4DR1Q

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr1Q00
5M5YH 3CCVA 5C4JH 4YCUA 1Y1VH 3A5ZB 3RZDH 3HOYG 1N32Q 3CCQA 1PVOA 4GS3A 4QIWE 4R4CA 1L1OA 1JJ2A 1PH4A 2E2IH 3CAMA 1MJEA 1OXUA 3CCRA 4A3EG 1GKHA 4A3KG 1Z9FA 3TREA 2E8GA 2RHQB 4MZ9A 3CPWA 4BBSH 4B3RQ 4LF5L 4JI2L 2ZJQA 1YBYA 3CF5A 2BH8A 4BY7H 2UU9L 4A3KH 1SFOH 4DV2L 1SN8A 4Y7NH 4LWCA 2VQFQ 1QVFA 1J5EL 1NE3A 4JI5Q 4GOPA 3CCLA 3M7NA 3PUZA 2D62A 2H5XA 3HOVG 2KENA 3CMAA 2UUBQ 4P75A 2BH2A 3JAMc 2JA7H 4LFAL 1IXRA 1H95A 3UDGA 1VQHA 5BR8L 1RL2A 4KHPQ 1PH3A 1UE7A 4DV0Q 4HIOA 1AE3A 3ULPA 2F4VL 1XPUA 1VQ5A 1U0LA 2AKWB 2VQFL 3JC66 4YWMA 4C3JH 2NVYH 3D31A 1TWAH 1NMGA 3H0GG 3FP9A 4IJHA 4HIKA 1C0AA 1K9MC 1L1OC 1VQDA 4LF7Q 4OONA 4JI2Q 5JEAJ 4LF6Q 2F52A 4JI1Q 4DR4L 4OX9L 4JBJA 4DKAC 2UXCQ 4BBSG 1LM0A 1WCMH 1RIPA 4NXNQ 3AYHB 3I2ZA 2OQ0A 5GROA 1AH9A 1FGUA 2YTXA 2Z6KA 3HOUG 4LFBQ 2VNUD 2EIFA 1QVGA 1X9NA 3UDFA 1VQNA 3GTLH 4K0KQ 3PF5A 4GLVB 1VQOA 1Q82C 4ALPA 2Q2UA 2YTVA 3CCJA 5E7NA 1BVSA 1FL0A 2L15A 3CCEA 3E9HA 3L7ZC 4HIDA 4DV1L 2B29A 4DV3Q 3UDXA 2UUCL 1XMQQ 4L5SA 2K5HA 3KDFB 1TWFH 3GTQH 4OWWB 1E1TA 1MJCA 3T1YQ 4BXXG 5JJLA 3AFQA 4AIMA 2UXBL 4YY3Q 1FJGL 2MNAA 4UPAA 5IY0A 5FLXc 4L5RC 1P16A 3HKZE 1QUQA 3F8TA 1K3RA 4UP9A 3S2DH 3U50C 2UXCL 3K8AA 2E5LL 1C9OA 5GAEC 1L0WA 3KDFA 3S1QH 1YVCA 2ID0A 1X3FA 2GVBA 1N34Q 2C35B 2I0QA 2VUMG 2D0OA 4JI3L 1HZ9A 1VQEA 1CUKA 2KCTA 3PUVA 4JI8Q 3NEMA 4R4OA 4DV7Q 3PUYA 1Z47A 2PNHA 4TVAB 4DK3C 1P8LA 2D0PA 4A3FH 2IY5B 2F3IA 4LUZA 5GADC 2I5HA 4IPGA 2WB1E 1VQGA 2OCEA 3RLFA 4XTCS 1AE2A 2NN6I 4B3SQ 5LMNL 1IL2A 3J7A5 4EQ5A 4A3IH 2JK8A 1ASZA 2MO1A 1OXSC 1YJ9A 4B3SL 1I6HH 2ALYB 1GD7A 1LUZA 4OWTB 4TQUS 3J81c 4NXNL 4P71A 3RNUA 1EFWA 4KHZA 2RF4A 1WI5A 3UE0A 2CKZB 3PUWA 3BZKA 3I4OA 4FDBA 4MNOA 2DUDA 4LF6L 2R92G 3AEVA 1WCMG 4GLXA 1N36L 3I55A 4UY8C 4GKKL 3NBHB 1XTDA 1XJVA 1FJGQ 3GTOH 1SE8A 1N33L 3FHWA 3BJUA 1TWGH 4A3BH 1N32L 2UXDL 4GLAC 2F4VQ 1OTCA 3GTPH 3I4NG 3GTKH 4IFDI 1Q81C 5BR8Q 1QZHA 1NJIC 2UUAL 3DM3A 3W5OA 1UWVA 2JEAI 4QQBX 3CXCA 2CCZA 1NY4A 2JA6H 3M4QA 4LNQA 1VQIA 2JE6I 4POGA 1CSQA 4K0KL 3DLLA 2JA6G 1Y1WG 1K8GA 1I94Q 1IYJB 3J80c 4A3LG 4YCVA 2Q2TA 2OWOA 3H3VH 2R93H 2HT1A 4BXXH 1MIUA 2RHSB 1VQKA 3I7FA 5C4XH 3KF6A 5IP9G 4BA1I 4QL5A 4A3CG 1X3EA 4YCWA 3KJPA 4JI3Q 4IOAA 2N8NA 1CKOA 2IHEA 3K0XA 4JOIA 3M85A 2ASBA 4HJ9A 3L0OA 5IYCG 4L5TA 2CQOA 4LF7L 5K36G 2Q2IA 2K50A 3IRBA 3TS0A 4JV5L 5JJKA 1N33Q 3STBD 5FLMG 3UDIA 1IBML 4JBKA 3RZOH 4HJ7A 4JYAL 1OXVA 2VZAA 5IP7G 4HJ8A 1YIJA 1HNZQ 3GTGH 1JE5A 2AWOA 1YHAA 4DUZL 4JI4Q 1D8LA 5HY6A 1IBLL 4GN3B 3HOUH 3TEHB 3PO2G 2QGQA 4DR4Q 1Q86C 1JJGA 5IWAL 1X3GA 4A75A 4XIGS 4LF9Q 3ICEA 2PI2A 4AYBE 4GNXA 4A3FG 4A3MG 5GQOA 1X56A 3F2CA 1KC8C 2N3SA 4NXML 1PH7A 4LF8Q 4A93H 4YY3L 4DNIA 3KFUA 3BZCA 5C44G 1E3PA 4UP8A 3SGIA 2A8VA 5C0XJ 4BY1G 4DV0L 4JI7Q 4X64Q 1FVIA 1BKBA 3BU2A 4GOPC 4DUYL 1IBKL 3M9BA 4BY1H 4LUOA 4HIMA 2UUBL 1HH2P 4EX5A 5JEAG 3JAMi 4DV6L 1SR3A 4AH6A 2ES2A 4JOIC 2ZTDA 3D0FA 1KAWA 3ULLA 4X6AH 5FJ8H 2V1CC 4R1JA 2GN5A 3RLOA 3U4ZA 4DR2Q 1YHQA 1PH9A 3F2DA 1CSPA 1YHBA 2HHHQ 3B6YA 3GD7A 1HNWL 2CFMA 3H3VI 4DR2L 5FLMH 1I50H 3HOWH 3RN2A 2IX0A 1HNWQ 4WJ4A 3S14H 1XNRQ 1X55A 4X62Q 1NTGA 2BA0A 2E2JH 2K52A 4QJFA 2B63H 1VS0A 1PH2A 3K80C 1HJPA 3PGZA 3HKSA 1IZ6A 1LTLA 3PSIA 3S1MH 2UUCQ 1VCIA 2QEXA 2XGTA 1KL9A 4NXMQ 3K7AH 4KLKA 2E2HH 1UEBA 4IJLA 3EIVA 1MKHA 2UXDQ 2A1AA 1S72A 5GAGC 4IPDA 5IP9H 5IYDH 1VQJA 3FKIH 2NVXH 4UP7A 3TS2A 1VQ8A 1A63A 2R93G 1N36Q 1HZAA 4LF9L 1HNXL 4YHHQ 4LF5Q 1TWCH 4OWXB 4LUVA 2YU9H 4DR7Q 4A3DH 3K81C 1BBUA 3A74A 4DUZQ 4WJ3M 2K75A 3CC7A 4A3JH 3PO3G 5M5XH 2VUMH 4R4QA 1Q12A 1M1KC 1IBMQ 2JA5G 4AYBG 1Y14B 1UE1A 2GVAA 2Z6KC 2OTLA 3F2BA 1HR0W 3CW2C 2PI2E 5M3MG 4OO1G 2JA8G 4LW1A 4LFCQ 5J3BA 2I5LX 4L5QA 4KHPL 4DR6L 1PH5A 2IHFA 2LSSA 3CC4A 2RCNA 3H15A 3W1GA 3CCUA 3GTMH 1S3OA 3LGJA 1G51A 4X64L 4JC0A 1VQMA 4C2MH 2R7ZG 4LFCL 3OYYA 4JI0L 4DR5Q 4Y52H 2DGYA 4ME3A 1LYLA 1N9WA 5LMNW 5ELNA 4DV4L 1HR0Q 5H1SE 4X62L 3CC2A 4LF8L 1CKNB 3GDEA 2YTYA 1WOCA 5LMUL 4A76A 4QGUA 1IBLQ 3NENA 3HOZG 4C3HH 2N49A 4NB3A 3STBC 4DR7L 1PA6A 1K73C 1PHJA 4JYAQ 4B3MQ 4DR1L 4JI6L 3PIPA 5M3MH 4O2DA 2ZJRA 5IYBG 4GNXC 3J81j 5AJ3L 4IPCA 2BA1A 1X6OA 4GNXB 1GVPA 5JJIA 1Q1EA 2I5MX 4DV4Q 1J6QA 1U5KA 1YJWA 2PQAB 4YWLA 3CQZH 1YITA 2ZM6Q 4A93G 4QY7A 2ZJPA 4A3GH 1VQBA 1E24A 3CPFA 2VS1A 4B3ML 4JI6Q 1W3SA 4X65L 3J7ZC 2R7ZH 4LFBL 3S1RH 3T1HL 2VY3A 1YI2A 1Q1BA 4OXPA 4PZ7A 3OW2A 5IWAQ 1XMOQ 5IP7H 2OTJA 1NBWA 1Q8KA 5ELOA 5HGQA 5C3EG 4P74A 3A5UA 1N34L 4LF4L 3S2HH 3K7UC 1KXLA 2WFWA 1YEZA 2E5LQ 4JCVE 3HOWG 2QA4A 1KD1C 2HHHL 3PUXA 1X65A 1C7YA 4BBRG 3G6EA 4X66Q 2B63G 3J80i 1S40A 2MFIA 4PMWA 1PH1A 1KQSA 5LMNQ 4LFAQ 1XMQL 1PYSB 3CCMA 1E1OA 2CWAA 4P73A 4YHHL 2VQEL 3S17H 4DR6Q 1SLJA 2HQLA 4JBWA 1QVCA 2JA7G 1CKNA 1BBWA 3AQQA 4DAMA 1I94L 1YJNA 1T9HA 2JA8H 4DUYQ 1KRSA 4GKJL 2ZTEA 3CP0A 1QUQB 3MXNB 4DV1Q 4JI7L 5IYDG 4IFDG 4GKJQ 2VL6A 1L1OB 3S24A 3PCOB 4B3TL 1EWIA 5FJ8G 1UE5A 1WJJA 1QZGA 4J15A 1M90C 2NVTH 4YWKA 3S16H 2AHOB 3S1NH 1EQQA 1ASYA 1B70B 5M3FG 4RG1A 3ZJYC 2R92H 1YZ6A 3HOZH 1A8VA 2XTIA 3TQYA 2EQSA 2MQHA 3FKIG 2A19A 4BA2I 5GAHC 1NMFA 1VQ4A 4IPHA 2YYZA 4A4IA 4NPSA 2B3GA 1Q46A 4BY7G 1D7QA 4LF4Q 2KCMA 4HJAA 4DV3L 2YV5A 3WWVA 1SMXA 3I56A 2WAQE 4JBMA 3HOXH 3I4MG 2LXJA 3A0JA 4APVA 4JI0Q 3ER0A 1CKMA 3KJOA 3GTJH 2NN6G 3T1HQ 4A3EH 1TXYA 3CMEA 4IO9A 2UXBQ 4DR3L 1WYDA 3AFPA 2PMZE 2WP8J 3VDYA 2NZHA 3KLWA 1Y1WH 1K0RA 4H02A 4A3GG 1VQ9A 2R7DA 1E7ZA 3HOYH 5C0XI 1A62A 4DV2Q 2AMCB 1JB7A 2JQOA 1VQLA 1YNXA 5C4XG 2IX1A 3KF6B 4A3JG 2PQAA 5IT9c 3G4SA 1SROA 2R7FA 3CCSA 1N8RC 1VQ7A 3PO3H 2ZTCA 2K14A 3RLNA 4GOPB 4PZ8A 2Q2HA 4OX9Q 4PG3A 4A3MH 3HFZB 4HJ5A 4DV6Q 4P72A 4JI4L 3RN5A 1EUJA 1KRTA 1HNZL 1VQFA 1HR0L 2OQKA 1V43A 3E9IA 4BBRH 1PV4A 1JT8A 4JV5Q 2VW9A 2Y0SE 1X54A 3HOXG 1OXXK 3ULJA 1J5EQ 3I4MH 1UE6A 5M5WH 1K83H 1XMOL 4MTNA 3U4VA 1GM5A 2IT1A 2MO0A 2UU9Q 2Z0SA 3J81i 4A3IG 3F1ZA 2HIVA 4B3TQ 5EAYA 1HZCA 2K4KA 4A3CH 3W1BA 2EXDA 1B7YB 4GN5A 3MEFA 2ZM6L 2ATWA 1L2FA 4DPGA 3ERSX 1WFQA 2FXQA 1HZBA 2NZOA 4R4TA 4X66L 2VQEQ 1EOVA 2JA9A 4IFDJ 1EIFA 4OO1I 1Y1VG 4DV5Q 2R6GA 3H0GH 1A0IA 1OXTA 2K5NA 3KOJA 4R4IA 3CD6A 2CWPA 4JI1L 1VQAA 1I3QH 1DGSA 5C44H 4KI0A 1KIXA 2NVQH 1EIYB 4GN4B 1XNQQ 1EQRA 4POFA 5IYBH 2K5VA 1KHIA 3EBEA 1TWHH 4A3DG 2LXKA 1JJCB 1K8AC 4DK6C 3PIOA 1VQCA 4X65Q 1XPOA 5LMUQ 3PF4A 3T1YL 2WAQG 3HOVH 2HIXA 3PO2H 4AQYL 2AWNA 3M4OH 3M4PA 4PZ6A 3HKZG 4DAYB 1IBKQ 2UUAQ 3I4NH 4IOCA 2N78A 4AQYQ 3L2PA 4JI5L 2KBNA 5AJ3Q 5IYCH 5IE8A 2WB1G 1I5FA 3RR5A 4GKKQ 5C3EH 1PYBA 4DR1Q 1EYGA 3S15H 1XNQL 1VQ6A 1SRUA 1XNRL 3E0EA 4B3RL 4O0AA 3KF8B 2Y0SG 1VQPA 2JEBI 1PFSA 3G71A 3KYHC 1PH8A 1GO3E 2KHJA 5M3FH 4DV5L 1E22A 1HNXQ 3PV0A 4DV7L 2JJQA 1JMCA 3UE1A 1G291 3NELA 4JG2A 3M3YH 3G48A 2JA5H 1V1QA 2KHIA 1G6PA 3EN2A 3TRZA 1W2BA 4A3BG 3GO5A 1V9PA 4C3IH 4A3LH 1O7IA 4DR5L 4RMFA 3U58A 3OTOL 1R9TH 5DLQE 4DR3Q 1PH6A 1Q7YC 1XPRA 3OTOQ 4JI8L 5C0XG 1B8AA 3Q8DA
chains in the Genus database with same CATH superfamily
2VB2X 1Y1VH 2B2YA 4PMCA 3L3OC 2KUMA 4QIWE 1L1OA 1PH4A 2E2IH 1MJEA 1OXUA 3GTQB 2F0NA 4A3EG 5DM63 4A3KG 2AQ3B 3TREA 2D2CC 2RHQB 1WTRA 4BBSH 5KIXA 3CF5A 2BH8A 2IWHA 4K8JA 4RH6A 2OT2A 2VQFQ 4XT3B 3MXGA 3W3AA 1EY4A 1J5EL 1NE3A 5E4WC 4GOPA 4Q5VA 2X6LA 4ME5A 2JA7H 3UDGA 4B9XA 2JA7B 1JB3A 5BR8L 1RL2A 1XPUA 1AE3A 2F4VL 2JP1A 1KABA 1U0LA 4KD4A 2JA5B 2RDGA 3JC66 5FOBB 1I4HA 3D31A 2HD3A 3K7AB 1EY6A 1C0AA 4WRDA 2LKVA 4OONA 3QOLA 1PFBA 5T1GA 4DR4L 1L0XB 4CDFC 1WCMH 3MEHA 3AYHB 3OHXC 1DD2A 2HDLA 1FGUA 1TVXA 4LFBQ 2EIFA 1QVGA 1VQNA 3PF5A 2XSCA 2YTVA 3EA6A 5E7NA 1BVSA 1FL0A 3CCEA 3L7ZC 1STBA 4ZAIA 4L5SA 1JWMD 2EY6A 2FINB 4OWWB 4AIMA 4A3GB 1K3RA 2UXCL 3U50C 5BN3A 3OMGA 1L0WA 1E0BA 3I90A 4IUUA 3S1QH 2JSOA 2MJ8A 2EY1A 2D0OA 3PUVA 1U4MA 1GUSA 2PNHA 4DK3C 5GADC 2I5HA 4IPGA 4IUTA 4XYQA 3BYYB 1K0SA 1AE2A 1IHZA 2NN6I 5CYUA 4Y7NB 5LMNL 4B3SQ 1H9SB 2JK8A 3CRLC 1GD7A 4OWTB 1VMPA 2WKCA 1TS4A 3ERQA 4KHZA 3R2TA 3BDOA 3PUWA 4LF6L 2R92G 1WCMG 3Q6SA 3I55A 2ZT9C 5I4DA 2QKIC 1UNSA 1Y1VB 1N33L 3BJUA 1TWGH 2UXDL 4GLAC 2F4VQ 3GTPH 3I4NG 1HPCA 1ZYRC 2MGSA 3BDLA 1VQIA 4K0KL 1Y1WG 1I94Q 5FO9B 1IYJB 1EY7A 3V05A 2OWOA 3H3VH 2HT1A 2A68D 3EVQA 4BXXH 3I7FA 3M4YA 3HKZB 3KJPA 3SK5A 2OEOA 1SE2A 2CQOA 1EEID 1TU2B 2Q2IA 5JJKA 1KDCA 5FLMG 3UDIA 4JYAL 4HJ8A 1YIJA 2IY5B 1YHAA 1M4VA 3PO2G 1Q86C 3E5SA 1JJGA 2XIWA 3ICEA 4AYBE 3S14B 4A3FG 4FXDA 1BXTA 5FO8B 2NTSA 4A93H 3IAYA 4DNIA 1TKWB 1LTRD 3R93A 3SGIA 1QB5D 4JI7Q 4X64Q 1FVIA 2Q8RE 3BU2A 5JVG3 1JQYD 1XYIA 4A3BB 4CKCA 3KLSA 1HH2P 4EX5A 5JEAG 1EU4A 4DA2A 1D1KA 3ULLA 4C3HG 2V1CC 4R1JA 5CC4A 1D1IA 3B6YA 1Y69U 3GD7A 2F0FA 2CFMA 4O1NA 1BBXC 1Y8NB 2CH4W 1ILQA 5FLMH 4DR2L 4QUFA 1R4QB 4WJ4A 1DXMA 1FR3A 3S14H 1X55A 4X62Q 4H13C 3NBIA 1AZQA 1MHWC 1BO0A 3AMUA 1EL0A 2NN6H 2LY7A 4A3EB 4IN3A 3NBHA 1EYCA 3S1MH 2QEXA 1EZ8A 1MKHA 2B2UC 2K05A 1S72A 4HMIA 2UXDQ 5IODA 4DAVA 5IYDH 1VQ8A 2R93G 1SNOA 2BDOA 2MHVA 3KBXA 1NNXA 2A69D 2SNSA 1WTHA 4K8IA 2WAQB 4A3JH 5M5XH 1PMRA 4AYBG 3LX0A 4OO1G 4ILWA 4L5QA 4KHPL 2WB1B 4H0LC 1PH5A 1NCVA 3PQIA 3CC4A 3RMHA 4F7XA 3W1GA 3CCUA 4C2MH 2E75C 4DR5Q 2DGYA 2PNRC 1K8OA 3VYTA 1LYLA 3DHQA 4DV4L 5H1SE 1MD2D 3C1EA 1ONLA 1ET6A 2YTYA 1WOCA 2H1EA 3LWUA 4K5VA 4A76A 1IBLQ 3HOZG 4C3HH 4V0BA 3STBC 3NWTA 1K73C 2RKSA 4DK0A 2LMCB 4B3MQ 3HGBA 3BVGA 3PIPA 4O2DA 2IJ0A 