4DR1Q

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr1Q00
2MO0A 4DUYL 5BR8Q 1FJGQ 4DV5Q 1PH7A 2KHJA 3CD6A 3E0EA 1Q81C 3I4NG 1KRSA 5AJ3Q 1XNQQ 1XNRL 3M3YH 3RR5A 4DK6C 3UE1A 2QEXA 1IBLL 2Q2TA 2IY5B 4YCWA 3OTOQ 4P71A 3WWVA 4BY1H 2E8GA 4DR1L 1EIYB 2Y0SE 2ZM6Q 5M5XH 1FVIA 1TWHH 4WJ3M 1YJWA 1O7IA 5JJLA 3LGJA 4GN3B 2D0PA 4X62Q 3CC4A 2ZJRA 3A5ZB 1L0WA 5IP9G 4DV1L 1YZ6A 1VQ9A 1X55A 1MKHA 1GVPA 3J80i 4EX5A 2NVYH 4A3CG 3CP0A 1IYJB 1PH5A 1JJCB 2VL6A 3S1MH 4IPGA 3ER0A 1I50H 4OONA 1XMOL 1A8VA 1ASZA 3PSIA 3VDYA 1RL2A 5FLXc 1FL0A 1MJEA 4DR6Q 1HNZQ 4HIMA 4BBRG 4JOIA 1U5KA 4X65Q 4A3IG 3KF6B 4GKKL 2R7FA 4GKJL 3CCQA 5IYCH 2F4VQ 2PI2E 3KDFA 1MJCA 3B6YA 3HKZE 3PO2G 1TWCH 4LF5Q 2AWNA 5LMNL 4A4IA 2A1AA 3KJOA 1PH8A 4B3SL 4PZ6A 2VZAA 1V9PA 4A3JH 4LF9L 4A93G 4DV3Q 4UP9A 3PUXA 5C4JH 1AH9A 3I4NH 1XMQL 3TS0A 2K14A 3NEMA 1YHBA 4DUZL 4HIDA 4DR2Q 2K52A 2IHEA 3PGZA 1VQFA 2B29A 4HJ9A 3ULPA 4JI1Q 4JCVE 1X56A 3HOXG 3MXNB 3J7ZC 1VQ7A 1E3PA 5GROA 2WAQE 4YCVA 1EIFA 5K36G 2VUMH 4XIGS 3UDGA 1QZHA 2A19A 2ZTCA 1GO3E 2K5HA 5IP9H 1QVGA 1JJGA 2KHIA 4LWCA 1N8RC 1IBLQ 2EQSA 1VQAA 1SMXA 3TQYA 3CXCA 4JBMA 4A3CH 2RHSB 1IZ6A 4DR1Q 3CCRA 1T9HA 4A76A 2HQLA 1GD7A 2DGYA 2JEAI 2OQKA 2YTYA 1KAWA 4KI0A 4LW1A 4YCUA 3L2PA 2UXBQ 4QY7A 4L5QA 2NZHA 3PUVA 5LMUL 4IFDG 2ZJQA 4BBRH 1CUKA 5JJIA 5FLMG 4A3IH 3K81C 1YBYA 2GVBA 3FKIG 4KHZA 1QVCA 2ALYB 3RLNA 4X66Q 3CCSA 1VQ4A 2IX1A 1SROA 1WCMG 2IX0A 1PVOA 3K0XA 1JE5A 5DLQE 2LXJA 3W1BA 2UUBL 3H3VI 2HHHQ 2GVAA 3PO2H 5M3MG 1FGUA 3S17H 5GAEC 1PYSB 2PQAB 3GTMH 4A93H 1CKNA 2E2JH 1C9OA 1CKOA 5ELOA 4KHPL 4GKKQ 1PH3A 4R4QA 3ZJYC 4JI3L 1HR0L 1IXRA 3I2ZA 4NXNQ 2BH2A 4DR7L 3HOXH 2CFMA 2JE6I 3K8AA 4LF8Q 3MEFA 4DV0Q 4BA2I 1EFWA 3W5OA 5IWAQ 2E2IH 4B3SQ 4HIKA 1BVSA 1VQ5A 2DUDA 4AQYQ 1J5EL 4YY3Q 2NZOA 2WB1G 1K83H 3SGIA 2Q2HA 4DPGA 2NVXH 1N36L 3PUWA 1YVCA 1HZCA 3I4MG 4HJAA 4MNOA 3S2DH 4A3MH 2OWOA 1S72A 4R1JA 4HJ8A 4GOPA 1SRUA 1KXLA 3STBC 3S1RH 4LF6L 1CSPA 1WOCA 2WP8J 1E1TA 4H02A 1N34L 3M7NA 2UXCQ 4OX9Q 5FLMH 1VQCA 4PG3A 4LFCQ 2AKWB 4JI4Q 1TXYA 1E24A 1NBWA 1K8AC 2B63G 5M3MH 1XPRA 1VS0A 1HJPA 4GLXA 1XTDA 3CCVA 2KCMA 3G4SA 5LMUQ 1I5FA 4A3JG 4GN4B 3HOUG 5IE8A 3KFUA 3RZOH 4XTCS 4IPHA 3J81c 1QZGA 2ATWA 4IFDJ 1B70B 1KQSA 4LF7L 3GTPH 4JBJA 1KC8C 1D7QA 3F2BA 5C0XG 4GS3A 4NPSA 3H15A 1L2FA 2VNUD 1YJNA 1IBKL 1X9NA 1WFQA 3GDEA 2UUAL 2RHQB 3PUYA 2UUCL 3W1GA 1E22A 1OXVA 4KHPQ 1N32L 2VUMG 2Z6KC 3A0JA 3CCMA 5HY6A 4Y7NH 1VQDA 1NE3A 2Y0SG 4QGUA 3PV0A 3T1HQ 4B3TQ 1X3FA 2LSSA 3F1ZA 3I4MH 1AE3A 4OO1I 3J7A5 2KCTA 4GN5A 4LUOA 1W3SA 3CAMA 4AIMA 3KJPA 3CQZH 2ES2A 2Z0SA 3AYHB 3STBD 4DAMA 3S15H 3S1QH 4LF4L 4DK3C 5ELNA 2VQFQ 3PCOB 1BKBA 4GNXA 4OWXB 5H1SE 1L1OA 2Q2IA 2BA0A 4GLAC 4JC0A 4NB3A 2RCNA 3DM3A 4X64L 2R92G 2UXDQ 3GTLH 2JA7G 4JV5Q 3CCJA 4A3KG 2JJQA 3GD7A 2K5NA 1Z47A 1WI5A 4EQ5A 3U50C 2R7DA 4HJ7A 1K9MC 2B63H 3HOZG 1UE7A 2FXQA 1UEBA 4P73A 1Q7YC 5LMNW 4LF6Q 4DV6Q 4YHHQ 3S1NH 4DV2Q 3I4OA 4LFAL 3HOUH 2OTJA 4A3LG 3EBEA 3TRZA 1JT8A 3HKZG 4P75A 3JAMc 4QQBX 5C44G 3H0GG 4JI0L 4PZ7A 3BU2A 3Q8DA 3J80c 2CQOA 4IJHA 3PF5A 1GM5A 4POFA 4R4TA 2YYZA 1X6OA 1DGSA 3K80C 1EQRA 2JQOA 4UPAA 1MIUA 2NN6G 1YJ9A 4DUYQ 1HNXL 2MNAA 1R9TH 3GTKH 2AHOB 3E9IA 3RZDH 1IBML 5IYDH 4KLKA 1X3EA 1G51A 3K7UC 3KOJA 2NVQH 1XNRQ 3J81j 4IOAA 4LF7Q 1P8LA 1QUQB 1I94L 4OXPA 1EYGA 4NXML 3CCEA 5GQOA 4HJ5A 5M5WH 1I3QH 3A5UA 2HIXA 3A74A 4DKAC 2MFIA 2R7ZH 2WAQG 5C0XJ 4JI5L 4A3MG 4JYAL 1VQIA 3M85A 4JI2L 4IPDA 1Q1EA 1YHAA 1YIJA 2JA6G 5M3FH 3JC66 4YWLA 3HOYG 3KLWA 3HKSA 4R4IA 4DNIA 1OTCA 4DV1Q 4JOIC 1Q46A 1HH2P 2OQ0A 4DV7L 3RLFA 3FHWA 3M9BA 1K73C 5C0XI 3I55A 2R92H 2VQEL 4JBKA 2JA7H 4A3KH 2N49A 4P74A 4BY7G 4DR4L 2K75A 4DV4L 4DR3L 4A3DH 1XMOQ 1YHQA 4B3RL 2D0OA 1K0RA 5IY0A 1X3GA 1VQGA 1PH6A 1G6PA 4A3LH 4LFBL 3K7AH 4UP7A 1UWVA 5E7NA 3GTQH 4K0KL 1HR0W 5C44H 4GKJQ 1C0AA 1VQMA 3H0GH 4RMFA 3ULLA 1V1QA 2EXDA 4C3JH 3AFPA 1A62A 3CMAA 5BR8L 5LMNQ 2IHFA 2KENA 1PH9A 1B7YB 4DV5L 3M4QA 4LFAQ 4LF9Q 1XNQL 1VQOA 4JI6L 1LYLA 1HZ9A 4IO9A 1HZAA 1XMQQ 2BH8A 3KF6A 1KHIA 2H5XA 3RLOA 1J6QA 1JB7A 4DUZQ 2R6GA 2V1CC 2L15A 4AYBE 3OTOL 4HIOA 1N33L 1NJIC 3M4OH 2IT1A 3CC7A 2MO1A 1H95A 1G291 1M90C 1HNXQ 4IJLA 2OCEA 4X62L 3F8TA 2JA6H 2NVTH 3HOYH 1SE8A 4A3GG 1VCIA 1KD1C 1P16A 5JEAG 1HNWQ 1RIPA 2I5HA 3KDFB 4APVA 1SN8A 2VW9A 2I5MX 1D8LA 2HIVA 3G48A 4A3EH 1XPUA 4BY7H 3S24A 2RF4A 3BJUA 4C3HH 2CCZA 3FP9A 4RG1A 4PMWA 2N3SA 3J81i 4DR6L 1OXUA 2WFWA 1A0IA 3AQQA 1HNZL 4X65L 4X6AH 3GO5A 2B3GA 3D31A 1Y1VG 3CPWA 2QA4A 4DV7Q 1I6HH 1OXTA 1N36Q 1TWGH 1Y1WG 1VQEA 2JA5H 4JG2A 5GADC 4LF5L 1Z9FA 1SFOH 3CPFA 2UUBQ 1NY4A 4LNQA 2QGQA 1C7YA 4B3RQ 1Q1BA 4DV3L 1Q12A 1W2BA 4A3BG 4A3FG 2AWOA 2JA8G 1PA6A 4IFDI 1UE5A 1QVFA 5C3EH 4DR2L 1VQNA 5IYDG 3TEHB 3HOZH 1BBUA 1LUZA 1B8AA 3D0FA 3TREA 4JI7L 1HR0Q 1Q86C 3U58A 4JI3Q 1X54A 1N9WA 4JI1L 1EQQA 1EWIA 4JI8L 3G71A 1JJ2A 4OWTB 2JA9A 4DR7Q 1PFSA 3KF8B 3CCLA 3HOVH 3U4ZA 2E5LL 2R7ZG 3G6EA 3HOWG 4GOPC 3CW2C 2PQAA 4TQUS 2CWPA 2I0QA 2YU9H 2K5VA 4J15A 4JI6Q 1J5EQ 5FJ8H 4QIWE 5M3FG 4A3GH 2XGTA 2ZTEA 3OW2A 1N33Q 5IYBG 1UE1A 1WYDA 1M1KC 2K50A 4B3ML 3I56A 2UXBL 2F52A 1S3OA 4A3DG 4AH6A 1VQ8A 1LM0A 2YTVA 3JAMi 4A3BH 5IP7G 3F2CA 4DAYB 2E2HH 1CKNB 2GN5A 3BZCA 1N34Q 4X66L 1Y1VH 3DLLA 3AEVA 2LXKA 1SR3A 4FDBA 5JEAJ 1Y1WH 3RN2A 1NMGA 1Q8KA 2YTXA 2HHHL 3S16H 4Y52H 2I5LX 4L5SA 1A63A 2BA1A 1YI2A 4L5RC 4YWKA 2ASBA 1LTLA 4QJFA 4A3FH 1PH1A 2JA8H 3IRBA 1PV4A 4ME3A 2UU9L 4MTNA 3T1YL 4NXNL 4O2DA 1EUJA 2VS1A 1PH2A 4LF8L 4DV0L 2XTIA 3UE0A 2F3IA 1TWFH 4GLVB 3GTGH 5IWAL 4GOPB 2MQHA 5GAGC 4AQYL 1IBKQ 3HOWH 4YY3L 1PH4A 2R93G 2UUAQ 2UUCQ 1E7ZA 4JBWA 3PIOA 1VQPA 1U0LA 1N32Q 4DR5L 4JI7Q 4IPCA 4GNXC 5M5YH 5IYBH 1L1OC 4JI8Q 4C2MH 2PMZE 2JK8A 2JEBI 3PUZA 1ASYA 3NBHB 3CF5A 4A3EG 3H3VH 3KYHC 5C4XG 1JMCA 2E5LQ 1NTGA 1VQHA 1HZBA 1NMFA 5IP7H 2UXCL 4LUZA 4OX9L 1UE6A 3EIVA 5J3BA 1YITA 1Y14B 4LF4Q 4LFCL 2N8NA 1K3RA 1KL9A 2VY3A 3UDIA 3CCUA 4JI4L 5HGQA 3U4VA 1VQKA 4X64Q 4PZ8A 4B3MQ 2JA5G 4BXXG 3CC2A 2PI2A 2YV5A 2ID0A 4TVAB 1FJGL 1YNXA 3E9HA 5AJ3L 2N78A 2ZTDA 5EAYA 4UP8A 5C3EG 1S40A 2A8VA 3TS2A 1OXXK 1V43A 1SLJA 5IT9c 1BBWA 4BBSG 1VQ6A 1OXSC 3AFQA 4JI0Q 4OO1G 1VQBA 2ZM6L 3PO3G 3PF4A 1XPOA 2PNHA 4POGA 3HOVG 2R93H 1KIXA 2EIFA 3HFZB 4LUVA 1CSQA 4P72A 3ERSX 2AMCB 2UU9Q 1IBMQ 3T1YQ 1CKMA 4O0AA 4AYBG 4GNXB 2HT1A 3ICEA 2C35B 1L1OB 2WB1E 3UDXA 5FJ8G 4B3TL 3T1HL 4C3IH 1I94Q 4BY1G 3PIPA 4NXMQ 1XJVA 5C4XH 4IOCA 2ZJPA 3S2HH 3RN5A 1EOVA 3L0OA 1GKHA 3BZKA 4JI5Q 2NN6I 4JYAQ 4JI2Q 1X65A 1VQJA 4R4OA 3I7FA 1AE2A 2D62A 2VQFL 1Q82C 2Z6KA 4YWMA 4DR5Q 1K8GA 1E1OA 3GTOH 4OWWB 1HNWL 1VQLA 1TWAH 3UDFA 2Q2UA 5GAHC 4UY8C 1QUQA 2UXDL 1KRTA 4L5TA 2F4VL 4JV5L 3ULJA 1PYBA 3M4PA 3GTJH 2VQEQ 4ALPA 4DR4Q 4DR3Q 4DV4Q 3PO3H 3RNUA 4BXXH 2OTLA 4QL5A 4YHHL 4DV6L 2KBNA 3NELA 4DV2L 3F2DA 2CWAA 4A75A 3FKIH 3OYYA 4LFBQ 1WCMH 1YEZA 5JJKA 5IYCG 4MZ9A 4BBSH 4K0KQ 1PHJA 3CMEA 3NENA 1IL2A 4R4CA 4BA1I 2CKZB 3L7ZC 3S14H 2K4KA 1WJJA 3EN2A 4WJ4A
chains in the Genus database with same CATH superfamily
1HTLD 3R8BA 1FJGQ 3A54A 1O7ZA 4DV5Q 1PH7A 1Q81C 1KRSA 1LTBD 4OGQC 3M3YH 1F9QA 1STYA 2F0NA 2TSSA 4KD3A 2ICIA 4ZKCB 1SE4A 5M5XH 1FVIA 4WJ3M 1O7IA 3PIO3 3LGJA 3K6OA 3CC4A 5I6WA 2ZJRA 3T16A 3TP6A 2ZXRA 1MKHA 3T53B 3CP0A 1RCVD 3SK8A 4IPGA 5M9OA 2EYOA 1ASZA 3P7JA 2E2JB 4N9TA 5FLXc 2F0WA 1V1PA 3TMEA 1BDOA 2BDOA 2OEOA 2Q8IB 1U5KA 4A3IG 1TS5A 4C3IB 2R7FA 4GKJL 4K2LA 5IYCH 2ICEC 1PFBA 3CU7A 1JR0D 1A2UA 4CGYB 3I70A 1Y69U 5EKIA 4G7ZC 3GTOB 5C4JH 4ZUIA 1PRTF 1KDAA 4HIDA 3S2DB 1HUNA 1VQFA 2LMCB 3GTJB 3K58A 3MXNB 1HCZA 3J81L 3L3OC 1EIFA 5K36G 3FKIB 1QZHA 1UEAB 3Q6SA 4MHEA 2ZTCA 5IP9H 1JJGA 4LWCA 2LKVA 3TQYA 4A3CH 3PIP3 1SYDA 2NUCA 2XWJB 3DWAA 4H44C 1PTOC 3KF8A 2VB3X 1UUPA 2JEAI 4RCOA 3C1EA 4KJOA 5KNCA 3L2PA 2UXBQ 1C8CA 1SNOA 1FNVA 5LMUL 3QIAA 1O7LA 4FYDA 5FO7B 4RFBA 2GVBA 1QVCA 1IHZA 5CMDA 5DLQE 1LABA 3PO2H 2EE1A 3TP7A 4QF4A 3GTMH 3A55A 2E2JH 5ELOA 3MWYW 1XXGA 4JI3L 1F9RA 4NP5A 3OWFA 2BH2A 4DR7L 2F0SA 4LF8Q 3MEFA 4BA2I 3S1QB 1LT3D 3VYRA 1BVSA 4AQYQ 1B1ZA 4G7HC 2Z9HA 3OIQA 1J5EL 4PNYA 3GTLB 5DM73 2B8GA 2Q2HA 3FRPB 1YVCA 3MZ5A 1B4OA 2H4OA 3A8KE 3I4MG 2PZUA 3S2DH 2OWOA 2KHSA 3S1NB 1PTOD 5CBAE 1JWMD 3E0JA 3TDQA 4K5WA 1WOCA 4TRDA 1HFNA 4MTKA 4U673 5FLMH 1VQCA 4LFCQ 2AKWB 5DEHA 3GQBA 3HGBA 3NBHA 3KLSX 2B63G 1EIHA 1XPRA 1GHKA 1HJPA 1XTDA 1ZYRC 3CCVA 3G4SA 5LMUQ 4LK1C 4A3JG 5CV6A 2C9OA 3RZOH 4IFDJ 1QZGA 2ATWA 1O7YA 3K0YA 4JBJA 5C0XG 4GS3A 1RKNA 4XQJA 2VNUD 2HQEA 1YJNA 1Q8IA 1WFQA 1UNSA 2UUAL 2RHQB 2UUCL 5IODA 4KK7A 3H91A 1N32L 5ELCA 1DOLA 2KCCA 4WORA 1OO9B 2J4XA 2LS01 4IUPA 1GXDC 4A3KB 2Z6KC 2VUMG 4EGVA 3CCMA 5EGTA 4B3TQ 1VQDA 1NE3A 2Z1CA 1X3FA 2LSSA 3F1ZA 5A2QL 3J7A5 3S17B 5KIXA 4JVZA 3QOJA 3AYHB 3S1QH 1VF5C 2B39A 1BOSA 3H0GB 1SEBD 1HNWQ 1BKBA 4OWXB 4JC0A 2BA0A 1EEID 2B2UC 3DM3A 4X64L 2K6AA 4FXKC 3GTLH 4JV5Q 2UXDQ 5NUCA 3SVMA 1WI5A 4NKLA 2EZVA 3OHXC 4O1NA 4P73A 1C4QA 1T5XD 5HURA 1ZYRD 3S1NH 5IGDA 4I65A 3EBEA 2AQ1B 2L5TA 2WAQB 1ET9A 1LT4D 3P1HA 1DGSA 3K80C 1HFGA 2NN6G 3VYTA 1U9RA 1R9TH 3EVQA 3E9IA 3SEBA 1IBML 1IYVA 4KLKA 4IOAA 2X69A 1QUQB 1I94L 5C6AA 1MSHA 5M5WH 1TT2A 5M3MB 2TMPA 1IW7C 3D8GA 4RGNA 3M85A 1K0SA 3HRZC 3TZUA 2MUYA 1XYIA 1I6HB 1EY8A 5EKKA 5M3FH 1XX8A 4DGZA 4DV1Q 2OQ0A 1SFOB 1SYBA 4B9WA 2NB0A 3M9BA 5C0XI 4JBKA 4A3KH 4BY7G 4P74A 3A7LA 3OIPA 1WTOA 1XMOQ 1B9MA 4K2KA 