3F A;  4AQY Q;  4JI5 L;  4KHP Q;  2UXC L;  4QL5 A;  4IOA A;  4X66 L;  4A3I G;  3J81 c;  4PZ8 A;  1YZ6 A;  3BZK A;  1GO3 E;  4DV2 L;  1IBK Q;  3GTJ H;  3B6Y A;  5AJ3 Q;  3PF4 A;  4K0K Q;  1L1O B;  1CKM A;  2MQH A;  3UDF A;  5GAH C;  1H95 A;  1OTC A;  2ZJQ A;  4P72 A;  3FKI G;  3K8A A;  2JA7 G;  1UE5 A;  2E2I H;  1N34 Q;  2XGT A;  1E7Z A;  1HZC A;  3CPW A;  4B3T Q;  4DKA C;  2UXB L;  2ZM6 Q;  2UUB Q;  3PUY A;  1M1K C;  2UXD L;  3ERS X;  1SRO A;  2Q2I A;  4GNX B;  1HNX L;  1JMC A;  3H3V H;  2AHO B;  3CC2 A;  2NZH A;  1HNZ L;  4POG A;  3I56 A;  3G48 A;  3EN2 A;  1D8L A;  4UP9 A;  2EXD A;  3L2P A;  3J7A 5;  1I3Q H;  1PHJ A;  4DV1 L;  1N8R C;  4DUY L;  1G29 1;  4OXP A;  1CSP A;  1Q12 A;  2YTV A;  1IBM L;  2KHI A;  3S1N H;  4OO1 I;  1YJN A;  3I4N G;  1QUQ A;  4MTN A;  1VQB A;  1WCM H;  4DV6 L;  1EYG A;  2N78 A;  2A8V A;  2OWO A;  1QVF A;  2VS1 A;  2LXK A;  1BBW A;  5C0X I;  1ASZ A;  5IE8 A;  4JI1 L;  1XJV A;  1PH5 A;  1WYD A;  1PH6 A;  1SRU A;  4LWC A;  4LF9 Q;  2R92 H;  3RNU A;  4UY8 C;  3CCS A;  4JV5 L;  4A3B G;  4LUZ A;  5LMU Q;  4A76 A;  4DR1 L;  2GVB A;  4A3J G;  3L0O A;  2I5H A;  4BBR G;  1R9T H;  4MZ9 A;  4PZ7 A;  3U4Z A;  3S15 H;  4DAM A;  3UDG A;  5EAY A;  1Q86 C;  1J5E L;  3H0G G;  4X65 L;  1VQ5 A;  4AH6 A;  3HOU G;  4C3H H;  4DR2 Q;  1WI5 A;  4DV5 Q;  1VQ4 A;  1JJ2 A;  2JEA I;  1CKN B;  3PUZ A;  1TWG H;  4LFB L;  1N36 L;  2AMC B;  3DLL A;  3OW2 A;  2WB1 E;  2JA6 G;  4GN3 B;  3CME A;  4GS3 A;  3RN5 A;  4OX9 Q;  1OXU A;  2WB1 G;  4BY7 G;  2OQK A;  1AE2 A;  3I7F A;  3UDX A;  3UDI A;  3RZD H;  1SFO H;  3T1H L;  3NEL A;  4TQU S;  1EQQ A;  1KD1 C;  3UE1 A;  3ULJ A;  4JI4 Q;  2YV5 A;  4JI7 Q;  1QUQ B;  3ULP A;  4NXN L;  4JBM A;  1AH9 A;  3NEM A;  3GD7 A;  1YI2 A;  3CCV A;  4JC0 A;  2ZTD A;  3K7A H;  3A0J A;  2UUC Q;  3RLO A;  1VQJ A;  3OTO Q;  4A3D G;  1OXS C;  3NEN A;  4POF A;  1XPR A;  2UUA L;  1DGS A;  5GRO A;  1MIU A;  2K5V A;  5JJL A;  3CCL A;  2VL6 A;  3PV0 A;  4DV3 L;  4IFD G;  4B3R Q;  4XIG S;  1BBU A;  4Y7N H;  4GN4 B;  2KEN A;  4EX5 A;  1NMF A;  4IPC A;  4LFA L;  3K81 C;  1YJ9 A;  1I94 Q;  1Y1V G;  3CCQ A;  