4DR3K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr3K00
1HNZK 4YHHK 3J7YP 4DV6K 4OX9K 4JI5K 1I94K 4JI0K 4GKJK 4JI1K 5AJ3K 4LF8K 4B3TK 4JI6K 4LF9K 1XMQK 4V19S 4B3RK 1FJGK 4KHPK 2UXDK 4CW7B 4X65K 1N32K 2VQFK 3JAMO 4DUYK 1IBLK 4B3SK 5FLXO 4DV2K 5IWAK 4AQYK 4LFBK 2UU9K 2E5LK 4JI4K 1J5EK 1N34K 3J80O 4JI2K 4DR3K 2VQEK 3T1HK 4DR2K 4LF6K 1N36K 1HNXK 1XMOK 5LMUK 4JI7K 4LFAK 2UUBK 4CVNE 1N33K 4X64K 4DR7K 2HHHK 3J81O 1HR0K 1XNRK 4NXMK 2UUCK 4DUZK 4JI8K 5BR8K 4DR4K 4DR1K 5A2QO 4X62K 4B3MK 3T1YK 2UUAK 4JI3K 4LF5K 2UXCK 3J7AP 2ZM6K 4DV0K 1IBKK 4X66K 4JYAK 4YY3K 4GKKK 2UXBK 5LMNK 4JV5K 4LFCK 5IT9O 4DV4K 4DV7K 4DV3K 1IBMK 5LL6Z 4NXNK 4K0KK 1XNQK 4LF7K 3OTOK 4LF4K 1HNWK 4DV5K 4DR5K 4DV1K 4DR6K 2F4VK
chains in the Genus database with same CATH superfamily
2E2PA 3H6EA 4GNIA 3NH2A 3IFRA 4DQQA 1VSDA 4CF0A 1I94K 4OKKA 3AVNA 3V81A 5D3GA 4FWNA 1XMQK 2HHTA 4X65K 3O9UA 3ZYYX 2YCHA 2IIRA 5I3UA 4CEAA 1S1TA 4BRLA 3D2EA 3OYDA 2I7NA 4WQ4C 2D0PA 2P9UB 2G8IA 3WXKA 2UU9K 2HHSA 2QW9A 2E2NA 5J2PA 1UA1A 1VQLN 1LWEA 5M1KA 3QICA 1HKCA 2FBXA 4CJKA 3TWHA 4JD2B 4DR3K 4YOUA 2FBTA 4DFJA 1N36K 3O9QA 4M3YA 1N8RO 2WTUA 1HNXK 4FJNA 4CHZA 1RDUA 4CFAA 1NGDA 4CE9A 2QXFA 4KHNA 3DYAA 4B1ZA 4TSXA 2NUBA 3KK3A 4QCLA 3EZ5A 3BDPA 4NXMK 1BGXT 3AVJA 3L0QA 3V9UA 5JLHA 4KH5A 3KD1E 4A61A 2G8KA 1RFQA 3V1RA 3LZIA 3MX5A 1XHZA 2YV0X 4RW6A 3ENOA 1LAWA 4B3MK 2P5GA 3HO1A 4BC4A 1RGIA 1X1PA 2ZM6K 4NCGA 2PYJA 1WSIA 1RT6A 3QB0A 2O8DA 3SUOA 1HJRA 3SAFA 3RTVA 4IOAL 3HYFA 4CD3A 3LDSA 3O4WA 4B1YB 1BL3A 1Y97A 2YHXA 3MN9A 1U48A 3ULEB 4FLUA 4BG9A 4BDYA 3OYMA 4FLVA 5C15A 3VENA 2ZJPL 3A8YA 2WONA 3R6MA 1XNQK 3WNEA 3NVMA 4DU1A 3OYFA 2A40A 3ZEUA 1XUPO 1NG9A 2A5XA 3VQCA 4AF1A 4KHYA 4AILC 1HMVA 4LY7A 4OKJA 3SBGA 3OYBA 3SV3A 2GUPA 4JI5K 4QS9A 5ELZA 2QM1A 3KD5E 2OTJN 2HHWA 4FJ5A 2V52B 3LP2A 4LF8K 2V51B 4U7BA 1SV5A 5GIOA 4HWIA 3EYZA 4E1JA 3VQAA 1IBLK 3C6AA 1G15A 1T8EA 3OS0A 3EEQA 5J1EA 1HNIA 3ZX0A 1NOZA 3K9JA 3MAQA 2E4LA 4AM7A 5AQJA 4EIAA 2JLEA 1GLAG 1BQNA 4C8MA 1CZBA 2HF4A 4FJJA 3IKMA 4XEIA 3V1OA 4H03B 3CC7N 3RRGA 2Z1GA 4FM2A 4KI6A 4DTUA 1U45A 2VQEK 4B9NA 4BVOA 3UIQA 3V4IA 4GW6A 3FZHA 2O8DB 2O8CA 1NK9A 2Y1JA 4PWDA 3MEGA 4CVNE 1S1UA 1FK9A 2HBKA 1BHLA 2ATQA 4IJNA 1N5YA 5BR8K 4YOYA 3THWA 2NLXA 3F9MA 5T7BA 4QOZB 2LSNA 4IOXA 2YNFA 4M42A 1TVRA 5JS1A 3CM6A 2QWQA 2KFZA 3CQYA 4DWIA 3S3NA 4G9ZA 4AHSA 1RNHA 1BCOA 3I0SA 2Q0RA 5TKYA 1HX1A 3J8AA 4KHQA 2D0BA 1D9DA 2NZTA 2P51A 4NLCA 1VQPN 5GAHP 3LM9A 5AQVA 3LANA 1C0UA 2OYQA 1NGGA 2ZJQL 1KFSA 2WOMA 4B08A 1RDAA 1JCFA 2E6MA 3PO4A 1HYVA 3C6UA 3CMEN 4MFBA 3QINA 3AAQA 3PSFA 4WFNL 3I55N 3SUNA 4H0TB 1HLUA 2W41A 1TL3A 2D0CA 3OBYA 3MXMA 3DXKA 1J54A 1W0HA 4LH5A 4B9LA 4FW1A 4KHPK 2B6AA 5BN8A 4M3XA 1NJWA 4FWMA 4EP5A 3DLBA 3CJBA 3VTIA 1S5JA 3VQ4A 2A42A 4B8AB 3THXA 3L4IA 2CGKA 4M41A 5F0XA 2ZD1A 4YFUA 2GELA 3KLIA 4B1UB 1U6ZA 2R7YA 3ATVA 4ELTA 2DY4A 1RTDA 2P9LB 3THVA 1JLAA 4JI2K 4BGAA 4EZ9A 1Q7YO 3D45A 2GUIA 3SK3A 3T1HK 4A5BA 4H0YB 2ZGYA 2OPSA 2NRHA 5DMRA 2E6LA 5C42A 5FPMA 4N76A 2BE2A 4JI7K 2G8WA 3T3FA 1VQ4N 1NGBA 4H8KA 4CIGA 4M7YA 3R8EA 2HNDA 3T7ZA 2HHHK 4DR7K 1WBBA 3W3DA 4FJKA 3LP3A 4DUZK 4PL8A 2ZGZA 3ENHA 3AA3A 5KI6A 4BE2A 3J7AP 4A62A 1D4XA 4O5FA 3S41A 4DU4A 3LPUA 1IKWA 4H0OA 4FZYA 2HBLA 3QEPA 4O55A 1YI2N 1Q86O 3I8BA 2QWPA 4FK2A 1RT4A 4KH4A 4PKGA 2W6KA 1Z26A 3SPYA 4OPKA 3NBPA 3K59A 1KLMA 3HSTB 4C1NI 3RRHA 1EKEA 1K8KA 4JKHA 1WLJA 2HMPA 4OGEA 4DTSA 3TTFA 1ZBIA 3C65A 5GIPA 1T03A 3O08A 4F4KA 1YJNN 1RTHA 3CJAA 4WYBA 5AJ3K 3NF9A 2YNHA 3NCIA 4JI6K 4LF9K 3UE5A 4AM6A 3CCUN 3P38A 4IWVA 4BRCA 1WNSA 1BI4A 1BCMA 1ZBFA 4CF1A 1C1CA 3FZFA 4CJSA 4CZJA 1UWBA 2QXLA 4MQ3A 4HUFA 3EL2A 2E1ZA 5FPEA 4F2SA 3KKSA 4KB1A 1WSEA 2P9NA 3LP0A 3OW2M 5FRNA 1DTQA 3WEEA 5M1NA 1VSJA 1RT7A 2OANA 3HM8A 3VGKA 1EP4A 4Y1CA 4CGFA 4CHPA 2YNIA 3A5LC 4E1NA 4IXCA 1J6ZA 3H45C 4Z94A 1BISA 3MEEA 4E3SA 3VQPA 3CJ1A 1XMOK 4FJGA 4HUEA 4DFMA 2P5OA 2BH1A 1KC8O 2ZJRL 4CGGA 1GLEG 1IKVA 4HCCA 5EXWA 4WFAL 4DQ8A 2VG7A 4BRFA 2E8AA 3LAKA 2F7TA 3FE1A 3H3OB 3G6EN 5KPZA 4RW7A 4LD0A 3CCRN 2E1YA 3IMXA 3AV9A 5GAGP 3KK7A 4C23A 3BF3A 1A5VA 1T3VA 5FRMA 3NGIA 4GKKK 3QFUA 4PQUA 3H1QA 2OPQA 3HRGA 2IC3A 3VF6A 2XY8A 3P1GA 4E19A 3CCQN 1ZYQA 1HPZA 3QEXA 2FC0A 4NXNK 3KVGA 1Q9YA 4FK4A 4LF7K 4WFBL 4LF4K 2VCPA 1HUXA 3JYTA 5GAEP 4IFYA 4Z4HA 1IG9A 1SQKA 5HRPA 3E9LA 3RVCA 2QWRA 3QEVA 4DTMA 2FF6A 4CD1A 3GBTA 3K9KA 1OVQA 3VQBA 4JI0K 3D7EO 4CHQA 4CJ4A 4WE1A 3WEEB 4C1NK 4CBWA 4FLZA 2GWKA 3AVKA 2UXDK 3THYB 3HP9A 4M3RA 3DLEA 3P5JA 1JLBA 1VRUA 2NRRA 1QSLA 4KHWA 3HK2A 4ISEA 1KQSM 