5C5MA 1U4PA 3J81j 1QE6A 1ZXTA 4C3JB 1X6OA 1WD0A 4GNXB 5JJIA 1A6XA 4DV4Q 2I07B 1U5KA 1VF5C 4DGZA 2KA7A 3K59A 3S2DB 4A93G 3V96A 2F0JA 2ZJPA 5TSSA 4LFBL 4DXFA 2VS1A 1GHJA 3J7ZC 3S1RH 4G7ZC 3C46A 5A35A 4FF4A 1HQMC 1Q8KA 4LF4L 3S2HH 4A3KB 1N34L 4M1UB 4KJOA 2NYZD 1HHVA 1S5ED 2IW3A 3TBIB 2B63G 1PH1A 1XMQL 2EE1A 1SNPA 2VQEL 2JA7G 5IGDA 1KRSA 1F9QA 1CFMA 5CR3A 1PTOC 5FJ8G 5I6YA 1QZGA 1MGSA 5CV8A 5COYA 2RSNA 1B70B 5M3FG 4RG1A 2R92H 3HOZH 1FYCA 3QJYA 2FFKB 1FNWA 2EQSA 3HOUB 4OEMB 2WV6D 3BS1A 4BY7G 1LTTD 2B8GA 3EROA 3WWVA 4ULLA 2A6EC 1CKMA 4G4KA 3WOFA 2PMZE 3PO2B 3TZDA 3PMFA 3A7LA 5IIFA 1SXTA 1CZWA 4KMUC 3OIQA 4A3JG 1VQ7A 1SROA 2R7FA 3CCSA 3HP3A 1HCZA 1SBBB 3TP6A 3T53B 2MPMA 4DV6Q 1CM9A 2NB0A 4DFAA 4JI4L 1EUJA 2NVXB 1SNCA 1VQFA 1DOKA 1OXXK 1QOHA 1UE6A 3VA5A 1K83H 1I6HB 3WDNA 1XMOL 3TMEA 1K83B 2UU9Q 4A3IG 2OF1A 3BVZA 2NWGA 5EAYA 3MHBA 4CJ1B 4JPBW 2ZM6L 1L2FA 4DPGA 3ERSX 2FXQA 2NZOA 4RGTA 4R8IA 2R92B 4X66L 4DN4M 2A6ED 2VQEQ 1HUMA 3QB3A 4DV5Q 2K5NA 1OXTA 3HG9A 2K32A 1KTKA 5CBEE 4G57A 1DGSA 1RCVD 3SK4A 2NVQH 2OXPA 1TWGB 1TWHH 4KD3A 1I4PA 1JJCB 5DEHA 4DK6C 1VQCA 5LMUQ 4KY7A 2WAQG 3FVQA 1FGBD 4CHTB 3HKZG 3GTJB 2F3WA 1QNUA 2HQEA 1S5BD 4I65A 5IYCH 2WB1G 4JW0A 5C3EH 1PYBA 1EYGA 2WIIB 1PTOF 1SRUA 1XNRL 2E74C 1V1PA 1BDOA 3KF8B 2Y0SG 2DY8A 3OIPA 3T4AC 3S1RB 3G71A 1ICFB 2KHJA 5M3FH 3PV0A 3H94A 5EPKA 2RSOA 2O5IC 1AEXA 1QNKA 2A69C 1G291 3D6CA 4ZQ3A 1A3VA 1V1OA 2JA5H 2KHIA 1CA5A 3EN2A 3FDTA 5J39A 3HOZB 4A3BG 3GO5A 5IT9L 3GV3A 1DJRD 3P1HA 1AFPA 4C3HB 1YNNC 1XPRA 1PFNA 4ZK9B 4JCVE 1ML0D 3SE0A 4CBVA 3GTKB 1B4OA 1H9SA 4YCUA 3MAQA 3HOYG 1N32Q 2NBFA 1EYAA 3KLRA 4MHEA 1JJ2A 4F8MA 3CAMA 1JC7A 2K5WA 3GTMB 4RA8A 4TKOB 3CCRA 2E2IB 1Z9FA 5ISRA 4MZ9A 3MTSA 3OWFA 1YBYA 4PV1C 4DV2L 2NVYB 4KK7A 4JI5Q 5LL6S 3CCLA 3M7NA 3PUZA 2D62A 5EPLA 3J7AF 3CMAA 5CGKA 2UUBQ 5ELCA 1T5EA 4LFAL 2RQXA 3CHBD 1VQHA 2F0SA 4KHPQ 1UE7A 4DV0Q 4HIOA 3ULPA 1VQ5A 4DF7A 5HGTA 2EOTA 4QF4A 4E6IA 1TWAH 1NMGA 3FEWX 3FP9A 1EQVA 4IJHA 1K9MC 1L1OC 4LF7Q 4JI2Q 2JA8B 2F52A 2UXCQ 4DKAC 1LTAD 4K2LA 4KKTA 3I2ZA 5CV7A 3HOUG 2DN8A 1O7LA 3A56A 2D9UA 3E6ZX 3QIAA 5F2DA 2E2JB 3UDFA 2SNMA 1VQOA 4DNTB 1Q82C 4ALPA 4RWSC 2L15A 3E9HA 1ZYRD 2F0EA 4RKLA 4DV1L 2B29A 3MFYA 1XMQQ 5LL6X 1E1TA 1MJCA 3NTKA 5C0XH 3M4OB 5JJLA 1Z6HA 2UXBL 4RGNA 2CW0C 3HKZE 1QUQA 3F8TA 3MXNA 3K8AA 4LMQD 5GAEC 1X3FA 1K8MA 2GVBA 2I46A 3M3YB 5C44G 1HZ9A 1VQEA 1CUKA 2KCTA 4DV7Q 3NEMA 1T5XD 4R4OA 1DZ1A 3PUYA 2RA4A 3G6JB 4Z9CB 5D3DA 1P8LA 2D0PA 5EBDA 5ELBA 2WB1E 1RF2D 1S5FD 1SJED 4XTCS 3FPPA 4RHSA 3EFXD 3J7A5 4EQ5A 4B3SL 1I6HH 4PQXA 1Y8OB 3DXJC 2DJGC 2JYOA 1CK1A 3K5MA 4BBRB 1ENAA 1EY5A 4FDBA 4MNOA 4IZ8A 4L8JA 4GLXA 1N36L 3H3VC 1XJVA 1N32L 4A3BH 1B9NA 5J1ZA 1SYBA 1OTCA 2RDHA 3K57A 3GTKH 4IFDI 1NJIC 2JEAI 3CXCA 2CCZA 1NY4A 1RODA 2JE6I 3X3MA 1RHPA 2IX3A 3P20A 4MIUA 3J80c 4YCVA 2NVQB 4TRDA 5JAVA 1IL8A 3FKIB 4QL5A 4A3CG 1X3EA 2IHEA 5IYCG 2F0WA 2P5ZX 1CI3M 2K50A 1RKNA 3NWSA 3STBD 3I4MB 3I70A 4JBKA 3RZOH 2VZAA 3GTGH 2R3ZA 4DUZL 4OIKA 4JI4Q 1H9RA 2XRSD 2Y0SB 3BVMA 4V190 1X3GA 3MXUA 4LF9Q 4DK1A 2PI2A 1KC8C 5GQOA 3F2CA 4YY3L 3QOJA 3KFUA 3V2TA 3DEPA 1BCPC 4GOPC 1ENCA 1E2WA 1Q90A 4DUYL 3M9BA 2QILA 4LUOA 4HIMA 4C1NI 3X3NA 4AH6A 1YHQA 1B3AA 1D5XC 3U4ZA 4U68A 2HHHQ 5JPNC 2EYLA 3U9OA 3BZDB 3HOYB 3HOWH 4OHJA 1XNRQ 4S3SA 3I91A 4IUVA 5M9OA 2BA0A 3WOEA 1GXDC 1A3TA 1LTSD 2UUCQ 1VCIA 5M5WB 2XGTA 3I4LA 3K7AH 4KLKA 1VQJA 2F0MA 3KK7A 1O80A 2EYFA 1BCPB 3VA7A 1N36Q 4LF9L 4N8X1 1HNXL 1STGA 3S16B 4A3DH 3K81C 1S5DD 2VUMH 4R4QA 1IBMQ 1UE1A 2Z6KC 1DCZA 1HR0W 3OPOA 3IFTA 2I5LX 2HDMA 3J7YW 4BBSB 3S2HB 1QJOA 2BDNA 2IHFA 4JK1C 2RCNA 1TY2A 1UEAB 3U9SA 1S3OA 3LGJA 1G51A 4LFCL 3OYYA 1KAAA 3SR1A 4JVZA 1N9WA 5LMNW 1C48A 5ELNA 4XQNA 1HR0Q 3CC2A 1CKNB 2B2VC 1F2YA 5ELDA 1H9KA 4OELB 2KEEA 5LMUL 4J1MA 3T51B 1RTOA 4QGUA 3DMUA 1JOOA 2N49A 1PA6A 1NAPA 4FO2A 3H6MA 1PFMA 1RJTA 1TS3A 1JOQA 4K5WA 5IYBG 2BA1A 1O7ZA 1BCPF 1Q1EA 5D14A 5IGCA 1G2SA 1GUTA 4YWLA 4QY7A 4A3GH 1WVLA 2HCIA 3Q0AA 4X65L 1G8ZD 1AN8A 5EBCA 3D8GA 4XT1B 1Q1BA 4OXPA 4PZ7A 3OW2A 1XMOQ 5HGQA 5ELOA 5C3EG 3TDQA 5CBAE 1YEZA 5K36H 1EWCA 4IUQA 4UHVA 5IGFA 3PUXA 5C4JB 4CKBA 4QCLA 5I6WA 3G6EA 4X66Q 3J80i 1S40A 2MFIA 1KQSA 1PYSB 1WCMB 3CCMA 1E1OA 2JN4A 3NSWA 1SLJA 1ENFA 2F0HA 1QVCA 2MP1A 1CKNA 4X3UA 4GKJL 1PZKD 2XWBB 1H9JA 2K7VA 5EKIA 5IGBA 4CDCC 2L5TA 3CP0A 1QUQB 3MXNB 4DV1Q 4IFDG 1TS5A 1L1OB 2VL6A 3S24A 2L55A 4CJ2C 4XYOA 1O78A 2B2VA 4J15A 2NVTH 4YWKA 3S16H 2EYMA 1U4RA 2NZ1D 4XDXA 1YZ6A 2Z4HA 4H7BA 1HFGA 1II3A 2A19A 3FMCA 1NMFA 1VQ4A 3HEJA 2B3GA 1A2UA 1SYDA 1D7QA 4LF4Q 1K3BC 2KCMA 2X6GA 2K5DA 4DV3L 4HJAA 2E76C 2YV5A 3I56A 4JBMA 4OO1H 5IT9E 2LXJA 4JI0Q 3FRPB 3GP7A 2NN6G 1TXYA 3JAME 1SE3A 3CMEA 2L12A 2EDGA 4KN4C 1VQ9A 2B2WA 3HOYH 3Q22A 1RDPD 1TQOA 4EGVA 4B9WA 2VUMB 3KF6B 5C44B 1N8RC 3PO3H 2Z1CA 2ZTCA 2K14A 1LV9A 1EZ6A 2K28A 3RLNA 3GTOB 1B9MA 1I6VC 2Q2HA 3H09A 2F0KA 4L6TB 4HJ5A 3SVMA 4KHVA 2MUYA 1KRTA 1HR0L 2BE5C 3NQIA 4RGMA 3NHHA 1J5EQ 5JJZA 5T1IA 3NE5B 3F1ZA 4XXEA 1HUNA 2K4KA 4A3CH 2EXDA 1B7YB 5C3WA 2M9VA 1WFQA 3D4WA 1HZBA 3T16A 2JA9A 3LWEA 4IFDJ 4OO1I 2K33A 1I50B 1Y1VG 2R6GA 1I4XA 4NKLA 3KOJA 2FMMA 2CWPA 1VQAA 1I3QH 4K6DA 2RCFA 3CKIB 4KI0A 2J7ZA 3JAML 1KIXA 2R93B 5IYBH 2K5VA 3UI2A 4FNFA 1AW7A 1O7YA 4ZLTF 1ESRA 3PIOA 2JA6B 3K5LA 2A5HA 2D5DA 4R8NA 2WACA 3T1YL 1HQRD 4Q0FA 3HOVH 3PO3B 2HIXA 3NQTA 3PO2H 3M4OH 4DAYB 1IBKQ 3I4NH 5EPJA 1WTPA 3MXPA 3KF8A 5CV9A 3IL8A 1BCPD 4FVMA 3NP8A 2SOBA 3RR5A 1I5FA 1TR5A 3M7GA 3S15H 2KQ3A 2XN9C 1AZPA 2TSSA 1SNMA 5K5PA 3OSOA 4B3RL 1VQPA 1PFSA 3RZOB 1GO3E 3QWNA 2HCCA 4DV5L 1E22A 1HNXQ 2JJQA 1EFID 1NR2A 3NELA 4JG2A 3G48A 1SYEA 1V1QA 2F03A 4R9WA 1SMYC 5C4HA 4FXGC 4WJWA 1O7IA 4RMFA 5NUCA 3OTOL 5DLQE 3HRZC 4DR3Q 1PH6A 2AUJD 5LHY1 5C0XG 5IOCA 1B8AA 1SAPA 5M5YH 1LO5D 2RBMA 5CV5A 4GS3A 1QCBD 3KBGA 2EYOA 1SYGA 1CA6A 3KLSX 4CKEA 1AP0A 1GKHA 3CPWA 1SDFA 2KCCA 3BYTB 4JI2L 1Q3LA 2ZJQA 4XQJA 4BY7H 1EY8A 3GV6A 2UU9L 1SN8A 4Y7NH 4LWCA 1QVFA 5CV4A 1GUWA 4FYDA 1TY0A 3TP7A 1CQVA 3C1FA 2BH2A 1R9TB 5E1FA 2FMCA 2K03A 1VMCA 1PH3A 1B50A 4X3SA 2AKWB 4YWMA 4C3JH 2NVYH 4EVOA 4HIKA 3H0GG 2E2HB 5M3MB 1VQDA 5JEAJ 1F2LA 4JI1Q 1S4ZA 4OX9L 1RIPA 4LK1C 5GROA 2IPKD 2Z6KA 1PRTC 4G7HC 1X9NA 2RDFA 3GTLH 4K0KQ 3T13A 3A8KE 2XRQD 2EVBA 1E2ZA 1STYA 2FHTA 4HIDA 1TT2A 3DM1A 3UDXA 2K5HA 5EQ0A 3T1YQ 1KLGD 1RD9D 4YY3Q 1FJGL 2MNAA 4L5RC 1P16A 2EY2A 4NMZA 5EGTA 1C9OA 3K0YA 1PZJD 4C3IB 3IKJA 3KDFA 1YVCA 2ID0A 1N34Q 2I0QA 2LS01 2VUMG 4A3JB 3J81E 1DYQA 1LTID 1Z47A 5JOBA 4A3FH 4LUZA 3R2IA 3I73A 1VQGA 2OCEA 3RLFA 5IGGA 1HA5A 5C3EB 1WTVA 1SFOB 1U4LA 1ASZA 2MO1A 1OXSC 2PZUA 3HOWB 4TQUS 4NDXA 4QIWB 3VR6A 3RNUA 4ZKCB 2B63B 1CQFA 2RF4A 4DU9A 2CKZB 2DUDA 3AEVA 4K5XA 4GKKL 1XTDA 1FD7D 3BG3A 5DM73 1LACA 4WORA 1CTMA 1BR9A 4K2KA 1BOSA 1QZHA 2UUAL 3DM3A 3W5OA 4QQBX 3OOCA 2JA6H 3M4QA 4IALA 4LNQA 2VXWA 2YU9B 1G2TA 1CSQA 5G3LD 1TWHB 1C4QA 3DLLA 1K8GA 2JA6G 4A3LG 5G3LF 2R93H 1QG7A 3HZXA 1MIUA 4KY6A 4BA1I 1EIGA 1KLUD 4JI3Q 1CKOA 3M85A 4FF2A 2ASBA 3L0OA 1Y8PB 4LF7L 1CZGA 4N9TA 3S1MB 4JV5L 2QW7A 1S5CD 5FK9C 1OXVA 5IP7G 2A6HD 1HNZQ 2M00A 3HOUH 1D8LA 5ELFA 4GN3B 3TEHB 2QGQA 4DR4Q 2F0UA 5IWAL 4NXML 1X56A 2BOSA 2B39A 3BZCA 5I9PA 4UP8A 1X3QA 4BY1G 5C4XB 1IBKL 4BY1H 1DOMA 4ZRZA 3TZUA 3JAMi 3P75A 4JOIC 3GQBA 1KAWA 5FJ8H 2GN5A 2K5QA 2Z8LA 1BNZA 1YHBA 2PW5A 2K01A 1HNWL 1WTWA 5KYIA 3HOXB 1QILA 4DAYA 3RN2A 2IX0A 1IYVA 2AQ2B 4A3IB 2TMPA 2B63H 4RAUC 1LTBD 3K80C 2F0GA 4RKBA 3PGZA 1L0YB 2B2TC 4HTHA 4CGYB 1LTLA 3PSIA 3OWEB 1GJXA 4IJLA 2A1AA 4N9PA 1NSNS 4IPDA 5GAGC 1F9RA 3FKIH 4UP7A 1A15A 4HEDA 3TS2A 3MVVA 1A63A 3ND8A 5ELEA 4H44C 1HZAA 4LF5Q 1TWCH 2XVSA 2YU9H 3S1NB 4DR7Q 1JR0D 1SSOA 4DUZQ 2A73B 3CC7A 4DNRB 1A3UA 1Q12A 2JA5G 1TWFB 2GVAA 2K6AA 2OTLA 1D5ZC 3CW2C 2NUCA 1W6KA 2JA8G 1PYWD 1QWYA 4DR6L 1PRTF 1PLFA 2F1MA 1HTLD 3GTMH 4X64L 4JC0A 4JI0L 3OW7A 4ME3A 3SEBA 4B08A 2PZWA 5EJWA 5JVH3 3MWYW 3VYUA 2Z6BA 4ABNA 4F88A 3NK9A 2BCOA 2N55A 5HURA 1PHJA 4JYAQ 1ZKOA 1I4RA 1GVPA 1TIID 1G91A 3DUZA 1J6QA 1YJWA 1RTNA 4N8FA 1YITA 2ZM6Q 3P7JA 3CPFA 4JI6Q 1W3SA 5J22A 2F0TA 2VY3A 2LFNA 1DONA 2H4OA 5IP7H 1NBWA 3A5UA 2WFWA 2ZXOA 1PRTB 2E5LQ 3HOWG 5EKKA 1X65A 1C7YA 4CDDC 1STAA 4PMWA 5M5XB 2EJFC 1I4GA 1D2BA 2HQLA 2A68C 4DAMA 3AQQA 3OMCA 1BBWA 1I94L 1YJNA 2DJFC 3SK6A 2PPBC 4JI7L 4K14A 5M5YB 1DM0B 5IYDG 4GKJQ 4B3TL 3PCOB 1I3QB 1EWIA 2DY7A 5KNBA 2F0VA 1STNA 1M90C 3S1NH 4ZKBB 3AU7A 5JEAH 4EQPA 1IW7D 4KJNA 1A8VA 2XTIA 4BA2I 3ONAB 4IPHA 2YYZA 4NPSA 1Q46A 2L11A 2KOLA 2EY5A 3VYSA 1SMXA 2WAQE 3HOXH 4APVA 2Q8IB 4RCNA 3KJOA 4A3EH 3GTJH 3TSSA 4IO9A 3BDCA 3AFPA 4FF3A 2WP8J 5FO7B 1F9PA 4DAPA 5C3XA 3VYRA 1SJHD 1B44D 4A3MB 2EZVA 3QR8A 4A3GG 4IUNA 4U673 1NUCA 5C0XI 1BF4A 4BY1B 2AMCB 1JB7A 1VQLA 1YNXA 1GUOA 2F0IA 1R4PB 1KXLA 3G4SA 2FJ2A 1FNVA 5E4XA 1LLRD 4GOPB 4EQNA 3HFZB 2ENBA 4P72A 3RN5A 2KJXA 1HNZL 1H9MA 2OQKA 2L1BA 4JV5Q 2VW9A 2Y0SE 3I4MH 3ULJA 5M5WH 1G6ZA 4MTNA 3U4VA 1GM5A 2IT1A 2MO0A 2Z0SA 3J81i 1I4QA 1HZCA 1SEBD 3QG1A 2EPBA 4GN5A 2B2UA 4GZYC 1ZEQX 1X32A 4IUPA 1EOVA 3N52A 3F2UA 4XQQA 2F0QA 3H0GH 1A0IA 3CD6A 2G9HD 1SNDA 5C44H 3I4NB 1WD1A 2CW0D 1EIYB 4GN4B 1XNQQ 1EQRA 1KHIA 3EBEA 3PIP3 4A3DG 2LXKA 3RUZA 1K8AC 4X65Q 4TSSA 1XPOA 1Y1WB 1J9OA 3CU7A 1MI2A 4AQYL 2AWNA 1F77A 1JORA 4IFDH 2CQAA 4PZ6A 4AYBB 1YNND 3L2PA 1XTCD 4BWGB 1Q8IA 5AJ3Q 