2D0O A;  4OWW B;  1AE3 A;  2V1C C;  4YWL A;  3PO2 G;  4ME3 A;  5C4X G;  1A62 A;  5M3M H;  5C0X J;  1XMO L;  1HR0 Q;  2RHS B;  4GLX A;  2PI2 E;  4A75 A;  2ES2 A;  2JQO A;  2Q2T A;  2UU9 Q;  4JYA L;  4A3L H;  5E7N A;  3S14 H;  4JYA Q;  1I6H H;  2K14 A;  1CKO A;  5ELO A;  4DV7 Q;  1XPO A;  1Y14 B;  4JI2 Q;  4LF8 Q;  2BH8 A;  4DR5 Q;  2YTX A;  1PH9 A;  1FVI A;  2IX1 A;  4YWK A;  1KAW A;  2R7F A;  1CSQ A;  1QZH A;  1YNX A;  2Z6K A;  3PO3 G;  3AFP A;  1V9P A;  3AQQ A;  3KJP A;  3RZO H;  1JJC B;  2AWN A;  1I50 H;  2H5X A;  2KHJ A;  2A1A A;  3A74 A;  4J15 A;  1QVG A;  3S16 H;  3KDF A;  4YCV A;  4NXM Q;  3GTM H;  3K0X A;  2F4V Q;  1IBL L;  4HJ7 A;  1BVS A;  3TRZ A;  4DAY B;  1TWC H;  4HIK A;  1IBL Q;  3GTQ H;  2JA8 H;  1ASY A;  1YVC A;  4QY7 A;  1E3P A;  2DGY A;  4R4T A;  2NVT H;  4BXX G;  1YBY A;  5GAE C;  4JI8 L;  3KYH C;  3AEV A;  4X6A H;  2BA1 A;  3AYH B;  1PH4 A;  4R4O A;  2GVA A;  4TVA B;  4AIM A;  2VQF Q;  3GTK H;  1NTG A;  4AQY L;  3E9I A;  4IPH A;  4KHP L;  1G51 A;  3ER0 A;  2E2J H;  1EQR A;  2PQA A;  3T1Y Q;  2VUM G;  2BA0 A;  3RLF A;  4GN5 A;  2JA5 G;  3CXC A;  2D0P A;  3SGI A;  5JEA G;  1IBK L;  2E5L Q;  1UE6 A;  1U0L A;  4OWT B;  1E22 A;  3D31 A;  5AJ3 L;  5IP7 H;  3RLN A;  2XTI A;  4K0K L;  1E1O A;  1VQA A;  3J7Z C;  1X56 A;  1KHI A;  1XNR Q;  5FLM H;  2HIX A;  1MJE A;  3I4M H;  3W5O A;  1N34 L;  1L0W A;  3KOJ A;  2R93 H;  3PUW A;  4JBW A;  4B3T L;  3HOX G;  3J80 c;  1VQ9 A;  2ZM6 L;  2UUB L;  3HOZ H;  2ZTC A;  4BA1 I;  1VQC A;  5LMN L;  3G6E A;  1L2F A;  3J81 i;  2R6G A;  2EIF A;  5LMN Q;  4L5R C;  5JEA J;  4LUO A;  2L15 A;  3KFU A;  3FHW A;  4O0A A;  2MO0 A;  4P71 A;  2Z6K C;  1K8A C;  5C3E H;  1VQP A;  2R92 G;  4JI0 L;  1KC8 C;  4JI0 Q;  1IYJ B;  4HJ8 A;  1JJG A;  3GDE A;  1Q82 C;  2GN5 A;  4A93 H;  3A5U A;  2KCM A;  4X64 Q;  1VQG A;  2VW9 A;  4A3K H;  3HOW H;  5IWA Q;  2IY5 B;  5IYD G;  2LSS A;  2PQA B;  4RG1 A;  5IP9 G;  1VQN A;  3AFQ A;  3M7N A;  4A3M G;  2RHQ B;  1MKH A;  4BY1 G;  3TS0 A;  2JA9 A;  2YU9 H;  4PG3 A;  1YHB A;  4LF9 L;  2CKZ B;  2OTJ A;  1GM5 A;  5LMU L;  4FDB A;  3CC4 A;  4HIM A;  5C44 H;  