2O8BA 4FJ7A 2QI2A 2NRXA 4CK2A 3P4IA 4JNEA 5AQWA 5JS2A 3RR7A 4FJHA 2G8HA 5DM7L 1X3NA 1RDDA 1L3VA 1BO5O 5AQPA 3SZ2A 4Y0WA 4BE0A 2A3ZA 1N34K 3VQQA 3UKRA 4KHSA 4OPJA 3B8AX 4O5BA 1YHQN 4BY9C 1KSPA 4JEPA 4DQSA 5HOOA 4DSEA 1P8ZA 3OA9A 2QK9A 3VGLA 1BIZA 2RKIA 4I7FA 3OBWA 3UKUA 3VESA 3WQUA 1QSYA 5CZ2A 4FLYA 4DQIA 3CF5L 5BPNA 4CECA 4CK1A 5A2QO 1QSSA 4BRQA 1K8AO 1M1KO 4FLXA 1FKOA 1YTAA 4OJRA 4KTQA 3AVHA 3VQ5A 2B5JA 2P9IB 4MDAA 1RBRA 3MN5A 4FWSA 3SQ4A 2QKKA 4DV4K 5GINA 1X9MA 4PY5A 2Q31A 4BE1A 5AZIA 1GOCA 2P9KB 4DSIA 3K2PA 1T6DA 1YIJN 4H0VB 2O8BB 1KVAA 1JLGA 1XC3A 4DR6K 3L2UA 1WB9A 3VQEA 4BACA 4DSFA 1BDGA 5AZJA 3SYZA 4CK3A 4FWQA 1U2VB 1T6CA 1GOAA 3ZSWA 1LV5A 4JHDB 5AFUH 3C6TA 3EKUA 1SKRA 2ASPA 1UAXA 1WBDA 1CZ9A 1U49A 1R59O 3S3MA 3ENBA 4KPYA 4CJVA 1MA9B 1WAJA 3CFPA 1YXQA 4I2PA 5IWAK 4UQGA 3CCJN 4E1MA 3D2FA 3FZLA 1IKXA 5KTQA 1Z6RA 3DJCA 2NRTA 3HJFA 1MWKA 4KH6A 3PX0A 2PY5A 2E5LK 1E3MA 2FXUA 4CEQA 1OKJA 3TSUA 3DLKA 3OYKA 1NLVA 3LDOA 2UYTA 3DLGA 3VEVA 1C0MA 3VERA 1QS4A 3CCEN 4FZXC 1O13A 4BGBA 1LAVA 2KKZA 1YUWA 4LF6K 3AVLA 1OH7A 1B9FA 3N4QA 1J5OA 3CM5A 1QTMA 4JK9A 3DRRA 2D4WA 4BR7A 2IVOA 5E41A 5FROA 4FM0A 3V9WA 4BC3A 5HBMA 1HKBA 3G10A 1BIUA 3P39A 1VAZA 2GX9A 3ZT1A 4DF4A 4H5VA 1QZ6A 3SPZA 4A2BA 3DLHA 5KPRA 4KTZA 3KLEA 4C8NA 2BUPA 3QERA 4BQLA 4ICLA 4CIEA 1M90O 1TYQB 3T19A 3GOIA 1SL2A 4CEOA 1NMNA 2Z1IA 1NJXA 1QQNA 4Z4GA 1MWMA 2GWJA 1LW0A 3OS2A 4CGIA 2VGMA 3FFIA 1IH7A 3H08A 1IBMK 3AA2A 4B9MA 3MECA 2YJFA 3AO2A 3NF6A 3DWLA 4I2QA 4HUGA 1E4GT 4J2AA 3SCXA 3MDQA 4WCEL 3ZT2A 4NCAA 3AVGA 2P9SB 4CJRA 1VSKA 3HP6A 2GEMA 4YOXA 4KKOA 1JXEA 4W5OA 2DTUA 5HRSA 4GKJK 3O1BA 4IEIA 2EX3A 1KFDA 4GVMA 3CJCA 1SKWA 4DLGA 2AP1A 4OKEA 3PV8A 2W6LA 1BA1A 2XY5A 3JS6A 4W5QA 3CERA 3O3GA 3WQTA 2VWBA 4BR2A 2V7YA 4JK8A 4MDBA 3G71N 4LFBK 3D2EB 4FJIA 4DTXA 3L2VA 1EWRA 1RT3A 3WXLA 4KBOA 2OA8A 3K57A 2ASOA 3RMAA 1L3UA 2DFEA 2QWMA 3VQ6A 4FJMA 1ESVA 3ZETA 2F96A 4OVLA 2A41A 5B8HA 1JLEA 2Q97A 5AQOA 3ID6A 2BDPA 5HRRA 4Z4FA 2JWKA 4U67L 1L5UA 1V4TA 1QZ5A 2UUCK 1NK4A 1HQEA 4BVPA 4IBNA 5E84A 3HM9A 3K5MA 1NGEA 1QQCA 4N56A 2UXCK 4E7JA 1E4FT 1MDUB 4X66K 4EHUA 4OGCA 3HPOA 3VEXA 4QS8A 4L3QA 2W42A 5EU7A 1RILA 2IVPA 3U9ZA 1ZBLA 4CJUA 5KQDA 3CQXA 3V9ZA 4CIFA 3RSEA 3SQ0A 4DTOA 1FXXA 4OPHA 4ILHA 1EXQA 4DV1K 4CZKA 2V7ZA 3AVMA 4JKGA 3TR8A 3ZEUB 4YHHK 5CZ1A 1XWLA 2HB5A 4JS4A 3LALA 2HHUA 1RBSA 4OX9K 3SQ2A 2HBJA 4W5TA 3WXIA 4JI1K 1VHXA 4FOEA 3NE6A 5JLFA 1S1WA 3FFKB 4AHRA 4CW7B 4FJ9A 2IVNA 3TAMA 4GV6A 1WN7A 2IAJA 3OYGA 5SZTA 3O3HA 3E66A 3JAMO 2A1SA 2JWLA 3ATUA 3C6HA 1XC9A 4B9TA 3BF1A 1HQUA 1YTUA 1OVYA 4KAZA 5CHIA 1C0TA 5J2NA 4CEBA 3HVRA 3AA4A 3NH1A 3NGYA 3DRPA 4QAGA 1J5EK 1S3XA 5CR4A 4DKWA 3B6OA 3OY9A 1VQ7N 4IO9L 3OYNA 4FJLA 4FXDA 3LM2A 2DFHA 3E1YA 2X6SA 3AY9A 1DEJA 1RBVA 3CHWA 4YOWA 3K5NA 5AQNA 4LC9B 4BRHA 3H46O 3AARA 2O8CB 4CGHA 2UUBK 4CFCA 4X64K 3ZT3A 5J2MA 4CZEA 1ITGA 2HSTA 4QS7A 4FYDA 3THWB 4C8LA 3Q7BA 4H5RA 4K43A 3O3FA 3TI0A 2FSKA 3OYJA 4B1VA 3LDPA 3DRSA 1IBKK 1WOQA 3CD6N 1Q9XA 5AQGA 3CI5A 3AGRA 2AA4A 2JGUA 1C1BA 1KD1O 1GLJO 3TSQA 4JV5K 4IDKA 1ZXOA 4DFKA 3OVNA 4JS5A 4H5WA 4DLEA 2Q1NA 1RDWX 5AQIA 5AQTA 4JKBA 5BN9A 3SMSA 1C0GA 2FLOA 1HNWK 4Z4EA 4DSKA 4F3OA 1N6QA 4IFVA 5F2RA 3EE8A 3H3NO 3U4LA 3MCAB 2PYLA 1DT9A 4JK7A 4XH1A 5HLFA 3VETA 3VEOA 2F4VK 1HNZK 4CGDA 1XHXA 4CZHA 5HP1A 3DXKB 4O44A 1JLCA 3VOVA 5DM6L 1NOYA 3DLRA 4JKAA 3K0SA 1VQKN 2VYPA 3HSCA 3O4NA 1VSHA 1ASUA 3THXB 1DKGD 2NRWA 4DS5A 4PA1A 2YI1A 3SUPA 4AHVA 1QQOA 1IJJA 3V9SA 3GDQA 1ATRA 3NMUA 4RW4A 2PBDA 5M1PA 4R5PA 4ZTFA 1RDBA 1RTIA 1VQ6N 4I6MA 2BANA 4JI4K 4M3TA 4NO7A 2O8FA 2HBMA 4BRMA 4HTLA 3HXMA 3MWPA 3ULDA 3KJVA 2CH5A 2BTFA 1YITN 4J8FA 4AHUA 2A1RA 3CPEA 4CBUA 1X9JA 4NYNA 4K41A 1J53A 4E7LA 4KHUA 1XNRK 1NGCA 4L8RB 4JKDA 1ZC6A 3VF4A 1REVA 3G0ZA 3TAQA 4IG3A 4DV0K 3AVCA 3V9XA 4DQRA 5JVHL 1OH8A 4CFBA 2P1JA 3LWMA 1OH5A 3QBWA 4W5RA 4IKFA 4JLHA 2GTDA 3F2KA 5EVZA 3ITHA 3M8SA 3D6RA 5JICA 3IDHA 4E7HA 1KVBA 4WQ5C 4CF8A 3BZKA 2O8EA 1IG8A 1S1XA 4O0IA 3A5MC 4CBXA 2I7PA 5C2DA 3P31A 1CXUA 1GLDG 3R1XA 4DV5K 3QEIA 1K8KB 1A5WA 1VSMA 1GLLO 3M8QA 1F21A 4ILJA 3HVTA 2RPIA 3FLCO 4G1QA 1J9AA 1KXPA 3TAFA 3O6WA 1B92A 1NM1A 2P9PA 3KK2A 4YDUA 3PY8A 4PKHA 5ADXH 4CHOA 3VQ9A 3FZMA 3QEWA 2VWJA 3U9DA 4B3SK 5FLXO 2OZSA 3MXIA 3SBTA 1BI4B 3RMCA 4BREA 4CJQA 3MEDA 3C7NA 2XY6A 1NJYA 5AQFA 3AVIA 1JJ2M 1JXBA 3ZSYA 2P9NB 3HOSA 2H3GX 1OH6A 3RMBA 5AQSA 4MLEA 5TKWA 4M63C 3QETA 1XI1A 4KREA 3OHRA 1NJIO 4DR2K 1JL1A 4O8UA 2FF3B 1LWFA 5KPTA 1I3AA 4ELVA 3LL3A 4XH4A 4DFPA 4C8KA 3WNGA 3NF7A 2QKBA 3ZX2A 4DG1A 