1EYDA 5IE8A 4GKKQ 5DNFA 4RFBA 1XNQL 1B1ZA 1GUNA 1HXYD 4L63B 4LJZC 2JEBI 3KYHC 4C1NK 1V8QA 3ITPA 4A3FB 2K1BA 1LT3D 2F3VA 3CQZB 4KKSA 4DV7L 5L37A 1EIHA 2K04A 1G6PA 1YNJD 4KY5A 5C6AA 2KCNA 2F0DA 1W2BA 1EWHA 1V9PA 4C3IH 4A3LH 5JPMC 2PW7A 2A74C 3R3OA 3D4DA 4HSVA 4HCEA 3OTOQ 2CHBD 1EU3A 1JWSD 1GHKA 3Q8DA 5BN5A 3K5NA 3CCVA 5C4JH 3TP8A 3A5ZB 3RZDH 3CCQA 3K5OA 5KEEA 1PVOA 1B3QA 3S17B 3MC0B 4ZUIA 1Z7TA 4FF1A 4R4CA 1HFNA 1JWUD 4B3RQ 2E8GA 4RCOA 4KV6A 4LF5L 1DOLA 1JICA 1JOKA 2O5JC 3ZYYX 2QDLA 4A3KH 1TWAB 3IFDA 1SFOH 1ICWA 4X3KA 2DNCA 2H5XA 3HOVG 3J80E 3D3RA 2KENA 4P75A 3JAMc 1H95A 1IXRA 1YNJC 4O42A 2E2DC 1PTOB 5KRUA 2VQFL 3NXWA 2R61A 4ZCKA 1IYUA 3S1QB 1F2ZA 5A2QL 2QF7A 3TP5A 4LF6Q 4JBJA 1EOTA 5M3FB 4BBSG 1LM0A 3I72A 1X3PA 1LT5D 4NXNQ 1AH9A 2OQ0A 4EQOA 2YTXA 2VNUD 5C5LA 1SYFA 1B2TA 1LT6D 2QCPX 4GLVB 4BY7B 2Q2UA 3ND9A 1ILPA 3CCJA 4ID6A 1D6EC 2J0TD 1OO9B 2PCFB 4DV3Q 1HRJA 2UUCL 3KDFB 1TWFH 2EXZA 3GTQH 4BXXG 4KTAA 3AFQA 2ICEC 1UAPA 2Z4IA 3RD4A 4UPAA 5IY0A 5KGUA 5FLXc 3Q23A 1A2TA 2L0CA 4UP9A 3S2DH 4ZUJA 2E5LL 4HMJA 3LNNA 4C3JG 2C35B 2NTTA 4JI3L 1IW7C 4JI8Q 4I7AA 4NW2A 4A93B 2JXMB 4TVAB 1SYCA 1SE4A 2F3IA 4J6HA 2QEJC 4FP5D 3SXHA 1STHA 3R8BA 2CH4A 1IL2A 1KDAA 3SHLA 4A3IH 1W6JA 1YJ9A 2ALYB 1LUZA 2B2YC 3J81c 4NXNL 4P71A 1XXGA 4P2CB 1EFWA 1WI5A 3UE0A 4OGQC 2L4NA 3BZKA 3I4OA 2XWJB 2A6HC 4J8QA 4UY8C 3NBHB 4QB4A 2SDFA 1FJGQ 1IKLA 2B2TA 3GTOH 1SE8A 2KECA 3FHWA 3NPPA 3RZDB 4QUCA 2ZXPA 1VDZA 3K58A 3H91A 4RHRA 1Q81C 5BR8Q 3SDZA 5I2XA 1UWVA 4A3DB 1IKMA 4POGA 2HUGA 2F4IA 2ICIA 2Q2TA 1PRTD 2Z9HA 2AUKA 2RHSB 1VQKA 5C4XH 3KF6A 5IP9G 4YCWA 4IOAA 2N8NA 4JOIA 3K0XA 1D5MC 1MSHA 2G5DA 4HJ9A 4L5TA 5K36G 2Q8TA 2PYKA 3IRBA 3TS0A 1N33Q 4WFN3 1IBML 4HJ7A 2F0PA 1JE5A 2AWOA 5HY6A 1IBLL 4OL7A 1WTOA 3S15B 3N6RA 2EYJA 4A75A 4XIGS 4A3MG 4GNXA 4PMBA 2N3SA 1PH7A 4LF8Q 3EJIA 3K6OA 4OIJA 1E3PA 2A8VA 2O2LD 5C0XJ 4DV0L 1BKBA 1K28A 2UUBL 2F0LA 4DV6L 1SR3A 5DAUA 2ES2A 2ZTDA 3D0FA 4UDUC 4X6AH 1EQTA 4LAAA 3RLOA 4DR2Q 1PH9A 3F2DA 1CSPA 3KUPA 1CT1D 3GTPB 3H3VI 1VF7A 5CV6A 1I50H 3T56B 2F0OA 1HNWQ 3A8IE 4G7OC 1E2VA 1NTGA 3GTLB 2E2JH 5D65A 2K52A 4QJFA 1VS0A 4K6LA 1PH2A 1BUVT 3GTGB 4ODGA 1HJPA 3HKSA 1IZ6A 1NR4A 2PMZB 3AB9A 1KL9A 4NXMQ 3EQLC 2E2HH 1UEBA 1SMYD 3EIVA 5IP9H 2NVXH 2PZTA 4PNYA 1CHQD 4YHHQ 3DWPA 4KKUA 4OWXB 4LUVA 1BBUA 3A74A 3I8ZA 4WJ3M 2K75A 3PO3G 1BQQT 4CDEC 4FXKC 1M1KC 1Y14B 4HCSA 3F2BA 2PO4A 2PI2E 1JCKB 1EEFD 5M3MG 4F87A 4LW1A 3HS0C 4LFCQ 5J3BA 5IGEA 4HR7B 3J81L 2LSSA 3H15A 4RGOS 1CHPD 2C5CA 1VQMA 3G7LA 2R7ZG 4Y52H 4LF8L 4X62L 3C3LA 1MBYA 3GDEA 1PDQA 3D4RA 3NENA 4NB3A 4DR7L 3URYA 4JI6L 4DR1L 2NVTB 5M3MH 4C3IG 2ZJRA 3PIO3 4GNXC 5AJ3L 4IPCA 1M8AA 2DNEA 3S9WA 4CJ0B 2EJGC 2I5MX 1FNUA 2KEDA 2PQAB 3CQZH 1VQBA 1E24A 4B3ML 5A2QE 2R7ZH 4C56C 3T1HL 1F9SA 1YI2A 2L9HA 3NTHA 5IWAQ 2OTJA 5E3FA 4P74A 3K7UC 1TS2A 1UUPA 2X69A 2QA4A 1KD1C 2HHHL 3J80L 1B53A 4NP5A 4BBRG 5KYLA 5CORA 1J8IA 3VR5A 5LMNQ 4LFAQ 3HOVB 3FPUB 2C9OA 1PTOD 2CWAA 4P73A 5I9OA 4YHHL 3S17H 4DR6Q 4JBWA 2JA8H 4MN3A 1T9HA 1V1PB 4DUYQ 1PXUA 2ZTEA 1GUGA 2QDBA 3MA2B 3CRKC 1XWEA 1PTOH 1UE5A 1WJJA 3H0GB 1ET9A 2SEBD 1C8CA 2AHOB 1EQQA 3A7AB 1TWCB 3O13A 2VB3X 1ASYA 3C2PA 3DWQA 3A54A 3ZJYC 4M8AA 3TQYA 2MQHA 3FKIG 3NTIA 5GAHC 2WKDA 2CVRA 5I2YA 4A4IA 1MSGA 3D6WA 4C2MB 3I4MG 2IL8A 3A0JA 5FKAC 3ER0A 3T1HQ 2RVLA 2UXBQ 2O4XA 2XNAC 4DR3L 1WYDA 3A55A 1U9RA 2NZHA 4MTKA 3VDYA 3KLWA 1Y1WH 1K0RA 4H02A 5BN4A 2R7DA 3QO2A 1E7ZA 1GOZA 3J7AV 1A62A 4DV2Q 2JQOA 4X3TA 4HN7A 4BS9A 5C4XG 2IX1A 5FLXL 2EJMA 2PQAA 5IT9c 5D3IB 4PZ8A 4OX9Q 4PG3A 4ZYSA 4A3MH 3VR2A 5KNDA 1PZID 3TN2A 1LTGD 1V43A 3E9IA 4BBRH 1PV4A 1JT8A 4KN7C 1X54A 4DXGA 3HOXG 3DWAA 1SNQA 2KVMA 5EKLA 3SK8A 2B8FA 5CMDA 2N88A 2M2LA 2HIVA 3E3XA 4B3TQ 3W2DA 5FLXE 3W1BA 1HA6A 3MEFA 2ATWA 3MFGA 4R4TA 4UAIA 2WINB 1KNEA 3VR3A 3A8JE 1EIFA 4QMGA 1XX8A 4R4IA 4JI1L 2AQ1B 5AFWA 1EY0A 2KHSA 4POFA 1ESFA 1WTQA 2GA4B 3PF4A 2V4DA 2ZXRA 3M4PA 2UUAQ 3DEOA 3VR4A 4HAEA 4IOCA 2N78A 4AQYQ 4JI5L 4I7ZC 2KBNA 1EY9A 4HSPA 1HTPA 2J4XA 1F2MA 2BE5D 3L9AX 4DR1Q 2EYHA 1VQ6A 1STEA 3E0EA 3NUCA 4O0AA 2B2WC 3MZ5A 4IQZA 1PH8A 3I3CA 2R7ZB 1WTXA 1LABA 1JMCA 3UE1A 4YIJA 5KNCA 1KDBA 4IURA 3M3YH 3TRZA 2G9DA 3E0JA 3Q24A 5C4ZA 1KNAA 4DR5L 3U58A 2PQEA 1R9TH 1Q7YC 1LT4D 4JI8L 2EYPA 1JE4A
chains in the Genus database with same CATH topology
5M5YH 3CCVA 5C4JH 4YCUA 1Y1VH 3A5ZB 3RZDH 3HOYG 1N32Q 3CCQA 1PVOA 4GS3A 4QIWE 4R4CA 1L1OA 1JJ2A 1PH4A 2E2IH 3CAMA 1MJEA 1OXUA 3CCRA 4A3EG 1GKHA 4A3KG 1Z9FA 3TREA 2E8GA 2RHQB 4MZ9A 3CPWA 4BBSH 4B3RQ 4LF5L 4JI2L 2ZJQA 1YBYA 3CF5A 2BH8A 4BY7H 2UU9L 4A3KH 1SFOH 4DV2L 1SN8A 4Y7NH 4LWCA 2VQFQ 1QVFA 1J5EL 1NE3A 4JI5Q 4GOPA 3CCLA 3M7NA 3PUZA 2D62A 2H5XA 3HOVG 2KENA 3CMAA 2UUBQ 4P75A 2BH2A 3JAMc 2JA7H 4LFAL 1IXRA 1H95A 3UDGA 1VQHA 5BR8L 1RL2A 4KHPQ 1PH3A 1UE7A 4DV0Q 4HIOA 1AE3A 3ULPA 2F4VL 1XPUA 1VQ5A 1U0LA 2AKWB 2VQFL 3JC66 4YWMA 4C3JH 2NVYH 3D31A 1TWAH 1NMGA 3H0GG 3FP9A 4IJHA 4HIKA 1C0AA 1K9MC 1L1OC 1VQDA 4LF7Q 4OONA 4JI2Q 5JEAJ 4LF6Q 2F52A 4JI1Q 4DR4L 4OX9L 4JBJA 4DKAC 2UXCQ 4BBSG 1LM0A 1WCMH 1RIPA 4NXNQ 3AYHB 3I2ZA 2OQ0A 5GROA 1AH9A 1FGUA 2YTXA 2Z6KA 3HOUG 4LFBQ 2VNUD 2EIFA 1QVGA 1X9NA 3UDFA 1VQNA 3GTLH 4K0KQ 3PF5A 4GLVB 1VQOA 1Q82C 4ALPA 2Q2UA 2YTVA 3CCJA 5E7NA 1BVSA 1FL0A 2L15A 3CCEA 3E9HA 3L7ZC 4HIDA 4DV1L 2B29A 4DV3Q 3UDXA 2UUCL 1XMQQ 4L5SA 2K5HA 3KDFB 1TWFH 3GTQH 4OWWB 1E1TA 1MJCA 3T1YQ 4BXXG 5JJLA 3AFQA 4AIMA 2UXBL 4YY3Q 1FJGL 2MNAA 4UPAA 5IY0A 5FLXc 4L5RC 1P16A 3HKZE 1QUQA 3F8TA 1K3RA 4UP9A 3S2DH 3U50C 2UXCL 3K8AA 2E5LL 1C9OA 5GAEC 1L0WA 3KDFA 3S1QH 1YVCA 2ID0A 1X3FA 2GVBA 1N34Q 2C35B 2I0QA 2VUMG 2D0OA 4JI3L 1HZ9A 1VQEA 1CUKA 2KCTA 3PUVA 4JI8Q 3NEMA 4R4OA 4DV7Q 3PUYA 1Z47A 2PNHA 4TVAB 4DK3C 1P8LA 2D0PA 4A3FH 2IY5B 2F3IA 4LUZA 5GADC 2I5HA 4IPGA 2WB1E 1VQGA 2OCEA 3RLFA 4XTCS 1AE2A 2NN6I 4B3SQ 5LMNL 1IL2A 3J7A5 4EQ5A 4A3IH 2JK8A 1ASZA 2MO1A 1OXSC 1YJ9A 4B3SL 1I6HH 2ALYB 1GD7A 1LUZA 4OWTB 4TQUS 3J81c 4NXNL 4P71A 3RNUA 1EFWA 4KHZA 2RF4A 1WI5A 3UE0A 2CKZB 3PUWA 3BZKA 3I4OA 4FDBA 4MNOA 2DUDA 4LF6L 2R92G 3AEVA 1WCMG 4GLXA 1N36L 3I55A 4UY8C 4GKKL 3NBHB 1XTDA 1XJVA 1FJGQ 3GTOH 1SE8A 1N33L 3FHWA 3BJUA 1TWGH 4A3BH 1N32L 2UXDL 4GLAC 2F4VQ 1OTCA 3GTPH 3I4NG 3GTKH 4IFDI 1Q81C 5BR8Q 1QZHA 1NJIC 2UUAL 3DM3A 3W5OA 1UWVA 2JEAI 4QQBX 3CXCA 2CCZA 1NY4A 2JA6H 3M4QA 4LNQA 1VQIA 2JE6I 4POGA 1CSQA 4K0KL 3DLLA 2JA6G 1Y1WG 1K8GA 1I94Q 1IYJB 3J80c 4A3LG 4YCVA 2Q2TA 2OWOA 3H3VH 2R93H 2HT1A 4BXXH 1MIUA 2RHSB 1VQKA 3I7FA 5C4XH 3KF6A 5IP9G 4BA1I 4QL5A 4A3CG 1X3EA 4YCWA 3KJPA 4JI3Q 4IOAA 2N8NA 1CKOA 2IHEA 3K0XA 4JOIA 3M85A 2ASBA 4HJ9A 3L0OA 5IYCG 4L5TA 2CQOA 4LF7L 5K36G 2Q2IA 2K50A 3IRBA 3TS0A 4JV5L 5JJKA 1N33Q 3STBD 5FLMG 3UDIA 1IBML 4JBKA 3RZOH 4HJ7A 4JYAL 1OXVA 2VZAA 5IP7G 4HJ8A 1YIJA 1HNZQ 3GTGH 1JE5A 2AWOA 1YHAA 4DUZL 4JI4Q 1D8LA 5HY6A 1IBLL 4GN3B 3HOUH 3TEHB 3PO2G 2QGQA 4DR4Q 1Q86C 1JJGA 5IWAL 1X3GA 4A75A 4XIGS 4LF9Q 3ICEA 2PI2A 4AYBE 4GNXA 4A3FG 4A3MG 5GQOA 1X56A 3F2CA 1KC8C 2N3SA 4NXML 1PH7A 4LF8Q 4A93H 4YY3L 4DNIA 3KFUA 3BZCA 5C44G 1E3PA 4UP8A 3SGIA 2A8VA 5C0XJ 4BY1G 4DV0L 4JI7Q 4X64Q 1FVIA 1BKBA 3BU2A 4GOPC 4DUYL 1IBKL 3M9BA 4BY1H 4LUOA 4HIMA 2UUBL 1HH2P 4EX5A 5JEAG 3JAMi 4DV6L 1SR3A 4AH6A 2ES2A 4JOIC 2ZTDA 3D0FA 1KAWA 3ULLA 4X6AH 5FJ8H 2V1CC 4R1JA 2GN5A 3RLOA 3U4ZA 4DR2Q 1YHQA 1PH9A 3F2DA 1CSPA 1YHBA 2HHHQ 3B6YA 3GD7A 1HNWL 2CFMA 3H3VI 4DR2L 5FLMH 1I50H 3HOWH 3RN2A 2IX0A 1HNWQ 4WJ4A 3S14H 1XNRQ 1X55A 4X62Q 1NTGA 2BA0A 2E2JH 2K52A 4QJFA 2B63H 1VS0A 1PH2A 3K80C 1HJPA 3PGZA 3HKSA 1IZ6A 1LTLA 3PSIA 3S1MH 2UUCQ 1VCIA 2QEXA 2XGTA 1KL9A 4NXMQ 3K7AH 4KLKA 2E2HH 1UEBA 4IJLA 3EIVA 1MKHA 2UXDQ 2A1AA 1S72A 5GAGC 4IPDA 5IP9H 5IYDH 1VQJA 3FKIH 2NVXH 4UP7A 3TS2A 1VQ8A 1A63A 2R93G 1N36Q 1HZAA 4LF9L 1HNXL 4YHHQ 4LF5Q 1TWCH 4OWXB 4LUVA 2YU9H 4DR7Q 4A3DH 3K81C 1BBUA 3A74A 4DUZQ 4WJ3M 2K75A 3CC7A 4A3JH 3PO3G 5M5XH 2VUMH 4R4QA 1Q12A 1M1KC 1IBMQ 2JA5G 4AYBG 1Y14B 1UE1A 2GVAA 2Z6KC 2OTLA 3F2BA 1HR0W 3CW2C 2PI2E 5M3MG 4OO1G 2JA8G 4LW1A 4LFCQ 5J3BA 2I5LX 4L5QA 4KHPL 4DR6L 1PH5A 2IHFA 2LSSA 3CC4A 2RCNA 3H15A 3W1GA 3CCUA 3GTMH 1S3OA 3LGJA 1G51A 4X64L 4JC0A 1VQMA 4C2MH 2R7ZG 4LFCL 3OYYA 4JI0L 4DR5Q 4Y52H 2DGYA 4ME3A 1LYLA 1N9WA 5LMNW 5ELNA 4DV4L 1HR0Q 5H1SE 4X62L 3CC2A 4LF8L 1CKNB 3GDEA 2YTYA 1WOCA 5LMUL 4A76A 4QGUA 1IBLQ 3NENA 3HOZG 4C3HH 2N49A 4NB3A 3STBC 4DR7L 1PA6A 1K73C 1PHJA 4JYAQ 4B3MQ 4DR1L 4JI6L 3PIPA 5M3MH 4O2DA 2ZJRA 5IYBG 4GNXC 3J81j 5AJ3L 4IPCA 2BA1A 1X6OA 4GNXB 1GVPA 5JJIA 1Q1EA 2I5MX 4DV4Q 1J6QA 1U5KA 1YJWA 2PQAB 4YWLA 3CQZH 1YITA 2ZM6Q 4A93G 4QY7A 2ZJPA 4A3GH 1VQBA 1E24A 3CPFA 2VS1A 4B3ML 4JI6Q 1W3SA 4X65L 3J7ZC 2R7ZH 4LFBL 3S1RH 3T1HL 2VY3A 1YI2A 1Q1BA 4OXPA 4PZ7A 3OW2A 5IWAQ 1XMOQ 5IP7H 2OTJA 1NBWA 1Q8KA 5ELOA 5HGQA 5C3EG 4P74A 3A5UA 1N34L 4LF4L 3S2HH 3K7UC 1KXLA 2WFWA 1YEZA 2E5LQ 4JCVE 3HOWG 2QA4A 1KD1C 2HHHL 3PUXA 1X65A 1C7YA 4BBRG 3G6EA 4X66Q 2B63G 3J80i 1S40A 2MFIA 4PMWA 1PH1A 1KQSA 5LMNQ 4LFAQ 1XMQL 1PYSB 3CCMA 1E1OA 2CWAA 4P73A 4YHHL 2VQEL 3S17H 4DR6Q 1SLJA 2HQLA 4JBWA 1QVCA 2JA7G 1CKNA 1BBWA 3AQQA 4DAMA 1I94L 1YJNA 1T9HA 2JA8H 4DUYQ 1KRSA 4GKJL 2ZTEA 3CP0A 1QUQB 3MXNB 4DV1Q 4JI7L 5IYDG 4IFDG 4GKJQ 2VL6A 1L1OB 3S24A 3PCOB 4B3TL 1EWIA 5FJ8G 1UE5A 1WJJA 1QZGA 4J15A 1M90C 2NVTH 4YWKA 3S16H 2AHOB 3S1NH 1EQQA 1ASYA 1B70B 5M3FG 4RG1A 