2KCT A;  2HQL A;  2Z0S A;  1YJW A;  3PSI A;  5IYC G;  5M3F H;  1B70 B;  4LF4 Q;  3FKI H;  4IFD I;  2JA7 H;  5DLQ E;  1EIF A;  3G4S A;  1LTL A;  2JK8 A;  2WAQ E;  3BZC A;  3F2D A;  2JEB I;  4DR3 Q;  2WFW A;  3CMA A;  2WAQ G;  4DR2 L;  3HKS A;  2I5L X;  2KBN A;  4DV5 L;  1SLJ A;  2R7D A;  4GKJ Q;  1HZ9 A;  5C4J H;  2CWA A;  1Z9F A;  1HNW Q;  3K80 C;  4DV0 L;  2QA4 A;  4DV0 Q;  1VQO A;  4P73 A;  1NJI C;  4IO9 A;  1WJJ A;  3L7Z C;  1NMG A;  4OX9 L;  3HOV G;  2OQ0 A;  4B3S Q;  2R7Z G;  4DR6 Q;  1RL2 A;  4LF7 Q;  4DK6 C;  1YHA A;  1E24 A;  1K0R A;  4JI4 L;  4JI7 L;  1S40 A;  4UPA A;  3I4N H;  1QVC A;  3IRB A;  4O2D A;  1TWH H;  4A3L G;  3GO5 A;  4A3E G;  1W2B A;  4JOI A;  1PH8 A;  1EUJ A;  1NE3 A;  1JB7 A;  3TQY A;  3BJU A;  2UUC L;  3OTO L;  4IPG A;  3U58 A;  3ULL A;  1PYB A;  4DK3 C;  1VCI A;  4B3R L;  1Q7Y C;  1Q81 C;  3G71 A;  1Q8K A;  1O7I A;  1QZG A;  4GOP A;  4A3F G;  1CUK A;  5FJ8 G;  2IT1 A;  1UE7 A;  2K4K A;  1WOC A;  3J81 j;  1I94 L;  5LMN W;  1Y1W H;  4A3B H;  2AWO A;  1M90 C;  4IJL A;  2MO1 A;  3PUX A;  3PF5 A;  3NBH B;  1HR0 L;  3HOY G;  1LYL A;  2HT1 A;  2UU9 L;  5HY6 A;  4NPS A;  3F2B A;  1B7Y B;  3EBE A;  1PH7 A;  2JA8 G;  4WJ3 M;  4DV7 L;  1VQL A;  4JI2 L;  5M5W H;  4LF8 L;  3HOU H;  4DR5 L;  4YCU A;  4LF5 Q;  4BBS H;  1HH2 P;  3TRE A;  4A3C H;  4APV A;  1P8L A;  3HFZ B;  3MXN B;  1FGU A;  4IFD J;  1VQD A;  3M4P A;  4KHZ A;  4DPG A;  1YIJ A;  1XMQ Q;  1N32 Q;  4GKK Q;  1VQ6 A;  3E0E A;  2CCZ A;  2JA6 H;  1T9H A;  2ZTE A;  1D7Q A;  4HJA A;  5K36 G;  4LF6 L;  2IHE A;  4LUV A;  1PH1 A;  1UWV A;  3KLW A;  4LF6 Q;  4BY7 H;  4NXM L;  4IJH A;  3GTG H;  2DUD A;  4JI3 Q;  4JG2 A;  5H1S E;  2F4V L;  2ZJR A;  1FJG Q;  4HJ5 A;  2VQE Q;  4UP8 A;  1KRS A;  1FL0 A;  4JBK A;  4DR4 L;  4OON A;  1L1O A;  4YWM A;  1XNQ Q;  1XPU A;  2WP8 J;  5IYB H;  2YYZ A;  1GD7 A;  4A3D H;  2N3S A;  1Q1B A;  1SR3 A;  1C9O A;  1TWA H;  4KLK A;  3M85 A;  2VQF L;  1VQF A;  4JOI C;  2D62 A;  1SN8 A;  5BR8 Q;  3I55 A;  3T1Y L;  4YY3 Q;  1SE8 A;  1KIX A;  1RIP A;  3PGZ A;  4C2M H;  1KRT A;  3JAM c;  1XTD A;  2K5N A;  1VQ8 A;  2E5L L;  2CFM A;  