3SJJA 2ETJA 5HRNA 2KZZA 3J81O 2O8EB 3LP1A 2CGJA 4IDHA 1WSGA 3FZKA 4DR1K 1W97L 1W7AA 4WQ4A 4OPAA 3ZX3A 2ASMA 1EQYA 2KW4A 3N4PA 5EOYA 1WSFA 1YVNA 2X74A 3QIPA 1TK8A 1KAXA 4CJLA 1V4SA 4PL7A 5FPDA 3DAWA 3SLCA 5AQZA 5LMNK 5BREA 4DSLA 1RT2A 1Z05A 3QDKA 4FWRA 4RWTA 3PX4A 1KRPA 5LJVA 3AGKA 2FBVA 2P9PB 5FDLA 3IUCA 1ASWA 5CY4A 2CH6A 5KQ8A 3O9TA 4B1WB 1WAFA 3OTOK 2VGNA 1S9EA 3K5OA 1DLOA 1S6QA 4JAXA 4XH5A 2KZMA 3EY1A 5C25A 1DTTA 3C7NB 1TK0A 3L2QA 3SNNA 1L3TA 4FOIA 5AQQA 1NK5A 4EZ6A 4H4MA 3Q7CA 3VGMA 1GLBG 3ZSOA 2XY7A 1FJGK 2WC9A 4YNQA 4MO5A 2D0AA 3O4QA 3KWIA 4Z4CA 4GV9A 4FL9A 4O8KA 4ELUA 3G4SN 3GG4A 4DUYK 4ISGA 5CYMA 3TTDA 5CE3A 3C95A 1QHTA 4DU3A 4DV2K 3I33A 3U3GA 4H5TA 1YT3A 4CF2A 3CCMN 2P9UA 2O4GA 3M1FA 3HPGA 3EE9A 3HBTA 3VPZA 4F8RA 4K42A 1SS6A 3O8MA 5AQKA 4O0JA 4JRQA 4JD2A 3UKRB 4H4OA 4MO4A 2Q0UA 3VQ7A 3LZJA 5CYQA 1RBUA 4BRIA 4CJWA 5AQLA 4IOCL 4E89A 4MLHA 1TAQA 3PLAA 4UY8O 2F9WA 1LOTB 3C94A 3MWTA 4KV8A 3PX6A 3VEYA 1KAZA 2IGIA 1TK5A 4EAHD 5EX5A 3OYAA 1RT1A 3UKUB 2GBZA 1RCHA 1RTJA 4EFHA 4CJ5A 1BU6O 3ZSQA 3NDKA 1NBWA 3SUQA 3ZSVA 4BRPA 4JYAK 2B4JA 5BPLA 3TPQA 4F2RA 4K25A 4CERA 3QLHA 3I56N 3HT3A 1YJ9N 3GE1A 3HTVA 5C12A 3ISNC 1GLCG 3ULEA 1K73O 3OS1A 4K8ZA 1TKDA 4FM1A 4CHNA 2F9TA 4IG0A 5E26A 1LCUA 3EN9A 3PO5A 1KAYA 5AZIB 1NU0A 4DMNA 2OPRA 2D5RA 3U3YA 3C0BA 2EHGA 5C10A 3KHYA 3KK1A 3CJ9A 1CLQA 1QVFM 4BC5A 3J7YP 4RW8A 5AZJB 4FLTA 1KVCA 4JKEA 3WXMB 3PSIA 5SWMA 4BDZA 2VWKA 3WXJA 1EWQA 4IEEA 5DK5A 5BRFA 3FGUA 4B3RK 2E88A 2Z1JA 3SJHA 4K8XA 3NVKA 2WBNA 1HPMA 3DXMA 1KLNA 4M3WA 1VSLA 3RWUA 1BG3A 3P83D 3KLHA 4OO1J 4BROA 1IV0A 4AHCA 4CEEA 1X3MA 3W0LA 1BWFO 4M7XA 3TAEA 1W2BM 1S72N 4R79A 3D2FB 1BQMA 3V6DA 2HVHA 3T69A 4AH9A 4DSJA 4M45A 1WSJA 4BDPA 3MK6A 3L6QA 4BR4A 2YKMA 1Q8IA 4FWOA 4RG8A 3K58A 3DLLL 4FVUA 1TAUA 3KLFA 4KRFA 2KHOA 4CEDA 1SKSA 3QESA 4FZZA 1JKHA 3AVBA 3M3ZA 3QNNA 3HZ6A 1D8YA 4KTWA 4ZHRA 2E2OA 3BY5A 1NKCA 1HR0K 2FSNA 5C2FA 2DPNA 2RE2A 4FVMA 1UA0A 1BOTO 3DMJA 4X62K 2UUAK 3CIPA 4BRAA 3VN5A 4YY3K 5AR0A 2UXBK 1NK0A 5M1OA 2HHVA 4FLWA 2ZE2A 4N5SA 2HHQA 3NF8A 4FWKA 1G99A 1NK7A 1I39A 2HVIA 2W40A 1MU2A 5IT9O 4Y1DA 4CEFA 3U8XA 1Z25A 3L2RA 5AFUA 3UB5A 3DXMB 5HROA 1VQON 2F8TA 4CJ3A 1LWCA 4JKCA 1S1VA 3O9SA 4FSVA 4ISFA 1SUQA 4M3UA 1YVUA 4IO8A 1CXQA 3TABA 2XHBA 3O5BA 4DCHA 3L3UA 5BRDA 5BPMA 4DQPA 5LJWA 1JCEA 1YF5L 3CFRA 1NGAA 5FPNA 4LH4A 2Q36A 3OYEA 3AO3A 4BWJA 3MN6A 4A59A 4B3TK 4V19S 2RHKA 1KCFA 4BG8A 3CFOA 4CJPA 3PUFA 2GV9A 1TUUA 3ASMA 1BA0A 2YKNA 1A5XA 3TSPA 3SMPA 4BC2A 4CZGA 1D9FA 3R9PA 4Z4IA 2CGLA 3HI0A 3HPHA 3MMVA 3V1QA 2AJQA 4AQYK 1FKPA 1VSEA 3WNFA 4B3OA 4FWPA 3LDNA 2QA4N 4DTPA 2YHWA 2P9LA 3M6GA 3MCPA 3F73A 3VEZA 2VG5A 2HMIA 3ZETB 1VQMN 1S22A 3A2FA 3I0RA 4BQZA 4FJ8A 1SZ2A 2G8FA 3QBXA 3CC4N 4W5NA 4M3ZA 4LFAK 2QWLA 1JCGA 2XO7A 4I9QA 4C8OA 4JI8K 4CZFA 1GOBA 3ID8A 1U4BA 3T1YK 2PZSA 2YX6A 4O4GA 3TTCA 1FW6A 3SAHA 3L4QA 1B9DA 4H0XB 1WSHA 4CZIA 1BUPA 4ID5A 4CGJA 4IJAA 1DGKN 3VF2A 4BR0A 3BUZB 2DFFA 4B9SA 3OJUA 4B8CA 2FBYA 2OZMA 2D0OA 1YAGA 2IDOA 3L3VA 3G25A 3JSMA 2WUSA 3ZCMA 4LFCK 1C0FA 3AO5A 5BR9A 2HF3A 3RMDA 4DHYA 4KI4A 4DTRA 3HOTA 3AO1A 5LL6Z 4WQ5A 3DOLA 2NRVA 3RSEB 3S9HA 1GLFO 2FSJA 1T44A 3TARA 4HTUA 3BGRA 4J2EA 5H1SQ 1EO1A 3TAPA 4B9QA 3IS9A 3D0PA 4JKGB 4J2BA 2PFUA 2EWSA 4BRKA 2HNZA 1XQSC 4LSLA 3VA3A 3DI6A 3F5TA 3GL1A 2Q2RA 3TU5A 4AHTA 5KRTA 4YOVA 3TANA 5C24A 4CESA 1TKZA 2IOCA 3CJ7A 4CI6A 4B9VA 1WUAA 4JKFA 4H5NA 1YJWN 1X9SA 3OYCA 2VG6A 3VMFB 3CPWM 3AVFA 3LDLA 3AAPA 5J2QA 1HKGA 2OCEA 4Q0BA 5I42A 1RT5A 5BRHA 3KLGA 4GVEA 4Q5VA 3QFPA 1ILYA 3CG7A 1VK0A 3M8RA 4J2DA 2KFNA 3E01A 2D1KA 1SAZA 4NB4A 4NCBA 5AQRA 4E0DA 4XIUA 3KTQA 3A5OC 3O9RA 4FPBA 2ITMA 3EZWA 1T7PA 4E7IA 1EETA 1VQ8N 2X6NA 4CZMA 3NGZA 4CZLA 2PAVA 1ATNA 1VRTA 1HRHA 3KWGA 1L3SA 4DF8A 1NJZA 1N33K 1JL2A 3IG1A 4OLAA 3AA5X 4EHTA 5F1XA 2X78A 4B9UA 5I9EB 1Q18A 3I8DA 4FK0A 1UOCA 4DR4K 3IAYA 2ZQBA 1VSFA 2G8UA 4LF5K 4BRNA 1HJOA 3AVAA 4NYFA 1NK8A 4BRGA 1JLQA 1NKEA 4EP4A 5AQYA 5M1QA 2NNWA 3SQ1A 1T05A 2YHAA 1K6YA 2A6AA 4FJXA 4DV3K 3NH0A 3L2WA 2OPPA 4K0KK 5AQXA 5KRSA 1TL1A 2KQ2A 5JVGL 3QMLA 4DTNA 2E20A 5LY3A 2YHBA 1NGJA 4BR9A 3WNHA 3RR8A 4FO0A 3ZSXA 4DV6K 1C1AA 4A5AA 1QHAA 2QWNA 1W9HA 3O1WA 3NFAA 3KKRA 1NWKA 3THYA 2QTDA 4BWMA 4FPAA 1Q82O 1N32K 4KFBA 1IO2A 1CZAN 4IZ9A 3VQ8A 4PHTX 4FCYA 4CCHA 3ZT4A 3VQDA 3WT0A 4Z0UA 4GMJB 5HL7L 3IRXA 3DOKA 3VEWA 3L8BA 3LWLA 3OJSA 3ZLJA 2RF2A 4JRPA 4RCHA 1TUYA 3FR0A 4I6MB 2I5JA 1Q81O 5C0YA 1SL0A 2O8FB 1JLFA 2XRIA 1TGOA 3CYMA 5AQUA 1NGIA 5JMVA 3SAGA 5EY4A 5LMUK 2HW3A 4GY2B 4N47A 3DM2A 1RDCA 