3ZJYC 2R92H 1YZ6A 3HOZH 1A8VA 2XTIA 3TQYA 2EQSA 2MQHA 3FKIG 2A19A 4BA2I 5GAHC 1NMFA 1VQ4A 4IPHA 2YYZA 4A4IA 4NPSA 2B3GA 1Q46A 4BY7G 1D7QA 4LF4Q 2KCMA 4HJAA 4DV3L 2YV5A 3WWVA 1SMXA 3I56A 2WAQE 4JBMA 3HOXH 3I4MG 2LXJA 3A0JA 4APVA 4JI0Q 3ER0A 1CKMA 3KJOA 3GTJH 2NN6G 3T1HQ 4A3EH 1TXYA 3CMEA 4IO9A 2UXBQ 4DR3L 1WYDA 3AFPA 2PMZE 2WP8J 3VDYA 2NZHA 3KLWA 1Y1WH 1K0RA 4H02A 4A3GG 1VQ9A 2R7DA 1E7ZA 3HOYH 5C0XI 1A62A 4DV2Q 2AMCB 1JB7A 2JQOA 1VQLA 1YNXA 5C4XG 2IX1A 3KF6B 4A3JG 2PQAA 5IT9c 3G4SA 1SROA 2R7FA 3CCSA 1N8RC 1VQ7A 3PO3H 2ZTCA 2K14A 3RLNA 4GOPB 4PZ8A 2Q2HA 4OX9Q 4PG3A 4A3MH 3HFZB 4HJ5A 4DV6Q 4P72A 4JI4L 3RN5A 1EUJA 1KRTA 1HNZL 1VQFA 1HR0L 2OQKA 1V43A 3E9IA 4BBRH 1PV4A 1JT8A 4JV5Q 2VW9A 2Y0SE 1X54A 3HOXG 1OXXK 3ULJA 1J5EQ 3I4MH 1UE6A 5M5WH 1K83H 1XMOL 4MTNA 3U4VA 1GM5A 2IT1A 2MO0A 2UU9Q 2Z0SA 3J81i 4A3IG 3F1ZA 2HIVA 4B3TQ 5EAYA 1HZCA 2K4KA 4A3CH 3W1BA 2EXDA 1B7YB 4GN5A 3MEFA 2ZM6L 2ATWA 1L2FA 4DPGA 3ERSX 1WFQA 2FXQA 1HZBA 2NZOA 4R4TA 4X66L 2VQEQ 1EOVA 2JA9A 4IFDJ 1EIFA 4OO1I 1Y1VG 4DV5Q 2R6GA 3H0GH 1A0IA 1OXTA 2K5NA 3KOJA 4R4IA 3CD6A 2CWPA 4JI1L 1VQAA 1I3QH 1DGSA 5C44H 4KI0A 1KIXA 2NVQH 1EIYB 4GN4B 1XNQQ 1EQRA 4POFA 5IYBH 2K5VA 1KHIA 3EBEA 1TWHH 4A3DG 2LXKA 1JJCB 1K8AC 4DK6C 3PIOA 1VQCA 4X65Q 1XPOA 5LMUQ 3PF4A 3T1YL 2WAQG 3HOVH 2HIXA 3PO2H 4AQYL 2AWNA 3M4OH 3M4PA 4PZ6A 3HKZG 4DAYB 1IBKQ 2UUAQ 3I4NH 4IOCA 2N78A 4AQYQ 3L2PA 4JI5L 2KBNA 5AJ3Q 5IYCH 5IE8A 2WB1G 1I5FA 3RR5A 4GKKQ 5C3EH 1PYBA 4DR1Q 1EYGA 3S15H 1XNQL 1VQ6A 1SRUA 1XNRL 3E0EA 4B3RL 4O0AA 3KF8B 2Y0SG 1VQPA 2JEBI 1PFSA 3G71A 3KYHC 1PH8A 1GO3E 2KHJA 5M3FH 4DV5L 1E22A 1HNXQ 3PV0A 4DV7L 2JJQA 1JMCA 3UE1A 1G291 3NELA 4JG2A 3M3YH 3G48A 2JA5H 1V1QA 2KHIA 1G6PA 3EN2A 3TRZA 1W2BA 4A3BG 3GO5A 1V9PA 4C3IH 4A3LH 1O7IA 4DR5L 4RMFA 3U58A 3OTOL 1R9TH 5DLQE 4DR3Q 1PH6A 1Q7YC 1XPRA 3OTOQ 4JI8L 5C0XG 1B8AA 3Q8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5Y H;  3CCV A;  5C4J H;  4YCU A;  1Y1V H;  3A5Z B;  3RZD H;  3HOY G;  1N32 Q;  3CCQ A;  1PVO A;  4GS3 A;  4QIW E;  4R4C A;  1L1O A;  1JJ2 A;  1PH4 A;  2E2I H;  3CAM A;  1MJE A;  1OXU A;  3CCR A;  4A3E G;  1GKH A;  4A3K G;  1Z9F A;  3TRE A;  2E8G A;  2RHQ B;  4MZ9 A;  3CPW A;  4BBS H;  4B3R Q;  4LF5 L;  4JI2 L;  2ZJQ A;  1YBY A;  3CF5 A;  2BH8 A;  4BY7 H;  2UU9 L;  4A3K H;  1SFO H;  4DV2 L;  1SN8 A;  4Y7N H;  4LWC A;  2VQF Q;  1QVF A;  1J5E L;  1NE3 A;  4JI5 Q;  4GOP A;  3CCL A;  3M7N A;  3PUZ A;  2D62 A;  2H5X A;  3HOV G;  2KEN A;  3CMA A;  2UUB Q;  4P75 A;  2BH2 A;  3JAM c;  2JA7 H;  4LFA L;  1IXR A;  1H95 A;  3UDG A;  1VQH A;  5BR8 L;  1RL2 A;  4KHP Q;  1PH3 A;  1UE7 A;  4DV0 Q;  4HIO A;  1AE3 A;  3ULP A;  2F4V L;  1XPU A;  1VQ5 A;  1U0L A;  2AKW B;  2VQF L;  3JC6 6;  4YWM A;  4C3J H;  2NVY H;  3D31 A;  1TWA H;  1NMG A;  3H0G G;  3FP9 A;  4IJH A;  4HIK A;  1C0A A;  1K9M C;  1L1O C;  1VQD A;  4LF7 Q;  4OON A;  4JI2 Q;  5JEA J;  4LF6 Q;  2F52 A;  4JI1 Q;  4DR4 L;  4OX9 L;  4JBJ A;  4DKA C;  2UXC Q;  4BBS G;  1LM0 A;  1WCM H;  1RIP A;  4NXN Q;  3AYH B;  3I2Z A;  2OQ0 A;  5GRO A;  1AH9 A;  1FGU A;  2YTX A;  2Z6K A;  3HOU G;  4LFB Q;  2VNU D;  2EIF A;  1QVG A;  1X9N A;  3UDF A;  1VQN A;  3GTL H;  4K0K Q;  3PF5 A;  4GLV B;  1VQO A;  1Q82 C;  4ALP A;  2Q2U A;  2YTV A;  3CCJ A;  5E7N A;  1BVS A;  1FL0 A;  2L15 A;  3CCE A;  3E9H A;  3L7Z C;  4HID A;  4DV1 L;  2B29 A;  4DV3 Q;  3UDX A;  2UUC L;  1XMQ Q;  4L5S A;  2K5H A;  3KDF B;  1TWF H;  3GTQ H;  4OWW B;  1E1T A;  1MJC A;  3T1Y Q;  4BXX G;  5JJL A;  3AFQ A;  4AIM A;  2UXB L;  4YY3 Q;  1FJG L;  2MNA A;  4UPA A;  5IY0 A;  5FLX c;  4L5R C;  1P16 A;  3HKZ E;  1QUQ A;  3F8T A;  1K3R A;  4UP9 A;  3S2D H;  3U50 C;  2UXC L;  3K8A A;  2E5L L;  1C9O A;  5GAE C;  1L0W A;  3KDF A;  3S1Q H;  1YVC A;  2ID0 A;  1X3F A;  2GVB A;  1N34 Q;  2C35 B;  2I0Q A;  2VUM G;  2D0O A;  4JI3 L;  1HZ9 A;  1VQE A;  1CUK A;  2KCT A;  3PUV A;  4JI8 Q;  3NEM A;  4R4O A;  4DV7 Q;  3PUY A;  1Z47 A;  2PNH A;  4TVA B;  4DK3 C;  1P8L A;  2D0P A;  4A3F H;  2IY5 B;  2F3I A;  4LUZ A;  5GAD C;  2I5H A;  4IPG A;  2WB1 E;  1VQG A;  2OCE A;  3RLF A;  4XTC S;  1AE2 A;  2NN6 I;  4B3S Q;  5LMN L;  1IL2 A;  3J7A 5;  4EQ5 A;  4A3I H;  2JK8 A;  1ASZ A;  2MO1 A;  1OXS C;  1YJ9 A;  4B3S L;  1I6H H;  2ALY B;  1GD7 A;  1LUZ A;  4OWT B;  4TQU S;  3J81 c;  4NXN L;  4P71 A;  3RNU A;  1EFW A;  4KHZ A;  2RF4 A;  1WI5 A;  3UE0 A;  2CKZ B;  3PUW A;  3BZK A;  3I4O A;  4FDB A;  4MNO A;  2DUD A;  4LF6 L;  2R92 G;  3AEV A;  1WCM G;  4GLX A;  1N36 L;  3I55 A;  4UY8 C;  4GKK L;  3NBH B;  1XTD A;  1XJV A;  1FJG Q;  3GTO H;  1SE8 A;  1N33 L;  3FHW A;  3BJU A;  1TWG H;  4A3B H;  1N32 L;  2UXD L;  4GLA C;  2F4V Q;  1OTC A;  3GTP H;  3I4N G;  3GTK H;  4IFD I;  1Q81 C;  5BR8 Q;  1QZH A;  1NJI C;  2UUA L;  3DM3 A;  3W5O A;  1UWV A;  2JEA I;  4QQB X;  3CXC A;  2CCZ A;  1NY4 A;  2JA6 H;  3M4Q A;  4LNQ A;  1VQI A;  2JE6 I;  4POG A;  1CSQ A;  4K0K L;  3DLL A;  2JA6 G;  1Y1W G;  1K8G A;  1I94 Q;  1IYJ B;  3J80 c;  4A3L G;  4YCV A;  2Q2T A;  2OWO A;  3H3V H;  2R93 H;  2HT1 A;  4BXX H;  1MIU A;  2RHS B;  1VQK A;  3I7F A;  5C4X H;  3KF6 A;  5IP9 G;  4BA1 I;  4QL5 A;  4A3C G;  1X3E A;  4YCW A;  3KJP A;  4JI3 Q;  4IOA A;  2N8N A;  1CKO A;  2IHE A;  3K0X A;  4JOI A;  3M85 A;  2ASB A;  4HJ9 A;  3L0O A;  5IYC G;  4L5T A;  2CQO A;  4LF7 L;  5K36 G;  2Q2I A;  2K50 A;  3IRB A;  3TS0 A;  4JV5 L;  5JJK A;  1N33 Q;  3STB D;  5FLM G;  3UDI A;  1IBM L;  4JBK A;  3RZO H;  4HJ7 A;  4JYA L;  1OXV A;  2VZA A;  5IP7 G;  4HJ8 A;  1YIJ A;  1HNZ Q;  3GTG H;  1JE5 A;  2AWO A;  1YHA A;  4DUZ L;  4JI4 Q;  1D8L A;  5HY6 A;  1IBL L;  4GN3 B;  3HOU H;  3TEH B;  3PO2 G;  2QGQ A;  4DR4 Q;  1Q86 C;  1JJG A;  5IWA L;  1X3G A;  4A75 A;  4XIG S;  4LF9 Q;  3ICE A;  2PI2 A;  4AYB E;  4GNX A;  4A3F G;  4A3M G;  5GQO A;  1X56 A;  3F2C A;  1KC8 C;  2N3S A;  4NXM L;  1PH7 A;  4LF8 Q;  4A93 H;  4YY3 L;  4DNI A;  3KFU A;  3BZC A;  5C44 G;  1E3P A;  4UP8 A;  3SGI A;  2A8V A;  5C0X J;  4BY1 G;  4DV0 L;  4JI7 Q;  4X64 Q;  1FVI A;  1BKB A;  3BU2 A;  4GOP C;  4DUY L;  1IBK L;  3M9B A;  4BY1 H;  4LUO A;  4HIM A;  2UUB L;  1HH2 P;  4EX5 A;  5JEA G;  3JAM i;  4DV6 L;  1SR3 A;  4AH6 A;  2ES2 A;  4JOI C;  2ZTD A;  3D0F A;  1KAW A;  3ULL A;  4X6A H;  5FJ8 H;  2V1C C;  4R1J A;  2GN5 A;  3RLO A;  3U4Z A;  4DR2 Q;  1YHQ A;  1PH9 A;  3F2D A;  1CSP A;  1YHB A;  2HHH Q;  3B6Y A;  3GD7 A;  1HNW L;  2CFM A;  3H3V I;  4DR2 L;  5FLM H;  1I50 H;  3HOW H;  3RN2 A;  2IX0 A;  1HNW Q;  4WJ4 A;  3S14 H;  1XNR Q;  1X55 A;  4X62 Q;  1NTG A;  2BA0 A;  2E2J H;  2K52 A;  4QJF A;  2B63 H;  1VS0 A;  1PH2 A;  3K80 C;  1HJP A;  3PGZ A;  3HKS A;  1IZ6 A;  1LTL A;  3PSI A;  3S1M H;  2UUC Q;  1VCI A;  2QEX A;  2XGT A;  1KL9 A;  4NXM Q;  3K7A H;  4KLK A;  2E2H H;  1UEB A;  4IJL A;  3EIV A;  1MKH A;  2UXD Q;  2A1A A;  1S72 A;  5GAG C;  4IPD A;  5IP9 H;  5IYD H;  1VQJ A;  3FKI H;  2NVX H;  4UP7 A;  3TS2 A;  1VQ8 A;  1A63 A;  2R93 G;  1N36 Q;  1HZA A;  4LF9 L;  1HNX L;  4YHH Q;  4LF5 Q;  1TWC H;  4OWX B;  4LUV A;  2YU9 H;  4DR7 Q;  4A3D H;  3K81 C;  1BBU A;  3A74 A;  4DUZ Q;  4WJ3 M;  2K75 A;  3CC7 A;  4A3J H;  3PO3 G;  5M5X H;  2VUM H;  4R4Q A;  1Q12 A;  1M1K C;  1IBM Q;  2JA5 G;  4AYB G;  1Y14 B;  1UE1 A;  2GVA A;  2Z6K C;  2OTL A;  3F2B A;  1HR0 W;  3CW2 C;  2PI2 E;  5M3M G;  4OO1 G;  2JA8 G;  4LW1 A;  4LFC Q;  5J3B A;  2I5L X;  4L5Q A;  4KHP L;  4DR6 L;  1PH5 A;  2IHF A;  2LSS A;  3CC4 A;  2RCN A;  3H15 A;  3W1G A;  3CCU A;  3GTM H;  1S3O A;  3LGJ A;  1G51 A;  4X64 L;  4JC0 A;  1VQM A;  4C2M H;  2R7Z G;  4LFC L;  3OYY A;  4JI0 L;  4DR5 Q;  4Y52 H;  2DGY A;  4ME3 A;  1LYL A;  1N9W A;  5LMN W;  5ELN A;  4DV4 L;  1HR0 Q;  5H1S E;  4X62 L;  3CC2 A;  4LF8 L;  1CKN B;  3GDE A;  2YTY A;  1WOC A;  5LMU L;  4A76 A;  4QGU A;  1IBL Q;  3NEN A;  3HOZ G;  4C3H H;  2N49 A;  4NB3 A;  3STB C;  4DR7 L;  1PA6 A;  1K73 C;  1PHJ A;  4JYA Q;  4B3M Q;  4DR1 L;  4JI6 L;  3PIP A;  5M3M H;  4O2D A;  2ZJR A;  5IYB G;  4GNX C;  3J81 j;  5AJ3 L;  4IPC A;  2BA1 A;  1X6O A;  4GNX B;  1GVP A;  5JJI A;  1Q1E A;  2I5M X;  4DV4 Q;  1J6Q A;  1U5K A;  1YJW A;  2PQA B;  4YWL A;  3CQZ H;  1YIT A;  2ZM6 Q;  4A93 G;  4QY7 A;  2ZJP A;  4A3G H;  1VQB A;  1E24 A;  3CPF A;  2VS1 A;  4B3M L;  4JI6 Q;  1W3S A;  4X65 L;  3J7Z C;  2R7Z H;  4LFB L;  3S1R H;  3T1H L;  2VY3 A;  1YI2 A;  1Q1B A;  4OXP A;  4PZ7 A;  3OW2 A;  5IWA Q;  1XMO Q;  5IP7 H;  2OTJ A;  1NBW A;  1Q8K A;  5ELO A;  5HGQ A;  5C3E G;  4P74 A;  3A5U A;  1N34 L;  4LF4 L;  3S2H H;  3K7U C;  1KXL A;  2WFW A;  1YEZ A;  2E5L Q;  4JCV E;  3HOW G;  2QA4 A;  1KD1 C;  2HHH L;  3PUX A;  1X65 A;  1C7Y A;  4BBR G;  3G6E A;  4X66 Q;  2B63 G;  3J80 i;  1S40 A;  2MFI A;  4PMW A;  1PH1 A;  1KQS A;  5LMN Q;  4LFA Q;  1XMQ L;  1PYS B;  3CCM A;  1E1O A;  2CWA A;  4P73 A;  4YHH L;  2VQE L;  3S17 H;  4DR6 Q;  1SLJ A;  2HQL A;  4JBW A;  1QVC A;  2JA7 G;  1CKN A;  1BBW A;  3AQQ A;  4DAM A;  1I94 L;  1YJN A;  1T9H A;  2JA8 H;  4DUY Q;  1KRS A;  4GKJ L;  2ZTE A;  3CP0 A;  1QUQ B;  3MXN B;  4DV1 Q;  4JI7 L;  5IYD G;  4IFD G;  4GKJ Q;  2VL6 A;  1L1O B;  3S24 A;  3PCO B;  4B3T L;  1EWI A;  5FJ8 G;  1UE5 A;  1WJJ A;  1QZG A;  4J15 A;  1M90 C;  2NVT