3HOZB 1CT1D 1YNNC 4KY7A 1NSNS 4KKTA 1UWVA 2EYLA 3GTQH 4K0KL 3H0GH 4RMFA 2XNAC 4DNTB 1A62A 2BOSA 3S15B 5BR8L 1BO0A 1PH9A 2I46A 2QKIC 2O4XA 2WKDA 1VQOA 1EZ8A 4JI6L 2BH8A 3KF6A 2H5XA 1J6QA 1CQFA 1KTKA 3DEOA 3H3VC 4HIOA 1F77A 4ID6A 1NJIC 2IT1A 1FR3A 1GUSA 1G291 1B44D 1IW7D 1M90C 4ULLA 3AB9A 2D2CC 4R8NA 3HOUB 2F03A 1VCIA 1P16A 5JEAG 2PO4A 1RIPA 2I5HA 2A73B 4APVA 1XPUA 1SN8A 1U4LA 3S24A 2RF4A 4A3BB 2CCZA 1KLGD 4PMWA 4DR6L 1HNZL 1A0IA 3BYYB 1YNND 2EOTA 3SDZA 1I6HH 1V8QA 1TWGH 2JA5H 4JG2A 1Z9FA 1JC7A 1SFOH 1GUWA 2B8FA 4ABNA 4G4KA 5LL6X 1PA6A 1ET6A 4C2MB 4IFDI 1PRTB 4L8JA 3HOZH 5DNFA 1Q86C 1GJXA 1GUOA 4JI8L 5CV9A 1PFSA 1QOHA 2E5LL 2R7ZG 4S3SA 3G6EA 3HOWG 2HCCA 2FJ2A 2K5VA 4J15A 4JI6Q 5FJ8H 3LWUA 4QIWE 2PCFB 3VR3A 2XWBB 5T1GA 3Q23A 4HTHA 5J39A 1UE1A 2F0GA 4A3DG 2NWGA 2ENBA 1EY5A 3MFGA 4X66L 3KLRA 4LAAA 4K6DA 2CQAA 3QJYA 2F0QA 4LMQD 1WTWA 1B50A 2HHHL 1NMGA 1Q8KA 2R93B 1H9KA 5C3WA 2BA1A 4L5RC 1ONLA 5F2DA 1I4RA 4DK0A 2O5JC 5JVH3 1SNQA 1PV4A 5E1FA 2UU9L 3GV3A 5C4XB 4A3EB 5ELDA 3FDTA 4NXNL 1EUJA 1L0YB 2VS1A 1JWUD 5ELBA 4C3HB 3UE0A 4GLVB 2SDFA 4GOPB 5JPMC 4YY3L 1PH4A 3PIOA 4EQPA 2EYMA 5IYBH 1L1OC 4JK1C 4JI8Q 4C2MH 5ELEA 1Y8PB 2E5LQ 4E6IA 1NTGA 1HZBA 1KNEA 2DNCA 5C3EB 2UXCL 4CJ1B 4KN7C 4LF4Q 2N8NA 2VY3A 4JI4L 4RHRA 1LT6D 1I4XA 1LTTD 2A5HA 3I91A 4TVAB 4AYBB 3E9HA 1NUCA 2Z6BA 2N78A 5EAYA 2BE5C 2A8VA 1OXXK 1V43A 3OMGA 4RGTA 1HXYD 1BBWA 5CBEE 5CGKA 5FLXL 3HP3A 1IKLA 1B53A 3BDLA 3PO3G 1SE3A 2PNHA 4POGA 2R93H 1CSQA 1TQOA 5CC4A 2AMCB 2UU9Q 4BS9A 3ICEA 1D5XC 2C35B 3UDXA 1I50B 4PMBA 3T1HL 1STBA 3K5OA 4BY1G 4HMJA 3PIPA 4HEDA 5C4XH 3RN5A 2RSNA 4J1MA 5K36H 1HUMA 4JYAQ 3I7FA 3BVGA 2VQFL 2G9HD 1STAA 4YWMA 1TWAH 2Q2UA 5GAHC 2KECA 1KRTA 2VQEQ 3NBIA 3I4NB 4QL5A 4CKCA 2CWAA 1X3PA 1NCVA 2OT2A 1NR2A 5M5YB 1DONA 2BE5D 2HD3A 1D1KA 4KMUC 1A2TA 3L7ZC 1VQ6A 1WJJA 3EN2A 2MO0A 1SXTA 1EY6A 2KHJA 1A6XA 1EY4A 1XNRL 2E75C 5EQ0A 3RR5A 4J6HA 4DK6C 2QEXA 1SYFA 2CVRA 2IY5B 3IAYA 2ZT9C 1G2SA 2Y0SE 3QOLA 1S5DD 1CZWA 1YJWA 2D0PA 4H7BA 1WTXA 1L0WA 2BDNA 4XXEA 1X55A 2F0FA 1IYJB 2JN4A 1QNUA 1TY2A 3ER0A 1I50H 1A8VA 4FF2A 1CA5A 1FL0A 3K5MA 4CDDC 4HIMA 2SOBA 1CZGA 4JOIA 3H94A 5FLXE 3HOXB 3SE0A 5T1IA 2E2IB 1MJCA 1LTSD 2NTSA 4ZQ3A 3R2IA 1Z7TA 3BZDB 4RKBA 2AWNA 5LMNL 2IWHA 1CTMA 3U9OA 2A1AA 1PH8A 4B3SL 1K83B 2VZAA 1V9PA 4IALA 2CW0C 4A3JH 1AZPA 1DCZA 1JWSD 4LF9L 2K03A 4A93G 3PUXA 3I4NH 1XMQL 2K14A 3NEMA 5D65A 4DR2Q 2K52A 5C0XH 4I7AA 4X3UA 2EYPA 4JCVE 1JOKA 1VQ7A 1EIGA 2VUMH 4XIGS 1SNCA 2A19A 1GO3E 2K5HA 1QVGA 4XYOA 2KHIA 1QCBD 1J8IA 2EQSA 4JBMA 1D5MC 1SMXA 4N8FA 3CXCA 3MAQA 2RHSB 1IZ6A 3CCRA 3H09A 2HQLA 1KAWA 1EYAA 4KI0A 1G2TA 4QY7A 1FNUA 3VR6A 4BBRH 4QUCA 3RLNA 1VQ4A 1A3TA 4XT3B 1WCMG 2UUBL 2FMCA 2MP1A 3I4LA 4RWSC 5M3MG 4DF7A 2WB1B 1RTNA 2CW0D 2PQAB 2RDGA 4DAYA 1CKNA 4Y7NB 4KHPL 1KNAA 4R4QA 3HEJA 4M1UB 1VMPA 3HOXH 1SNDA 2CFMA 1SNPA 2RQXA 2E2IH 5IWAQ 4B3SQ 1AEXA 1VQ5A 5L37A 2SEBD 5I9PA 1K83H 2J0TD 2PW7A 2NVXH 1SE2A 3PUWA 1SBBB 1EOTA 1PFNA 5D3IB 4G7OC 4R1JA 4HJ8A 1WD1A 1KXLA 3S1RH 1JOOA 4LF6L 1N34L 3H6MA 2AUKA 4IFDH 3K59A 2H1EA 1PLFA 1EZ6A 4FF3A 1S5FD 1RD9D 1TXYA 5C5MA 1AFPA 1SNMA 3D4RA 1VS0A 2LFNA 1I4QA 4GLXA 2B2YC 3HOUG 5IE8A 4H13C 1CQVA 1Q3LA 4TKOB 3SXHA 3GTPH 1KQSA 4N8X1 5FK9C 4CKBA 1L2FA 1K3BC 1IBKL 1EY9A 3GDEA 1LTRD 2XIWA 4KHPQ 1FYCA 3VA5A 3A0JA 1T5EA 5HY6A 4Y7NH 2Y0SG 3PO2B 3V96A 1AE3A 2VXWA 2DN8A 2CH4W 1W3SA 4DN4M 3GTMB 2ES2A 3D6CA 4DAMA 3K7AB 3D4WA 3HKZB 5C44B 5JEAH 4DK3C 4GNXA 5H1SE 4NB3A 4C3JB 2RCNA 3WOEA 4ZCKA 2R92G 1KDCA 2JA7G 2K5NA 4HJ7A 1BQQT 3QB3A 3NXWA 3X3MA 4Q0FA 1UE7A 2FXQA 4KN4C 1Q7YC 4LF6Q 1LTID 4DV6Q 2KA7A 2IX3A 4A3LG 3JAMc 4P75A 4QQBX 4QB4A 4ZYSA 4JI0L 3J80c 1GM5A 4IJHA 2YYZA 1EQRA 2JQOA 3GV6A 1MIUA 1VMCA 2JP1A 1HNXL 2MNAA 5COYA 1X3EA 3BG3A 3K7UC 3KOJA 4WRDA 5E4WC 3J81j 2G9DA 4NXML 1I3QH 3J7AF 5I2XA 4DKAC 2R7ZH 1ZKOA 4N9PA 5C0XJ 4A3MG 2JSOA 4KD4A 2MGSA 2N55A 5CV7A 3RZOB 1YIJA 2JA6G 3JC66 4LJZC 4YWLA 3HOYG 3KBXA 3KBGA 1HH2P 4MIUA 4XT1B 4DV7L 1K73C 3NUCA 2N49A 2K75A 4DR3L 4A3DH 4C3HG 4KKSA 3EJIA 4JW0A 2F0JA 5CYUA 4DNRB 3NQTA 1X3GA 1PH6A 1G6PA 3K7AH 4UP7A 5C44H 4GKJQ 1DYQA 1V1QA 2MJ8A 3NPPA 4C3JH 3AFPA 1KAAA 4A3GB 4IUQA 1JB3A 2M00A 1XNQL 1F9PA 4IO9A 1HZ9A 1HZAA 4MN3A 1JB7A 4L5SA 3PF4A 1PRTC 2V1CC 3OTOL 1BUVT 2B2VA 3CC7A 5IT9E 2B2TA 1H95A 2E2HB 2F0MA 1HNXQ 1Q90A 1FGBD 2OCEA 4ZLTF 4X62L 3F8TA 1V1PB 2KUMA 2RBMA 1SE8A 2PPBC 1BNZA 1H9RA 1M4VA 1KD1C 2EYJA 2EY2A 1H9SA 2WV6D 2VW9A 1LT5D 2HIVA 1WTPA 3FP9A 4RG1A 1R9TB 2WFWA 3AQQA 1WD0A 4X65L 3GO5A 2B3GA 3D31A 1Y1VG 4DV7Q 1O80A 1CI3M 3GTGB 5M5WB 3PQIA 5EPKA 1Y1WG 1D1IA 4QUFA 5GADC 4LF5L 4UDUC 3DM1A 3IFDA 1L0XB 1Q1BA 5M3FB 4JPBW 4DV3L 3NSWA 1STHA 3CRKC 1PFMA 4K8IA 1BBUA 1SMYC 4JI7L 3U58A 1PRTD 1U4RA 1N9WA 1X54A 4JI1L 5IIFA 3G71A 1EQQA 4JI3Q 4OWTB 1GUGA 2JA9A 4DR7Q 3KF8B 3CCLA 1D5ZC 3U4ZA 1S4ZA 4GOPC 4TQUS 2YU9H 5FKAC 1J5EQ 4A3GH 3GTQB 2XGTA 3WOFA 3DMUA 1K8MA 2AQ2B 5EKLA 1QWYA 2F52A 1LM0A 1J9OA 3JAMi 2F0KA 2E2HH 2PZWA 1DXMA 5EBCA 3TN2A 2EPBA 1SR3A 5JEAJ 2V4DA 2YTXA 3S16H 4Y52H 3MTSA 2ASBA 4A3FH 4R9WA 2JA8H 3NWSA 4ME3A 1VF7A 3T1YL 4KKUA 1SMYD 3E6ZX 1E0BA 4DV0L 1WTHA 2XTIA 3C1FA 5HGTA 3GTGH 3CHBD 3TZDA 5GAGC 4TSSA 3SR1A 2L0CA 2UUAQ 2UUCQ 1EWHA 4DFAA 1N32Q 3V2TA 4JI7Q 1TWGB 2JA5B 3R2TA 3ND8A 4V0BA 1ASYA 1CFMA 1JCKB 3NBHB 3CF5A 3L9AX 2K04A 5IP7H 5KYIA 4OX9L 1I4HA 1UE6A 2RSOA 3EIVA 2L9HA 4BBSB 1Y14B 3UDIA 1K3RA 5HGQA 4X64Q 5IOCA 4BXXG 1F2YA 3SHLA 2YV5A 5FOBB 2ZTDA 3I72A 4K5XA 1KABA 5IT9c 3GP7A 3AFQA 4OO1G 1QILA 3LX0A 3HOVG 2EIFA 1CHPD 1EYCA 4LUVA 3ERSX 2NVYB 3R3OA 2RDFA 1IBMQ 3T1YQ 4QCLA 3X3NA 1VDZA 2QDLA 2QILA 1I94Q 2VB2X 4CBVA 1DM0B 1KDBA 5FO8B 2ZJPA 1GKHA 2NN6I 1RF2D 1VQJA 2D62A 1Q82C 3EROA 1SAPA 2Z6KA 4OWWB 1EU4A 2CHBD 4UY8C 3A56A 3OPOA 3M4PA 1DOMA 4PQXA 4YHHL 3R93A 2KBNA 1SJED 1X32A 3NELA 4DV2L 3K57A 2B2UA 2D9UA 2K05A 2B2WC 1WCMH 1YEZA 1EWCA 5IYCG 5JJKA 4BBSH 4K0KQ 3RD4A 1PHJA 4O42A 4BA1I 2CKZB 4HR7B 1A15A 4IN3A 2K4KA 4DUYL 5BR8Q 2F0VA 1JE4A 3FEWX 4X3SA 1JOQA 3UE1A 1IBLL 2F0PA 5ELFA 4CKEA 1HA5A 4FNFA 3G6JB 3E3XA 4G57A 2DNEA 3MA2B 4DR1L 1EIYB 2FINB 1TWHH 4J8QA 4A3IB 5IP9G 4X3KA 1YZ6A 2MPMA 4EX5A 4A3CG 2NVYH 1JJCB 3S1MH 2OXPA 4B08A 4DK1A 2EJMA 4OONA 3EQLC 3VDYA 1RL2A 1MJEA 2XRSD 4FO2A 2EJFC 1HNZQ 4DR6Q 4KY6A 3KF6B 4GKKL 4PV1C 3KDFA 1DJRD 3PO2G 4FXGC 4A4IA 1HQMC 1ENAA 4OELB 2PMZB 3I90A 2P5ZX 1TWAB 1YHBA 3M4YA 4DUZL 2IHEA 2FMMA 3PGZA 1W6KA 4HJ9A 2HDMA 4NW2A 2SNMA 4C3IG 3Q24A 2D5DA 3J7ZC 2F4IA 1E3PA 5GROA 2WAQE 4YCVA 1F2LA 3UDGA 1D2BA 1TS4A 1GHJA 1N8RC 1IBLQ 3HG9A 1STGA 1SYGA 4DR1Q 4A76A 1ICWA 2K5DA 2ZXOA 2YTYA 3CRLC 4YCUA 2IJ0A 4LW1A 4GZYC 3SK4A 4L5QA 3PUVA 2QW7A 2ZJQA 5FLMG 4A3IH 3K81C 1N36L 3FKIG 4X66Q 3KK7A 3TP8A 3CCSA 1SROA 1PVOA 3K0XA 4IUVA 2LXJA 3W1BA 2HHHQ 4ME5A 3F2UA 4P2CB 1FGUA 5G3LF 2XN9C 1PYSB 1DZ1A 4CJ0B 1ENFA 4GKKQ 3I4MB 5IGGA 1HR0L 4IZ8A 4DXGA 1RJTA 1PMRA 4NXNQ 1I4GA 1EFWA 3JAML 4HIKA 1LACA 2DUDA 2B2WA 4YY3Q 3J80L 2NZOA 3HZXA 2F3WA 4U68A 4HSVA 3W3AA 4RCNA 2B63B 3MXPA 1HZCA 1HQRD 4MNOA 4A3MH 2K32A 2C5CA 4A3JB 2WP8J 2KEDA 2UXCQ 1TS2A 4PG3A 2RCFA 1IYUA 4JI4Q 1NBWA 3GTKB 5DAUA 3RZDB 2A69C 2VUMB 4RKLA 2KCMA 1I5FA 2Q8RE 4K6LA 3KFUA 1H9MA 4XTCS 4IPHA 1B70B 4LF7L 2QDBA 1KC8C 3KUPA 4NPSA 1GUTA 1X9NA 1BCPF 2F0UA 4FVMA 2L12A 3PUYA 1ZXTA 1Y8OB 1E22A 4BBRB 1OXVA 4RA8A 1PZID 3A7AB 1CA6A 2EY1A 1A3VA 4F87A 3PV0A 3T1HQ 3I4MH 1FNWA 3EA6A 4GN5A 1SDFA 3CAMA 3UI2A 4AIMA 3KJPA 2Z0SA 3C2PA 1TU2B 2VQFQ 4RGMA 1L1OA 2Q2IA 4GLAC 4OEMB 1JICA 3CCJA 4A3KG 3GD7A 3T13A 1K9MC 2B63H 3J7YW 1CHQD 5LMNW 2A69D 2DY7A 1E2ZA 2OTJA 2NVXB 4HAEA 3TRZA 1JT8A 4QMGA 3H0GG 5TSSA 4PZ7A 3BU2A 3Q8DA 3JAME 3PF5A 4R4TA 1X6OA 4F88A 3S1RB 4UPAA 3J80E 3GTKH 2X6GA 3OWEB 2AHOB 2PW5A 3RZDH 5C3XA 1G51A 4BY7B 1XNRQ 4LF7Q 1P8LA 4OL7A 4OXPA 1EYGA 3CCEA 5GQOA 3A5UA 2QCPX 2MFIA 2WAQG 4OHJA 4JI5L 3D4DA 4JI2L 1Q1EA 1YHAA 2A74C 3KLWA 3HKSA 1TR5A 4R4IA 4DNIA 3GTPB 3FHWA 4KJNA 3ZYYX 1K28A 4DR4L 4DV4L 2DY8A 1AZQA 4B3RL 2D0OA 1K0RA 5C5LA 1GOZA 4LFBL 5E7NA 4V190 2I07B 4CDFC 2EXDA 2NYZD 5JJZA 3CMAA 5LMNQ 2ZXPA 2NN6H 1B7YB 4DV5L 3M4QA 1TY0A 4LF9Q 2F0HA 1PYWD 1XMQQ 3HOZG 3RLOA 1KHIA 2R6GA 4AYBE 2WIIB 1N33L 3SK6A 3SK5A 4M8AA 2E2DC 2KOLA 4IUTA 3DXJC 3U9SA 1TKWB 5BN3A 2I5MX 3G48A 3P75A 4BY7H 3BJUA 1U4MA 3MXNA 4F8MA 1MHWC 1QG7A 4ZAIA 3NTHA 1OXUA 3OSOA 1TVXA 4HSPA 1TWFB 1I3QB 1VQEA 2FFKB 2R7ZB 1PZJD 2UUBQ 4FP5D 4HCSA 2QGQA 5D3DA 1C7YA 4B3RQ 2O5IC 1Q12A 1W2BA 4A3BG 2XVSA 1UE5A 1QVFA 1VQNA 4L63B 5IYDG 3D0FA 3TREA 1B8AA 4HMIA 4A3DB 1ILPA 3NE5B 2X6LA 3HOVH 3ONAB 3CW2C 5IT9L 2F0LA 1U4PA 2ZTEA 1N33Q 5IYBG 1PTOF 5KEEA 1WYDA 4B3ML 2K50A 3I56A 2RKSA 2UXBL 4AH6A 1VQ8A 2YTVA 4DAYB 1CKNB 2GN5A 3BZCA 1N34Q 1O78A 2QEJC 1SYCA 4RH6A 3DLLA 3AEVA 2LXKA 3QO2A 3RN2A 1A63A 1YI2A 4YWKA 2E76C 1LTLA 4ILWA 5KNDA 3FPPA 3ITPA 5LHY1 2EYFA 5KYLA 2MHVA 2Z8LA 4DAPA 1PH2A 3M7GA 4EQOA 4LF8L 2F3IA 1TWFH 2NTTA 3K5NA 2MQHA 2F0DA 4AQYL 1IBKQ 3HOWH 2R93G 1LV9A 1E2VA 3LNNA 4JBWA 1U0LA 1LO5D 3T51B 5C4HA 3NQIA 1WVLA 2JK8A 2JEBI 1PDQA 5C4XG 4A3EG 1JMCA 4RAUC 5I6YA 5KNBA 1H9JA 1WTQA 1NMFA 1G6ZA 1MSGA 2EJGC 5EPJA 1AW7A 1YITA 4LFCL 2NBFA 1CM9A 3S14B 5I9OA 1VQKA 3PO3B 3BS1A 4B3MQ 2OF1A 2YU9B 2ID0A 1R4QB 1ML0D 5AJ3L 4BY1B 3MHBA 3TS2A 5C3EG 1S40A 1QNKA 5IGFA 4L6TB 1OXSC 3OMCA 4JI0Q 4DAVA 1M8AA 2ZM6L 2B2YA 1BCPB 3BYTB 3IKJA 4C1NK 1QJOA 