3NHGA 3HL8A 3KIOA 4E7KA 3PIOL 4H0PA 4CFDA 4HVJA 5AQHA 3LDQA 4RTFD 4N41A 3QIOA 4CF9A 4DTJA 3SI6A 3TAGA 4JN4A 4JI3K 2HNYA 2RN2A 3J7ZO 5KGXA 3OYIA 3E9PA 1C6VA 2BGGA 3U6FA 4ID1A 3VA0A 1X9WA 2P9IA 4A57A 4CJTA 1QE1A 4WF9L 3A5NC 2E2QA 1P90A 3CETA 3JXUA 2P9KA 4I9LA 3M8PA 2Z1HA 3O80A 4YOTA 3NAEA 5M1FA 1S9GA 5GADP 2HHXA 3CC2N 4DR5K 2F8SA 2YJEA 1H1VA 2YNGA 2HOEA 3LPTA 5KGWA 1D5AA 2YHYA 4LSNA 2ZWHA 3T1AA 1U2VA 1NGHA 4CEZA 2NRZA 4BR5A 4CJFA 3CXCM 4DS4A 4JHDA 1ZBSA 3AO4A 4NLBA 3SV4A 2ZF5O 2VQFK 3EKSA 1NGFA 3MX2A 1RBTA 3S3OA 3CQ8A 1TV6A 4YORA 2ITGA 2Q3SA 4PUOA 3OYHA 4HHTA 2IS3A 2KLAA 3MXJA 3CCVN 1VQ5N 5K14A 3BEXA 3ZSRA 3VTHA 1IKYA 1VQNN 3J80O 4RW9A 1NK6A 1HNVA 3ZT0A 4PKIA 4KB0A 2Y1IA 1U47A 2WFBA 3MN7A 3PIPL 4B1XB 4FWLA 3R3LA 3CCSN 3H1VX 4GV3A 1R0AA 1K9MO 3LAMA 4CJEA 1HYZA 3F9KA 1NMDA 3BZCA 3QO9A 1Y64A 4KO0A 3QNOA 2OTLN 1S6PA 4ILGB 3OYLA 1QQMA 1VQ9N 4CJ7A 1ASVA 1EX4A 4HCBA 1NKBA 3ALYA 1LW2A 3E9OA 1TKTA 3CCLN 5MLCQ 3B6PA 3CMAN 4DB3A 3K5LA 1KTQA 1TKXA 2J4RA 1ATSA 1TYQA 1U04A 4YDUC 3A0IX 1ZBUA 2KTQA 1SL1A 4CHYA 1O1WA 2G8VA 4A2AA 3WUHA 4FW2A 4OLBA 3M5RA 4DV7K 1HYSA 1VSIA 2QWOA 4ZTJA 4BRDA 5AQMA 2O4IA 3KZBA 4IFEA 3EO3A 5ADXA 4F3TA 3BP8A 1QVGM 1NNEA 1ZBHA 2QEXN 2P9SA 3ZSZA 4F9OA
chains in the Genus database with same CATH topology
1HNZK 4YHHK 3J7YP 4DV6K 4OX9K 4JI5K 1I94K 4JI0K 4GKJK 4JI1K 5AJ3K 4LF8K 4B3TK 4JI6K 4LF9K 1XMQK 4V19S 4B3RK 1FJGK 4KHPK 2UXDK 4CW7B 4X65K 1N32K 2VQFK 3JAMO 4DUYK 1IBLK 4B3SK 5FLXO 4DV2K 5IWAK 4AQYK 4LFBK 2UU9K 2E5LK 4JI4K 1J5EK 1N34K 3J80O 4JI2K 4DR3K 2VQEK 3T1HK 4DR2K 4LF6K 1N36K 1HNXK 1XMOK 5LMUK 4JI7K 4LFAK 2UUBK 4CVNE 1N33K 4X64K 4DR7K 2HHHK 3J81O 1HR0K 1XNRK 4NXMK 2UUCK 4DUZK 4JI8K 5BR8K 4DR4K 4DR1K 5A2QO 4X62K 4B3MK 3T1YK 2UUAK 4JI3K 4LF5K 2UXCK 3J7AP 2ZM6K 4DV0K 1IBKK 4X66K 4JYAK 4YY3K 4GKKK 2UXBK 5LMNK 4JV5K 4LFCK 5IT9O 4DV4K 4DV7K 4DV3K 1IBMK 5LL6Z 4NXNK 4K0KK 1XNQK 4LF7K 3OTOK 4LF4K 1HNWK 4DV5K 4DR5K 4DV1K 4DR6K 2F4VK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ K;  4YHH K;  3J7Y P;  4DV6 K;  4OX9 K;  4JI5 K;  1I94 K;  4JI0 K;  4GKJ K;  4JI1 K;  5AJ3 K;  4LF8 K;  4B3T K;  4JI6 K;  4LF9 K;  1XMQ K;  4V19 S;  4B3R K;  1FJG K;  4KHP K;  2UXD K;  4CW7 B;  4X65 K;  1N32 K;  2VQF K;  3JAM O;  4DUY K;  1IBL K;  4B3S K;  5FLX O;  4DV2 K;  5IWA K;  4AQY K;  4LFB K;  2UU9 K;  2E5L K;  4JI4 K;  1J5E K;  1N34 K;  3J80 O;  4JI2 K;  4DR3 K;  2VQE K;  3T1H K;  4DR2 K;  4LF6 K;  1N36 K;  1HNX K;  1XMO K;  5LMU K;  4JI7 K;  4LFA K;  2UUB K;  4CVN E;  1N33 K;  4X64 K;  4DR7 K;  2HHH K;  3J81 O;  1HR0 K;  1XNR K;  4NXM K;  2UUC K;  4DUZ K;  4JI8 K;  5BR8 K;  4DR4 K;  4DR1 K;  5A2Q O;  4X62 K;  4B3M K;  3T1Y K;  2UUA K;  4JI3 K;  4LF5 K;  2UXC K;  3J7A P;  2ZM6 K;  4DV0 K;  1IBK K;  4X66 K;  4JYA K;  4YY3 K;  4GKK K;  2UXB K;  5LMN K;  4JV5 K;  4LFC K;  5IT9 O;  4DV4 K;  4DV7 K;  4DV3 K;  1IBM K;  5LL6 Z;  4NXN K;  4K0K K;  1XNQ K;  4LF7 K;  3OTO K;  4LF4 K;  1HNW K;  4DV5 K;  4DR5 K;  4DV1 K;  4DR6 K;  2F4V K; 
#chains in the Genus database with same CATH topology
 2E2P A;  3H6E A;  4GNI A;  3NH2 A;  3IFR A;  4DQQ A;  1VSD A;  4CF0 A;  1I94 K;  4OKK A;  3AVN A;  3V81 A;  5D3G A;  4FWN A;  1XMQ K;  2HHT A;  4X65 K;  3O9U A;  3ZYY X;  2YCH A;  2IIR A;  5I3U A;  4CEA A;  1S1T A;  4BRL A;  3D2E A;  3OYD A;  2I7N A;  4WQ4 C;  2D0P A;  2P9U B;  2G8I A;  3WXK A;  2UU9 K;  2HHS A;  2QW9 A;  2E2N A;  5J2P A;  1UA1 A;  1VQL N;  1LWE A;  5M1K A;  3QIC A;  1HKC A;  2FBX A;  4CJK A;  3TWH A;  4JD2 B;  4DR3 K;  4YOU A;  2FBT A;  4DFJ A;  1N36 K;  3O9Q A;  4M3Y A;  1N8R O;  2WTU A;  1HNX K;  4FJN A;  4CHZ A;  1RDU A;  4CFA A;  1NGD A;  4CE9 A;  2QXF A;  4KHN A;  3DYA A;  4B1Z A;  4TSX A;  2NUB A;  3KK3 A;  4QCL A;  3EZ5 A;  3BDP A;  4NXM K;  1BGX T;  3AVJ A;  3L0Q A;  3V9U A;  5JLH A;  4KH5 A;  3KD1 E;  4A61 A;  2G8K A;  1RFQ A;  3V1R A;  3LZI A;  3MX5 A;  1XHZ A;  2YV0 X;  4RW6 A;  3ENO A;  1LAW A;  4B3M K;  2P5G A;  3HO1 A;  4BC4 A;  1RGI A;  1X1P A;  2ZM6 K;  4NCG A;  2PYJ A;  1WSI A;  1RT6 A;  3QB0 A;  2O8D A;  3SUO A;  1HJR A;  3SAF A;  3RTV A;  4IOA L;  3HYF A;  4CD3 A;  3LDS A;  3O4W A;  4B1Y B;  1BL3 A;  1Y97 A;  2YHX A;  3MN9 A;  1U48 A;  3ULE B;  4FLU A;  4BG9 A;  4BDY A;  3OYM A;  4FLV A;  5C15 A;  3VEN A;  2ZJP L;  3A8Y A;  2WON A;  3R6M A;  1XNQ K;  3WNE A;  3NVM A;  4DU1 A;  3OYF A;  2A40 A;  3ZEU A;  1XUP O;  1NG9 A;  2A5X A;  3VQC A;  4AF1 A;  4KHY A;  4AIL C;  1HMV A;  4LY7 A;  4OKJ A;  3SBG A;  3OYB A;  3SV3 A;  2GUP A;  