H;  4YWK A;  3S16 H;  2AHO B;  3S1N H;  1EQQ A;  1ASY A;  1B70 B;  5M3F G;  4RG1 A;  3ZJY C;  2R92 H;  1YZ6 A;  3HOZ H;  1A8V A;  2XTI A;  3TQY A;  2EQS A;  2MQH A;  3FKI G;  2A19 A;  4BA2 I;  5GAH C;  1NMF A;  1VQ4 A;  4IPH A;  2YYZ A;  4A4I A;  4NPS A;  2B3G A;  1Q46 A;  4BY7 G;  1D7Q A;  4LF4 Q;  2KCM A;  4HJA A;  4DV3 L;  2YV5 A;  3WWV A;  1SMX A;  3I56 A;  2WAQ E;  4JBM A;  3HOX H;  3I4M G;  2LXJ A;  3A0J A;  4APV A;  4JI0 Q;  3ER0 A;  1CKM A;  3KJO A;  3GTJ H;  2NN6 G;  3T1H Q;  4A3E H;  1TXY A;  3CME A;  4IO9 A;  2UXB Q;  4DR3 L;  1WYD A;  3AFP A;  2PMZ E;  2WP8 J;  3VDY A;  2NZH A;  3KLW A;  1Y1W H;  1K0R A;  4H02 A;  4A3G G;  1VQ9 A;  2R7D A;  1E7Z A;  3HOY H;  5C0X I;  1A62 A;  4DV2 Q;  2AMC B;  1JB7 A;  2JQO A;  1VQL A;  1YNX A;  5C4X G;  2IX1 A;  3KF6 B;  4A3J G;  2PQA A;  5IT9 c;  3G4S A;  1SRO A;  2R7F A;  3CCS A;  1N8R C;  1VQ7 A;  3PO3 H;  2ZTC A;  2K14 A;  3RLN A;  4GOP B;  4PZ8 A;  2Q2H A;  4OX9 Q;  4PG3 A;  4A3M H;  3HFZ B;  4HJ5 A;  4DV6 Q;  4P72 A;  4JI4 L;  3RN5 A;  1EUJ A;  1KRT A;  1HNZ L;  1VQF A;  1HR0 L;  2OQK A;  1V43 A;  3E9I A;  4BBR H;  1PV4 A;  1JT8 A;  4JV5 Q;  2VW9 A;  2Y0S E;  1X54 A;  3HOX G;  1OXX K;  3ULJ A;  1J5E Q;  3I4M H;  1UE6 A;  5M5W H;  1K83 H;  1XMO L;  4MTN A;  3U4V A;  1GM5 A;  2IT1 A;  2MO0 A;  2UU9 Q;  2Z0S A;  3J81 i;  4A3I G;  3F1Z A;  2HIV A;  4B3T Q;  5EAY A;  1HZC A;  2K4K A;  4A3C H;  3W1B A;  2EXD A;  1B7Y B;  4GN5 A;  3MEF A;  2ZM6 L;  2ATW A;  1L2F A;  4DPG A;  3ERS X;  1WFQ A;  2FXQ A;  1HZB A;  2NZO A;  4R4T A;  4X66 L;  2VQE Q;  1EOV A;  2JA9 A;  4IFD J;  1EIF A;  4OO1 I;  1Y1V G;  4DV5 Q;  2R6G A;  3H0G H;  1A0I A;  1OXT A;  2K5N A;  3KOJ A;  4R4I A;  3CD6 A;  2CWP A;  4JI1 L;  1VQA A;  1I3Q H;  1DGS A;  5C44 H;  4KI0 A;  1KIX A;  2NVQ H;  1EIY B;  4GN4 B;  1XNQ Q;  1EQR A;  4POF A;  5IYB H;  2K5V A;  1KHI A;  3EBE A;  1TWH H;  4A3D G;  2LXK A;  1JJC B;  1K8A C;  4DK6 C;  3PIO A;  1VQC A;  4X65 Q;  1XPO A;  5LMU Q;  3PF4 A;  3T1Y L;  2WAQ G;  3HOV H;  2HIX A;  3PO2 H;  4AQY L;  2AWN A;  3M4O H;  3M4P A;  4PZ6 A;  3HKZ G;  4DAY B;  1IBK Q;  2UUA Q;  3I4N H;  4IOC A;  2N78 A;  4AQY Q;  3L2P A;  4JI5 L;  2KBN A;  5AJ3 Q;  5IYC H;  5IE8 A;  2WB1 G;  1I5F A;  3RR5 A;  4GKK Q;  5C3E H;  1PYB A;  4DR1 Q;  1EYG A;  3S15 H;  1XNQ L;  1VQ6 A;  1SRU A;  1XNR L;  3E0E A;  4B3R L;  4O0A A;  3KF8 B;  2Y0S G;  1VQP A;  2JEB I;  1PFS A;  3G71 A;  3KYH C;  1PH8 A;  1GO3 E;  2KHJ A;  5M3F H;  4DV5 L;  1E22 A;  1HNX Q;  3PV0 A;  4DV7 L;  2JJQ A;  1JMC A;  3UE1 A;  1G29 1;  3NEL A;  4JG2 A;  3M3Y H;  3G48 A;  2JA5 H;  1V1Q A;  2KHI A;  1G6P A;  3EN2 A;  3TRZ A;  1W2B A;  4A3B G;  3GO5 A;  1V9P A;  4C3I H;  4A3L H;  1O7I A;  4DR5 L;  4RMF A;  3U58 A;  3OTO L;  1R9T H;  5DLQ E;  4DR3 Q;  1PH6 A;  1Q7Y C;  1XPR A;  3OTO Q;  4JI8 L;  5C0X G;  1B8A A;  3Q8D A; 
#chains in the Genus database with same CATH topology
 2VB2 X;  1Y1V H;  2B2Y A;  4PMC A;  3L3O C;  2KUM A;  4QIW E;  1L1O A;  1PH4 A;  2E2I H;  1MJE A;  1OXU A;  3GTQ B;  2F0N A;  4A3E G;  5DM6 3;  4A3K G;  2AQ3 B;  3TRE A;  2D2C C;  2RHQ B;  1WTR A;  4BBS H;  5KIX A;  3CF5 A;  2BH8 A;  2IWH A;  4K8J A;  4RH6 A;  2OT2 A;  2VQF Q;  4XT3 B;  3MXG A;  3W3A A;  1EY4 A;  1J5E L;  1NE3 A;  5E4W C;  4GOP A;  4Q5V A;  2X6L A;  4ME5 A;  2JA7 H;  3UDG A;  4B9X A;  2JA7 B;  1JB3 A;  5BR8 L;  1RL2 A;  1XPU A;  1AE3 A;  2F4V L;  2JP1 A;  1KAB A;  1U0L A;  4KD4 A;  2JA5 B;  2RDG A;  3JC6 6;  5FOB B;  1I4H A;  3D31 A;  2HD3 A;  3K7A B;  1EY6 A;  1C0A A;  4WRD A;  2LKV A;  4OON A;  3QOL A;  1PFB A;  5T1G A;  4DR4 L;  1L0X B;  4CDF C;  1WCM H;  3MEH A;  3AYH B;  3OHX C;  1DD2 A;  2HDL A;  1FGU A;  1TVX A;  4LFB Q;  2EIF A;  1QVG A;  1VQN A;  3PF5 A;  2XSC A;  2YTV A;  3EA6 A;  5E7N A;  1BVS A;  1FL0 A;  3CCE A;  3L7Z C;  1STB A;  4ZAI A;  4L5S A;  1JWM D;  2EY6 A;  2FIN B;  4OWW B;  4AIM A;  4A3G B;  1K3R A;  2UXC L;  3U50 C;  5BN3 A;  3OMG A;  1L0W A;  1E0B A;  3I90 A;  4IUU A;  3S1Q H;  2JSO A;  2MJ8 A;  2EY1 A;  2D0O A;  3PUV A;  1U4M A;  1GUS A;  2PNH A;  4DK3 C;  5GAD C;  2I5H A;  4IPG A;  4IUT A;  4XYQ A;  3BYY B;  1K0S A;  1AE2 A;  1IHZ A;  2NN6 I;  5CYU A;  4Y7N B;  5LMN L;  4B3S Q;  1H9S B;  2JK8 A;  3CRL C;  1GD7 A;  4OWT B;  1VMP A;  2WKC A;  1TS4 A;  3ERQ A;  4KHZ A;  3R2T A;  3BDO A;  3PUW A;  4LF6 L;  2R92 G;  1WCM G;  3Q6S A;  3I55 A;  2ZT9 C;  5I4D A;  2QKI C;  1UNS A;  1Y1V B;  1N33 L;  3BJU A;  1TWG H;  2UXD L;  4GLA C;  2F4V Q;  3GTP H;  3I4N G;  1HPC A;  1ZYR C;  2MGS A;  3BDL A;  1VQI A;  4K0K L;  1Y1W G;  1I94 Q;  5FO9 B;  1IYJ B;  1EY7 A;  3V05 A;  2OWO A;  3H3V H;  2HT1 A;  2A68 D;  3EVQ A;  4BXX H;  3I7F A;  3M4Y A;  3HKZ B;  3KJP A;  3SK5 A;  2OEO A;  1SE2 A;  2CQO A;  1EEI D;  1TU2 B;  2Q2I A;  5JJK A;  1KDC A;  5FLM G;  3UDI A;  4JYA L;  4HJ8 A;  1YIJ A;  2IY5 B;  1YHA A;  1M4V A;  3PO2 G;  1Q86 C;  3E5S A;  1JJG A;  2XIW A;  3ICE A;  4AYB E;  3S14 B;  4A3F G;  4FXD A;  1BXT A;  5FO8 B;  2NTS A;  4A93 H;  3IAY A;  4DNI A;  1TKW B;  1LTR D;  3R93 A;  3SGI A;  1QB5 D;  4JI7 Q;  4X64 Q;  1FVI A;  2Q8R E;  3BU2 A;  5JVG 3;  1JQY D;  1XYI A;  4A3B B;  4CKC A;  3KLS A;  1HH2 P;  4EX5 A;  5JEA G;  1EU4 A;  4DA2 A;  1D1K A;  3ULL A;  4C3H G;  2V1C C;  4R1J A;  5CC4 A;  1D1I A;  3B6Y A;  1Y69 U;  3GD7 A;  2F0F A;  2CFM A;  4O1N A;  1BBX C;  1Y8N B;  2CH4 W;  1ILQ A;  5FLM H;  4DR2 L;  4QUF A;  1R4Q B;  4WJ4 A;  1DXM A;  1FR3 A;  3S14 H;  1X55 A;  4X62 Q;  4H13 C;  3NBI A;  1AZQ A;  1MHW C;  1BO0 A;  3AMU A;  1EL0 A;  2NN6 H;  2LY7 A;  4A3E B;  4IN3 A;  3NBH A;  1EYC A;  3S1M H;  2QEX A;  1EZ8 A;  1MKH A;  2B2U C;  2K05 A;  1S72 A;  4HMI A;  2UXD Q;  5IOD A;  4DAV A;  5IYD H;  1VQ8 A;  2R93 G;  1SNO A;  2BDO A;  2MHV A;  3KBX A;  1NNX A;  2A69 D;  2SNS A;  1WTH A;  4K8I A;  2WAQ B;  4A3J H;  5M5X H;  1PMR A;  4AYB G;  3LX0 A;  4OO1 G;  4ILW A;  4L5Q A;  4KHP L;  2WB1 B;  4H0L C;  1PH5 A;  1NCV A;  3PQI A;  3CC4 A;  3RMH A;  4F7X A;  3W1G A;  3CCU A;  4C2M H;  2E75 C;  4DR5 Q;  2DGY A;  2PNR C;  1K8O A;  3VYT A;  1LYL A;  3DHQ A;  4DV4 L;  5H1S E;  1MD2 D;  3C1E A;  1ONL A;  1ET6 A;  2YTY A;  1WOC A;  2H1E A;  3LWU A;  4K5V A;  4A76 A;  1IBL Q;  3HOZ G;  4C3H H;  4V0B A;  3STB C;  3NWT A;  1K73 C;  2RKS A;  4DK0 A;  2LMC B;  4B3M Q;  3HGB A;  3BVG A;  3PIP A;  4O2D A;  2IJ0 A;  5C5M A;  1U4P A;  3J81 j;  1QE6 A;  1ZXT A;  4C3J B;  1X6O A;  1WD0 A;  4GNX B;  5JJI A;  1A6X A;  4DV4 Q;  2I07 B;  1U5K A;  1VF5 C;  4DGZ A;  2KA7 A;  3K59 A;  3S2D B;  4A93 G;  3V96 A;  2F0J A;  2ZJP A;  5TSS A;  4LFB L;  4DXF A;  2VS1 A;  1GHJ A;  3J7Z C;  3S1R H;  4G7Z C;  3C46 A;  5A35 A;  4FF4 A;  1HQM C;  1Q8K A;  4LF4 L;  3S2H H;  4A3K B;  1N34 L;  4M1U B;  4KJO A;  2NYZ D;  1HHV A;  1S5E D;  2IW3 A;  3TBI B;  2B63 G;  1PH1 A;  1XMQ L;  2EE1 A;  1SNP A;  2VQE L;  2JA7 G;  5IGD A;  1KRS A;  1F9Q A;  1CFM A;  5CR3 A;  1PTO C;  5FJ8 G;  5I6Y A;  1QZG A;  1MGS A;  5CV8 A;  5COY A;  2RSN A;  1B70 B;  5M3F G;  4RG1 A;  2R92 H;  3HOZ H;  1FYC A;  3QJY A;  2FFK B;  1FNW A;  2EQS A;  3HOU B;  4OEM B;  2WV6 D;  3BS1 A;  4BY7 G;  1LTT D;  2B8G A;  3ERO A;  3WWV A;  4ULL A;  2A6E C;  1CKM A;  4G4K A;  3WOF A;  2PMZ E;  3PO2 B;  3TZD A;  3PMF A;  3A7L A;  5IIF A;  1SXT A;  1CZW A;  4KMU C;  3OIQ A;  4A3J G;  1VQ7 A;  1SRO A;  2R7F A;  3CCS A;  3HP3 A;  1HCZ A;  1SBB B;  3TP6 A;  3T53 B;  2MPM A;  4DV6 Q;  1CM9 A;  2NB0 A;  4DFA A;  4JI4 L;  1EUJ A;  2NVX B;  1SNC A;  1VQF A;  1DOK A;  1OXX K;  1QOH A;  1UE6 A;  3VA5 A;  1K83 H;  1I6H B;  3WDN A;  1XMO L;  3TME A;  1K83 B;  2UU9 Q;  4A3I G;  2OF1 A;  3BVZ A;  2NWG A;  5EAY A;  3MHB A;  4CJ1 B;  4JPB W;  2ZM6 L;  1L2F A;  4DPG A;  3ERS X;  2FXQ A;  2NZO A;  4RGT A;  4R8I A;  2R92 B;  4X66 L;  4DN4 M;  2A6E D;  2VQE Q;  1HUM A;  3QB3 A;  4DV5 Q;  2K5N A;  1OXT A;  3HG9 A;  2K32 A;  1KTK A;  5CBE E;  4G57 A;  1DGS A;  1RCV D;  3SK4 A;  2NVQ H;  2OXP A;  1TWG B;  1TWH H;  4KD3 A;  1I4P A;  1JJC B;  5DEH A;  4DK6 C;  1VQC A;  5LMU Q;  4KY7 A;  2WAQ G;  3FVQ A;  1FGB D;  4CHT B;  3HKZ G;  3GTJ B;  2F3W A;  1QNU A;  2HQE A;  1S5B D;  4I65 A;  5IYC H;  2WB1 G;  4JW0 A;  5C3E H;  1PYB A;  1EYG A;  2WII B;  1PTO F;  1SRU A;  1XNR L;  2E74 C;  1V1P A;  1BDO A;  3KF8 B;  2Y0S G;  2DY8 A;  3OIP A;  3T4A C;  3S1R B;  3G71 A;  1ICF B;  2KHJ A;  5M3F H;  3PV0 A;  3H94 A;  5EPK A;  2RSO A;  2O5I C;  1AEX A;  1QNK A;  2A69 C;  1G29 1;  3D6C A;  4ZQ3 A;  1A3V A;  1V1O A;  2JA5 H;  2KHI A;  1CA5 A;  3EN2 A;  3FDT A;  5J39 A;  3HOZ B;  4A3B G;  3GO5 A;  5IT9 L;  3GV3 A;  1DJR D;  3P1H A;  1AFP A;  4C3H B;  1YNN C;  1XPR A;  1PFN A;  4ZK9 B;  4JCV E;  1ML0 D;  3SE0 A;  4CBV A;  3GTK B;  1B4O A;  1H9S A;  4YCU A;  3MAQ A;  3HOY G;  1N32 Q;  2NBF A;  1EYA A;  3KLR A;  4MHE A;  1JJ2 A;  4F8M A;  3CAM A;  1JC7 A;  2K5W A;  3GTM B;  4RA8 A;  4TKO B;  3CCR A;  2E2I B;  1Z9F A;  5ISR A;  4MZ9 A;  3MTS A;  3OWF A;  1YBY A;  4PV1 C;  4DV2 L;  2NVY B;  4KK7 A;  4JI5 Q;  5LL6 S;  3CCL A;  3M7N A;  3PUZ A;  2D62 A;  5EPL A;  3J7A F;  3CMA A;  5CGK A;  2UUB Q;  5ELC A;  1T5E A;  4LFA L;  2RQX A;  3CHB D;  1VQH A;  2F0S A;  4KHP Q;  