3HFZB 1CKMA 4O0AA 4AYBG 4GNXB 2HT1A 2WACA 4B3TL 2WB1E 4YIJA 4C3IH 3S16B 1EEFD 4NXMQ 1XJVA 2XRQD 1EOVA 4OIKA 1STEA 3BZKA 4A3FB 2JA8B 3OOCA 1IL8A 1X65A 1A3UA 4R4OA 1HNWL 3GTOH 1VQLA 5J22A 2RDHA 3UDFA 1TWCB 4H0LC 1QUQA 2UXDL 4JV5L 2F4VL 1PYBA 3GTJH 2NZ1D 3BDOA 4DR3Q 3BVZA 2EYHA 1HRJA 1PZKD 2OTLA 3F2DA 1LTAD 4HN7A 4HCEA 2KJXA 3FKIH 1ICFB 3DWPA 3OYYA 3V05A 1MGSA 4MZ9A 3K5LA 1IL2A 4QIWB 2PQEA 5JPNC 1NR4A 2F3VA 3S14H 3PO3H 4WJ4A 2L55A 3CD6A 3E0EA 3I4NG 5AJ3Q 4OIJA 1NNXA 1XNQQ 4NMZA 4B9XA 2Q2TA 2HCIA 3J81E 4YCWA 3OTOQ 4P71A 3WWVA 4BY1H 2E8GA 4WFN3 4K14A 2ZM6Q 1W6JA 5JJLA 3N6RA 4GN3B 4X62Q 2DJFC 1ILQA 3A5ZB 3O13A 5IGBA 4DV1L 1B2TA 1VQ9A 5A35A 3J80i 1GVPA 2PNRC 1PH5A 2VL6A 2K5QA 1EY7A 1YNJC 5AFWA 1XMOL 4A93B 3E5SA 3PSIA 4BBRG 4X65Q 1EYDA 3CCQA 2F4VQ 2PI2E 3B6YA 3HKZE 5CR3A 4K8JA 5ISRA 1TWCH 4LF5Q 1XTCD 5KGUA 3KJOA 2WINB 1R4PB 4PZ6A 4XQQA 4DV3Q 4UP9A 1AN8A 3VYUA 1AH9A 4BWGB 3TS0A 1IKMA 1F9SA 4FF1A 3ND9A 1H9SB 2B29A 3ULPA 1UAPA 1RDPD 4JI1Q 1X56A 3HOXG 5CV5A 3BDCA 3IFTA 3AMUA 2AUJD 4ZUJA 1WCMB 3Q22A 1FD7D 1VQAA 2F1MA 3URYA 3RMHA 1T9HA 1GD7A 1YNJD 2DGYA 2OQKA 4DA2A 5CORA 2NZHA 3S9WA 4IFDG 1CUKA 4CDCC 5JJIA 1HA6A 1YBYA 4KHZA 2ALYB 2IX1A 1XWEA 2IX0A 1JE5A 5KRUA 3H3VI 1TWHB 2GVAA 3S17H 1Z6HA 5GAEC 2L4NA 4A93H 1K8OA 1C9OA 1CKOA 1PH3A 1HPCA 3ZJYC 5IGEA 3S1MB 1IXRA 3NWTA 3QR8A 3CQZB 2DJGC 3I2ZA 2WKCA 2JE6I 3K8AA 3MFYA 4DV0Q 3OW7A 1SJHD 3W5OA 1ENCA 3QG1A 3LWEA 2BCOA 2WB1G 3SGIA 2R3ZA 5A2QE 4DPGA 2F0TA 2QF7A 1PTOB 4RGOS 4C1NI 4HJAA 2Z4IA 1QE6A 1S72A 1LLRD 4X3TA 1SRUA 4GOPA 2A68C 3STBC 1CSPA 4Z9CB 3RUZA 1E1TA 4H02A 3M7NA 3TP5A 4OX9Q 1CK1A 2KCNA 1ZEQX 4XQNA 1E24A 1K8AC 4IURA 5M3MH 4C56C 4FF4A 2NVQB 1MI2A 1DOKA 4CJ2C 2FHTA 4GN4B 1WTRA 1GUNA 2Y0SB 2XSCA 5I4DA 1AP0A 5BN4A 3MVVA 3J81c 4UHVA 1F2MA 2K1BA 1DD2A 3F2BA 1B3AA 2JXMB 3H15A 3NTKA 2L1BA 3W1GA 2PZTA 2R92B 3FVQA 2JA7B 3ERQA 3W2DA 3DUZA 4QGUA 1BXTA 2Z4HA 4OO1I 2KCTA 4LUOA 3DHQA 3CQZH 5E4XA 1EU3A 2A68D 3FMCA 3STBD 3S15H 4NDXA 1B9NA 2K7VA 4LF4L 5ELNA 3PCOB 2N88A 4KY5A 1SSOA 2JJQA 2K33A 1Z47A 4EQ5A 3U50C 2R7DA 1EL0A 1PTOH 1UEBA 4YHHQ 4FXDA 4XDXA 3DWQA 4DV2Q 3M4OB 3I4OA 4ZK9B 4LFAL 3HOUH 2IL8A 3HKZG 5C4ZA 3MC0B 1JQYD 5C44G 3BVMA 5I2YA 4A3MB 3D6WA 1BR9A 2A6EC 2CQOA 4C3JG 4POFA 1TS3A 2JA6B 1EFID 5EPLA 1MBYA 1WTVA 2NVTB 3HOYB 1YJ9A 4A3BH 1I6VC 2IPKD 4DUYQ 3I3CA 5IGCA 5IYDH 2A6HC 2K28A 2NVQH 3WDNA 4HJ5A 1EQVA 1TIID 2HIXA 3A74A 1EY0A 1RTOA 3T56B 4JYAL 1VQIA 4IPDA 2KQ3A 1OTCA 5JOBA 4JOIC 1Q46A 3RLFA 4R8IA 2R92H 3I55A 3G7LA 2VQEL 2JA7H 4ZKBB 1STNA 2M9VA 3VR2A 1YHQA 1NAPA 3NHHA 3TSSA 5IY0A 1VQGA 4A3LH 3QWNA 4I7ZC 1MD2D 4UAIA 3VA7A 1HR0W 1C0AA 1VQMA 3ULLA 2A6ED 5DM63 2IHFA 2KENA 2O2LD 4LFAQ 1PXUA 1LYLA 2A6HD 1HTPA 3IL8A 1D7QA 4DUZQ 3M4OH 2L15A 2MO1A 1G8ZD 4XYQA 4IJLA 1Y1VB 2SNSA 2JA6H 2NVTH 3HOYH 1Y1WB 4A3GG 2R61A 3C46A 1RHPA 3A8JE 3KDFB 4EQNA 4A3EH 1D8LA 1BBXC 4C3HH 1S5ED 2N3SA 3J81i 3A8IE 4X6AH 1X3QA 4K5VA 3CPWA 2QA4A 1OXTA 5EJWA 1N36Q 1C48A 5J1ZA 1QB5D 2E74C 3CPFA 1NY4A 4IUNA 4LNQA 5JAVA 4A3FG 2AWOA 2JA8G 3P20A 3MXUA 5C3EH 3Q0AA 4DR2L 3TEHB 1LUZA 3VR5A 1HR0Q 1F2ZA 2L11A 1RODA 1JJ2A 2AQ3B 1EWIA 2PQAA 1HHVA 2CWPA 2I0QA 5CV4A 5BN5A 2Q8TA 5M3FG 4KV6A 2RA4A 3OW2A 1JORA 2GA4B 1M1KC 2KVMA 2CH4A 3HS0C 4F7XA 1S3OA 2M2LA 5E3FA 5IP7G 3F2CA 2HUGA 3MEHA 1Y1VH 4FDBA 4WJWA 4Q5VA 1Y1WH 2I5LX 1BF4A 1KLUD 2HDLA 4DXFA 4QJFA 1PH1A 4DU9A 3IRBA 5G3LD 1ESFA 4MTNA 3S2HB 4O2DA 4ZRZA 3AU7A 1S5CD 2G5DA 5IWAL 4KHVA 4CHTB 1I4PA 4KTAA 1E7ZA 1BCPC 3EFXD 2F0EA 1VQPA 4DR5L 3NK9A 2EVBA 4IPCA 4GNXC 5M5YH 4PMCA 3PUZA 2PMZE 3H3VH 5LL6S 3D3RA 3KYHC 1V1OA 5EBDA 1VQHA 1E2WA 1SYEA 3I8ZA 3I73A 4LUZA 2K5WA 5J3BA 2JYOA 3VR4A 3CCUA 1KL9A 4RHSA 3U4VA 4EVOA 4PZ8A 5D14A 3HOVB 2JA5G 2KEEA 3FPUB 3PMFA 3CKIB 3CC2A 2PI2A 3M3YB 1D6EC 1FJGL 1YNXA 4UP8A 4IQZA 5CV8A 1SLJA 5M5XB 2F0IA 4BBSG 3T4AC 1II3A 1VQBA 1XPOA 2RVLA 4IUUA 3DEPA 5K5PA 1KIXA 4P72A 3NP8A 1BCPD 1L1OB 5FJ8G 2J7ZA 2EY5A 2F0OA 1B3QA 4IOCA 3S2HH 3L0OA 3NTIA 5FO9B 4JI5Q 2EY6A 4JI2Q 1ESRA 3VYSA 1AE2A 2K01A 1K8GA 4DR5Q 1E1OA 4ODGA 4L5TA 3ULJA 1LTGD 5JVG3 2EXZA 2LY7A 4ALPA 4DR4Q 1G91A 3HOWB 5C4JB 4DV4Q 4BXXH 3RNUA 3N52A 3C3LA 4DV6L 3J7AV 3KLSA 2IW3A 2EDGA 4A75A 1S5BD 4LFBQ 3TBIB 1Y8NB 3CMEA 4OO1H 3NENA 1EQTA 4R4CA 2B2VC 3MXGA 2B2TC 2PYKA 4CDEC
chains in the Genus database with same CATH topology
2MO0A 4DUYL 5BR8Q 1FJGQ 4DV5Q 1PH7A 2KHJA 3CD6A 3E0EA 1Q81C 3I4NG 1KRSA 5AJ3Q 1XNQQ 1XNRL 3M3YH 3RR5A 4DK6C 3UE1A 2QEXA 1IBLL 2Q2TA 2IY5B 4YCWA 3OTOQ 4P71A 3WWVA 4BY1H 2E8GA 4DR1L 1EIYB 2Y0SE 2ZM6Q 5M5XH 1FVIA 1TWHH 4WJ3M 1YJWA 1O7IA 5JJLA 3LGJA 4GN3B 2D0PA 4X62Q 3CC4A 2ZJRA 3A5ZB 1L0WA 5IP9G 4DV1L 1YZ6A 1VQ9A 1X55A 1MKHA 1GVPA 3J80i 4EX5A 2NVYH 4A3CG 3CP0A 1IYJB 1PH5A 1JJCB 2VL6A 3S1MH 4IPGA 3ER0A 1I50H 4OONA 1XMOL 1A8VA 1ASZA 3PSIA 3VDYA 1RL2A 5FLXc 1FL0A 1MJEA 4DR6Q 1HNZQ 4HIMA 4BBRG 4JOIA 1U5KA 4X65Q 4A3IG 3KF6B 4GKKL 2R7FA 4GKJL 3CCQA 5IYCH 2F4VQ 2PI2E 3KDFA 1MJCA 3B6YA 3HKZE 3PO2G 1TWCH 4LF5Q 2AWNA 5LMNL 4A4IA 2A1AA 3KJOA 1PH8A 4B3SL 4PZ6A 2VZAA 1V9PA 4A3JH 4LF9L 4A93G 4DV3Q 4UP9A 3PUXA 5C4JH 1AH9A 3I4NH 1XMQL 3TS0A 2K14A 3NEMA 1YHBA 4DUZL 4HIDA 4DR2Q 2K52A 2IHEA 3PGZA 1VQFA 2B29A 4HJ9A 3ULPA 4JI1Q 4JCVE 1X56A 3HOXG 3MXNB 3J7ZC 1VQ7A 1E3PA 5GROA 2WAQE 4YCVA 1EIFA 5K36G 2VUMH 4XIGS 3UDGA 1QZHA 2A19A 2ZTCA 1GO3E 2K5HA 5IP9H 1QVGA 1JJGA 2KHIA 4LWCA 1N8RC 1IBLQ 2EQSA 1VQAA 1SMXA 3TQYA 3CXCA 4JBMA 4A3CH 2RHSB 1IZ6A 4DR1Q 3CCRA 1T9HA 4A76A 2HQLA 1GD7A 2DGYA 2JEAI 2OQKA 2YTYA 1KAWA 4KI0A 4LW1A 4YCUA 3L2PA 2UXBQ 4QY7A 4L5QA 2NZHA 3PUVA 5LMUL 4IFDG 2ZJQA 4BBRH 1CUKA 5JJIA 5FLMG 4A3IH 3K81C 1YBYA 2GVBA 3FKIG 4KHZA 1QVCA 2ALYB 3RLNA 4X66Q 3CCSA 1VQ4A 2IX1A 1SROA 1WCMG 2IX0A 1PVOA 3K0XA 1JE5A 5DLQE 2LXJA 3W1BA 2UUBL 3H3VI 2HHHQ 2GVAA 3PO2H 5M3MG 1FGUA 3S17H 5GAEC 1PYSB 2PQAB 3GTMH 4A93H 1CKNA 2E2JH 1C9OA 1CKOA 5ELOA 4KHPL 4GKKQ 1PH3A 4R4QA 3ZJYC 4JI3L 1HR0L 1IXRA 3I2ZA 4NXNQ 2BH2A 4DR7L 3HOXH 2CFMA 2JE6I 3K8AA 4LF8Q 3MEFA 4DV0Q 4BA2I 1EFWA 3W5OA 5IWAQ 2E2IH 4B3SQ 4HIKA 1BVSA 1VQ5A 2DUDA 4AQYQ 1J5EL 4YY3Q 2NZOA 2WB1G 1K83H 3SGIA 2Q2HA 4DPGA 2NVXH 1N36L 3PUWA 1YVCA 1HZCA 3I4MG 4HJAA 4MNOA 3S2DH 4A3MH 2OWOA 1S72A 4R1JA 4HJ8A 4GOPA 1SRUA 1KXLA 3STBC 3S1RH 4LF6L 1CSPA 1WOCA 2WP8J 1E1TA 4H02A 1N34L 3M7NA 2UXCQ 4OX9Q 5FLMH 1VQCA 4PG3A 4LFCQ 2AKWB 4JI4Q 1TXYA 1E24A 1NBWA 1K8AC 2B63G 5M3MH 1XPRA 1VS0A 1HJPA 4GLXA 1XTDA 3CCVA 2KCMA 3G4SA 5LMUQ 1I5FA 4A3JG 4GN4B 3HOUG 5IE8A 3KFUA 3RZOH 4XTCS 4IPHA 3J81c 1QZGA 2ATWA 4IFDJ 1B70B 1KQSA 4LF7L 3GTPH 4JBJA 1KC8C 1D7QA 3F2BA 5C0XG 4GS3A 4NPSA 3H15A 1L2FA 2VNUD 1YJNA 1IBKL 1X9NA 1WFQA 3GDEA 2UUAL 2RHQB 3PUYA 2UUCL 3W1GA 1E22A 1OXVA 4KHPQ 1N32L 2VUMG 2Z6KC 3A0JA 3CCMA 5HY6A 4Y7NH 1VQDA 1NE3A 2Y0SG 4QGUA 3PV0A 3T1HQ 4B3TQ 1X3FA 2LSSA 3F1ZA 3I4MH 1AE3A 4OO1I 3J7A5 2KCTA 4GN5A 4LUOA 1W3SA 3CAMA 4AIMA 3KJPA 3CQZH 2ES2A 2Z0SA 3AYHB 3STBD 4DAMA 3S15H 3S1QH 4LF4L 4DK3C 5ELNA 2VQFQ 3PCOB 1BKBA 4GNXA 4OWXB 5H1SE 1L1OA 2Q2IA 2BA0A 4GLAC 4JC0A 4NB3A 2RCNA 3DM3A 4X64L 2R92G 2UXDQ 3GTLH 2JA7G 4JV5Q 3CCJA 4A3KG 2JJQA 3GD7A 2K5NA 1Z47A 1WI5A 4EQ5A 3U50C 2R7DA 4HJ7A 1K9MC 2B63H 3HOZG 1UE7A 2FXQA 1UEBA 4P73A 1Q7YC 5LMNW 4LF6Q 4DV6Q 4YHHQ 3S1NH 4DV2Q 3I4OA 4LFAL 3HOUH 2OTJA 4A3LG 3EBEA 3TRZA 1JT8A 3HKZG 4P75A 3JAMc 4QQBX 5C44G 3H0GG 4JI0L 4PZ7A 3BU2A 3Q8DA 3J80c 2CQOA 4IJHA 3PF5A 1GM5A 4POFA 4R4TA 2YYZA 1X6OA 1DGSA 3K80C 1EQRA 2JQOA 4UPAA 1MIUA 2NN6G 1YJ9A 4DUYQ 1HNXL 2MNAA 1R9TH 3GTKH 2AHOB 3E9IA 3RZDH 1IBML 5IYDH 4KLKA 1X3EA 1G51A 3K7UC 3KOJA 2NVQH 1XNRQ 3J81j 4IOAA 4LF7Q 1P8LA 1QUQB 1I94L 4OXPA 1EYGA 4NXML 3CCEA 5GQOA 4HJ5A 5M5WH 1I3QH 3A5UA 2HIXA 3A74A 4DKAC 2MFIA 2R7ZH 2WAQG 5C0XJ 4JI5L 4A3MG 4JYAL 1VQIA 3M85A 4JI2L 4IPDA 1Q1EA 1YHAA 1YIJA 2JA6G 5M3FH 3JC66 4YWLA 3HOYG 3KLWA 3HKSA 4R4IA 4DNIA 1OTCA 4DV1Q 4JOIC 1Q46A 1HH2P 2OQ0A 4DV7L 3RLFA 3FHWA 3M9BA 1K73C 5C0XI 3I55A 2R92H 2VQEL 4JBKA 2JA7H 4A3KH 2N49A 4P74A 4BY7G 4DR4L 2K75A 4DV4L 4DR3L 4A3DH 1XMOQ 1YHQA 4B3RL 2D0OA 1K0RA 5IY0A 1X3GA 1VQGA 1PH6A 1G6PA 4A3LH 4LFBL 3K7AH 4UP7A 1UWVA 5E7NA 3GTQH 4K0KL 1HR0W 5C44H 4GKJQ 1C0AA 1VQMA 3H0GH 4RMFA 3ULLA 1V1QA 2EXDA 4C3JH 3AFPA 1A62A 3CMAA 5BR8L 5LMNQ 2IHFA 2KENA 1PH9A 1B7YB 4DV5L 3M4QA 4LFAQ 4LF9Q 1XNQL 1VQOA 4JI6L 1LYLA 1HZ9A 4IO9A 1HZAA 1XMQQ 2BH8A 3KF6A 1KHIA 2H5XA 3RLOA 1J6QA 1JB7A 4DUZQ 2R6GA 2V1CC 2L15A 4AYBE 3OTOL 4HIOA 1N33L 1NJIC 3M4OH 2IT1A 3CC7A 2MO1A 1H95A 1G291 1M90C 1HNXQ 4IJLA 2OCEA 4X62L 3F8TA 2JA6H 2NVTH 3HOYH 1SE8A 4A3GG 1VCIA 1KD1C 1P16A 5JEAG 1HNWQ 1RIPA 2I5HA 3KDFB 4APVA 1SN8A 2VW9A 2I5MX 1D8LA 2HIVA 3G48A 4A3EH 1XPUA 4BY7H 3S24A 2RF4A 3BJUA 4C3HH 2CCZA 3FP9A 4RG1A 4PMWA 2N3SA 3J81i 4DR6L 1OXUA 2WFWA 1A0IA 3AQQA 1HNZL 4X65L 4X6AH 3GO5A 2B3GA 3D31A 1Y1VG 3CPWA 2QA4A 4DV7Q 1I6HH 1OXTA 1N36Q 1TWGH 1Y1WG 1VQEA 2JA5H 4JG2A 5GADC 4LF5L 1Z9FA 1SFOH 3CPFA 2UUBQ 1NY4A 4LNQA 2QGQA 1C7YA 4B3RQ 1Q1BA 4DV3L 1Q12A 1W2BA 4A3BG 4A3FG 2AWOA 2JA8G 1PA6A 4IFDI 1UE5A 1QVFA 5C3EH 4DR2L 1VQNA 5IYDG 3TEHB 3HOZH 1BBUA 1LUZA 1B8AA 3D0FA 3TREA 4JI7L 1HR0Q 1Q86C 3U58A 4JI3Q 1X54A 1N9WA 4JI1L 1EQQA 1EWIA 4JI8L 3G71A 1JJ2A 4OWTB 2JA9A 4DR7Q 1PFSA 3KF8B 3CCLA 3HOVH 3U4ZA 2E5LL 2R7ZG 3G6EA 3HOWG 4GOPC 3CW2C 2PQAA 4TQUS 2CWPA 2I0QA 2YU9H 2K5VA 4J15A 4JI6Q 1J5EQ 5FJ8H 4QIWE 5M3FG 4A3GH 2XGTA 2ZTEA 3OW2A 1N33Q 