4JI5 K;  4QS9 A;  5ELZ A;  2QM1 A;  3KD5 E;  2OTJ N;  2HHW A;  4FJ5 A;  2V52 B;  3LP2 A;  4LF8 K;  2V51 B;  4U7B A;  1SV5 A;  5GIO A;  4HWI A;  3EYZ A;  4E1J A;  3VQA A;  1IBL K;  3C6A A;  1G15 A;  1T8E A;  3OS0 A;  3EEQ A;  5J1E A;  1HNI A;  3ZX0 A;  1NOZ A;  3K9J A;  3MAQ A;  2E4L A;  4AM7 A;  5AQJ A;  4EIA A;  2JLE A;  1GLA G;  1BQN A;  4C8M A;  1CZB A;  2HF4 A;  4FJJ A;  3IKM A;  4XEI A;  3V1O A;  4H03 B;  3CC7 N;  3RRG A;  2Z1G A;  4FM2 A;  4KI6 A;  4DTU A;  1U45 A;  2VQE K;  4B9N A;  4BVO A;  3UIQ A;  3V4I A;  4GW6 A;  3FZH A;  2O8D B;  2O8C A;  1NK9 A;  2Y1J A;  4PWD A;  3MEG A;  4CVN E;  1S1U A;  1FK9 A;  2HBK A;  1BHL A;  2ATQ A;  4IJN A;  1N5Y A;  5BR8 K;  4YOY A;  3THW A;  2NLX A;  3F9M A;  5T7B A;  4QOZ B;  2LSN A;  4IOX A;  2YNF A;  4M42 A;  1TVR A;  5JS1 A;  3CM6 A;  2QWQ A;  2KFZ A;  3CQY A;  4DWI A;  3S3N A;  4G9Z A;  4AHS A;  1RNH A;  1BCO A;  3I0S A;  2Q0R A;  5TKY A;  1HX1 A;  3J8A A;  4KHQ A;  2D0B A;  1D9D A;  2NZT A;  2P51 A;  4NLC A;  1VQP N;  5GAH P;  3LM9 A;  5AQV A;  3LAN A;  1C0U A;  2OYQ A;  1NGG A;  2ZJQ L;  1KFS A;  2WOM A;  4B08 A;  1RDA A;  1JCF A;  2E6M A;  3PO4 A;  1HYV A;  3C6U A;  3CME N;  4MFB A;  3QIN A;  3AAQ A;  3PSF A;  4WFN L;  3I55 N;  3SUN A;  4H0T B;  1HLU A;  2W41 A;  1TL3 A;  2D0C A;  3OBY A;  3MXM A;  3DXK A;  1J54 A;  1W0H A;  4LH5 A;  4B9L A;  4FW1 A;  4KHP K;  2B6A A;  5BN8 A;  4M3X A;  1NJW A;  4FWM A;  4EP5 A;  3DLB A;  3CJB A;  3VTI A;  1S5J A;  3VQ4 A;  2A42 A;  4B8A B;  3THX A;  3L4I A;  2CGK A;  4M41 A;  5F0X A;  2ZD1 A;  4YFU A;  2GEL A;  3KLI A;  4B1U B;  1U6Z A;  2R7Y A;  3ATV A;  4ELT A;  2DY4 A;  1RTD A;  2P9L B;  3THV A;  1JLA A;  4JI2 K;  4BGA A;  4EZ9 A;  1Q7Y O;  3D45 A;  2GUI A;  3SK3 A;  3T1H K;  4A5B A;  4H0Y B;  2ZGY A;  2OPS A;  2NRH A;  5DMR A;  2E6L A;  5C42 A;  5FPM A;  4N76 A;  2BE2 A;  4JI7 K;  2G8W A;  3T3F A;  1VQ4 N;  1NGB A;  4H8K A;  4CIG A;  4M7Y A;  3R8E A;  2HND A;  3T7Z A;  2HHH K;  4DR7 K;  1WBB A;  3W3D A;  4FJK A;  3LP3 A;  4DUZ K;  4PL8 A;  2ZGZ A;  3ENH A;  3AA3 A;  5KI6 A;  4BE2 A;  3J7A P;  4A62 A;  1D4X A;  4O5F A;  3S41 A;  4DU4 A;  3LPU A;  1IKW A;  4H0O A;  4FZY A;  2HBL A;  3QEP A;  4O55 A;  1YI2 N;  1Q86 O;  3I8B A;  2QWP A;  4FK2 A;  1RT4 A;  4KH4 A;  4PKG A;  2W6K A;  1Z26 A;  3SPY A;  4OPK A;  3NBP A;  3K59 A;  1KLM A;  3HST B;  4C1N I;  3RRH A;  1EKE A;  1K8K A;  4JKH A;  1WLJ A;  2HMP A;  4OGE A;  4DTS A;  3TTF A;  1ZBI A;  3C65 A;  5GIP A;  1T03 A;  3O08 A;  4F4K A;  1YJN N;  1RTH A;  3CJA A;  4WYB A;  5AJ3 K;  3NF9 A;  2YNH A;  3NCI A;  4JI6 K;  4LF9 K;  3UE5 A;  4AM6 A;  3CCU N;  3P38 A;  4IWV A;  4BRC A;  1WNS A;  1BI4 A;  1BCM A;  1ZBF A;  4CF1 A;  1C1C A;  3FZF A;  4CJS A;  4CZJ A;  1UWB A;  2QXL A;  4MQ3 A;  4HUF A;  3EL2 A;  2E1Z A;  5FPE A;  4F2S A;  3KKS A;  4KB1 A;  1WSE A;  2P9N A;  3LP0 A;  3OW2 M;  5FRN A;  1DTQ A;  3WEE A;  5M1N A;  1VSJ A;  1RT7 A;  2OAN A;  3HM8 A;  3VGK A;  1EP4 A;  4Y1C A;  4CGF A;  4CHP A;  2YNI A;  3A5L C;  4E1N A;  4IXC A;  1J6Z A;  3H45 C;  4Z94 A;  1BIS A;  3MEE A;  4E3S A;  3VQP A;  3CJ1 A;  1XMO K;  4FJG A;  4HUE A;  4DFM A;  2P5O A;  2BH1 A;  1KC8 O;  2ZJR L;  4CGG A;  1GLE G;  1IKV A;  4HCC A;  5EXW A;  4WFA L;  4DQ8 A;  2VG7 A;  4BRF A;  2E8A A;  3LAK A;  2F7T A;  3FE1 A;  3H3O B;  3G6E N;  5KPZ A;  4RW7 A;  4LD0 A;  3CCR N;  2E1Y A;  3IMX A;  3AV9 A;  5GAG P;  3KK7 A;  4C23 A;  3BF3 A;  1A5V A;  1T3V A;  5FRM A;  3NGI A;  4GKK K;  3QFU A;  4PQU A;  3H1Q A;  2OPQ A;  3HRG A;  2IC3 A;  3VF6 A;  2XY8 A;  3P1G A;  4E19 A;  3CCQ N;  1ZYQ A;  1HPZ A;  3QEX A;  2FC0 A;  4NXN K;  3KVG A;  1Q9Y A;  4FK4 A;  4LF7 K;  4WFB L;  4LF4 K;  2VCP A;  1HUX A;  3JYT A;  5GAE P;  4IFY A;  4Z4H A;  1IG9 A;  1SQK A;  5HRP A;  3E9L A;  3RVC A;  2QWR A;  3QEV A;  4DTM A;  2FF6 A;  4CD1 A;  3GBT A;  3K9K A;  1OVQ A;  3VQB A;  4JI0 K;  3D7E O;  4CHQ A;  4CJ4 A;  4WE1 A;  3WEE B;  4C1N K;  4CBW A;  4FLZ A;  2GWK A;  3AVK A;  2UXD K;  3THY B;  3HP9 A;  4M3R A;  3DLE A;  3P5J A;  1JLB A;  1VRU A;  2NRR A;  1QSL A;  4KHW A;  3HK2 A;  4ISE A;  1KQS M;  2O8B A;  4FJ7 A;  2QI2 A;  2NRX A;  4CK2 A;  3P4I A;  4JNE A;  5AQW A;  5JS2 A;  3RR7 A;  4FJH A;  2G8H A;  5DM7 L;  1X3N A;  1RDD A;  1L3V A;  1BO5 O;  5AQP A;  3SZ2 A;  4Y0W A;  4BE0 A;  2A3Z A;  1N34 K;  3VQQ A;  3UKR A;  4KHS A;  4OPJ A;  3B8A X;  4O5B A;  1YHQ N;  4BY9 C;  1KSP A;  4JEP A;  4DQS A;  5HOO A;  4DSE A;  1P8Z A;  3OA9 A;  2QK9 A;  3VGL A;  1BIZ A;  2RKI A;  4I7F A;  3OBW A;  3UKU A;  3VES A;  3WQU A;  1QSY A;  5CZ2 A;  4FLY A;  4DQI A;  3CF5 L;  5BPN A;  4CEC A;  4CK1 A;  5A2Q O;  1QSS A;  4BRQ A;  1K8A O;  1M1K O;  4FLX A;  1FKO A;  1YTA A;  4OJR A;  4KTQ A;  3AVH A;  3VQ5 A;  2B5J A;  2P9I B;  4MDA A;  1RBR A;  3MN5 A;  4FWS A;  3SQ4 A;  2QKK A;  4DV4 K;  5GIN A;  1X9M A;  4PY5 A;  2Q31 A;  4BE1 A;  5AZI A;  1GOC A;  2P9K B;  4DSI A;  3K2P A;  1T6D A;  1YIJ N;  4H0V B;  2O8B B;  1KVA A;  1JLG A;  1XC3 A;  4DR6 K;  3L2U A;  1WB9 A;  3VQE A;  4BAC A;  4DSF A;  1BDG A;  5AZJ A;  3SYZ A;  4CK3 A;  4FWQ A;  1U2V B;  1T6C A;  1GOA A;  3ZSW A;  1LV5 A;  4JHD B;  5AFU H;  3C6T A;  3EKU A;  1SKR A;  2ASP A;  1UAX A;  1WBD A;  1CZ9 A;  1U49 A;  1R59 O;  3S3M A;  3ENB A;  4KPY A;  4CJV A;  1MA9 B;  1WAJ A;  3CFP A;  1YXQ A;  4I2P A;  5IWA K;  4UQG A;  3CCJ N;  4E1M A;  3D2F A;  3FZL A;  1IKX A;  5KTQ A;  1Z6R A;  3DJC A;  2NRT A;  3HJF A;  1MWK A;  4KH6 A;  3PX0 A;  2PY5 A;  2E5L K;  1E3M A;  2FXU A;  4CEQ A;  1OKJ A;  3TSU A;  3DLK A;  3OYK A;  1NLV A;  3LDO A;  2UYT A;  3DLG A;  3VEV A;  1C0M A;  3VER A;  1QS4 A;  3CCE N;  4FZX C;  1O13 A;  4BGB A;  1LAV A;  2KKZ A;  1YUW A;  4LF6 K;  3AVL A;  1OH7 A;  1B9F A;  3N4Q A;  1J5O A;  3CM5 A;  1QTM A;  4JK9 A;  3DRR A;  2D4W A;  4BR7 A;  2IVO A;  5E41 A;  5FRO A;  4FM0 A;  3V9W A;  4BC3 A;  5HBM A;  1HKB A;  3G10 A;  1BIU A;  3P39 A;  1VAZ A;  2GX9 A;  3ZT1 A;  4DF4 A;  4H5V A;  1QZ6 A;  3SPZ A;  4A2B A;  3DLH A;  5KPR A;  4KTZ A;  3KLE A;  4C8N A;  2BUP A;  3QER A;  4BQL A;  4ICL A;  4CIE A;  1M90 O;  1TYQ B;  3T19 A;  3GOI A;  1SL2 A;  4CEO A;  1NMN A;  2Z1I A;  1NJX A;  1QQN A;  4Z4G A;  1MWM A;  2GWJ A;  1LW0 A;  3OS2 A;  4CGI A;  2VGM A;  3FFI A;  1IH7 A;  3H08 A;  1IBM K;  3AA2 A;  4B9M A;  3MEC A;  2YJF A;  3AO2 A;  3NF6 A;  3DWL A;  4I2Q A;  4HUG A;  1E4G T;  4J2A A;  3SCX A;  3MDQ A;  4WCE L;  3ZT2 A;  4NCA A;  3AVG A;  2P9S B;  4CJR A;  1VSK A;  3HP6 A;  2GEM A;  4YOX A;  4KKO A;  1JXE A;  4W5O A;  2DTU A;  5HRS A;  4GKJ K;  3O1B A;  4IEI A;  2EX3 A;  1KFD A;  4GVM A;  3CJC A;  1SKW A;  4DLG A;  2AP1 A;  4OKE A;  3PV8 A;  2W6L A;  1BA1 A;  2XY5 A;  3JS6 A;  4W5Q A;  3CER A;  3O3G A;  3WQT A;  2VWB A;  4BR2 A;  2V7Y A;  4JK8 A;  4MDB A;  3G71 N;  4LFB K;  3D2E B;  4FJI A;  4DTX A;  3L2V A;  1EWR A;  1RT3 A;  3WXL A;  4KBO A;  2OA8 A;  3K57 A;  2ASO A;  3RMA A;  1L3U A;  2DFE A;  2QWM A;  3VQ6 A;  4FJM A;  1ESV A;  3ZET A;  2F96 A;  4OVL A;  2A41 A;  5B8H A;  1JLE A;  2Q97 A;  5AQO A;  3ID6 A;  2BDP A;  5HRR A;  4Z4F A;  2JWK A;  4U67 L;  1L5U A;  1V4T A;  1QZ5 A;  2UUC K;  1NK4 A;  1HQE A;  4BVP A;  4IBN A;  5E84 A;  3HM9 A;  3K5M A;  1NGE A;  1QQC A;  4N56 A;  2UXC K;  4E7J A;  1E4F T;  1MDU B;  4X66 K;  4EHU A;  4OGC A;  3HPO A;  3VEX A;  4QS8 A;  4L3Q A;  2W42 A;  5EU7 A;  1RIL A;  2IVP A;  3U9Z A;  1ZBL A;  4CJU A;  5KQD A;  3CQX A;  3V9Z A;  4CIF A;  3RSE A;  3SQ0 A;  4DTO A;  1FXX A;  4OPH A;  4ILH A;  1EXQ A;  4DV1 K;  4CZK A;  2V7Z A;  3AVM A;  4JKG A;  3TR8 A;  3ZEU B;  4YHH K;  5CZ1 A;  1XWL A;  2HB5 A;  4JS4 A;  3LAL A;  2HHU A;  1RBS A;  4OX9 K;  3SQ2 A;  2HBJ A;  4W5T A;  3WXI A;  4JI1 K;  1VHX A;  4FOE A;  3NE6 A;  5JLF A;  1S1W A;  3FFK B;  4AHR A;  4CW7 B;  4FJ9 A;  2IVN A;  3TAM A;  4GV6 A;  1WN7 A;  2IAJ A;  3OYG A;  5SZT A;  3O3H A;  3E66 A;  3JAM O;  2A1S A;  2JWL A;  3ATU A;  3C6H A;  1XC9 A;  4B9T A;  3BF1 A;  1HQU A;  1YTU A;  1OVY A;  4KAZ A;  5CHI A;  1C0T A;  5J2N A;  4CEB A;  3HVR A;  3AA4 A;  3NH1 A;  3NGY A;  3DRP A;  4QAG A;  1J5E K;  1S3X A;  5CR4 A;  4DKW A;  3B6O A;  3OY9 A;  1VQ7 N;  4IO9 L;  3OYN A;  4FJL A;  4FXD A;  3LM2 A;  2DFH A;  3E1Y A;  2X6S A;  3AY9 A;  1DEJ A;  1RBV A;  3CHW A;  4YOW A;  3K5N A;  5AQN A;  4LC9 B;  4BRH A;  3H46 O;  3AAR A;  2O8C B;  4CGH A;  2UUB K;  4CFC A;  4X64 K;  3ZT3 A;  5J2M A;  4CZE A;  1ITG A;  2HST A;  4QS7 A;  4FYD A;  3THW B;  4C8L A;  3Q7B A;  4H5R A;  4K43 A;  3O3F A;  3TI0 A;  2FSK A;  3OYJ A;  4B1V A;  3LDP A;  3DRS A;  1IBK K;  1WOQ A;  3CD6 N;  1Q9X A;  5AQG A;  3CI5 A;  3AGR A;  2AA4 A;  2JGU A;  1C1B A;  1KD1 O;  1GLJ O;  3TSQ A;  4JV5 K;  4IDK A;  1ZXO A;  4DFK A;  3OVN A;  4JS5 A;  4H5W A;  4DLE A;  2Q1N A;  1RDW X;  5AQI A;  5AQT A;  4JKB A;  5BN9 A;  3SMS A;  1C0G A;  2FLO A;  1HNW K;  4Z4E A;  4DSK A;  4F3O A;  1N6Q A;  4IFV A;  5F2R A;  3EE8 A;  3H3N O;  3U4L A;  3MCA B;  2PYL A;  1DT9 A;  4JK7 A;  4XH1 A;  5HLF A;  3VET A;  3VEO A;  2F4V