1UE7 A;  4DV0 Q;  4HIO A;  3ULP A;  1VQ5 A;  4DF7 A;  5HGT A;  2EOT A;  4QF4 A;  4E6I A;  1TWA H;  1NMG A;  3FEW X;  3FP9 A;  1EQV A;  4IJH A;  1K9M C;  1L1O C;  4LF7 Q;  4JI2 Q;  2JA8 B;  2F52 A;  2UXC Q;  4DKA C;  1LTA D;  4K2L A;  4KKT A;  3I2Z A;  5CV7 A;  3HOU G;  2DN8 A;  1O7L A;  3A56 A;  2D9U A;  3E6Z X;  3QIA A;  5F2D A;  2E2J B;  3UDF A;  2SNM A;  1VQO A;  4DNT B;  1Q82 C;  4ALP A;  4RWS C;  2L15 A;  3E9H A;  1ZYR D;  2F0E A;  4RKL A;  4DV1 L;  2B29 A;  3MFY A;  1XMQ Q;  5LL6 X;  1E1T A;  1MJC A;  3NTK A;  5C0X H;  3M4O B;  5JJL A;  1Z6H A;  2UXB L;  4RGN A;  2CW0 C;  3HKZ E;  1QUQ A;  3F8T A;  3MXN A;  3K8A A;  4LMQ D;  5GAE C;  1X3F A;  1K8M A;  2GVB A;  2I46 A;  3M3Y B;  5C44 G;  1HZ9 A;  1VQE A;  1CUK A;  2KCT A;  4DV7 Q;  3NEM A;  1T5X D;  4R4O A;  1DZ1 A;  3PUY A;  2RA4 A;  3G6J B;  4Z9C B;  5D3D A;  1P8L A;  2D0P A;  5EBD A;  5ELB A;  2WB1 E;  1RF2 D;  1S5F D;  1SJE D;  4XTC S;  3FPP A;  4RHS A;  3EFX D;  3J7A 5;  4EQ5 A;  4B3S L;  1I6H H;  4PQX A;  1Y8O B;  3DXJ C;  2DJG C;  2JYO A;  1CK1 A;  3K5M A;  4BBR B;  1ENA A;  1EY5 A;  4FDB A;  4MNO A;  4IZ8 A;  4L8J A;  4GLX A;  1N36 L;  3H3V C;  1XJV A;  1N32 L;  4A3B H;  1B9N A;  5J1Z A;  1SYB A;  1OTC A;  2RDH A;  3K57 A;  3GTK H;  4IFD I;  1NJI C;  2JEA I;  3CXC A;  2CCZ A;  1NY4 A;  1ROD A;  2JE6 I;  3X3M A;  1RHP A;  2IX3 A;  3P20 A;  4MIU A;  3J80 c;  4YCV A;  2NVQ B;  4TRD A;  5JAV A;  1IL8 A;  3FKI B;  4QL5 A;  4A3C G;  1X3E A;  2IHE A;  5IYC G;  2F0W A;  2P5Z X;  1CI3 M;  2K50 A;  1RKN A;  3NWS A;  3STB D;  3I4M B;  3I70 A;  4JBK A;  3RZO H;  2VZA A;  3GTG H;  2R3Z A;  4DUZ L;  4OIK A;  4JI4 Q;  1H9R A;  2XRS D;  2Y0S B;  3BVM A;  4V19 0;  1X3G A;  3MXU A;  4LF9 Q;  4DK1 A;  2PI2 A;  1KC8 C;  5GQO A;  3F2C A;  4YY3 L;  3QOJ A;  3KFU A;  3V2T A;  3DEP A;  1BCP C;  4GOP C;  1ENC A;  1E2W A;  1Q90 A;  4DUY L;  3M9B A;  2QIL A;  4LUO A;  4HIM A;  4C1N I;  3X3N A;  4AH6 A;  1YHQ A;  1B3A A;  1D5X C;  3U4Z A;  4U68 A;  2HHH Q;  5JPN C;  2EYL A;  3U9O A;  3BZD B;  3HOY B;  3HOW H;  4OHJ A;  1XNR Q;  4S3S A;  3I91 A;  4IUV A;  5M9O A;  2BA0 A;  3WOE A;  1GXD C;  1A3T A;  1LTS D;  2UUC Q;  1VCI A;  5M5W B;  2XGT A;  3I4L A;  3K7A H;  4KLK A;  1VQJ A;  2F0M A;  3KK7 A;  1O80 A;  2EYF A;  1BCP B;  3VA7 A;  1N36 Q;  4LF9 L;  4N8X 1;  1HNX L;  1STG A;  3S16 B;  4A3D H;  3K81 C;  1S5D D;  2VUM H;  4R4Q A;  1IBM Q;  1UE1 A;  2Z6K C;  1DCZ A;  1HR0 W;  3OPO A;  3IFT A;  2I5L X;  2HDM A;  3J7Y W;  4BBS B;  3S2H B;  1QJO A;  2BDN A;  2IHF A;  4JK1 C;  2RCN A;  1TY2 A;  1UEA B;  3U9S A;  1S3O A;  3LGJ A;  1G51 A;  4LFC L;  3OYY A;  1KAA A;  3SR1 A;  4JVZ A;  1N9W A;  5LMN W;  1C48 A;  5ELN A;  4XQN A;  1HR0 Q;  3CC2 A;  1CKN B;  2B2V C;  1F2Y A;  5ELD A;  1H9K A;  4OEL B;  2KEE A;  5LMU L;  4J1M A;  3T51 B;  1RTO A;  4QGU A;  3DMU A;  1JOO A;  2N49 A;  1PA6 A;  1NAP A;  4FO2 A;  3H6M A;  1PFM A;  1RJT A;  1TS3 A;  1JOQ A;  4K5W A;  5IYB G;  2BA1 A;  1O7Z A;  1BCP F;  1Q1E A;  5D14 A;  5IGC A;  1G2S A;  1GUT A;  4YWL A;  4QY7 A;  4A3G H;  1WVL A;  2HCI A;  3Q0A A;  4X65 L;  1G8Z D;  1AN8 A;  5EBC A;  3D8G A;  4XT1 B;  1Q1B A;  4OXP A;  4PZ7 A;  3OW2 A;  1XMO Q;  5HGQ A;  5ELO A;  5C3E G;  3TDQ A;  5CBA E;  1YEZ A;  5K36 H;  1EWC A;  4IUQ A;  4UHV A;  5IGF A;  3PUX A;  5C4J B;  4CKB A;  4QCL A;  5I6W A;  3G6E A;  4X66 Q;  3J80 i;  1S40 A;  2MFI A;  1KQS A;  1PYS B;  1WCM B;  3CCM A;  1E1O A;  2JN4 A;  3NSW A;  1SLJ A;  1ENF A;  2F0H A;  1QVC A;  2MP1 A;  1CKN A;  4X3U A;  4GKJ L;  1PZK D;  2XWB B;  1H9J A;  2K7V A;  5EKI A;  5IGB A;  4CDC C;  2L5T A;  3CP0 A;  1QUQ B;  3MXN B;  4DV1 Q;  4IFD G;  1TS5 A;  1L1O B;  2VL6 A;  3S24 A;  2L55 A;  4CJ2 C;  4XYO A;  1O78 A;  2B2V A;  4J15 A;  2NVT H;  4YWK A;  3S16 H;  2EYM A;  1U4R A;  2NZ1 D;  4XDX A;  1YZ6 A;  2Z4H A;  4H7B A;  1HFG A;  1II3 A;  2A19 A;  3FMC A;  1NMF A;  1VQ4 A;  3HEJ A;  2B3G A;  1A2U A;  1SYD A;  1D7Q A;  4LF4 Q;  1K3B C;  2KCM A;  2X6G A;  2K5D A;  4DV3 L;  4HJA A;  2E76 C;  2YV5 A;  3I56 A;  4JBM A;  4OO1 H;  5IT9 E;  2LXJ A;  4JI0 Q;  3FRP B;  3GP7 A;  2NN6 G;  1TXY A;  3JAM E;  1SE3 A;  3CME A;  2L12 A;  2EDG A;  4KN4 C;  1VQ9 A;  2B2W A;  3HOY H;  3Q22 A;  1RDP D;  1TQO A;  4EGV A;  4B9W A;  2VUM B;  3KF6 B;  5C44 B;  1N8R C;  3PO3 H;  2Z1C A;  2ZTC A;  2K14 A;  1LV9 A;  1EZ6 A;  2K28 A;  3RLN A;  3GTO B;  1B9M A;  1I6V C;  2Q2H A;  3H09 A;  2F0K A;  4L6T B;  4HJ5 A;  3SVM A;  4KHV A;  2MUY A;  1KRT A;  1HR0 L;  2BE5 C;  3NQI A;  4RGM A;  3NHH A;  1J5E Q;  5JJZ A;  5T1I A;  3NE5 B;  3F1Z A;  4XXE A;  1HUN A;  2K4K A;  4A3C H;  2EXD A;  1B7Y B;  5C3W A;  2M9V A;  1WFQ A;  3D4W A;  1HZB A;  3T16 A;  2JA9 A;  3LWE A;  4IFD J;  4OO1 I;  2K33 A;  1I50 B;  1Y1V G;  2R6G A;  1I4X A;  4NKL A;  3KOJ A;  2FMM A;  2CWP A;  1VQA A;  1I3Q H;  4K6D A;  2RCF A;  3CKI B;  4KI0 A;  2J7Z A;  3JAM L;  1KIX A;  2R93 B;  5IYB H;  2K5V A;  3UI2 A;  4FNF A;  1AW7 A;  1O7Y A;  4ZLT F;  1ESR A;  3PIO A;  2JA6 B;  3K5L A;  2A5H A;  2D5D A;  4R8N A;  2WAC A;  3T1Y L;  1HQR D;  4Q0F A;  3HOV H;  3PO3 B;  2HIX A;  3NQT A;  3PO2 H;  3M4O H;  4DAY B;  1IBK Q;  3I4N H;  5EPJ A;  1WTP A;  3MXP A;  3KF8 A;  5CV9 A;  3IL8 A;  1BCP D;  4FVM A;  3NP8 A;  2SOB A;  3RR5 A;  1I5F A;  1TR5 A;  3M7G A;  3S15 H;  2KQ3 A;  2XN9 C;  1AZP A;  2TSS A;  1SNM A;  5K5P A;  3OSO A;  4B3R L;  1VQP A;  1PFS A;  3RZO B;  1GO3 E;  3QWN A;  2HCC A;  4DV5 L;  1E22 A;  1HNX Q;  2JJQ A;  1EFI D;  1NR2 A;  3NEL A;  4JG2 A;  3G48 A;  1SYE A;  1V1Q A;  2F03 A;  4R9W A;  1SMY C;  5C4H A;  4FXG C;  4WJW A;  1O7I A;  4RMF A;  5NUC A;  3OTO L;  5DLQ E;  3HRZ C;  4DR3 Q;  1PH6 A;  2AUJ D;  5LHY 1;  5C0X G;  5IOC A;  1B8A A;  1SAP A;  5M5Y H;  1LO5 D;  2RBM A;  5CV5 A;  4GS3 A;  1QCB D;  3KBG A;  2EYO A;  1SYG A;  1CA6 A;  3KLS X;  4CKE A;  1AP0 A;  1GKH A;  3CPW A;  1SDF A;  2KCC A;  3BYT B;  4JI2 L;  1Q3L A;  2ZJQ A;  4XQJ A;  4BY7 H;  1EY8 A;  3GV6 A;  2UU9 L;  1SN8 A;  4Y7N H;  4LWC A;  1QVF A;  5CV4 A;  1GUW A;  4FYD A;  1TY0 A;  3TP7 A;  1CQV A;  3C1F A;  2BH2 A;  1R9T B;  5E1F A;  2FMC A;  2K03 A;  1VMC A;  1PH3 A;  1B50 A;  4X3S A;  2AKW B;  4YWM A;  4C3J H;  2NVY H;  4EVO A;  4HIK A;  3H0G G;  2E2H B;  5M3M B;  1VQD A;  5JEA J;  1F2L A;  4JI1 Q;  1S4Z A;  4OX9 L;  1RIP A;  4LK1 C;  5GRO A;  2IPK D;  2Z6K A;  1PRT C;  4G7H C;  1X9N A;  2RDF A;  3GTL H;  4K0K Q;  3T13 A;  3A8K E;  2XRQ D;  2EVB A;  1E2Z A;  1STY A;  2FHT A;  4HID A;  1TT2 A;  3DM1 A;  3UDX A;  2K5H A;  5EQ0 A;  3T1Y Q;  1KLG D;  1RD9 D;  4YY3 Q;  1FJG L;  2MNA A;  4L5R C;  1P16 A;  2EY2 A;  4NMZ A;  5EGT A;  1C9O A;  3K0Y A;  1PZJ D;  4C3I B;  3IKJ A;  3KDF A;  1YVC A;  2ID0 A;  1N34 Q;  2I0Q A;  2LS0 1;  2VUM G;  4A3J B;  3J81 E;  1DYQ A;  1LTI D;  1Z47 A;  5JOB A;  4A3F H;  4LUZ A;  3R2I A;  3I73 A;  1VQG A;  2OCE A;  3RLF A;  5IGG A;  1HA5 A;  5C3E B;  1WTV A;  1SFO B;  1U4L A;  1ASZ A;  2MO1 A;  1OXS C;  2PZU A;  3HOW B;  4TQU S;  4NDX A;  4QIW B;  3VR6 A;  3RNU A;  4ZKC B;  2B63 B;  1CQF A;  2RF4 A;  4DU9 A;  2CKZ B;  2DUD A;  3AEV A;  4K5X A;  4GKK L;  1XTD A;  1FD7 D;  3BG3 A;  5DM7 3;  1LAC A;  4WOR A;  1CTM A;  1BR9 A;  4K2K A;  1BOS A;  1QZH A;  2UUA L;  3DM3 A;  3W5O A;  4QQB X;  3OOC A;  2JA6 H;  3M4Q A;  4IAL A;  4LNQ A;  2VXW A;  2YU9 B;  1G2T A;  1CSQ A;  5G3L D;  1TWH B;  1C4Q A;  3DLL A;  1K8G A;  2JA6 G;  4A3L G;  5G3L F;  2R93 H;  1QG7 A;  3HZX A;  1MIU A;  4KY6 A;  4BA1 I;  1EIG A;  1KLU D;  4JI3 Q;  1CKO A;  3M85 A;  4FF2 A;  2ASB A;  3L0O A;  1Y8P B;  4LF7 L;  1CZG A;  4N9T A;  3S1M B;  4JV5 L;  2QW7 A;  1S5C D;  5FK9 C;  1OXV A;  5IP7 G;  2A6H D;  1HNZ Q;  2M00 A;  3HOU H;  1D8L A;  5ELF A;  4GN3 B;  3TEH B;  2QGQ A;  4DR4 Q;  2F0U A;  5IWA L;  4NXM L;  1X56 A;  2BOS A;  2B39 A;  3BZC A;  5I9P A;  4UP8 A;  1X3Q A;  4BY1 G;  5C4X B;  1IBK L;  4BY1 H;  1DOM A;  4ZRZ A;  3TZU A;  3JAM i;  3P75 A;  4JOI C;  3GQB A;  1KAW A;  5FJ8 H;  2GN5 A;  2K5Q A;  2Z8L A;  1BNZ A;  1YHB A;  2PW5 A;  2K01 A;  1HNW L;  1WTW A;  5KYI A;  3HOX B;  1QIL A;  4DAY A;  3RN2 A;  2IX0 A;  1IYV A;  2AQ2 B;  4A3I B;  2TMP A;  2B63 H;  4RAU C;  1LTB D;  3K80 C;  2F0G A;  4RKB A;  3PGZ A;  1L0Y B;  2B2T C;  4HTH A;  4CGY B;  1LTL A;  3PSI A;  3OWE B;  1GJX A;  4IJL A;  2A1A A;  4N9P A;  1NSN S;  4IPD A;  5GAG C;  1F9R A;  3FKI H;  4UP7 A;  1A15 A;  4HED A;  3TS2 A;  3MVV A;  1A63 A;  3ND8 A;  5ELE A;  4H44 C;  1HZA A;  4LF5 Q;  1TWC H;  2XVS A;  2YU9 H;  3S1N B;  4DR7 Q;  1JR0 D;  1SSO A;  4DUZ Q;  2A73 B;  3CC7 A;  4DNR B;  1A3U A;  1Q12 A;  2JA5 G;  1TWF B;  2GVA A;  2K6A A;  2OTL A;  1D5Z C;  3CW2 C;  2NUC A;  1W6K A;  2JA8 G;  1PYW D;  1QWY A;  4DR6 L;  1PRT F;  1PLF A;  2F1M A;  1HTL D;  3GTM H;  4X64 L;  4JC0 A;  4JI0 L;  3OW7 A;  4ME3 A;  3SEB A;  4B08 A;  2PZW A;  5EJW A;  5JVH 3;  3MWY W;  3VYU A;  2Z6B A;  4ABN A;  4F88 A;  3NK9 A;  2BCO A;  2N55 A;  5HUR A;  1PHJ A;  4JYA Q;  1ZKO A;  1I4R A;  1GVP A;  1TII D;  1G91 A;  3DUZ A;  1J6Q A;  1YJW A;  1RTN A;  4N8F A;  1YIT A;  2ZM6 Q;  3P7J A;  3CPF A;  4JI6 Q;  1W3S A;  5J22 A;  2F0T A;  2VY3 A;  2LFN A;  1DON A;  2H4O A;  5IP7 H;  1NBW