5IYBG 1UE1A 1WYDA 1M1KC 2K50A 4B3ML 3I56A 2UXBL 2F52A 1S3OA 4A3DG 4AH6A 1VQ8A 1LM0A 2YTVA 3JAMi 4A3BH 5IP7G 3F2CA 4DAYB 2E2HH 1CKNB 2GN5A 3BZCA 1N34Q 4X66L 1Y1VH 3DLLA 3AEVA 2LXKA 1SR3A 4FDBA 5JEAJ 1Y1WH 3RN2A 1NMGA 1Q8KA 2YTXA 2HHHL 3S16H 4Y52H 2I5LX 4L5SA 1A63A 2BA1A 1YI2A 4L5RC 4YWKA 2ASBA 1LTLA 4QJFA 4A3FH 1PH1A 2JA8H 3IRBA 1PV4A 4ME3A 2UU9L 4MTNA 3T1YL 4NXNL 4O2DA 1EUJA 2VS1A 1PH2A 4LF8L 4DV0L 2XTIA 3UE0A 2F3IA 1TWFH 4GLVB 3GTGH 5IWAL 4GOPB 2MQHA 5GAGC 4AQYL 1IBKQ 3HOWH 4YY3L 1PH4A 2R93G 2UUAQ 2UUCQ 1E7ZA 4JBWA 3PIOA 1VQPA 1U0LA 1N32Q 4DR5L 4JI7Q 4IPCA 4GNXC 5M5YH 5IYBH 1L1OC 4JI8Q 4C2MH 2PMZE 2JK8A 2JEBI 3PUZA 1ASYA 3NBHB 3CF5A 4A3EG 3H3VH 3KYHC 5C4XG 1JMCA 2E5LQ 1NTGA 1VQHA 1HZBA 1NMFA 5IP7H 2UXCL 4LUZA 4OX9L 1UE6A 3EIVA 5J3BA 1YITA 1Y14B 4LF4Q 4LFCL 2N8NA 1K3RA 1KL9A 2VY3A 3UDIA 3CCUA 4JI4L 5HGQA 3U4VA 1VQKA 4X64Q 4PZ8A 4B3MQ 2JA5G 4BXXG 3CC2A 2PI2A 2YV5A 2ID0A 4TVAB 1FJGL 1YNXA 3E9HA 5AJ3L 2N78A 2ZTDA 5EAYA 4UP8A 5C3EG 1S40A 2A8VA 3TS2A 1OXXK 1V43A 1SLJA 5IT9c 1BBWA 4BBSG 1VQ6A 1OXSC 3AFQA 4JI0Q 4OO1G 1VQBA 2ZM6L 3PO3G 3PF4A 1XPOA 2PNHA 4POGA 3HOVG 2R93H 1KIXA 2EIFA 3HFZB 4LUVA 1CSQA 4P72A 3ERSX 2AMCB 2UU9Q 1IBMQ 3T1YQ 1CKMA 4O0AA 4AYBG 4GNXB 2HT1A 3ICEA 2C35B 1L1OB 2WB1E 3UDXA 5FJ8G 4B3TL 3T1HL 4C3IH 1I94Q 4BY1G 3PIPA 4NXMQ 1XJVA 5C4XH 4IOCA 2ZJPA 3S2HH 3RN5A 1EOVA 3L0OA 1GKHA 3BZKA 4JI5Q 2NN6I 4JYAQ 4JI2Q 1X65A 1VQJA 4R4OA 3I7FA 1AE2A 2D62A 2VQFL 1Q82C 2Z6KA 4YWMA 4DR5Q 1K8GA 1E1OA 3GTOH 4OWWB 1HNWL 1VQLA 1TWAH 3UDFA 2Q2UA 5GAHC 4UY8C 1QUQA 2UXDL 1KRTA 4L5TA 2F4VL 4JV5L 3ULJA 1PYBA 3M4PA 3GTJH 2VQEQ 4ALPA 4DR4Q 4DR3Q 4DV4Q 3PO3H 3RNUA 4BXXH 2OTLA 4QL5A 4YHHL 4DV6L 2KBNA 3NELA 4DV2L 3F2DA 2CWAA 4A75A 3FKIH 3OYYA 4LFBQ 1WCMH 1YEZA 5JJKA 5IYCG 4MZ9A 4BBSH 4K0KQ 1PHJA 3CMEA 3NENA 1IL2A 4R4CA 4BA1I 2CKZB 3L7ZC 3S14H 2K4KA 1WJJA 3EN2A 4WJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MO0 A;  4DUY L;  5BR8 Q;  1FJG Q;  4DV5 Q;  1PH7 A;  2KHJ A;  3CD6 A;  3E0E A;  1Q81 C;  3I4N G;  1KRS A;  5AJ3 Q;  1XNQ Q;  1XNR L;  3M3Y H;  3RR5 A;  4DK6 C;  3UE1 A;  2QEX A;  1IBL L;  2Q2T A;  2IY5 B;  4YCW A;  3OTO Q;  4P71 A;  3WWV A;  4BY1 H;  2E8G A;  4DR1 L;  1EIY B;  2Y0S E;  2ZM6 Q;  5M5X H;  1FVI A;  1TWH H;  4WJ3 M;  1YJW A;  1O7I A;  5JJL A;  3LGJ A;  4GN3 B;  2D0P A;  4X62 Q;  3CC4 A;  2ZJR A;  3A5Z B;  1L0W A;  5IP9 G;  4DV1 L;  1YZ6 A;  1VQ9 A;  1X55 A;  1MKH A;  1GVP A;  3J80 i;  4EX5 A;  2NVY H;  4A3C G;  3CP0 A;  1IYJ B;  1PH5 A;  1JJC B;  2VL6 A;  3S1M H;  4IPG A;  3ER0 A;  1I50 H;  4OON A;  1XMO L;  1A8V A;  1ASZ A;  3PSI A;  3VDY A;  1RL2 A;  5FLX c;  1FL0 A;  1MJE A;  4DR6 Q;  1HNZ Q;  4HIM A;  4BBR G;  4JOI A;  1U5K A;  4X65 Q;  4A3I G;  3KF6 B;  4GKK L;  2R7F A;  4GKJ L;  3CCQ A;  5IYC H;  2F4V Q;  2PI2 E;  3KDF A;  1MJC A;  3B6Y A;  3HKZ E;  3PO2 G;  1TWC H;  4LF5 Q;  2AWN A;  5LMN L;  4A4I A;  2A1A A;  3KJO A;  1PH8 A;  4B3S L;  4PZ6 A;  2VZA A;  1V9P A;  4A3J H;  4LF9 L;  4A93 G;  4DV3 Q;  4UP9 A;  3PUX A;  5C4J H;  1AH9 A;  3I4N H;  1XMQ L;  3TS0 A;  2K14 A;  3NEM A;  1YHB A;  4DUZ L;  4HID A;  4DR2 Q;  2K52 A;  2IHE A;  3PGZ A;  1VQF A;  2B29 A;  4HJ9 A;  3ULP A;  4JI1 Q;  4JCV E;  1X56 A;  3HOX G;  3MXN B;  3J7Z C;  1VQ7 A;  1E3P A;  5GRO A;  2WAQ E;  4YCV A;  1EIF A;  5K36 G;  2VUM H;  4XIG S;  3UDG A;  1QZH A;  2A19 A;  2ZTC A;  1GO3 E;  2K5H A;  5IP9 H;  1QVG A;  1JJG A;  2KHI A;  4LWC A;  1N8R C;  1IBL Q;  2EQS A;  1VQA A;  1SMX A;  3TQY A;  3CXC A;  4JBM A;  4A3C H;  2RHS B;  1IZ6 A;  4DR1 Q;  3CCR A;  1T9H A;  4A76 A;  2HQL A;  1GD7 A;  2DGY A;  2JEA I;  2OQK A;  2YTY A;  1KAW A;  4KI0 A;  4LW1 A;  4YCU A;  3L2P A;  2UXB Q;  4QY7 A;  4L5Q A;  2NZH A;  3PUV A;  5LMU L;  4IFD G;  2ZJQ A;  4BBR H;  1CUK A;  5JJI A;  5FLM G;  4A3I H;  3K81 C;  1YBY A;  2GVB A;  3FKI G;  4KHZ A;  1QVC A;  2ALY B;  3RLN A;  4X66 Q;  3CCS A;  1VQ4 A;  2IX1 A;  1SRO A;  1WCM G;  2IX0 A;  1PVO A;  3K0X A;  1JE5 A;  5DLQ E;  2LXJ A;  3W1B A;  2UUB L;  3H3V I;  2HHH Q;  2GVA A;  3PO2 H;  5M3M G;  1FGU A;  3S17 H;  5GAE C;  1PYS B;  2PQA B;  3GTM H;  4A93 H;  1CKN A;  2E2J H;  1C9O A;  1CKO A;  5ELO A;  4KHP L;  4GKK Q;  1PH3 A;  4R4Q A;  3ZJY C;  4JI3 L;  1HR0 L;  1IXR A;  3I2Z A;  4NXN Q;  2BH2 A;  4DR7 L;  3HOX H;  2CFM A;  2JE6 I;  3K8A A;  4LF8 Q;  3MEF A;  4DV0 Q;  4BA2 I;  1EFW A;  3W5O A;  5IWA Q;  2E2I H;  4B3S Q;  4HIK A;  1BVS A;  1VQ5 A;  2DUD A;  4AQY Q;  1J5E L;  4YY3 Q;  2NZO A;  2WB1 G;  1K83 H;  3SGI A;  2Q2H A;  4DPG A;  2NVX H;  1N36 L;  3PUW A;  1YVC A;  1HZC A;  3I4M G;  4HJA A;  4MNO A;  3S2D H;  4A3M H;  2OWO A;  1S72 A;  4R1J A;  4HJ8 A;  4GOP A;  1SRU A;  1KXL A;  3STB C;  3S1R H;  4LF6 L;  1CSP A;  1WOC A;  2WP8 J;  1E1T A;  4H02 A;  1N34 L;  3M7N A;  2UXC Q;  4OX9 Q;  5FLM H;  1VQC A;  4PG3 A;  4LFC Q;  2AKW B;  4JI4 Q;  1TXY A;  1E24 A;  1NBW A;  1K8A C;  2B63 G;  5M3M H;  1XPR A;  1VS0 A;  1HJP A;  4GLX A;  1XTD A;  3CCV A;  2KCM A;  3G4S A;  5LMU Q;  1I5F A;  4A3J G;  4GN4 B;  3HOU G;  5IE8 A;  3KFU A;  3RZO H;  4XTC S;  4IPH A;  3J81 c;  1QZG A;  2ATW A;  4IFD J;  1B70 B;  1KQS A;  4LF7 L;  3GTP H;  4JBJ A;  1KC8 C;  1D7Q A;  3F2B A;  5C0X G;  4GS3 A;  4NPS A;  3H15 A;  1L2F A;  2VNU D;  1YJN A;  1IBK L;  1X9N A;  1WFQ A;  3GDE A;  2UUA L;  2RHQ B;  3PUY A;  2UUC L;  3W1G A;  1E22 A;  1OXV A;  4KHP Q;  1N32 L;  2VUM G;  2Z6K C;  3A0J A;  3CCM A;  5HY6 A;  4Y7N H;  1VQD A;  1NE3 A;  2Y0S G;  4QGU A;  3PV0 A;  3T1H Q;  4B3T Q;  1X3F A;  2LSS A;  3F1Z A;  3I4M H;  1AE3 A;  4OO1 I;  3J7A 5;  2KCT A;  4GN5 A;  4LUO A;  1W3S A;  3CAM A;  4AIM A;  3KJP A;  3CQZ H;  2ES2 A;  2Z0S A;  3AYH B;  3STB D;  4DAM A;  3S15 H;  3S1Q H;  4LF4 L;  4DK3 C;  5ELN A;  2VQF Q;  3PCO B;  1BKB A;  4GNX A;  4OWX B;  5H1S E;  1L1O A;  2Q2I A;  2BA0 A;  4GLA C;  4JC0 A;  4NB3 A;  2RCN A;  3DM3 A;  4X64 L;  2R92 G;  2UXD Q;  3GTL H;  2JA7 G;  4JV5 Q;  3CCJ A;  4A3K G;  2JJQ A;  3GD7 A;  2K5N A;  1Z47 A;  1WI5 A;  4EQ5 A;  3U50 C;  2R7D A;  4HJ7 A;  1K9M C;  2B63 H;  3HOZ G;  1UE7 A;  2FXQ A;  1UEB A;  4P73 A;  1Q7Y C;  5LMN W;  4LF6 Q;  4DV6 Q;  4YHH Q;  3S1N H;  4DV2 Q;  3I4O A;  4LFA L;  3HOU H;  2OTJ A;  4A3L G;  3EBE A;  3TRZ A;  1JT8 A;  3HKZ G;  4P75 A;  3JAM c;  4QQB X;  5C44 G;  3H0G G;  4JI0 L;  4PZ7 A;  3BU2 A;  3Q8D A;  3J80 c;  2CQO A;  4IJH A;  3PF5 A;  1GM5 A;  4POF A;  4R4T A;  2YYZ A;  1X6O A;  1DGS A;  3K80 C;  1EQR A;  2JQO A;  4UPA A;  1MIU A;  2NN6 G;  1YJ9 A;  4DUY Q;  1HNX L;  2MNA A;  1R9T H;  3GTK H;  2AHO B;  3E9I A;  3RZD H;  1IBM L;  5IYD H;  4KLK A;  1X3E A;  1G51 A;  3K7U C;  3KOJ A;  2NVQ H;  1XNR Q;  3J81 j;  4IOA A;  4LF7 Q;  1P8L A;  1QUQ B;  1I94 L;  4OXP A;  1EYG A;  4NXM L;  3CCE A;  5GQO A;  4HJ5 A;  5M5W H;  1I3Q H;  3A5U A;  2HIX A;  3A74 A;  4DKA C;  2MFI A;  2R7Z H;  2WAQ G;  5C0X J;  4JI5 L;  4A3M G;  4JYA L;  1VQI A;  3M85 A;  4JI2 L;  4IPD A;  1Q1E A;  1YHA A;  1YIJ A;  2JA6 G;  5M3F H;  3JC6 6;  4YWL A;  3HOY G;  3KLW A;  3HKS A;  4R4I A;  4DNI A;  1OTC A;  4DV1 Q;  4JOI C;  1Q46 A;  1HH2 P;  2OQ0 A;  4DV7 L;  3RLF A;  3FHW A;  3M9B A;  1K73 C;  5C0X I;  3I55 A;  2R92 H;  2VQE L;  4JBK A;  2JA7 H;  4A3K H;  2N49 A;  4P74 A;  4BY7 G;  4DR4 L;  2K75 A;  4DV4 L;  4DR3 L;  4A3D H;  1XMO Q;  1YHQ A;  4B3R L;  2D0O A;  1K0R A;  5IY0 A;  1X3G A;  1VQG A;  1PH6 A;  1G6P A;  4A3L H;  4LFB L;  3K7A H;  4UP7 A;  1UWV A;  5E7N A;  3GTQ H;  4K0K L;  1HR0 W;  5C44 H;  4GKJ Q;  1C0A A;  1VQM A;  3H0G H;  4RMF A;  3ULL A;  1V1Q A;  2EXD A;  4C3J H;  3AFP A;  1A62 A;  3CMA A;  5BR8 L;  5LMN Q;  2IHF A;  2KEN A;  1PH9 A;  1B7Y B;  4DV5 L;  3M4Q A;  4LFA Q;  4LF9 Q;  1XNQ L;  1VQO A;  4JI6 L;  1LYL A;  1HZ9 A;  4IO9 A;  1HZA A;  1XMQ Q;  2BH8 A;  3KF6 A;  1KHI A;  2H5X A;  3RLO A;  1J6Q A;  1JB7 A;  4DUZ Q;  2R6G A;  2V1C C;  2L15 A;  4AYB E;  3OTO L;  4HIO A;  1N33 L;  1NJI C;  3M4O H;  2IT1 A;  3CC7 A;  2MO1 A;  1H95 A;  1G29 1;  1M90 C;  1HNX Q;  4IJL A;  2OCE A;  4X62 L;  3F8T A;  2JA6 H;  2NVT H;  3HOY H;  1SE8 A;  4A3G G;  1VCI A;  1KD1 C;  1P16 A;  5JEA G;  1HNW Q;  1RIP A;  2I5H A;  3KDF B;  4APV A;  1SN8 A;  2VW9 A;  2I5M X;  1D8L A;  2HIV A;  3G48 A;  4A3E H;  1XPU A;  4BY7 H;  3S24 A;  2RF4 A;  3BJU A;  4C3H H;  2CCZ A;  3FP9 A;  4RG1 A;  4PMW A;  2N3S A;  3J81 i;  4DR6 L;  1OXU A;  2WFW A;  1A0I A;  3AQQ A;  1HNZ L;  4X65 L;  4X6A H;  3GO5 A;  2B3G A;  3D31 A;  1Y1V G;  3CPW A;  2QA4 A;  4DV7 Q;  1I6H H;  1OXT A;  1N36 Q;  1TWG H;  1Y1W G;  1VQE A;  2JA5 H;  4JG2 A;  5GAD C;  4LF5 L;  1Z9F A;  1SFO H;  3CPF A;  2UUB Q;  1NY4 A;  4LNQ A;  2QGQ A;  1C7Y A;  4B3R Q;  1Q1B A;  4DV3 L;  1Q12 A;  1W2B A;  4A3B G;  4A3F G;  2AWO A;  2JA8 G;  1PA6 A;  4IFD I;  1UE5 A;  1QVF A;  5C3E H;  4DR2 L;  1VQN A;  5IYD G;  3TEH B;  3HOZ H;  1BBU A;  1LUZ A;  1B8A A;  3D0F A;  3TRE A;  4JI7 L;  1HR0 Q;  1Q86 C;  3U58 A;  4JI3 Q;  1X54 A;  1N9W A;  4JI1 L;  1EQQ A;  1EWI A;  4JI8 L;  3G71 A;  1JJ2 A;  4OWT B;  2JA9 A;  4DR7 Q;  1PFS A;  3KF8 B;  3CCL A;  3HOV H;  3U4Z A;  2E5L L;  2R7Z G;  3G6E A;  3HOW G;  4GOP C;  3CW2 C;  2PQA A;  4TQU S;  2CWP A;  2I0Q A;  2YU9 H;  2K5V A;  4J15 A;  4JI6 Q;  1J5E Q;  5FJ8 H;  4QIW E;  5M3F G;  4A3G H;  2XGT A;  2ZTE A;  3OW2 A;  1N33 Q;  5IYB G;  1UE1 A;  1WYD A;  1M1K C;  2K50 A;  4B3M L;  3I56 A;  2UXB L;  2F52 A;  1S3O A;  4A3D G;  4AH6 A;  1VQ8 A;  1LM0 A;  2YTV A;  3JAM i;  4A3B H;  5IP7 G;  3F2C A;  4DAY B;  2E2H H;  1CKN B;  2GN5 A;  3BZC A;  1N34 Q;  4X66 L;  1Y1V H;  3DLL A;  3AEV A;  2LXK A;  1SR3 A;  4FDB A;  5JEA J;  1Y1W H;  3RN2 A;  1NMG A;  1Q8K A;  2YTX A;  2HHH L;  3S16 H;  4Y52 H;  2I5L X;  4L5S A;  1A63 A;  2BA1 A;  1YI2 A;  4L5R C;  4YWK A;  2ASB A;  1LTL A;  4QJF A;  4A3F H;  1PH1 A;  2JA8 H;  3IRB A;  1PV4 A;  4ME3 A;  2UU9 L;  4MTN A;  3T1Y L;  4NXN L;  4O2D A;  1EUJ A;  2VS1 A;  1PH2 A;  4LF8 L;  4DV0 L;  2XTI A;  3UE0 A;  2F3I A;  1TWF H;  4GLV B;  3GTG H;  5IWA L;  4GOP B;  2MQH A;  5GAG C;  4AQY L;  1IBK Q;  3HOW H;  4YY3 L;  1PH4 A;  2R93 G;  2UUA Q;  2UUC Q;  1E7Z A;  4JBW A;  3PIO A;  1VQP A;  1U0L A;  1N32 Q;  4DR5 L;  4JI7 Q;  4IPC A;  4GNX C;  5M5Y H;  5IYB H;  1L1O C;  4JI8 Q;  4C2M H;  2PMZ E;  2JK8 A;  2JEB I;  3PUZ A;  1ASY A;  3NBH B;  3CF5 A;  4A3E G;  3H3V H;  3KYH C;  5C4X G;  1JMC A;  2E5L Q;  1NTG A;  1VQH A;  1HZB A;  1NMF A;  5IP7 H;  2UXC L;  4LUZ A;  4OX9 L;  1UE6 A;  3EIV A;  5J3B A;  1YIT A;  1Y14 B;  4LF4 Q;  4LFC L;  2N8N A;  1K3R A;  1KL9 A;  2VY3 A;  3UDI A;  3CCU A;  4JI4 L;  5HGQ A;  3U4V A;  1VQK A;  4X64 Q;  4PZ8 A;  4B3M Q;  2JA5 G;  4BXX G;  3CC2 A;  2PI2 A;  2YV5 A;  2ID0 A;  4TVA B;  1FJG L;  1YNX A;  3E9H A;  5AJ3 L;  2N78 A;  2ZTD A;  5EAY A;  4UP8 A;  5C3E G;  1S40 A;  2A8V A;  3TS2 A;  1OXX K;  1V43 A;  1SLJ A;  5IT9 c;  1BBW A;  4BBS G;  1VQ6 A;  1OXS C;  3AFQ A;  4JI0 Q;  4OO1 G;  1VQB A;  2ZM6 L;  3PO3 G;  3PF4 A;  1XPO A;  2PNH A;  4POG A;  3HOV G;  2R93 H;  1KIX A;  2EIF A;  3HFZ B;  4LUV A;  1CSQ A;  4P72 A;  3ERS X;  2AMC B;  2UU9 Q;  1IBM Q;  3T1Y Q;  1CKM A;  4O0A A;  4AYB G;  4GNX B;  2HT1 A;  3ICE A;  2C35 B;  1L1O B;  2WB1 E;  3UDX A;  5FJ8 G;  4B3T L;  3T1H L;  4C3I H;  1I94 Q;  4BY1 G;  3PIP A;  4NXM Q;  1XJV A;  5C4X H;  4IOC A;  2ZJP A;  3S2H H;  3RN5 A;  1EOV A;  3L0O A;  1GKH A;  3BZK A;  4JI5 Q;  2NN6 I;  4JYA Q;  4JI2 Q;  1X65 A;  1VQJ A;  4R4O A;  3I7F A;  1AE2 A;  2D62 A;  2VQF L;  1Q82 C;  2Z6K A;  4YWM A;  4DR5 Q;  1K8G A;  1E1O A;  3GTO H;  4OWW B;  1HNW L;  1VQL A;  1TWA H;  3UDF A;  2Q2U A;  5GAH C;  4UY8 C;  1QUQ A;  2UXD L;  1KRT A;  4L5T A;  2F4V L;  4JV5 L;  3ULJ A;  1PYB A;  3M4P A;  3GTJ H;  2VQE Q;  4ALP A;  4DR4 Q;  4DR3 Q;  4DV4 Q;  3PO3 H;  3RNU A;  4BXX H;  2OTL A;  4QL5 A;  4YHH L;  4DV6 L;  2KBN A;  3NEL A;  4DV2 L;  3F2D A;  2CWA A;  4A75 A;  3FKI H;  3OYY A;  4LFB Q;  1WCM H;  1YEZ A;  5JJK A;  5IYC G;  4MZ9 A;  4BBS H;  4K0K Q;  1PHJ A;  3CME A;  3NEN A;  1IL2 A;  4R4C A;  4BA1 I;  2CKZ B;  3L7Z C;  3S14 H;  2K4K A;  1WJJ A;  3EN2 A;  4WJ4 A; 
#chains in the Genus database with same CATH topology
 1HTL D;  3R8B A;  1FJG Q;  3A54 A;  1O7Z A;  4DV5 Q;  1PH7 A;  1Q81 C;  1KRS A;  1LTB D;  4OGQ C;  3M3Y H;  1F9Q A;  1STY A;  2F0N A;  2TSS A;  4KD3 A;  2ICI A;  4ZKC B;  1SE4 A;  5M5X H;  1FVI A;  4WJ3 M;  1O7I A;  3PIO 3;  3LGJ A;  3K6O A;  3CC4 A;  5I6W A;  2ZJR A;  3T16 A;  3TP6 A;  2ZXR A;  1MKH A;  3T53 B;  3CP0 A;  1RCV D;  3SK8 A;  4IPG A;  5M9O A;  2EYO A;  1ASZ A;  3P7J A;  2E2J B;  4N9T A;  5FLX c;  2F0W A;  1V1P A;  3TME A;  1BDO A;  2BDO A;  2OEO A;  2Q8I B;  1U5K A;  4A3I G;  1TS5 A;  4C3I B;  2R7F A;  4GKJ L;  4K2L A;  5IYC H;  2ICE C;  1PFB A;  3CU7 A;  1JR0 D;  1A2U A;  4CGY B;  3I70 A;  1Y69 U;  5EKI A;  4G7Z C;  3GTO B;  5C4J H;  4ZUI A;  1PRT F;  1KDA A;  4HID A;  3S2D B;  1HUN A;  1VQF A;  2LMC B;  3GTJ B;  3K58 A;  3MXN B;  1HCZ A;  3J81 L;  3L3O C;  1EIF A;  5K36 G;  3FKI B;  1QZH A;  1UEA B;  3Q6S A;  4MHE A;  2ZTC A;  5IP9 H;  1JJG A;  4LWC A;  2LKV A;  3TQY A;  4A3C H;  3PIP 3;  1SYD A;  2NUC A;  2XWJ B;  3DWA A;  4H44 C;  1PTO C;  3KF8 A;  2VB3 X;  1UUP A;  2JEA I;  4RCO A;  3C1E A;  4KJO A;  5KNC A;  3L2P A;  2UXB Q;  1C8C A;  1SNO A;  1FNV A;  5LMU L;  3QIA A;  1O7L A;  4FYD A;  5FO7 B;  4RFB A;  2GVB A;  1QVC A;  1IHZ A;  5CMD A;  5DLQ E;  1LAB A;  3PO2 H;  2EE1 A;  3TP7 A;  4QF4 A;  3GTM H;  3A55 A;  2E2J H;  5ELO A;  3MWY W;  1XXG A;  4JI3 L;  1F9R A;  4NP5 A;  3OWF A;  2BH2 A;  4DR7 L;  2F0S A;  4LF8 Q;  3MEF A;  4BA2 I;  3S1Q B;  1LT3 D;  3VYR A;  1BVS A;  4AQY Q;  1B1Z A;  4G7H C;  2Z9H A;  3OIQ A;  1J5E L;  4PNY A;  3GTL B;  5DM7 3;  2B8G A;  2Q2H A;  3FRP B;  1YVC A;  3MZ5 A;  1B4O A;  2H4O A;  3A8K E;  3I4M G;  2PZU A;  3S2D H;  2OWO A;  2KHS A;  3S1N B;  1PTO D;  5CBA E;  1JWM D;  3E0J A;  3TDQ A;  4K5W A;  1WOC A;  4TRD A;  1HFN A;  4MTK A;  4U67 3;  5FLM H;  1VQC A;  4LFC Q;  2AKW B;  5DEH A;  3GQB A;  3HGB A;  3NBH A;  3KLS X;  2B63 G;  1EIH A;  1XPR A;  1GHK A;  1HJP A;  1XTD A;  1ZYR C;  3CCV A;  3G4S A;  5LMU Q;  4LK1 C;  4A3J G;  5CV6 A;  2C9O A;  3RZO H;  4IFD J;  1QZG A;  2ATW A;  1O7Y A;  3K0Y A;  4JBJ A;  5C0X G;  4GS3 A;  1RKN A;  4XQJ A;  2VNU D;  2HQE A;  1YJN A;  1Q8I A;  1WFQ A;  1UNS A;  2UUA L;  2RHQ B;  2UUC L;  5IOD A;  4KK7 A;  3H91 A;  1N32 L;  5ELC A;  1DOL A;  2KCC A;  4WOR A;  1OO9 B;  2J4X A;  2LS0 1;  4IUP A;  1GXD C;  4A3K B;  2Z6K C;  2VUM G;  4EGV A;  3CCM A;  5EGT A;  4B3T Q;  1VQD A;  1NE3 A;  2Z1C A;  1X3F A;  2LSS A;  3F1Z A;  5A2Q L;  3J7A 5;  3S17 B;  5KIX A;  4JVZ A;  3QOJ A;  3AYH B;  3S1Q H;  1VF5 C;  2B39 A;  1BOS A;  3H0G B;  1SEB D;  1HNW Q;  1BKB A;  4OWX B;  4JC0 A;  2BA0 A;  1EEI D;  2B2U C;  3DM3 A;  4X64 L;  2K6A A;  4FXK C;  3GTL H;  4JV5 Q;  2UXD Q;  5NUC A;  3SVM A;  1WI5 A;  4NKL A;  2EZV A;  3OHX C;  4O1N A;  4P73 A;  1C4Q A;  1T5X D;  5HUR A;  1ZYR D;  3S1N H;  5IGD A;  4I65 A;  3EBE A;  2AQ1 B;  2L5T A;  2WAQ B;  1ET9 A;  1LT4 D;  3P1H A;  1DGS A;  3K80 C;  1HFG A;  2NN6 G;  3VYT A;  1U9R A;  1R9T H;  3EVQ A;  3E9I A;  3SEB A;  1IBM L;  1IYV A;  4KLK A;  4IOA A;  2X69 A;  1QUQ B;  1I94 L;  5C6A A;  1MSH A;  5M5W H;  1TT2 A;  5M3M B;  2TMP A;  1IW7 C;  3D8G A;  4RGN A;  3M85 A;  1K0S A;  3HRZ C;  3TZU A;  2MUY A;  1XYI A;  1I6H B;  1EY8 A;  5EKK A;  5M3F H;  1XX8 A;  4DGZ A;  4DV1 Q;  2OQ0 A;  1SFO B;  1SYB A;  4B9W A;  2NB0 A;  3M9B A;  5C0X I;  4JBK A;  4A3K H;  4BY7 G;  4P74 A;  3A7L A;  3OIP A;  1WTO A;  1XMO Q;  1B9M A;  4K2K A;  3HOZ B;  1CT1 D;  1YNN C;  4KY7 A;  1NSN S;  4KKT A;  1UWV A;  2EYL A;  3GTQ H;  4K0K L;  3H0G H;  4RMF A;  2XNA C;  4DNT B;  1A62 A;  2BOS A;  3S15 B;  5BR8 L;  1BO0 A;  1PH9 A;  2I46 A;  2QKI C;  2O4X A;  2WKD A;  1VQO A;  1EZ8 A;  4JI6 L;  2BH8 A;  3KF6 A;  2H5X A;  1J6Q A;  1CQF A;  1KTK A;  3DEO A;  3H3V C;  4HIO A;  1F77 A;  4ID6 A;  1NJI C;  2IT1 A;  1FR3 A;  1GUS A;  1G29 1;  1B44 D;  1IW7 D;  1M90 C;  4ULL A;  3AB9 A;  2D2C C;  4R8N A;  3HOU B;  2F03 A;  1VCI A;  1P16 A;  5JEA G;  2PO4 A;  1RIP A;  2I5H A;  2A73 B;  4APV A;  1XPU A;  1SN8 A;  1U4L A;  3S24 A;  2RF4 A;  4A3B B;  2CCZ A;  1KLG D;  4PMW A;  4DR6 L;  1HNZ L;  1A0I A;  3BYY B;  1YNN D;  2EOT A;  3SDZ A;  1I6H H;  1V8Q A;  1TWG H;  2JA5 H;  4JG2 A;  1Z9F A;  1JC7 A;  1SFO H;  1GUW A;  2B8F A;  4ABN A;  4G4K A;  5LL6 X;  1PA6 A;  1ET6 A;  4C2M B;  4IFD I;  1PRT B;  4L8J A;  3HOZ H;  5DNF A;  1Q86 C;  1GJX A;  1GUO A;  4JI8 L;  5CV9 A;  1PFS A;  1QOH A;  2E5L L;  2R7Z G;  4S3S A;  3G6E A;  3HOW G;  2HCC A;  2FJ2 A;  2K5V A;  4J15 A;  4JI6 Q;  5FJ8 H;  3LWU A;  4QIW E;  2PCF B;  3VR3 A;  2XWB B;  5T1G A;  3Q23 A;  4HTH A;  5J39 A;  1UE1 A;  2F0G A;  4A3D G;  2NWG A;  2ENB A;  1EY5 A;  3MFG A;  4X66 L;  3KLR A;  4LAA A;  4K6D A;  2CQA A;  3QJY A;  2F0Q A;  4LMQ D;  1WTW A;  1B50 A;  2HHH L;  1NMG A;  1Q8K A;  2R93 B;  1H9K A;  5C3W A;  2BA1 A;  4L5R C;  1ONL A;  5F2D A;  1I4R A;  4DK0 A;  2O5J C;  5JVH 3;  1SNQ A;  1PV4 A;  5E1F A;  2UU9 L;  3GV3 A;  5C4X B;  4A3E B;  5ELD A;  3FDT A;  4NXN L;  1EUJ A;  1L0Y B;  2VS1 A;  1JWU D;  5ELB A;  4C3H B;  3UE0 A;  4GLV B;  2SDF A;  4GOP B;  5JPM C;  4YY3 L;  1PH4 A;  3PIO A;  4EQP A;  2EYM A;  5IYB H;  1L1O C;  4JK1 C;  4JI8 Q;  4C2M H;  5ELE A;  1Y8P B;  2E5L Q;  4E6I A;  1NTG A;  1HZB A;  1KNE A;  2DNC A;  5C3E B;  2UXC L;  4CJ1 B;  4KN7 C;  4LF4 Q;  2N8N A;  2VY3 A;  4JI4 L;  4RHR A;  1LT6 D;  1I4X A;  1LTT D;  2A5H A;  3I91 A;  4TVA B;  4AYB B;  3E9H A;  1NUC A;  2Z6B A;  2N78 A;  5EAY A;  2BE5 C;  2A8V A;  1OXX K;  1V43 A;  3OMG A;  4RGT A;  1HXY D;  1BBW A;  5CBE E;  5CGK A;  5FLX L;  3HP3 A;  1IKL A;  1B53 A;  3BDL A;  3PO3 G;  1SE3 A;  2PNH A;  4POG A;  2R93 H;  1CSQ A;  1TQO A;  5CC4 A;  2AMC B;  2UU9 Q;  4BS9 A;  3ICE A;  1D5X C;  2C35 B;  3UDX A;  1I50 B;  4PMB A;  3T1H L;  1STB A;  3K5O A;  4BY1 G;  4HMJ A;  3PIP A;  4HED A;  5C4X H;  3RN5 A;  2RSN A;  4J1M A;  5K36 H;  1HUM A;  4JYA Q;  3I7F A;  3BVG A;  2VQF L;  2G9H D;  1STA A;  4YWM A;  1TWA H;  2Q2U A;  5GAH C;  2KEC A;  1KRT A;  2VQE Q;  3NBI A;  3I4N B;  4QL5 A;  4CKC A;  2CWA A;  1X3P A;  1NCV A;  2OT2 A;  1NR2 A;  5M5Y B;  1DON A;  2BE5 D;  2HD3 A;  1D1K A;  4KMU C;  1A2T A;  3L7Z C;  1VQ6 A;  1WJJ A;  3EN2 A;  2MO0 A;  1SXT A;  1EY6 A;  2KHJ A;  1A6X A;  1EY4 A;  