4QIW E;  4GNX A;  3PO2 H;  4Y52 H;  1WFQ A;  3E9H A;  3EIV A;  1OXV A;  2AKW B;  1YIT A;  3KJO A;  4GOP C;  1I5F A;  4DV4 Q;  1VQM A;  2PI2 A;  1EFW A;  3LGJ A;  1XNR L;  4A3G H;  1LM0 A;  1X9N A;  4XTC S;  1HZA A;  4R4Q A;  3CW2 C;  1PH3 A;  1X3E A;  4WJ4 A;  1N9W A;  2C35 B;  2Y0S E;  4JI6 Q;  1KXL A;  3RR5 A;  4H02 A;  4DUZ Q;  1Q1E A;  4A3K G;  1WCM G;  2YTY A;  1YHQ A;  2Y0S G;  1UE1 A;  3CD6 A;  2LXJ A;  1EOV A;  1NBW A;  3FP9 A;  2CQO A;  3PO3 H;  4X62 Q;  1B8A A;  2UXC Q;  2NN6 I;  1Q46 A;  4HID A;  4JI5 Q;  2K75 A;  4X66 Q;  3MEF A;  1EWI A;  3KDF B;  5J3B A;  1U5K A;  4DV2 Q;  4A4I A;  4P74 A;  3S17 H;  2ALY B;  5IT9 c;  5C44 G;  3I2Z A;  3CCU A;  3BU2 A;  4DNI A;  2K52 A;  4BXX H;  3GTO H;  4X64 L;  1JT8 A;  1BKB A;  5M3F G;  5IWA L;  5GAD C;  1G6P A;  3J80 i;  1V1Q A;  1KQS A;  1L1O C;  2B63 H;  2VZA A;  3M4O H;  1TXY A;  1Z47 A;  1UEB A;  2A19 A;  1HR0 W;  4C3I H;  4L5T A;  3A5Z B;  4R1J A;  2UXB Q;  3S2H H;  2EQS A;  4C3J H;  3JC6 6;  3CCR A;  3PUV A;  5IY0 A;  4A3I H;  2VUM H;  2JA5 H;  2UXD Q;  5JJK A;  2VY3 A;  3W1B A;  3M3Y H;  1CKN A;  3S1R H;  1HNX Q;  1TWF H;  2NVQ H;  1K83 H;  1HNZ Q;  2F3I A;  2OCE A;  4NB3 A;  1JE5 A;  4GNX C;  3F8T A;  1K8G A;  4LF4 L;  1KL9 A;  4DV1 Q;  4DUY Q;  1K3R A;  2NN6 G;  3CCE A;  2NZO A;  5GQO A;  2QEX A;  4HJ9 A;  4R4I A;  4DR3 L;  1PFS A;  1IBM Q;  1OXT A;  4MNO A;  3HOX H;  1GVP A;  4L5S A;  1IXR A;  1EIY B;  4DV6 Q;  4GKJ L;  3WWV A;  1HNW L;  2HHH L;  4QQB X;  1A63 A;  2HHH Q;  2Q2H A;  3DM3 A;  4PMW A;  2BH2 A;  4KI0 A;  1K9M C;  3KF6 A;  3H15 A;  3U50 C;  1X55 A;  4B3S L;  4DR6 L;  3TS2 A;  1W3S A;  4JI1 Q;  1VQ7 A;  4LF7 L;  1PVO A;  3PCO B;  1MJC A;  1X54 A;  3PIO A;  1Y1W G;  4IOC A;  4JV5 Q;  5M3M G;  4DR1 Q;  1X3G A;  4UP7 A;  3GTL H;  2PNH A;  3TEH B;  5M5X H;  4RMF A;  2Q2U A;  1J5E Q;  2K5H A;  5IYD H;  3M4Q A;  3ZJY C;  2B29 A;  4X65 Q;  3CF5 A;  4EQ5 A;  1VQH A;  5IP9 H;  3CCM A;  1VQK A;  4BBS G;  4A3C G;  1VQE A;  3CQZ H;  4JCV E;  2FXQ A;  4A3M H;  2ZJP A;  4JBJ A;  1E1T A;  4R4C A;  4BY1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...