A;  3A5U A;  2WFW A;  2ZXO A;  1PRT B;  2E5L Q;  3HOW G;  5EKK A;  1X65 A;  1C7Y A;  4CDD C;  1STA A;  4PMW A;  5M5X B;  2EJF C;  1I4G A;  1D2B A;  2HQL A;  2A68 C;  4DAM A;  3AQQ A;  3OMC A;  1BBW A;  1I94 L;  1YJN A;  2DJF C;  3SK6 A;  2PPB C;  4JI7 L;  4K14 A;  5M5Y B;  1DM0 B;  5IYD G;  4GKJ Q;  4B3T L;  3PCO B;  1I3Q B;  1EWI A;  2DY7 A;  5KNB A;  2F0V A;  1STN A;  1M90 C;  3S1N H;  4ZKB B;  3AU7 A;  5JEA H;  4EQP A;  1IW7 D;  4KJN A;  1A8V A;  2XTI A;  4BA2 I;  3ONA B;  4IPH A;  2YYZ A;  4NPS A;  1Q46 A;  2L11 A;  2KOL A;  2EY5 A;  3VYS A;  1SMX A;  2WAQ E;  3HOX H;  4APV A;  2Q8I B;  4RCN A;  3KJO A;  4A3E H;  3GTJ H;  3TSS A;  4IO9 A;  3BDC A;  3AFP A;  4FF3 A;  2WP8 J;  5FO7 B;  1F9P A;  4DAP A;  5C3X A;  3VYR A;  1SJH D;  1B44 D;  4A3M B;  2EZV A;  3QR8 A;  4A3G G;  4IUN A;  4U67 3;  1NUC A;  5C0X I;  1BF4 A;  4BY1 B;  2AMC B;  1JB7 A;  1VQL A;  1YNX A;  1GUO A;  2F0I A;  1R4P B;  1KXL A;  3G4S A;  2FJ2 A;  1FNV A;  5E4X A;  1LLR D;  4GOP B;  4EQN A;  3HFZ B;  2ENB A;  4P72 A;  3RN5 A;  2KJX A;  1HNZ L;  1H9M A;  2OQK A;  2L1B A;  4JV5 Q;  2VW9 A;  2Y0S E;  3I4M H;  3ULJ A;  5M5W H;  1G6Z A;  4MTN A;  3U4V A;  1GM5 A;  2IT1 A;  2MO0 A;  2Z0S A;  3J81 i;  1I4Q A;  1HZC A;  1SEB D;  3QG1 A;  2EPB A;  4GN5 A;  2B2U A;  4GZY C;  1ZEQ X;  1X32 A;  4IUP A;  1EOV A;  3N52 A;  3F2U A;  4XQQ A;  2F0Q A;  3H0G H;  1A0I A;  3CD6 A;  2G9H D;  1SND A;  5C44 H;  3I4N B;  1WD1 A;  2CW0 D;  1EIY B;  4GN4 B;  1XNQ Q;  1EQR A;  1KHI A;  3EBE A;  3PIP 3;  4A3D G;  2LXK A;  3RUZ A;  1K8A C;  4X65 Q;  4TSS A;  1XPO A;  1Y1W B;  1J9O A;  3CU7 A;  1MI2 A;  4AQY L;  2AWN A;  1F77 A;  1JOR A;  4IFD H;  2CQA A;  4PZ6 A;  4AYB B;  1YNN D;  3L2P A;  1XTC D;  4BWG B;  1Q8I A;  5AJ3 Q;  1EYD A;  5IE8 A;  4GKK Q;  5DNF A;  4RFB A;  1XNQ L;  1B1Z A;  1GUN A;  1HXY D;  4L63 B;  4LJZ C;  2JEB I;  3KYH C;  4C1N K;  1V8Q A;  3ITP A;  4A3F B;  2K1B A;  1LT3 D;  2F3V A;  3CQZ B;  4KKS A;  4DV7 L;  5L37 A;  1EIH A;  2K04 A;  1G6P A;  1YNJ D;  4KY5 A;  5C6A A;  2KCN A;  2F0D A;  1W2B A;  1EWH A;  1V9P A;  4C3I H;  4A3L H;  5JPM C;  2PW7 A;  2A74 C;  3R3O A;  3D4D A;  4HSV A;  4HCE A;  3OTO Q;  2CHB D;  1EU3 A;  1JWS D;  1GHK A;  3Q8D A;  5BN5 A;  3K5N A;  3CCV A;  5C4J H;  3TP8 A;  3A5Z B;  3RZD H;  3CCQ A;  3K5O A;  5KEE A;  1PVO A;  1B3Q A;  3S17 B;  3MC0 B;  4ZUI A;  1Z7T A;  4FF1 A;  4R4C A;  1HFN A;  1JWU D;  4B3R Q;  2E8G A;  4RCO A;  4KV6 A;  4LF5 L;  1DOL A;  1JIC A;  1JOK A;  2O5J C;  3ZYY X;  2QDL A;  4A3K H;  1TWA B;  3IFD A;  1SFO H;  1ICW A;  4X3K A;  2DNC A;  2H5X A;  3HOV G;  3J80 E;  3D3R A;  2KEN A;  4P75 A;  3JAM c;  1H95 A;  1IXR A;  1YNJ C;  4O42 A;  2E2D C;  1PTO B;  5KRU A;  2VQF L;  3NXW A;  2R61 A;  4ZCK A;  1IYU A;  3S1Q B;  1F2Z A;  5A2Q L;  2QF7 A;  3TP5 A;  4LF6 Q;  4JBJ A;  1EOT A;  5M3F B;  4BBS G;  1LM0 A;  3I72 A;  1X3P A;  1LT5 D;  4NXN Q;  1AH9 A;  2OQ0 A;  4EQO A;  2YTX A;  2VNU D;  5C5L A;  1SYF A;  1B2T A;  1LT6 D;  2QCP X;  4GLV B;  4BY7 B;  2Q2U A;  3ND9 A;  1ILP A;  3CCJ A;  4ID6 A;  1D6E C;  2J0T D;  1OO9 B;  2PCF B;  4DV3 Q;  1HRJ A;  2UUC L;  3KDF B;  1TWF H;  2EXZ A;  3GTQ H;  4BXX G;  4KTA A;  3AFQ A;  2ICE C;  1UAP A;  2Z4I A;  3RD4 A;  4UPA A;  5IY0 A;  5KGU A;  5FLX c;  3Q23 A;  1A2T A;  2L0C A;  4UP9 A;  3S2D H;  4ZUJ A;  2E5L L;  4HMJ A;  3LNN A;  4C3J G;  2C35 B;  2NTT A;  4JI3 L;  1IW7 C;  4JI8 Q;  4I7A A;  4NW2 A;  4A93 B;  2JXM B;  4TVA B;  1SYC A;  1SE4 A;  2F3I A;  4J6H A;  2QEJ C;  4FP5 D;  3SXH A;  1STH A;  3R8B A;  2CH4 A;  1IL2 A;  1KDA A;  3SHL A;  4A3I H;  1W6J A;  1YJ9 A;  2ALY B;  1LUZ A;  2B2Y C;  3J81 c;  4NXN L;  4P71 A;  1XXG A;  4P2C B;  1EFW A;  1WI5 A;  3UE0 A;  4OGQ C;  2L4N A;  3BZK A;  3I4O A;  2XWJ B;  2A6H C;  4J8Q A;  4UY8 C;  3NBH B;  4QB4 A;  2SDF A;  1FJG Q;  1IKL A;  2B2T A;  3GTO H;  1SE8 A;  2KEC A;  3FHW A;  3NPP A;  3RZD B;  4QUC A;  2ZXP A;  1VDZ A;  3K58 A;  3H91 A;  4RHR A;  1Q81 C;  5BR8 Q;  3SDZ A;  5I2X A;  1UWV A;  4A3D B;  1IKM A;  4POG A;  2HUG A;  2F4I A;  2ICI A;  2Q2T A;  1PRT D;  2Z9H A;  2AUK A;  2RHS B;  1VQK A;  5C4X H;  3KF6 A;  5IP9 G;  4YCW A;  4IOA A;  2N8N A;  4JOI A;  3K0X A;  1D5M C;  1MSH A;  2G5D A;  4HJ9 A;  4L5T A;  5K36 G;  2Q8T A;  2PYK A;  3IRB A;  3TS0 A;  1N33 Q;  4WFN 3;  1IBM L;  4HJ7 A;  2F0P A;  1JE5 A;  2AWO A;  5HY6 A;  1IBL L;  4OL7 A;  1WTO A;  3S15 B;  3N6R A;  2EYJ A;  4A75 A;  4XIG S;  4A3M G;  4GNX A;  4PMB A;  2N3S A;  1PH7 A;  4LF8 Q;  3EJI A;  3K6O A;  4OIJ A;  1E3P A;  2A8V A;  2O2L D;  5C0X J;  4DV0 L;  1BKB A;  1K28 A;  2UUB L;  2F0L A;  4DV6 L;  1SR3 A;  5DAU A;  2ES2 A;  2ZTD A;  3D0F A;  4UDU C;  4X6A H;  1EQT A;  4LAA A;  3RLO A;  4DR2 Q;  1PH9 A;  3F2D A;  1CSP A;  3KUP A;  1CT1 D;  3GTP B;  3H3V I;  1VF7 A;  5CV6 A;  1I50 H;  3T56 B;  2F0O A;  1HNW Q;  3A8I E;  4G7O C;  1E2V A;  1NTG A;  3GTL B;  2E2J H;  5D65 A;  2K52 A;  4QJF A;  1VS0 A;  4K6L A;  1PH2 A;  1BUV T;  3GTG B;  4ODG A;  1HJP A;  3HKS A;  1IZ6 A;  1NR4 A;  2PMZ B;  3AB9 A;  1KL9 A;  4NXM Q;  3EQL C;  2E2H H;  1UEB A;  1SMY D;  3EIV A;  5IP9 H;  2NVX H;  2PZT A;  4PNY A;  1CHQ D;  4YHH Q;  3DWP A;  4KKU A;  4OWX B;  4LUV A;  1BBU A;  3A74 A;  3I8Z A;  4WJ3 M;  2K75 A;  3PO3 G;  1BQQ T;  4CDE C;  4FXK C;  1M1K C;  1Y14 B;  4HCS A;  3F2B A;  2PO4 A;  2PI2 E;  1JCK B;  1EEF D;  5M3M G;  4F87 A;  4LW1 A;  3HS0 C;  4LFC Q;  5J3B A;  5IGE A;  4HR7 B;  3J81 L;  2LSS A;  3H15 A;  4RGO S;  1CHP D;  2C5C A;  1VQM A;  3G7L A;  2R7Z G;  4Y52 H;  4LF8 L;  4X62 L;  3C3L A;  1MBY A;  3GDE A;  1PDQ A;  3D4R A;  3NEN A;  4NB3 A;  4DR7 L;  3URY A;  4JI6 L;  4DR1 L;  2NVT B;  5M3M H;  4C3I G;  2ZJR A;  3PIO 3;  4GNX C;  5AJ3 L;  4IPC A;  1M8A A;  2DNE A;  3S9W A;  4CJ0 B;  2EJG C;  2I5M X;  1FNU A;  2KED A;  2PQA B;  3CQZ H;  1VQB A;  1E24 A;  4B3M L;  5A2Q E;  2R7Z H;  4C56 C;  3T1H L;  1F9S A;  1YI2 A;  2L9H A;  3NTH A;  5IWA Q;  2OTJ A;  5E3F A;  4P74 A;  3K7U C;  1TS2 A;  1UUP A;  2X69 A;  2QA4 A;  1KD1 C;  2HHH L;  3J80 L;  1B53 A;  4NP5 A;  4BBR G;  5KYL A;  5COR A;  1J8I A;  3VR5 A;  5LMN Q;  4LFA Q;  3HOV B;  3FPU B;  2C9O A;  1PTO D;  2CWA A;  4P73 A;  5I9O A;  4YHH L;  3S17 H;  4DR6 Q;  4JBW A;  2JA8 H;  4MN3 A;  1T9H A;  1V1P B;  4DUY Q;  1PXU A;  2ZTE A;  1GUG A;  2QDB A;  3MA2 B;  3CRK C;  1XWE A;  1PTO H;  1UE5 A;  1WJJ A;  3H0G B;  1ET9 A;  2SEB D;  1C8C A;  2AHO B;  1EQQ A;  3A7A B;  1TWC B;  3O13 A;  2VB3 X;  1ASY A;  3C2P A;  3DWQ A;  3A54 A;  3ZJY C;  4M8A A;  3TQY A;  2MQH A;  3FKI G;  3NTI A;  5GAH C;  2WKD A;  2CVR A;  5I2Y A;  4A4I A;  1MSG A;  3D6W A;  4C2M B;  3I4M G;  2IL8 A;  3A0J A;  5FKA C;  3ER0 A;  3T1H Q;  2RVL A;  2UXB Q;  2O4X A;  2XNA C;  4DR3 L;  1WYD A;  3A55 A;  1U9R A;  2NZH A;  4MTK A;  3VDY A;  3KLW A;  1Y1W H;  1K0R A;  4H02 A;  5BN4 A;  2R7D A;  3QO2 A;  1E7Z A;  1GOZ A;  3J7A V;  1A62 A;  4DV2 Q;  2JQO A;  4X3T A;  4HN7 A;  4BS9 A;  5C4X G;  2IX1 A;  5FLX L;  2EJM A;  2PQA A;  5IT9 c;  5D3I B;  4PZ8 A;  4OX9 Q;  4PG3 A;  4ZYS A;  4A3M H;  3VR2 A;  5KND A;  1PZI D;  3TN2 A;  1LTG D;  1V43 A;  3E9I A;  4BBR H;  1PV4 A;  1JT8 A;  4KN7 C;  1X54 A;  4DXG A;  3HOX G;  3DWA A;  1SNQ A;  2KVM A;  5EKL A;  3SK8 A;  2B8F A;  5CMD A;  2N88 A;  2M2L A;  2HIV A;  3E3X A;  4B3T Q;  3W2D A;  5FLX E;  3W1B A;  1HA6 A;  3MEF A;  2ATW A;  3MFG A;  4R4T A;  4UAI A;  2WIN B;  1KNE A;  3VR3 A;  3A8J E;  1EIF A;  4QMG A;  1XX8 A;  4R4I A;  4JI1 L;  2AQ1 B;  5AFW A;  1EY0 A;  2KHS A;  4POF A;  1ESF A;  1WTQ A;  2GA4 B;  3PF4 A;  2V4D A;  2ZXR A;  3M4P A;  2UUA Q;  3DEO A;  3VR4 A;  4HAE A;  4IOC A;  2N78 A;  4AQY Q;  4JI5 L;  4I7Z C;  2KBN A;  1EY9 A;  4HSP A;  1HTP A;  2J4X A;  1F2M A;  2BE5 D;  3L9A X;  4DR1 Q;  2EYH A;  1VQ6 A;  1STE A;  3E0E A;  3NUC A;  4O0A A;  2B2W C;  3MZ5 A;  4IQZ A;  1PH8 A;  3I3C A;  2R7Z B;  1WTX A;  1LAB A;  1JMC A;  3UE1 A;  4YIJ A;  5KNC A;  1KDB A;  4IUR A;  3M3Y H;  3TRZ A;  2G9D A;  3E0J A;  3Q24 A;  5C4Z A;  1KNA A;  4DR5 L;  3U58 A;  2PQE A;  1R9T H;  1Q7Y C;  1LT4 D;  4JI8 L;  2EYP A;  1JE4 A; 
#chains in the Genus database with same CATH homology