1XNR L;  2E75 C;  5EQ0 A;  3RR5 A;  4J6H A;  4DK6 C;  2QEX A;  1SYF A;  2CVR A;  2IY5 B;  3IAY A;  2ZT9 C;  1G2S A;  2Y0S E;  3QOL A;  1S5D D;  1CZW A;  1YJW A;  2D0P A;  4H7B A;  1WTX A;  1L0W A;  2BDN A;  4XXE A;  1X55 A;  2F0F A;  1IYJ B;  2JN4 A;  1QNU A;  1TY2 A;  3ER0 A;  1I50 H;  1A8V A;  4FF2 A;  1CA5 A;  1FL0 A;  3K5M A;  4CDD C;  4HIM A;  2SOB A;  1CZG A;  4JOI A;  3H94 A;  5FLX E;  3HOX B;  3SE0 A;  5T1I A;  2E2I B;  1MJC A;  1LTS D;  2NTS A;  4ZQ3 A;  3R2I A;  1Z7T A;  3BZD B;  4RKB A;  2AWN A;  5LMN L;  2IWH A;  1CTM A;  3U9O A;  2A1A A;  1PH8 A;  4B3S L;  1K83 B;  2VZA A;  1V9P A;  4IAL A;  2CW0 C;  4A3J H;  1AZP A;  1DCZ A;  1JWS D;  4LF9 L;  2K03 A;  4A93 G;  3PUX A;  3I4N H;  1XMQ L;  2K14 A;  3NEM A;  5D65 A;  4DR2 Q;  2K52 A;  5C0X H;  4I7A A;  4X3U A;  2EYP A;  4JCV E;  1JOK A;  1VQ7 A;  1EIG A;  2VUM H;  4XIG S;  1SNC A;  2A19 A;  1GO3 E;  2K5H A;  1QVG A;  4XYO A;  2KHI A;  1QCB D;  1J8I A;  2EQS A;  4JBM A;  1D5M C;  1SMX A;  4N8F A;  3CXC A;  3MAQ A;  2RHS B;  1IZ6 A;  3CCR A;  3H09 A;  2HQL A;  1KAW A;  1EYA A;  4KI0 A;  1G2T A;  4QY7 A;  1FNU A;  3VR6 A;  4BBR H;  4QUC A;  3RLN A;  1VQ4 A;  1A3T A;  4XT3 B;  1WCM G;  2UUB L;  2FMC A;  2MP1 A;  3I4L A;  4RWS C;  5M3M G;  4DF7 A;  2WB1 B;  1RTN A;  2CW0 D;  2PQA B;  2RDG A;  4DAY A;  1CKN A;  4Y7N B;  4KHP L;  1KNA A;  4R4Q A;  3HEJ A;  4M1U B;  1VMP A;  3HOX H;  1SND A;  2CFM A;  1SNP A;  2RQX A;  2E2I H;  5IWA Q;  4B3S Q;  1AEX A;  1VQ5 A;  5L37 A;  2SEB D;  5I9P A;  1K83 H;  2J0T D;  2PW7 A;  2NVX H;  1SE2 A;  3PUW A;  1SBB B;  1EOT A;  1PFN A;  5D3I B;  4G7O C;  4R1J A;  4HJ8 A;  1WD1 A;  1KXL A;  3S1R H;  1JOO A;  4LF6 L;  1N34 L;  3H6M A;  2AUK A;  4IFD H;  3K59 A;  2H1E A;  1PLF A;  1EZ6 A;  4FF3 A;  1S5F D;  1RD9 D;  1TXY A;  5C5M A;  1AFP A;  1SNM A;  3D4R A;  1VS0 A;  2LFN A;  1I4Q A;  4GLX A;  2B2Y C;  3HOU G;  5IE8 A;  4H13 C;  1CQV A;  1Q3L A;  4TKO B;  3SXH A;  3GTP H;  1KQS A;  4N8X 1;  5FK9 C;  4CKB A;  1L2F A;  1K3B C;  1IBK L;  1EY9 A;  3GDE A;  1LTR D;  2XIW A;  4KHP Q;  1FYC A;  3VA5 A;  3A0J A;  1T5E A;  5HY6 A;  4Y7N H;  2Y0S G;  3PO2 B;  3V96 A;  1AE3 A;  2VXW A;  2DN8 A;  2CH4 W;  1W3S A;  4DN4 M;  3GTM B;  2ES2 A;  3D6C A;  4DAM A;  3K7A B;  3D4W A;  3HKZ B;  5C44 B;  5JEA H;  4DK3 C;  4GNX A;  5H1S E;  4NB3 A;  4C3J B;  2RCN A;  3WOE A;  4ZCK A;  2R92 G;  1KDC A;  2JA7 G;  2K5N A;  4HJ7 A;  1BQQ T;  3QB3 A;  3NXW A;  3X3M A;  4Q0F A;  1UE7 A;  2FXQ A;  4KN4 C;  1Q7Y C;  4LF6 Q;  1LTI D;  4DV6 Q;  2KA7 A;  2IX3 A;  4A3L G;  3JAM c;  4P75 A;  4QQB X;  4QB4 A;  4ZYS A;  4JI0 L;  3J80 c;  1GM5 A;  4IJH A;  2YYZ A;  1EQR A;  2JQO A;  3GV6 A;  1MIU A;  1VMC A;  2JP1 A;  1HNX L;  2MNA A;  5COY A;  1X3E A;  3BG3 A;  3K7U C;  3KOJ A;  4WRD A;  5E4W C;  3J81 j;  2G9D A;  4NXM L;  1I3Q H;  3J7A F;  5I2X A;  4DKA C;  2R7Z H;  1ZKO A;  4N9P A;  5C0X J;  4A3M G;  2JSO A;  4KD4 A;  2MGS A;  2N55 A;  5CV7 A;  3RZO B;  1YIJ A;  2JA6 G;  3JC6 6;  4LJZ C;  4YWL A;  3HOY G;  3KBX A;  3KBG A;  1HH2 P;  4MIU A;  4XT1 B;  4DV7 L;  1K73 C;  3NUC A;  2N49 A;  2K75 A;  4DR3 L;  4A3D H;  4C3H G;  4KKS A;  3EJI A;  4JW0 A;  2F0J A;  5CYU A;  4DNR B;  3NQT A;  1X3G A;  1PH6 A;  1G6P A;  3K7A H;  4UP7 A;  5C44 H;  4GKJ Q;  1DYQ A;  1V1Q A;  2MJ8 A;  3NPP A;  4C3J H;  3AFP A;  1KAA A;  4A3G B;  4IUQ A;  1JB3 A;  2M00 A;  1XNQ L;  1F9P A;  4IO9 A;  1HZ9 A;  1HZA A;  4MN3 A;  1JB7 A;  4L5S A;  3PF4 A;  1PRT C;  2V1C C;  3OTO L;  1BUV T;  2B2V A;  3CC7 A;  5IT9 E;  2B2T A;  1H95 A;  2E2H B;  2F0M A;  1HNX Q;  1Q90 A;  1FGB D;  2OCE A;  4ZLT F;  4X62 L;  3F8T A;  1V1P B;  2KUM A;  2RBM A;  1SE8 A;  2PPB C;  1BNZ A;  1H9R A;  1M4V A;  1KD1 C;  2EYJ A;  2EY2 A;  1H9S A;  2WV6 D;  2VW9 A;  1LT5 D;  2HIV A;  1WTP A;  3FP9 A;  4RG1 A;  1R9T B;  2WFW A;  3AQQ A;  1WD0 A;  4X65 L;  3GO5 A;  2B3G A;  3D31 A;  1Y1V G;  4DV7 Q;  1O80 A;  1CI3 M;  3GTG B;  5M5W B;  3PQI A;  5EPK A;  1Y1W G;  1D1I A;  4QUF A;  5GAD C;  4LF5 L;  4UDU C;  3DM1 A;  3IFD A;  1L0X B;  1Q1B A;  5M3F B;  4JPB W;  4DV3 L;  3NSW A;  1STH A;  3CRK C;  1PFM A;  4K8I A;  1BBU A;  1SMY C;  4JI7 L;  3U58 A;  1PRT D;  1U4R A;  1N9W A;  1X54 A;  4JI1 L;  5IIF A;  3G71 A;  1EQQ A;  4JI3 Q;  4OWT B;  1GUG A;  2JA9 A;  4DR7 Q;  3KF8 B;  3CCL A;  1D5Z C;  3U4Z A;  1S4Z A;  4GOP C;  4TQU S;  2YU9 H;  5FKA C;  1J5E Q;  4A3G H;  3GTQ B;  2XGT A;  3WOF A;  3DMU A;  1K8M A;  2AQ2 B;  5EKL A;  1QWY A;  2F52 A;  1LM0 A;  1J9O A;  3JAM i;  2F0K A;  2E2H H;  2PZW A;  1DXM A;  5EBC A;  3TN2 A;  2EPB A;  1SR3 A;  5JEA J;  2V4D A;  2YTX A;  3S16 H;  4Y52 H;  3MTS A;  2ASB A;  4A3F H;  4R9W A;  2JA8 H;  3NWS A;  4ME3 A;  1VF7 A;  3T1Y L;  4KKU A;  1SMY D;  3E6Z X;  1E0B A;  4DV0 L;  1WTH A;  2XTI A;  3C1F A;  5HGT A;  3GTG H;  3CHB D;  3TZD A;  5GAG C;  4TSS A;  3SR1 A;  2L0C A;  2UUA Q;  2UUC Q;  1EWH A;  4DFA A;  1N32 Q;  3V2T A;  4JI7 Q;  1TWG B;  2JA5 B;  3R2T A;  3ND8 A;  4V0B A;  1ASY A;  1CFM A;  1JCK B;  3NBH B;  3CF5 A;  3L9A X;  2K04 A;  5IP7 H;  5KYI A;  4OX9 L;  1I4H A;  1UE6 A;  2RSO A;  3EIV A;  2L9H A;  4BBS B;  1Y14 B;  3UDI A;  1K3R A;  5HGQ A;  4X64 Q;  5IOC A;  4BXX G;  1F2Y A;  3SHL A;  2YV5 A;  5FOB B;  2ZTD A;  3I72 A;  4K5X A;  1KAB A;  5IT9 c;  3GP7 A;  3AFQ A;  4OO1 G;  1QIL A;  3LX0 A;  3HOV G;  2EIF A;  1CHP D;  1EYC A;  4LUV A;  3ERS X;  2NVY B;  3R3O A;  2RDF A;  1IBM Q;  3T1Y Q;  4QCL A;  3X3N A;  1VDZ A;  2QDL A;  2QIL A;  1I94 Q;  2VB2 X;  4CBV A;  1DM0 B;  1KDB A;  5FO8 B;  2ZJP A;  1GKH A;  2NN6 I;  1RF2 D;  1VQJ A;  2D62 A;  1Q82 C;  3ERO A;  1SAP A;  2Z6K A;  4OWW B;  1EU4 A;  2CHB D;  4UY8 C;  3A56 A;  3OPO A;  3M4P A;  1DOM A;  4PQX A;  4YHH L;  3R93 A;  2KBN A;  1SJE D;  1X32 A;  3NEL A;  4DV2 L;  3K57 A;  2B2U A;  2D9U A;  2K05 A;  2B2W C;  1WCM H;  1YEZ A;  1EWC A;  5IYC G;  5JJK A;  4BBS H;  4K0K Q;  3RD4 A;  1PHJ A;  4O42 A;  4BA1 I;  2CKZ B;  4HR7 B;  1A15 A;  4IN3 A;  2K4K A;  4DUY L;  5BR8 Q;  2F0V A;  1JE4 A;  3FEW X;  4X3S A;  1JOQ A;  3UE1 A;  1IBL L;  2F0P A;  5ELF A;  4CKE A;  1HA5 A;  4FNF A;  3G6J B;  3E3X A;  4G57 A;  2DNE A;  3MA2 B;  4DR1 L;  1EIY B;  2FIN B;  1TWH H;  4J8Q A;  4A3I B;  5IP9 G;  4X3K A;  1YZ6 A;  2MPM A;  4EX5 A;  4A3C G;  2NVY H;  1JJC B;  3S1M H;  2OXP A;  4B08 A;  4DK1 A;  2EJM A;  4OON A;  3EQL C;  3VDY A;  1RL2 A;  1MJE A;  2XRS D;  4FO2 A;  2EJF C;  1HNZ Q;  4DR6 Q;  4KY6 A;  3KF6 B;  4GKK L;  4PV1 C;  3KDF A;  1DJR D;  3PO2 G;  4FXG C;  4A4I A;  1HQM C;  1ENA A;  4OEL B;  2PMZ B;  3I90 A;  2P5Z X;  1TWA B;  1YHB A;  3M4Y A;  4DUZ L;  2IHE A;  2FMM A;  3PGZ A;  1W6K A;  4HJ9 A;  2HDM A;  4NW2 A;  2SNM A;  4C3I G;  3Q24 A;  2D5D A;  3J7Z C;  2F4I A;  1E3P A;  5GRO A;  2WAQ E;  4YCV A;  1F2L A;  3UDG A;  1D2B A;  1TS4 A;  1GHJ A;  1N8R C;  1IBL Q;  3HG9 A;  1STG A;  1SYG A;  4DR1 Q;  4A76 A;  1ICW A;  2K5D A;  2ZXO A;  2YTY A;  3CRL C;  4YCU A;  2IJ0 A;  4LW1 A;  4GZY C;  3SK4 A;  4L5Q A;  3PUV A;  2QW7 A;  2ZJQ A;  5FLM G;  4A3I H;  3K81 C;  1N36 L;  3FKI G;  4X66 Q;  3KK7 A;  3TP8 A;  3CCS A;  1SRO A;  1PVO A;  3K0X A;  4IUV A;  2LXJ A;  3W1B A;  2HHH Q;  4ME5 A;  3F2U A;  4P2C B;  1FGU A;  5G3L F;  2XN9 C;  1PYS B;  1DZ1 A;  4CJ0 B;  1ENF A;  4GKK Q;  3I4M B;  5IGG A;  1HR0 L;  4IZ8 A;  4DXG A;  1RJT A;  1PMR A;  4NXN Q;  1I4G A;  1EFW A;  3JAM L;  4HIK A;  1LAC A;  2DUD A;  2B2W A;  4YY3 Q;  3J80 L;  2NZO A;  3HZX A;  2F3W A;  4U68 A;  4HSV A;  3W3A A;  4RCN A;  2B63 B;  3MXP A;  1HZC A;  1HQR D;  4MNO A;  4A3M H;  2K32 A;  2C5C A;  4A3J B;  2WP8 J;  2KED A;  2UXC Q;  1TS2 A;  4PG3 A;  2RCF A;  1IYU A;  4JI4 Q;  1NBW A;  3GTK B;  5DAU A;  3RZD B;  2A69 C;  2VUM B;  4RKL A;  2KCM A;  1I5F A;  2Q8R E;  4K6L A;  3KFU A;  1H9M A;  4XTC S;  4IPH A;  1B70 B;  4LF7 L;  2QDB A;  1KC8 C;  3KUP A;  4NPS A;  1GUT A;  1X9N A;  1BCP F;  2F0U A;  4FVM A;  2L12 A;  3PUY A;  1ZXT A;  1Y8O B;  1E22 A;  4BBR B;  1OXV A;  4RA8 A;  1PZI D;  3A7A B;  1CA6 A;  2EY1 A;  1A3V A;  4F87 A;  3PV0 A;  3T1H Q;  3I4M H;  1FNW A;  3EA6 A;  4GN5 A;  1SDF A;  3CAM A;  3UI2 A;  4AIM A;  3KJP A;  2Z0S A;  3C2P A;  1TU2 B;  2VQF Q;  4RGM A;  1L1O A;  2Q2I A;  4GLA C;  4OEM B;  1JIC A;  3CCJ A;  4A3K G;  3GD7 A;  3T13 A;  1K9M C;  2B63 H;  3J7Y W;  1CHQ D;  5LMN W;  2A69 D;  2DY7 A;  1E2Z A;  2OTJ A;  2NVX B;  4HAE A;  3TRZ A;  1JT8 A;  4QMG A;  3H0G G;  5TSS A;  4PZ7 A;  3BU2 A;  3Q8D A;  3JAM E;  3PF5 A;  4R4T A;  1X6O A;  4F88 A;  3S1R B;  4UPA A;  3J80 E;  3GTK H;  2X6G A;  3OWE B;  2AHO B;  2PW5 A;  3RZD H;  5C3X A;  1G51 A;  4BY7 B;  1XNR Q;  4LF7 Q;  1P8L A;  4OL7 A;  4OXP A;  1EYG A;  3CCE A;  5GQO A;  3A5U A;  2QCP X;  2MFI A;  2WAQ G;  4OHJ A;  4JI5 L;  3D4D A;  4JI2 L;  1Q1E A;  1YHA A;  2A74 C;  3KLW A;  3HKS A;  1TR5 A;  4R4I A;  4DNI A;  3GTP B;  3FHW A;  4KJN A;  3ZYY X;  1K28 A;  4DR4 L;  4DV4 L;  2DY8 A;  1AZQ A;  4B3R L;  2D0O A;  1K0R A;  5C5L A;  1GOZ A;  4LFB L;  5E7N A;  4V19 0;  2I07 B;  4CDF C;  2EXD A;  2NYZ D;  5JJZ A;  3CMA A;  5LMN Q;  2ZXP A;  2NN6 H;  1B7Y B;  4DV5 L;  3M4Q A;  1TY0 A;  4LF9 Q;  2F0H A;  1PYW D;  1XMQ Q;  3HOZ G;  3RLO