K;  1HNZ K;  4CGD A;  1XHX A;  4CZH A;  5HP1 A;  3DXK B;  4O44 A;  1JLC A;  3VOV A;  5DM6 L;  1NOY A;  3DLR A;  4JKA A;  3K0S A;  1VQK N;  2VYP A;  3HSC A;  3O4N A;  1VSH A;  1ASU A;  3THX B;  1DKG D;  2NRW A;  4DS5 A;  4PA1 A;  2YI1 A;  3SUP A;  4AHV A;  1QQO A;  1IJJ A;  3V9S A;  3GDQ A;  1ATR A;  3NMU A;  4RW4 A;  2PBD A;  5M1P A;  4R5P A;  4ZTF A;  1RDB A;  1RTI A;  1VQ6 N;  4I6M A;  2BAN A;  4JI4 K;  4M3T A;  4NO7 A;  2O8F A;  2HBM A;  4BRM A;  4HTL A;  3HXM A;  3MWP A;  3ULD A;  3KJV A;  2CH5 A;  2BTF A;  1YIT N;  4J8F A;  4AHU A;  2A1R A;  3CPE A;  4CBU A;  1X9J A;  4NYN A;  4K41 A;  1J53 A;  4E7L A;  4KHU A;  1XNR K;  1NGC A;  4L8R B;  4JKD A;  1ZC6 A;  3VF4 A;  1REV A;  3G0Z A;  3TAQ A;  4IG3 A;  4DV0 K;  3AVC A;  3V9X A;  4DQR A;  5JVH L;  1OH8 A;  4CFB A;  2P1J A;  3LWM A;  1OH5 A;  3QBW A;  4W5R A;  4IKF A;  4JLH A;  2GTD A;  3F2K A;  5EVZ A;  3ITH A;  3M8S A;  3D6R A;  5JIC A;  3IDH A;  4E7H A;  1KVB A;  4WQ5 C;  4CF8 A;  3BZK A;  2O8E A;  1IG8 A;  1S1X A;  4O0I A;  3A5M C;  4CBX A;  2I7P A;  5C2D A;  3P31 A;  1CXU A;  1GLD G;  3R1X A;  4DV5 K;  3QEI A;  1K8K B;  1A5W A;  1VSM A;  1GLL O;  3M8Q A;  1F21 A;  4ILJ A;  3HVT A;  2RPI A;  3FLC O;  4G1Q A;  1J9A A;  1KXP A;  3TAF A;  3O6W A;  1B92 A;  1NM1 A;  2P9P A;  3KK2 A;  4YDU A;  3PY8 A;  4PKH A;  5ADX H;  4CHO A;  3VQ9 A;  3FZM A;  3QEW A;  2VWJ A;  3U9D A;  4B3S K;  5FLX O;  2OZS A;  3MXI A;  3SBT A;  1BI4 B;  3RMC A;  4BRE A;  4CJQ A;  3MED A;  3C7N A;  2XY6 A;  1NJY A;  5AQF A;  3AVI A;  1JJ2 M;  1JXB A;  3ZSY A;  2P9N B;  3HOS A;  2H3G X;  1OH6 A;  3RMB A;  5AQS A;  4MLE A;  5TKW A;  4M63 C;  3QET A;  1XI1 A;  4KRE A;  3OHR A;  1NJI O;  4DR2 K;  1JL1 A;  4O8U A;  2FF3 B;  1LWF A;  5KPT A;  1I3A A;  4ELV A;  3LL3 A;  4XH4 A;  4DFP A;  4C8K A;  3WNG A;  3NF7 A;  2QKB A;  3ZX2 A;  4DG1 A;  3SJJ A;  2ETJ A;  5HRN A;  2KZZ A;  3J81 O;  2O8E B;  3LP1 A;  2CGJ A;  4IDH A;  1WSG A;  3FZK A;  4DR1 K;  1W97 L;  1W7A A;  4WQ4 A;  4OPA A;  3ZX3 A;  2ASM A;  1EQY A;  2KW4 A;  3N4P A;  5EOY A;  1WSF A;  1YVN A;  2X74 A;  3QIP A;  1TK8 A;  1KAX A;  4CJL A;  1V4S A;  4PL7 A;  5FPD A;  3DAW A;  3SLC A;  5AQZ A;  5LMN K;  5BRE A;  4DSL A;  1RT2 A;  1Z05 A;  3QDK A;  4FWR A;  4RWT A;  3PX4 A;  1KRP A;  5LJV A;  3AGK A;  2FBV A;  2P9P B;  5FDL A;  3IUC A;  1ASW A;  5CY4 A;  2CH6 A;  5KQ8 A;  3O9T A;  4B1W B;  1WAF A;  3OTO K;  2VGN A;  1S9E A;  3K5O A;  1DLO A;  1S6Q A;  4JAX A;  4XH5 A;  2KZM A;  3EY1 A;  5C25 A;  1DTT A;  3C7N B;  1TK0 A;  3L2Q A;  3SNN A;  1L3T A;  4FOI A;  5AQQ A;  1NK5 A;  4EZ6 A;  4H4M A;  3Q7C A;  3VGM A;  1GLB G;  3ZSO A;  2XY7 A;  1FJG K;  2WC9 A;  4YNQ A;  4MO5 A;  2D0A A;  3O4Q A;  3KWI A;  4Z4C A;  4GV9 A;  4FL9 A;  4O8K A;  4ELU A;  3G4S N;  3GG4 A;  4DUY K;  4ISG A;  5CYM A;  3TTD A;  5CE3 A;  3C95 A;  1QHT A;  4DU3 A;  4DV2 K;  3I33 A;  3U3G A;  4H5T A;  1YT3 A;  4CF2 A;  3CCM N;  2P9U A;  2O4G A;  3M1F A;  3HPG A;  3EE9 A;  3HBT A;  3VPZ A;  4F8R A;  4K42 A;  1SS6 A;  3O8M A;  5AQK A;  4O0J A;  4JRQ A;  4JD2 A;  3UKR B;  4H4O A;  4MO4 A;  2Q0U A;  3VQ7 A;  3LZJ A;  5CYQ A;  1RBU A;  4BRI A;  4CJW A;  5AQL A;  4IOC L;  4E89 A;  4MLH A;  1TAQ A;  3PLA A;  4UY8 O;  2F9W A;  1LOT B;  3C94 A;  3MWT A;  4KV8 A;  3PX6 A;  3VEY A;  1KAZ A;  2IGI A;  1TK5 A;  4EAH D;  5EX5 A;  3OYA A;  1RT1 A;  3UKU B;  2GBZ A;  1RCH A;  1RTJ A;  4EFH A;  4CJ5 A;  1BU6 O;  3ZSQ A;  3NDK A;  1NBW A;  3SUQ A;  3ZSV A;  4BRP A;  4JYA K;  2B4J A;  5BPL A;  3TPQ A;  4F2R A;  4K25 A;  4CER A;  3QLH A;  3I56 N;  3HT3 A;  1YJ9 N;  3GE1 A;  3HTV A;  5C12 A;  3ISN C;  1GLC G;  3ULE A;  1K73 O;  3OS1 A;  4K8Z A;  1TKD A;  4FM1 A;  4CHN A;  2F9T A;  4IG0 A;  5E26 A;  1LCU A;  3EN9 A;  3PO5 A;  1KAY A;  5AZI B;  1NU0 A;  4DMN A;  2OPR A;  2D5R A;  3U3Y A;  3C0B A;  2EHG A;  5C10 A;  3KHY A;  3KK1 A;  3CJ9 A;  1CLQ A;  1QVF M;  4BC5 A;  3J7Y P;  4RW8 A;  5AZJ B;  4FLT A;  1KVC A;  4JKE A;  3WXM B;  3PSI A;  5SWM A;  4BDZ A;  2VWK A;  3WXJ A;  1EWQ A;  4IEE A;  5DK5 A;  5BRF A;  3FGU A;  4B3R K;  2E88 A;  2Z1J A;  3SJH A;  4K8X A;  3NVK A;  2WBN A;  1HPM A;  3DXM A;  1KLN A;  4M3W A;  1VSL A;  3RWU A;  1BG3 A;  3P83 D;  3KLH A;  4OO1 J;  4BRO A;  1IV0 A;  4AHC A;  4CEE A;  1X3M A;  3W0L A;  1BWF O;  4M7X A;  3TAE A;  1W2B M;  1S72 N;  4R79 A;  3D2F B;  1BQM A;  3V6D A;  2HVH A;  3T69 A;  4AH9 A;  4DSJ A;  4M45 A;  1WSJ A;  4BDP A;  3MK6 A;  3L6Q A;  4BR4 A;  2YKM A;  1Q8I A;  4FWO A;  