 5M5Y H;  3CCV A;  5C4J H;  4YCU A;  1Y1V H;  3A5Z B;  3RZD H;  3HOY G;  1N32 Q;  3CCQ A;  1PVO A;  4GS3 A;  4QIW E;  4R4C A;  1L1O A;  1JJ2 A;  1PH4 A;  2E2I H;  3CAM A;  1MJE A;  1OXU A;  3CCR A;  4A3E G;  1GKH A;  4A3K G;  1Z9F A;  3TRE A;  2E8G A;  2RHQ B;  4MZ9 A;  3CPW A;  4BBS H;  4B3R Q;  4LF5 L;  4JI2 L;  2ZJQ A;  1YBY A;  3CF5 A;  2BH8 A;  4BY7 H;  2UU9 L;  4A3K H;  1SFO H;  4DV2 L;  1SN8 A;  4Y7N H;  4LWC A;  2VQF Q;  1QVF A;  1J5E L;  1NE3 A;  4JI5 Q;  4GOP A;  3CCL A;  3M7N A;  3PUZ A;  2D62 A;  2H5X A;  3HOV G;  2KEN A;  3CMA A;  2UUB Q;  4P75 A;  2BH2 A;  3JAM c;  2JA7 H;  4LFA L;  1IXR A;  1H95 A;  3UDG A;  1VQH A;  5BR8 L;  1RL2 A;  4KHP Q;  1PH3 A;  1UE7 A;  4DV0 Q;  4HIO A;  1AE3 A;  3ULP A;  2F4V L;  1XPU A;  1VQ5 A;  1U0L A;  2AKW B;  2VQF L;  3JC6 6;  4YWM A;  4C3J H;  2NVY H;  3D31 A;  1TWA H;  1NMG A;  3H0G G;  3FP9 A;  4IJH A;  4HIK A;  1C0A A;  1K9M C;  1L1O C;  1VQD A;  4LF7 Q;  4OON A;  4JI2 Q;  5JEA J;  4LF6 Q;  2F52 A;  4JI1 Q;  4DR4 L;  4OX9 L;  4JBJ A;  4DKA C;  2UXC Q;  4BBS G;  1LM0 A;  1WCM H;  1RIP A;  4NXN Q;  3AYH B;  3I2Z A;  2OQ0 A;  5GRO A;  1AH9 A;  1FGU A;  2YTX A;  2Z6K A;  3HOU G;  4LFB Q;  2VNU D;  2EIF A;  1QVG A;  1X9N A;  3UDF A;  1VQN A;  3GTL H;  4K0K Q;  3PF5 A;  4GLV B;  1VQO A;  1Q82 C;  4ALP A;  2Q2U A;  2YTV A;  3CCJ A;  5E7N A;  1BVS A;  1FL0 A;  2L15 A;  3CCE A;  3E9H A;  3L7Z C;  4HID A;  4DV1 L;  2B29 A;  4DV3 Q;  3UDX A;  2UUC L;  1XMQ Q;  4L5S A;  2K5H A;  3KDF B;  1TWF H;  3GTQ H;  4OWW B;  1E1T A;  1MJC A;  3T1Y Q;  4BXX G;  5JJL A;  3AFQ A;  4AIM A;  2UXB L;  4YY3 Q;  1FJG L;  2MNA A;  4UPA A;  5IY0 A;  5FLX c;  4L5R C;  1P16 A;  3HKZ E;  1QUQ A;  3F8T A;  1K3R A;  4UP9 A;  3S2D H;  3U50 C;  2UXC L;  3K8A A;  2E5L L;  1C9O A;  5GAE C;  1L0W A;  3KDF A;  3S1Q H;  1YVC A;  2ID0 A;  1X3F A;  2GVB A;  1N34 Q;  2C35 B;  2I0Q A;  2VUM G;  2D0O A;  4JI3 L;  1HZ9 A;  1VQE A;  1CUK A;  2KCT A;  3PUV A;  4JI8 Q;  3NEM A;  4R4O A;  4DV7 Q;  3PUY A;  1Z47 A;  2PNH A;  4TVA B;  4DK3 C;  1P8L A;  2D0P A;  4A3F H;  2IY5 B;  2F3I A;  4LUZ A;  5GAD C;  2I5H A;  4IPG A;  2WB1 E;  1VQG A;  2OCE A;  3RLF A;  4XTC S;  1AE2 A;  2NN6 I;  4B3S Q;  5LMN L;  1IL2 A;  3J7A 5;  4EQ5 A;  4A3I H;  2JK8 A;  1ASZ A;  2MO1 A;  1OXS C;  1YJ9 A;  4B3S L;  1I6H H;  2ALY B;  1GD7 A;  1LUZ A;  4OWT B;  4TQU S;  3J81 c;  4NXN L;  4P71 A;  3RNU A;  1EFW A;  4KHZ A;  2RF4 A;  1WI5 A;  3UE0 A;  2CKZ B;  3PUW A;  3BZK A;  3I4O A;  4FDB A;  4MNO A;  2DUD A;  4LF6 L;  2R92 G;  3AEV A;  1WCM G;  4GLX A;  1N36 L;  3I55 A;  4UY8 C;  4GKK L;  3NBH B;  1XTD A;  1XJV A;  1FJG Q;  3GTO H;  1SE8 A;  1N33 L;  3FHW A;  3BJU A;  1TWG H;  4A3B H;  1N32 L;  2UXD L;  4GLA C;  2F4V Q;  1OTC A;  3GTP H;  3I4N G;  3GTK H;  4IFD I;  1Q81 C;  5BR8 Q;  1QZH A;  1NJI C;  2UUA L;  3DM3 A;  3W5O A;  1UWV A;  2JEA I;  4QQB X;  3CXC A;  2CCZ A;  1NY4 A;  2JA6 H;  3M4Q A;  4LNQ A;  1VQI A;  2JE6 I;  4POG A;  1CSQ A;  4K0K L;  3DLL A;  2JA6 G;  1Y1W G;  1K8G A;  1I94 Q;  1IYJ B;  3J80 c;  4A3L G;  4YCV A;  2Q2T A;  2OWO A;  3H3V H;  2R93 H;  2HT1 A;  4BXX H;  1MIU A;  2RHS B;  1VQK A;  3I7F A;  5C4X H;  3KF6 A;  5IP9 G;  4BA1 I;  4QL5 A;  4A3C G;  1X3E A;  4YCW A;  3KJP A;  4JI3 Q;  4IOA A;  2N8N A;  1CKO A;  2IHE A;  3K0X A;  4JOI A;  3M85 A;  2ASB A;  4HJ9 A;  3L0O A;  5IYC G;  4L5T A;  2CQO A;  4LF7 L;  5K36 G;  2Q2I A;  2K50 A;  3IRB A;  3TS0 A;  4JV5 L;  5JJK A;  1N33 Q;  3STB D;  5FLM G;  3UDI A;  1IBM L;  4JBK A;  3RZO H;  4HJ7 A;  4JYA L;  1OXV A;  2VZA A;  5IP7 G;  4HJ8 A;  1YIJ A;  1HNZ Q;  3GTG H;  1JE5 A;  2AWO A;  1YHA A;  4DUZ L;  4JI4 Q;  1D8L A;  5HY6 A;  1IBL L;  4GN3 B;  3HOU H;  3TEH B;  3PO2 G;  2QGQ A;  4DR4 Q;  1Q86 C;  1JJG A;  5IWA L;  1X3G A;  4A75 A;  4XIG S;  4LF9 Q;  3ICE A;  2PI2 A;  4AYB E;  4GNX A;  4A3F G;  4A3M G;  5GQO A;  1X56 A;  3F2C A;  1KC8 C;  2N3S A;  4NXM L;  1PH7 A;  4LF8 Q;  4A93 H;  4YY3 L;  4DNI A;  3KFU A;  3BZC A;  5C44 G;  1E3P A;  4UP8 A;  3SGI A;  2A8V A;  5C0X J;  4BY1 G;  4DV0 L;  4JI7 Q;  4X64 Q;  1FVI A;  1BKB A;  3BU2 A;  4GOP C;  4DUY L;  1IBK L;  3M9B A;  4BY1 H;  4LUO A;  4HIM A;  2UUB L;  1HH2 P;  4EX5 A;  5JEA G;  3JAM i;  4DV6 L;  1SR3 A;  4AH6 A;  2ES2 A;  4JOI C;  2ZTD A;  3D0F A;  1KAW A;  3ULL A;  4X6A H;  5FJ8 H;  2V1C C;  4R1J A;  2GN5 A;  3RLO A;  3U4Z A;  4DR2 Q;  1YHQ A;  1PH9 A;  3F2D A;  1CSP A;  1YHB A;  2HHH Q;  3B6Y A;  3GD7 A;  1HNW L;  2CFM A;  3H3V I;  4DR2 L;  5FLM H;  1I50 H;  3HOW H;  3RN2 A;  2IX0 A;  1HNW Q;  4WJ4 A;  3S14 H;  1XNR Q;  1X55 A;  4X62 Q;  1NTG A;  2BA0 A;  2E2J H;  2K52 A;  4QJF A;  2B63 H;  1VS0 A;  1PH2 A;  3K80 C;  1HJP A;  3PGZ A;  3HKS A;  1IZ6 A;  1LTL A;  3PSI A;  3S1M H;  2UUC Q;  1VCI A;  2QEX A;  2XGT A;  1KL9 A;  4NXM Q;  3K7A H;  4KLK A;  2E2H H;  1UEB A;  4IJL A;  3EIV A;  1MKH A;  2UXD Q;  2A1A A;  1S72 A;  5GAG C;  4IPD A;  5IP9 H;  5IYD H;  1VQJ A;  3FKI H;  2NVX H;  4UP7 A;  3TS2 A;  1VQ8 A;  1A63 A;  2R93 G;  1N36 Q;  1HZA A;  4LF9 L;  1HNX L;  4YHH Q;  4LF5 Q;  1TWC H;  4OWX B;  4LUV A;  2YU9 H;  4DR7 Q;  4A3D H;  3K81 C;  1BBU A;  3A74 A;  4DUZ Q;  4WJ3 M;  2K75 A;  3CC7 A;  4A3J H;  3PO3 G;  5M5X H;  2VUM H;  4R4Q A;  1Q12 A;  1M1K C;  1IBM Q;  2JA5 G;  4AYB G;  1Y14 B;  1UE1 A;  2GVA A;  2Z6K C;  2OTL A;  3F2B A;  1HR0 W;  3CW2 C;  2PI2 E;  5M3M G;  4OO1 G;  2JA8 G;  4LW1 A;  4LFC Q;  5J3B A;  2I5L X;  4L5Q A;  4KHP L;  4DR6 L;  1PH5 A;  2IHF A;  2LSS A;  3CC4 A;  2RCN A;  3H15 A;  3W1G A;  3CCU A;  3GTM H;  1S3O A;  3LGJ A;  1G51 A;  4X64 L;  4JC0 A;  1VQM A;  4C2M H;  2R7Z G;  4LFC L;  3OYY A;  4JI0 L;  4DR5 Q;  4Y52 H;  2DGY A;  4ME3 A;  1LYL A;  1N9W A;  5LMN W;  5ELN A;  4DV4 L;  1HR0 Q;  5H1S E;  4X62 L;  3CC2 A;  4LF8 L;  1CKN B;  3GDE A;  2YTY A;  1WOC A;  5LMU L;  4A76 A;  4QGU A;  1IBL Q;  3NEN A;  3HOZ G;  4C3H H;  2N49 A;  4NB3 A;  3STB C;  4DR7 L;  1PA6 A;  1K73 C;  1PHJ A;  4JYA Q;  4B3M Q;  4DR1 L;  4JI6 L;  3PIP A;  5M3M H;  4O2D A;  2ZJR A;  5IYB G;  4GNX C;  3J81 j;  5AJ3 L;  4IPC A;  2BA1 A;  1X6O A;  4GNX B;  1GVP A;  5JJI A;  1Q1E A;  2I5M X;  4DV4 Q;  1J6Q A;  1U5K A;  1YJW A;  2PQA B;  4YWL A;  3CQZ H;  1YIT A;  2ZM6 Q;  4A93 G;  4QY7 A;  2ZJP A;  4A3G H;  1VQB A;  1E24 A;  3CPF A;  2VS1 A;  4B3M L;  4JI6 Q;  1W3S A;  4X65 L;  3J7Z C;  2R7Z H;  4LFB L;  3S1R H;  3T1H L;  2VY3 A;  1YI2 A;  1Q1B A;  4OXP A;  4PZ7 A;  3OW2 A;  5IWA Q;  1XMO Q;  5IP7 H;  2OTJ A;  1NBW A;  1Q8K A;  5ELO A;  5HGQ A;  5C3E G;  4P74 A;  3A5U A;  1N34 L;  4LF4 L;  3S2H H;  3K7U C;  1KXL A;  2WFW A;  1YEZ A;  2E5L Q;  4JCV E;  3HOW G;  2QA4 A;  1KD1 C;  2HHH L;  3PUX A;  1X65 A;  1C7Y A;  4BBR G;  3G6E A;  4X66 Q;  2B63 G;  3J80 i;  1S40 A;  2MFI A;  4PMW A;  1PH1 A;  1KQS A;  5LMN Q;  4LFA Q;  1XMQ L;  1PYS B;  3CCM A;  1E1O A;  2CWA A;  4P73 A;  4YHH L;  2VQE L;  3S17 H;  4DR6 Q;  1SLJ A;  2HQL A;  4JBW A;  1QVC A;  2JA7 G;  1CKN A;  1BBW A;  3AQQ A;  4DAM A;  1I94 L;  1YJN A;  1T9H A;  2JA8 H;  4DUY Q;  1KRS A;  4GKJ L;  2ZTE A;  3CP0 A;  1QUQ B;  3MXN B;  4DV1 Q;  4JI7 L;  5IYD G;  4IFD G;  4GKJ Q;  2VL6 A;  1L1O B;  3S24 A;  3PCO B;  4B3T L;  1EWI A;  5FJ8 G;  1UE5 A;  1WJJ A;  1QZG A;  4J15 A;  1M90 C;  2NVT H;  4YWK A;  3S16 H;  2AHO B;  3S1N H;  1EQQ A;  1ASY A;  1B70 B;  5M3F G;  4RG1 A;  3ZJY C;  2R92 H;  1YZ6 A;  3HOZ H;  1A8V A;  2XTI A;  3TQY A;  2EQS A;  2MQH A;  3FKI G;  2A19 A;  4BA2 I;  5GAH C;  1NMF A;  1VQ4 A;  4IPH A;  2YYZ A;  4A4I A;  4NPS A;  2B3G A;  1Q46 A;  4BY7 G;  1D7Q A;  4LF4 Q;  2KCM A;  4HJA A;  4DV3 L;  2YV5 A;  3WWV A;  1SMX A;  3I56 A;  2WAQ E;  4JBM A;  3HOX H;  3I4M G;  2LXJ A;  3A0J A;  4APV A;  4JI0 Q;  3ER0 A;  1CKM A;  3KJO A;  3GTJ H;  2NN6 G;  3T1H Q;  4A3E H;  1TXY A;  3CME A;  4IO9 A;  2UXB Q;  4DR3 L;  1WYD A;  3AFP A;  2PMZ E;  2WP8 J;  3VDY A;  2NZH A;  3KLW A;  1Y1W H;  1K0R A;  4H02 A;  4A3G G;  1VQ9 A;  2R7D A;  1E7Z A;  3HOY H;  5C0X I;  1A62 A;  4DV2 Q;  2AMC B;  1JB7 A;  2JQO A;  1VQL A;  1YNX A;  5C4X G;  2IX1 A;  3KF6 B;  4A3J G;  2PQA A;  5IT9 c;  3G4S A;  1SRO A;  2R7F A;  3CCS A;  1N8R C;  1VQ7 A;  3PO3 H;  2ZTC A;  2K14 A;  3RLN A;  4GOP B;  4PZ8 A;  2Q2H A;  4OX9 Q;  4PG3 A;  4A3M H;  3HFZ B;  4HJ5 A;  4DV6 Q;  4P72 A;  4JI4 L;  3RN5 A;  1EUJ A;  1KRT A;  1HNZ L;  1VQF A;  1HR0 L;  2OQK A;  1V43 A;  3E9I A;  4BBR H;  1PV4 A;  1JT8 A;  4JV5 Q;  2VW9 A;  2Y0S E;  1X54 A;  3HOX G;  1OXX K;  3ULJ A;  1J5E Q;  3I4M H;  1UE6 A;  5M5W H;  1K83 H;  1XMO L;  4MTN A;  3U4V A;  1GM5 A;  2IT1 A;  2MO0 A;  2UU9 Q;  2Z0S A;  3J81 i;  4A3I G;  3F1Z A;  2HIV A;  4B3T Q;  5EAY A;  1HZC A;  2K4K A;  4A3C H;  3W1B A;  2EXD A;  1B7Y B;  4GN5 A;  3MEF A;  2ZM6 L;  2ATW A;  1L2F A;  4DPG A;  3ERS X;  1WFQ A;  2FXQ A;  1HZB A;  2NZO A;  4R4T A;  4X66 L;  2VQE Q;  1EOV A;  2JA9 A;  4IFD J;  1EIF A;  4OO1 I;  1Y1V G;  4DV5 Q;  2R6G A;  3H0G H;  1A0I A;  1OXT A;  2K5N A;  3KOJ A;  4R4I A;  3CD6 A;  2CWP A;  4JI1 L;  1VQA A;  1I3Q H;  1DGS A;  5C44 H;  4KI0 A;  1KIX A;  2NVQ H;  1EIY B;  4GN4 B;  1XNQ Q;  1EQR A;  4POF A;  5IYB H;  2K5V A;  1KHI A;  3EBE A;  1TWH H;  4A3D G;  2LXK A;  1JJC B;  1K8A C;  4DK6 C;  3PIO A;  1VQC A;  4X65 Q;  1XPO A;  5LMU Q;  3PF4 A;  3T1Y L;  2WAQ G;  3HOV H;  2HIX A;  3PO2 H;  4AQY L;  2AWN A;  3M4O H;  3M4P A;  4PZ6 A;  3HKZ G;  4DAY B;  1IBK Q;  2UUA Q;  3I4N H;  4IOC A;  2N78 A;  4AQY Q;  3L2P A;  4JI5 L;  2KBN A;  5AJ3 Q;  5IYC H;  5IE8 A;  2WB1 G;  1I5F A;  3RR5 A;  4GKK Q;  5C3E H;  1PYB A;  4DR1 Q;  1EYG A;  3S15 H;  1XNQ L;  1VQ6 A;  1SRU A;  1XNR L;  3E0E A;  4B3R L;  4O0A A;  3KF8 B;  2Y0S G;  1VQP A;  2JEB I;  1PFS A;  3G71 A;  3KYH C;  1PH8 A;  1GO3 E;  2KHJ A;  5M3F H;  4DV5 L;  1E22 A;  1HNX Q;  3PV0 A;  4DV7 L;  2JJQ A;  1JMC A;  3UE1 A;  1G29 1;  3NEL A;  4JG2 A;  3M3Y H;  3G48 A;  2JA5 H;  1V1Q A;  2KHI A;  1G6P A;  3EN2 A;  3TRZ A;  1W2B A;  4A3B G;  3GO5 A;  1V9P A;  4C3I H;  4A3L H;  1O7I A;  4DR5 L;  4RMF A;  3U58 A;  3OTO L;  1R9T H;  5DLQ E;  4DR3 Q;  1PH6 A;  1Q7Y C;  1XPR A;  3OTO Q;  4JI8 L;  5C0X G;  1B8A A;  3Q8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...