A;  1KHI A;  2R6G A;  4AYB E;  2WII B;  1N33 L;  3SK6 A;  3SK5 A;  4M8A A;  2E2D C;  2KOL A;  4IUT A;  3DXJ C;  3U9S A;  1TKW B;  5BN3 A;  2I5M X;  3G48 A;  3P75 A;  4BY7 H;  3BJU A;  1U4M A;  3MXN A;  4F8M A;  1MHW C;  1QG7 A;  4ZAI A;  3NTH A;  1OXU A;  3OSO A;  1TVX A;  4HSP A;  1TWF B;  1I3Q B;  1VQE A;  2FFK B;  2R7Z B;  1PZJ D;  2UUB Q;  4FP5 D;  4HCS A;  2QGQ A;  5D3D A;  1C7Y A;  4B3R Q;  2O5I C;  1Q12 A;  1W2B A;  4A3B G;  2XVS A;  1UE5 A;  1QVF A;  1VQN A;  4L63 B;  5IYD G;  3D0F A;  3TRE A;  1B8A A;  4HMI A;  4A3D B;  1ILP A;  3NE5 B;  2X6L A;  3HOV H;  3ONA B;  3CW2 C;  5IT9 L;  2F0L A;  1U4P A;  2ZTE A;  1N33 Q;  5IYB G;  1PTO F;  5KEE A;  1WYD A;  4B3M L;  2K50 A;  3I56 A;  2RKS A;  2UXB L;  4AH6 A;  1VQ8 A;  2YTV A;  4DAY B;  1CKN B;  2GN5 A;  3BZC A;  1N34 Q;  1O78 A;  2QEJ C;  1SYC A;  4RH6 A;  3DLL A;  3AEV A;  2LXK A;  3QO2 A;  3RN2 A;  1A63 A;  1YI2 A;  4YWK A;  2E76 C;  1LTL A;  4ILW A;  5KND A;  3FPP A;  3ITP A;  5LHY 1;  2EYF A;  5KYL A;  2MHV A;  2Z8L A;  4DAP A;  1PH2 A;  3M7G A;  4EQO A;  4LF8 L;  2F3I A;  1TWF H;  2NTT A;  3K5N A;  2MQH A;  2F0D A;  4AQY L;  1IBK Q;  3HOW H;  2R93 G;  1LV9 A;  1E2V A;  3LNN A;  4JBW A;  1U0L A;  1LO5 D;  3T51 B;  5C4H A;  3NQI A;  1WVL A;  2JK8 A;  2JEB I;  1PDQ A;  5C4X G;  4A3E G;  1JMC A;  4RAU C;  5I6Y A;  5KNB A;  1H9J A;  1WTQ A;  1NMF A;  1G6Z A;  1MSG A;  2EJG C;  5EPJ A;  1AW7 A;  1YIT A;  4LFC L;  2NBF A;  1CM9 A;  3S14 B;  5I9O A;  1VQK A;  3PO3 B;  3BS1 A;  4B3M Q;  2OF1 A;  2YU9 B;  2ID0 A;  1R4Q B;  1ML0 D;  5AJ3 L;  4BY1 B;  3MHB A;  3TS2 A;  5C3E G;  1S40 A;  1QNK A;  5IGF A;  4L6T B;  1OXS C;  3OMC A;  4JI0 Q;  4DAV A;  1M8A A;  2ZM6 L;  2B2Y A;  1BCP B;  3BYT B;  3IKJ A;  4C1N K;  1QJO A;  3HFZ B;  1CKM A;  4O0A A;  4AYB G;  4GNX B;  2HT1 A;  2WAC A;  4B3T L;  2WB1 E;  4YIJ A;  4C3I H;  3S16 B;  1EEF D;  4NXM Q;  1XJV A;  2XRQ D;  1EOV A;  4OIK A;  1STE A;  3BZK A;  4A3F B;  2JA8 B;  3OOC A;  1IL8 A;  1X65 A;  1A3U A;  4R4O A;  1HNW L;  3GTO H;  1VQL A;  5J22 A;  2RDH A;  3UDF A;  1TWC B;  4H0L C;  1QUQ A;  2UXD L;  4JV5 L;  2F4V L;  1PYB A;  3GTJ H;  2NZ1 D;  3BDO A;  4DR3 Q;  3BVZ A;  2EYH A;  1HRJ A;  1PZK D;  2OTL A;  3F2D A;  1LTA D;  4HN7 A;  4HCE A;  2KJX A;  3FKI H;  1ICF B;  3DWP A;  3OYY A;  3V05 A;  1MGS A;  4MZ9 A;  3K5L A;  1IL2 A;  4QIW B;  2PQE A;  5JPN C;  1NR4 A;  2F3V A;  3S14 H;  3PO3 H;  4WJ4 A;  2L55 A;  3CD6 A;  3E0E A;  3I4N G;  5AJ3 Q;  4OIJ A;  1NNX A;  1XNQ Q;  4NMZ A;  4B9X A;  2Q2T A;  2HCI A;  3J81 E;  4YCW A;  3OTO Q;  4P71 A;  3WWV A;  4BY1 H;  2E8G A;  4WFN 3;  4K14 A;  2ZM6 Q;  1W6J A;  5JJL A;  3N6R A;  4GN3 B;  4X62 Q;  2DJF C;  1ILQ A;  3A5Z B;  3O13 A;  5IGB A;  4DV1 L;  1B2T A;  1VQ9 A;  5A35 A;  3J80 i;  1GVP A;  2PNR C;  1PH5 A;  2VL6 A;  2K5Q A;  1EY7 A;  1YNJ C;  5AFW A;  1XMO L;  4A93 B;  3E5S A;  3PSI A;  4BBR G;  4X65 Q;  1EYD A;  3CCQ A;  2F4V Q;  2PI2 E;  3B6Y A;  3HKZ E;  5CR3 A;  4K8J A;  5ISR A;  1TWC H;  4LF5 Q;  1XTC D;  5KGU A;  3KJO A;  2WIN B;  1R4P B;  4PZ6 A;  4XQQ A;  4DV3 Q;  4UP9 A;  1AN8 A;  3VYU A;  1AH9 A;  4BWG B;  3TS0 A;  1IKM A;  1F9S A;  4FF1 A;  3ND9 A;  1H9S B;  2B29 A;  3ULP A;  1UAP A;  1RDP D;  4JI1 Q;  1X56 A;  3HOX G;  5CV5 A;  3BDC A;  3IFT A;  3AMU A;  2AUJ D;  4ZUJ A;  1WCM B;  3Q22 A;  1FD7 D;  1VQA A;  2F1M A;  3URY A;  3RMH A;  1T9H A;  1GD7 A;  1YNJ D;  2DGY A;  2OQK A;  4DA2 A;  5COR A;  2NZH A;  3S9W A;  4IFD G;  1CUK A;  4CDC C;  5JJI A;  1HA6 A;  1YBY A;  4KHZ A;  2ALY B;  2IX1 A;  1XWE A;  2IX0 A;  1JE5 A;  5KRU A;  3H3V I;  1TWH B;  2GVA A;  3S17 H;  1Z6H A;  5GAE C;  2L4N A;  4A93 H;  1K8O A;  1C9O A;  1CKO A;  1PH3 A;  1HPC A;  3ZJY C;  5IGE A;  3S1M B;  1IXR A;  3NWT A;  3QR8 A;  3CQZ B;  2DJG C;  3I2Z A;  2WKC A;  2JE6 I;  3K8A A;  3MFY A;  4DV0 Q;  3OW7 A;  1SJH D;  3W5O A;  1ENC A;  3QG1 A;  3LWE A;  2BCO A;  2WB1 G;  3SGI A;  2R3Z A;  5A2Q E;  4DPG A;  2F0T A;  2QF7 A;  1PTO B;  4RGO S;  4C1N I;  4HJA A;  2Z4I A;  1QE6 A;  1S72 A;  1LLR D;  4X3T A;  1SRU A;  4GOP A;  2A68 C;  3STB C;  1CSP A;  4Z9C B;  3RUZ A;  1E1T A;  4H02 A;  3M7N A;  3TP5 A;  4OX9 Q;  1CK1 A;  2KCN A;  1ZEQ X;  4XQN A;  1E24 A;  1K8A C;  4IUR A;  5M3M H;  4C56 C;  4FF4 A;  2NVQ B;  1MI2 A;  1DOK A;  4CJ2 C;  2FHT A;  4GN4 B;  1WTR A;  1GUN A;  2Y0S B;  2XSC A;  5I4D A;  1AP0 A;  5BN4 A;  3MVV A;  3J81 c;  4UHV A;  1F2M A;  2K1B A;  1DD2 A;  3F2B A;  1B3A A;  2JXM B;  3H15 A;  3NTK A;  2L1B A;  3W1G A;  2PZT A;  2R92 B;  3FVQ A;  2JA7 B;  3ERQ A;  3W2D A;  3DUZ A;  4QGU A;  1BXT A;  2Z4H A;  4OO1 I;  2KCT A;  4LUO A;  3DHQ A;  3CQZ H;  5E4X A;  1EU3 A;  2A68 D;  3FMC A;  3STB D;  3S15 H;  4NDX A;  1B9N A;  2K7V A;  4LF4 L;  5ELN A;  3PCO B;  2N88 A;  4KY5 A;  1SSO A;  2JJQ A;  2K33 A;  1Z47 A;  4EQ5 A;  3U50 C;  2R7D A;  1EL0 A;  1PTO H;  1UEB A;  4YHH Q;  4FXD A;  4XDX A;  3DWQ A;  4DV2 Q;  3M4O B;  3I4O A;  4ZK9 B;  4LFA L;  3HOU H;  2IL8 A;  3HKZ G;  5C4Z A;  3MC0 B;  1JQY D;  5C44 G;  3BVM A;  5I2Y A;  4A3M B;  3D6W A;  1BR9 A;  2A6E C;  2CQO A;  4C3J G;  4POF A;  1TS3 A;  2JA6 B;  1EFI D;  5EPL A;  1MBY A;  1WTV A;  2NVT B;  3HOY B;  1YJ9 A;  4A3B H;  1I6V C;  2IPK D;  4DUY Q;  3I3C A;  5IGC A;  5IYD H;  2A6H C;  2K28 A;  2NVQ H;  3WDN A;  4HJ5 A;  1EQV A;  1TII D;  2HIX A;  3A74 A;  1EY0 A;  1RTO A;  3T56 B;  4JYA L;  1VQI A;  4IPD A;  2KQ3 A;  1OTC A;  5JOB A;  4JOI C;  1Q46 A;  3RLF A;  4R8I A;  2R92 H;  3I55 A;  3G7L A;  2VQE L;  2JA7 H;  4ZKB B;  1STN A;  2M9V A;  3VR2 A;  1YHQ A;  1NAP A;  3NHH A;  3TSS A;  5IY0 A;  1VQG A;  4A3L H;  3QWN A;  4I7Z C;  1MD2 D;  4UAI A;  3VA7 A;  1HR0 W;  1C0A A;  1VQM A;  3ULL A;  2A6E D;  5DM6 3;  2IHF A;  2KEN A;  2O2L D;  4LFA Q;  1PXU A;  1LYL A;  2A6H D;  1HTP A;  3IL8 A;  1D7Q A;  4DUZ Q;  3M4O H;  2L15 A;  2MO1 A;  1G8Z D;  4XYQ A;  4IJL A;  1Y1V B;  2SNS A;  2JA6 H;  2NVT H;  3HOY H;  1Y1W B;  4A3G G;  2R61 A;  3C46 A;  1RHP A;  3A8J E;  3KDF B;  4EQN A;  4A3E H;  1D8L A;  1BBX C;  4C3H H;  1S5E D;  2N3S A;  3J81 i;  3A8I E;  4X6A H;  1X3Q A;  4K5V A;  3CPW A;  2QA4 A;  1OXT A;  5EJW A;  1N36 Q;  1C48 A;  5J1Z A;  1QB5 D;  2E74 C;  3CPF A;  1NY4 A;  4IUN A;  4LNQ A;  5JAV A;  4A3F G;  2AWO A;  2JA8 G;  3P20 A;  3MXU A;  5C3E H;  3Q0A A;  4DR2 L;  3TEH B;  1LUZ A;  3VR5 A;  1HR0 Q;  1F2Z A;  2L11 A;  1ROD A;  1JJ2 A;  2AQ3 B;  1EWI A;  2PQA A;  1HHV A;  2CWP A;  2I0Q A;  5CV4 A;  5BN5 A;  2Q8T A;  5M3F G;  4KV6 A;  2RA4 A;  3OW2 A;  1JOR A;  2GA4 B;  1M1K C;  2KVM A;  2CH4 A;  3HS0 C;  4F7X A;  1S3O A;  2M2L A;  5E3F A;  5IP7 G;  3F2C A;  2HUG A;  3MEH A;  1Y1V H;  4FDB A;  4WJW A;  4Q5V A;  1Y1W H;  2I5L X;  1BF4 A;  1KLU D;  2HDL A;  4DXF A;  4QJF A;  1PH1 A;  4DU9 A;  3IRB A;  5G3L D;  1ESF A;  4MTN A;  3S2H B;  4O2D A;  4ZRZ A;  3AU7 A;  1S5C D;  2G5D A;  5IWA L;  4KHV A;  4CHT B;  1I4P A;  4KTA A;  1E7Z A;  1BCP C;  3EFX D;  2F0E A;  1VQP A;  4DR5 L;  3NK9 A;  2EVB A;  4IPC A;  4GNX C;  5M5Y H;  4PMC A;  3PUZ A;  2PMZ E;  3H3V H;  5LL6 S;  3D3R A;  3KYH C;  1V1O A;  5EBD A;  1VQH A;  1E2W A;  1SYE A;  3I8Z A;  3I73 A;  4LUZ A;  2K5W A;  5J3B A;  2JYO A;  3VR4 A;  3CCU A;  1KL9 A;  4RHS A;  3U4V A;  4EVO A;  4PZ8 A;  5D14 A;  3HOV B;  2JA5 G;  2KEE A;  3FPU B;  3PMF A;  3CKI B;  3CC2 A;  2PI2 A;  3M3Y B;  1D6E C;  1FJG L;  1YNX A;  4UP8 A;  4IQZ A;  5CV8 A;  1SLJ A;  5M5X B;  2F0I A;  4BBS G;  3T4A C;  1II3 A;  1VQB A;  1XPO A;  2RVL A;  4IUU A;  3DEP A;  5K5P A;  1KIX A;  4P72 A;  3NP8 A;  1BCP D;  1L1O B;  5FJ8 G;  2J7Z A;  2EY5 A;  2F0O A;  1B3Q A;  4IOC A;  3S2H H;  3L0O A;  3NTI A;  5FO9 B;  4JI5 Q;  2EY6 A;  4JI2 Q;  1ESR A;  3VYS A;  1AE2 A;  2K01 A;  1K8G A;  4DR5 Q;  1E1O A;  4ODG A;  4L5T A;  3ULJ A;  1LTG D;  5JVG 3;  2EXZ A;  2LY7 A;  4ALP A;  4DR4 Q;  1G91 A;  3HOW B;  5C4J B;  4DV4 Q;  4BXX H;  3RNU A;  3N52 A;  3C3L A;  4DV6 L;  3J7A V;  3KLS A;  2IW3 A;  2EDG A;  4A75 A;  1S5B D;  4LFB Q;  3TBI B;  1Y8N B;  3CME A;  4OO1 H;  3NEN A;  1EQT A;  4R4C A;  2B2V C;  3MXG A;  2B2T C;  2PYK A;  4CDE C; 
#chains in the Genus database with same CATH homology
 2MO0 A;  4DUY L;  5BR8 Q;  1FJG Q;  4DV5 Q;  1PH7 A;  2KHJ A;  3CD6 A;  3E0E A;  1Q81 C;  3I4N G;  1KRS A;  5AJ3 Q;  1XNQ Q;  1XNR L;  3M3Y H;  3RR5 A;  4DK6 C;  3UE1 A;  2QEX A;  1IBL L;  2Q2T A;  2IY5 B;  4YCW A;  3OTO Q;  4P71 A;  3WWV A;  4BY1 H;  2E8G A;  4DR1 L;  1EIY B;  2Y0S E;  2ZM6 Q;  5M5X H;  1FVI A;  1TWH H;  4WJ3 M;  1YJW A;  1O7I A;  5JJL A;  3LGJ A;  4GN3 B;  2D0P A;  4X62 Q;  3CC4 A;  2ZJR A;  3A5Z B;  1L0W A;  5IP9 G;  4DV1 L;  1YZ6 A;  1VQ9 A;  1X55 A;  1MKH A;  1GVP A;  3J80 i;  4EX5 A;  2NVY H;  4A3C G;  3CP0 A;  1IYJ B;  1PH5 A;  1JJC B;  2VL6 A;  3S1M H;  4IPG A;  3ER0 A;  1I50 H;  4OON A;  1XMO L;  1A8V A;  1ASZ A;  3PSI A;  3VDY A;  1RL2 A;  5FLX c;  1FL0 A;  1MJE A;  4DR6 Q;  1HNZ Q;  4HIM A;  4BBR G;  4JOI A;  1U5K A;  4X65 Q;  4A3I G;  3KF6 B;  4GKK L;  2R7F A;  4GKJ L;  3CCQ A;  5IYC H;  2F4V Q;  2PI2 E;  3KDF A;  1MJC A;  3B6Y A;  3HKZ E;  3PO2 G;  1TWC H;  4LF5 Q;  2AWN A;  5LMN L;  4A4I A;  2A1A A;  3KJO A;  1PH8 A;  4B3S L;  4PZ6 A;  2VZA A;  1V9P A;  4A3J H;  4LF9 L;  4A93 G;  4DV3 Q;  4UP9 A;  3PUX A;  5C4J H;  1AH9 A;  3I4N H;  1XMQ L;  3TS0 A;  2K14 A;  3NEM A;  1YHB A;  4DUZ L;  4HID A;  4DR2 Q;  2K52 A;  2IHE A;  3PGZ A;  1VQF A;  2B29 A;  4HJ9 A;  3ULP A;  4JI1 Q;  4JCV E;  1X56 A;  3HOX G;  3MXN B;  3J7Z C;  1VQ7 A;  1E3P A;  5GRO A;  2WAQ E;  4YCV A;  1EIF A;  5K36 G;  2VUM H;  4XIG S;  3UDG A;  1QZH A;  2A19 A;  2ZTC A;  1GO3 E;  2K5H A;  5IP9 H;  1QVG A;  1JJG A;  2KHI A;  4LWC A;  1N8R C;  1IBL Q;  2EQS A;  1VQA A;  1SMX A;  3TQY A;  3CXC A;  4JBM A;  4A3C H;  2RHS B;  1IZ6 A;  4DR1 Q;  3CCR A;  1T9H A;  4A76 A;  2HQL A;  1GD7 A;  2DGY A;  2JEA I;  2OQK A;  2YTY A;  1KAW A;  4KI0 A;  4LW1 A;  4YCU A;  3L2P A;  2UXB Q;  4QY7 A;  4L5Q A;  2NZH A;  3PUV A;  5LMU L;  4IFD G;  2ZJQ A;  4BBR H;  1CUK A;  5JJI A;  5FLM G;  4A3I H;  3K81 C;  1YBY A;  2GVB A;  3FKI G;  4KHZ A;  1QVC A;  2ALY B;  3RLN A;  4X66 Q;  3CCS A;  1VQ4 A;  2IX1 A;  1SRO A;  1WCM G;  2IX0 A;  1PVO A;  3K0X A;  1JE5 A;  5DLQ E;  2LXJ A;  3W1B A;  2UUB L;  3H3V I;  2HHH Q;  2GVA A;  3PO2 H;  5M3M G;  1FGU A;  3S17 H;  5GAE C;  1PYS B;  2PQA B;  3GTM H;  4A93 H;  1CKN A;  2E2J H;  1C9O A;  1CKO A;  5ELO A;  4KHP L;  4GKK Q;  1PH3 A;  4R4Q A;  3ZJY C;  4JI3 L;  1HR0 L;  1IXR A;  3I2Z A;  4NXN Q;  2BH2 A;  4DR7 L;  3HOX H;  2CFM A;  2JE6 I;  3K8A A;  4LF8 Q;  3MEF A;  4DV0 Q;  4BA2 I;  1EFW A;  3W5O A;  5IWA Q;  2E2I H;  4B3S Q;  4HIK A;  1BVS A;  1VQ5 A;  2DUD A;  4AQY Q;  1J5E L;  4YY3 Q;  2NZO A;  2WB1 G;  1K83 H;  3SGI A;  2Q2H A;  4DPG A;  2NVX H;  1N36 L;  3PUW A;  1YVC A;  1HZC A;  3I4M G;  4HJA A;  4MNO A;  3S2D H;  4A3M H;  2OWO A;  1S72 A;  4R1J A;  4HJ8 A;  4GOP A;  1SRU A;  1KXL A;  3STB C;  3S1R H;  4LF6 L;  1CSP A;  1WOC A;  2WP8 J;  1E1T A;  4H02 A;  1N34 L;  3M7N A;  2UXC Q;  4OX9 Q;  5FLM H;  1VQC A;  4PG3 A;  4LFC Q;  2AKW B;  4JI4 Q;  1TXY A;  1E24 A;  1NBW A;  1K8A C;  2B63 G;  5M3M H;  1XPR A;  1VS0 A;  1HJP A;  4GLX A;  1XTD A;  3CCV A;  2KCM A;  3G4S A;  5LMU Q;  1I5F A;  4A3J G;  4GN4 B;  3HOU G;  5IE8 A;  3KFU A;  3RZO H;  4XTC S;  4IPH A;  3J81 c;  1QZG A;  2ATW A;  4IFD J;  1B70 B;  1KQS A;  4LF7 L;  3GTP H;  4JBJ A;  1KC8 C;  1D7Q A;  3F2B A;  5C0X G;  4GS3 A;  4NPS A;  3H15 A;  1L2F A;  2VNU D;  1YJN A;  1IBK L;  1X9N A;  1WFQ A;  3GDE A;  2UUA L;  2RHQ B;  3PUY A;  2UUC L;  3W1G A;  1E22 A;  1OXV A;  4KHP Q;  1N32 L;  2VUM G;  2Z6K C;  3A0J A;  3CCM A;  5HY6 A;  4Y7N H;  1VQD A;  1NE3 A;  2Y0S G;  4QGU A;  3PV0 A;  3T1H Q;  4B3T Q;  1X3F A;  2LSS A;  3F1Z A;  3I4M H;  1AE3 A;  4OO1 I;  3J7A 5;  2KCT A;  4GN5 A;  4LUO A;  1W3S A;  3CAM A;  4AIM A;  3KJP A;  3CQZ H;  2ES2 A;  2Z0S A;  3AYH B;  3STB D;  4DAM A;  3S15 H;  3S1Q H;  4LF4 L;  4DK3 C;  5ELN A;  2VQF Q;  3PCO B;  1BKB A;  4GNX A;  4OWX B;  5H1S E;  1L1O A;  2Q2I A;  2BA0 A;  4GLA C;  4JC0 A;  4NB3 A;  2RCN A;  3DM3 A;  4X64 L;  2R92 G;  2UXD Q;  3GTL H;  2JA7 G;  4JV5 Q;  3CCJ A;  4A3K G;  2JJQ A;  3GD7 A;  2K5N A;  1Z47 A;  1WI5 A;  4EQ5 A;  3U50 C;  2R7D A;  4HJ7 A;  1K9M C;  2B63 H;  3HOZ G;  1UE7 A;  2FXQ A;  1UEB A;  4P73 A;  1Q7Y C;  5LMN W;  4LF6 Q;  4DV6 Q;  4YHH Q;  3S1N H;  4DV2 Q;  3I4O A;  4LFA L;  3HOU H;  2OTJ A;  4A3L G;  3EBE A;  3TRZ A;  1JT8 A;  3HKZ G;  4P75 A;  3JAM c;  4QQB X;  5C44 G;  3H0G G;  4JI0 L;  4PZ7 A;  3BU2 A;  3Q8D A;  3J80 c;  2CQO A;  4IJH A;  3PF5 A;  1GM5 A;  4POF A;  4R4T A;  2YYZ A;  1X6O A;  1DGS A;  3K80 C;  1EQR A;  2JQO A;  4UPA A;  1MIU A;  2NN6 G;  1YJ9 A;  4DUY Q;  1HNX L;  2MNA A;  1R9T H;  3GTK H;  2AHO B;  3E9I A;  3RZD H;  1IBM L;  5IYD H;  4KLK A;  1X3E A;  1G51 A;  3K7U C;  3KOJ A;  2NVQ H;  1XNR Q;  3J81 j;  4IOA A;  4LF7 Q;  1P8L A;  1QUQ B;  1I94 L;  4OXP A;  1EYG A;  4NXM L;  3CCE A;  5GQO A;  4HJ5 A;  5M5W H;  1I3Q H;  3A5U A;  2HIX A;  3A74 A;  4DKA C;  2MFI A;  2R7Z H;  2WAQ G;  5C0X J;  4JI5 L;  4A3M G;  4JYA L;  1VQI A;  3M85 A;  4JI2 L;  4IPD A;  1Q1E A;  1YHA A;  1YIJ A;  2JA6 G;  5M3F H;  3JC6 6;  4YWL A;  3HOY G;  3KLW A;  3HKS A;  4R4I A;  4DNI A;  1OTC A;  4DV1 Q;  4JOI C;  1Q46 A;  1HH2 P;  2OQ0 A;  4DV7 L;  3RLF A;  3FHW A;  3M9B A;  1K73 C;  5C0X I;  3I55 A;  2R92 H;  2VQE L;  4JBK A;  2JA7 H;  4A3K H;  2N49 A;  4P74 A;  4BY7 G;  4DR4 L;  2K75 A;  4DV4 L;  4DR3 L;  4A3D H;  1XMO Q;  1YHQ A;  4B3R L;  2D0O A;  1K0R A;  5IY0 A;  1X3G A;  1VQG A;  1PH6 A;  1G6P A;  4A3L H;  4LFB L;  3K7A H;  4UP7 A;  1UWV A;  5E7N A;  3GTQ H;  4K0K L;  1HR0 W;  5C44 H;  4GKJ Q;  1C0A A;  1VQM A;  3H0G H;  4RMF A;  3ULL A;  1V1Q A;  2EXD A;  4C3J H;  3AFP A;  1A62 A;  3CMA A;  5BR8 L;  5LMN Q;  2IHF A;  2KEN A;  1PH9 A;  1B7Y B;  4DV5 L;  3M4Q A;  4LFA Q;  4LF9 Q;  1XNQ L;  1VQO A;  4JI6 L;  1LYL A;  1HZ9 A;  4IO9 A;  1HZA A;  1XMQ Q;  2BH8 A;  3KF6 A;  1KHI A;  2H5X A;  3RLO A;  1J6Q A;  1JB7 A;  4DUZ Q;  2R6G A;  2V1C C;  2L15 A;  4AYB E;  3OTO L;  4HIO A;  1N33 L;  1NJI C;  3M4O H;  2IT1 A;  3CC7 A;  2MO1 A;  1H95 A;  1G29 1;  1M90 C;  1HNX Q;  4IJL A;  2OCE A;  4X62 L;  3F8T A;  2JA6 H;  2NVT H;  3HOY H;  1SE8 A;  4A3G G;  1VCI A;  1KD1 C;  1P16 A;  5JEA G;  1HNW Q;  1RIP A;  2I5H A;  3KDF B;  4APV A;  1SN8 A;  2VW9 A;  2I5M X;  1D8L A;  2HIV A;  3G48 A;  4A3E H;  1XPU A;  4BY7 H;  3S24 A;  2RF4 A;  3BJU A;  4C3H H;  2CCZ A;  3FP9 A;  4RG1 A;  4PMW A;  2N3S A;  3J81 i;  4DR6 L;  1OXU A;  2WFW A;  1A0I A;  3AQQ A;  1HNZ L;  4X65 L;  4X6A H;  3GO5 A;  2B3G A;  3D31 A;  1Y1V G;  3CPW A;  2QA4 A;  4DV7 Q;  1I6H H;  1OXT A;  1N36 Q;  1TWG H;  1Y1W G;  1VQE A;  2JA5 H;  4JG2 A;  5GAD C;  4LF5 L;  1Z9F A;  1SFO H;  3CPF A;  2UUB Q;  1NY4 A;  4LNQ A;  2QGQ A;  1C7Y A;  4B3R Q;  1Q1B A;  4DV3 L;  1Q12 A;  1W2B A;  4A3B G;  4A3F G;  2AWO A;  2JA8 G;  1PA6 A;  4IFD I;  1UE5 A;  1QVF A;  5C3E H;  4DR2 L;  1VQN A;  5IYD G;  3TEH B;  3HOZ H;  1BBU A;  1LUZ A;  1B8A A;  3D0F A;  3TRE A;  4JI7 L;  1HR0 Q;  1Q86 C;  3U58 A;  4JI3 Q;  1X54 A;  1N9W A;  4JI1 L;  1EQQ A;  1EWI A;  4JI8 L;  3G71 A;  1JJ2 A;  4OWT B;  2JA9 A;  4DR7 Q;  1PFS A;  3KF8 B;  3CCL A;  3HOV H;  3U4Z A;  2E5L L;  2R7Z G;  3G6E A;  3HOW G;  4GOP C;  3CW2 C;  2PQA A;  4TQU S;  2CWP A;  2I0Q A;  2YU9 H;  2K5V A;  4J15 A;  4JI6 Q;  1J5E Q;  5FJ8 H;  4QIW E;  5M3F G;  4A3G H;  2XGT A;  2ZTE A;  3OW2 A;  1N33 Q;  5IYB G;  1UE1 A;  1WYD A;  1M1K C;  2K50 A;  4B3M L;  3I56 A;  2UXB L;  2F52 A;  1S3O A;  4A3D G;  4AH6 A;  1VQ8 A;  1LM0 A;  2YTV A;  3JAM i;  4A3B H;  5IP7 G;  3F2C A;  4DAY B;  2E2H H;  1CKN B;  2GN5 A;  3BZC A;  1N34 Q;  4X66 L;  1Y1V H;  3DLL A;  3AEV A;  2LXK A;  1SR3 A;  4FDB A;  5JEA J;  1Y1W H;  3RN2 A;  1NMG A;  1Q8K A;  2YTX A;  2HHH L;  3S16 H;  4Y52 H;  2I5L X;  4L5S A;  1A63 A;  2BA1 A;  1YI2 A;  4L5R C;  4YWK A;  2ASB A;  1LTL A;  4QJF A;  4A3F H;  1PH1 A;  2JA8 H;  3IRB A;  1PV4 A;  4ME3 A;  2UU9 L;  4MTN A;  3T1Y L;  4NXN L;  4O2D A;  1EUJ A;  2VS1 A;  1PH2 A;  4LF8 L;  4DV0 L;  2XTI A;  3UE0 A;  2F3I A;  1TWF H;  4GLV B;  3GTG H;  5IWA L;  4GOP B;  2MQH A;  5GAG C;  4AQY L;  1IBK Q;  3HOW H;  4YY3 L;  1PH4 A;  2R93 G;  2UUA Q;  2UUC Q;  1E7Z A;  4JBW A;  3PIO A;  1VQP A;  1U0L A;  1N32 Q;  4DR5 L;  4JI7 Q;  4IPC A;  4GNX C;  5M5Y H;  5IYB H;  1L1O C;  4JI8 Q;  4C2M H;  2PMZ E;  2JK8 A;  2JEB I;  3PUZ A;  1ASY A;  3NBH B;  3CF5 A;  4A3E G;  3H3V H;  3KYH C;  5C4X G;  1JMC A;  2E5L Q;  1NTG A;  1VQH A;  1HZB A;  1NMF A;  5IP7 H;  2UXC L;  4LUZ A;  4OX9 L;  1UE6 A;  3EIV A;  5J3B A;  1YIT A;  1Y14 B;  4LF4 Q;  4LFC L;  2N8N A;  1K3R A;  1KL9 A;  2VY3 A;  3UDI A;  3CCU A;  4JI4 L;  5HGQ A;  3U4V A;  1VQK A;  4X64 Q;  4PZ8 A;  4B3M Q;  2JA5 G;  4BXX G;  3CC2 A;  2PI2 A;  2YV5 A;  2ID0 A;  4TVA B;  1FJG L;  1YNX A;  3E9H A;  5AJ3 L;  2N78 A;  2ZTD A;  5EAY A;  4UP8 A;  5C3E G;  1S40 A;  2A8V A;  3TS2 A;  1OXX K;  1V43 A;  1SLJ A;  5IT9 c;  1BBW A;  4BBS G;  1VQ6 A;  1OXS C;  3AFQ A;  4JI0 Q;  4OO1 G;  1VQB A;  2ZM6 L;  3PO3 G;  3PF4 A;  1XPO A;  2PNH A;  4POG A;  3HOV G;  2R93 H;  1KIX A;  2EIF A;  3HFZ B;  4LUV A;  1CSQ A;  4P72 A;  3ERS X;  2AMC B;  2UU9 Q;  1IBM Q;  3T1Y Q;  1CKM A;  4O0A A;  4AYB G;  4GNX B;  2HT1 A;  3ICE A;  2C35 B;  1L1O B;  2WB1 E;  3UDX A;  5FJ8 G;  4B3T L;  3T1H L;  4C3I H;  1I94 Q;  4BY1 G;  3PIP A;  4NXM Q;  1XJV A;  5C4X H;  4IOC A;  2ZJP A;  3S2H H;  3RN5 A;  1EOV A;  3L0O A;  1GKH A;  3BZK A;  4JI5 Q;  2NN6 I;  4JYA Q;  4JI2 Q;  1X65 A;  1VQJ A;  4R4O A;  3I7F A;  1AE2 A;  2D62 A;  2VQF L;  1Q82 C;  2Z6K A;  4YWM A;  4DR5 Q;  1K8G A;  1E1O A;  3GTO H;  4OWW B;  1HNW L;  1VQL A;  1TWA H;  3UDF A;  2Q2U A;  5GAH C;  4UY8 C;  1QUQ A;  2UXD L;  1KRT A;  4L5T A;  2F4V L;  4JV5 L;  3ULJ A;  1PYB A;  3M4P A;  3GTJ H;  2VQE Q;  4ALP A;  4DR4 Q;  4DR3 Q;  4DV4 Q;  3PO3 H;  3RNU A;  4BXX H;  2OTL A;  4QL5 A;  4YHH L;  4DV6 L;  2KBN A;  3NEL A;  4DV2 L;  3F2D A;  2CWA A;  4A75 A;  3FKI H;  3OYY A;  4LFB Q;  1WCM H;  1YEZ A;  5JJK A;  5IYC G;  4MZ9 A;  4BBS H;  4K0K Q;  1PHJ A;  3CME A;  3NEN A;  1IL2 A;  4R4C A;  4BA1 I;  2CKZ B;  3L7Z C;  3S14 H;  2K4K A;  1WJJ A;  3EN2 A;  4WJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...