4RG8 A;  3K58 A;  3DLL L;  4FVU A;  1TAU A;  3KLF A;  4KRF A;  2KHO A;  4CED A;  1SKS A;  3QES A;  4FZZ A;  1JKH A;  3AVB A;  3M3Z A;  3QNN A;  3HZ6 A;  1D8Y A;  4KTW A;  4ZHR A;  2E2O A;  3BY5 A;  1NKC A;  1HR0 K;  2FSN A;  5C2F A;  2DPN A;  2RE2 A;  4FVM A;  1UA0 A;  1BOT O;  3DMJ A;  4X62 K;  2UUA K;  3CIP A;  4BRA A;  3VN5 A;  4YY3 K;  5AR0 A;  2UXB K;  1NK0 A;  5M1O A;  2HHV A;  4FLW A;  2ZE2 A;  4N5S A;  2HHQ A;  3NF8 A;  4FWK A;  1G99 A;  1NK7 A;  1I39 A;  2HVI A;  2W40 A;  1MU2 A;  5IT9 O;  4Y1D A;  4CEF A;  3U8X A;  1Z25 A;  3L2R A;  5AFU A;  3UB5 A;  3DXM B;  5HRO A;  1VQO N;  2F8T A;  4CJ3 A;  1LWC A;  4JKC A;  1S1V A;  3O9S A;  4FSV A;  4ISF A;  1SUQ A;  4M3U A;  1YVU A;  4IO8 A;  1CXQ A;  3TAB A;  2XHB A;  3O5B A;  4DCH A;  3L3U A;  5BRD A;  5BPM A;  4DQP A;  5LJW A;  1JCE A;  1YF5 L;  3CFR A;  1NGA A;  5FPN A;  4LH4 A;  2Q36 A;  3OYE A;  3AO3 A;  4BWJ A;  3MN6 A;  4A59 A;  4B3T K;  4V19 S;  2RHK A;  1KCF A;  4BG8 A;  3CFO A;  4CJP A;  3PUF A;  2GV9 A;  1TUU A;  3ASM A;  1BA0 A;  2YKN A;  1A5X A;  3TSP A;  3SMP A;  4BC2 A;  4CZG A;  1D9F A;  3R9P A;  4Z4I A;  2CGL A;  3HI0 A;  3HPH A;  3MMV A;  3V1Q A;  2AJQ A;  4AQY K;  1FKP A;  1VSE A;  3WNF A;  4B3O A;  4FWP A;  3LDN A;  2QA4 N;  4DTP A;  2YHW A;  2P9L A;  3M6G A;  3MCP A;  3F73 A;  3VEZ A;  2VG5 A;  2HMI A;  3ZET B;  1VQM N;  1S22 A;  3A2F A;  3I0R A;  4BQZ A;  4FJ8 A;  1SZ2 A;  2G8F A;  3QBX A;  3CC4 N;  4W5N A;  4M3Z A;  4LFA K;  2QWL A;  1JCG A;  2XO7 A;  4I9Q A;  4C8O A;  4JI8 K;  4CZF A;  1GOB A;  3ID8 A;  1U4B A;  3T1Y K;  2PZS A;  2YX6 A;  4O4G A;  3TTC A;  1FW6 A;  3SAH A;  3L4Q A;  1B9D A;  4H0X B;  1WSH A;  4CZI A;  1BUP A;  4ID5 A;  4CGJ A;  4IJA A;  1DGK N;  3VF2 A;  4BR0 A;  3BUZ B;  2DFF A;  4B9S A;  3OJU A;  4B8C A;  2FBY A;  2OZM A;  2D0O A;  1YAG A;  2IDO A;  3L3V A;  3G25 A;  3JSM A;  2WUS A;  3ZCM A;  4LFC K;  1C0F A;  3AO5 A;  5BR9 A;  2HF3 A;  3RMD A;  4DHY A;  4KI4 A;  4DTR A;  3HOT A;  3AO1 A;  5LL6 Z;  4WQ5 A;  3DOL A;  2NRV A;  3RSE B;  3S9H A;  1GLF O;  2FSJ A;  1T44 A;  3TAR A;  4HTU A;  3BGR A;  4J2E A;  5H1S Q;  1EO1 A;  3TAP A;  4B9Q A;  3IS9 A;  3D0P A;  4JKG B;  4J2B A;  2PFU A;  2EWS A;  4BRK A;  2HNZ A;  1XQS C;  4LSL A;  3VA3 A;  3DI6 A;  3F5T A;  3GL1 A;  2Q2R A;  3TU5 A;  4AHT A;  5KRT A;  4YOV A;  3TAN A;  5C24 A;  4CES A;  1TKZ A;  2IOC A;  3CJ7 A;  4CI6 A;  4B9V A;  1WUA A;  4JKF A;  4H5N A;  1YJW N;  1X9S A;  3OYC A;  2VG6 A;  3VMF B;  3CPW M;  3AVF A;  3LDL A;  3AAP A;  5J2Q A;  1HKG A;  2OCE A;  4Q0B A;  5I42 A;  1RT5 A;  5BRH A;  3KLG A;  4GVE A;  4Q5V A;  3QFP A;  1ILY A;  3CG7 A;  1VK0 A;  3M8R A;  4J2D A;  2KFN A;  3E01 A;  2D1K A;  1SAZ A;  4NB4 A;  4NCB A;  5AQR A;  4E0D A;  4XIU A;  3KTQ A;  3A5O C;  3O9R A;  4FPB A;  2ITM A;  3EZW A;  1T7P A;  4E7I A;  1EET A;  1VQ8 N;  2X6N A;  4CZM A;  3NGZ A;  4CZL A;  2PAV A;  1ATN A;  1VRT A;  1HRH A;  3KWG A;  1L3S A;  4DF8 A;  1NJZ A;  1N33 K;  1JL2 A;  3IG1 A;  4OLA A;  3AA5 X;  4EHT A;  5F1X A;  2X78 A;  4B9U A;  5I9E B;  1Q18 A;  3I8D A;  4FK0 A;  1UOC A;  4DR4 K;  3IAY A;  2ZQB A;  1VSF A;  2G8U A;  4LF5 K;  4BRN A;  1HJO A;  3AVA A;  4NYF A;  1NK8 A;  4BRG A;  1JLQ A;  1NKE A;  4EP4 A;  5AQY A;  5M1Q A;  2NNW A;  3SQ1 A;  1T05 A;  2YHA A;  1K6Y A;  2A6A A;  4FJX A;  4DV3 K;  3NH0 A;  3L2W A;  2OPP A;  4K0K K;  5AQX A;  5KRS A;  1TL1 A;  2KQ2 A;  5JVG L;  3QML A;  4DTN A;  2E20 A;  5LY3 A;  2YHB A;  1NGJ A;  4BR9 A;  3WNH A;  3RR8 A;  4FO0 A;  3ZSX A;  4DV6 K;  1C1A A;  4A5A A;  1QHA A;  2QWN A;  1W9H A;  3O1W A;  3NFA A;  3KKR A;  1NWK A;  3THY A;  2QTD A;  4BWM A;  4FPA A;  1Q82 O;  1N32 K;  4KFB A;  1IO2 A;  1CZA N;  4IZ9 A;  3VQ8 A;  4PHT X;  4FCY A;  4CCH A;  3ZT4 A;  3VQD A;  3WT0 A;  4Z0U A;  4GMJ B;  5HL7 L;  3IRX A;  3DOK A;  3VEW A;  3L8B A;  3LWL A;  3OJS A;  3ZLJ A;  2RF2 A;  4JRP A;  4RCH A;  1TUY A;  3FR0 A;  4I6M B;  2I5J A;  1Q81 O;  5C0Y A;  1SL0 A;  2O8F B;  1JLF A;  2XRI A;  1TGO A;  3CYM A;  5AQU A;  1NGI A;  5JMV A;  3SAG A;  5EY4 A;  5LMU K;  2HW3 A;  4GY2 B;  4N47 A;  3DM2 A;  1RDC A;  3NHG A;  3HL8 A;  3KIO A;  4E7K A;  3PIO L;  4H0P A;  4CFD A;  4HVJ A;  5AQH A;  3LDQ A;  4RTF D;  4N41 A;  3QIO A;  4CF9 A;  4DTJ A;  3SI6 A;  3TAG A;  4JN4 A;  4JI3 K;  2HNY A;  2RN2 A;  3J7Z O;  5KGX A;  3OYI A;  3E9P A;  1C6V A;  2BGG A;  3U6F A;  4ID1 A;  3VA0 A;  1X9W A;  2P9I A;  4A57 A;  4CJT A;  1QE1 A;  4WF9 L;  3A5N C;  2E2Q A;  1P90 A;  3CET A;  3JXU A;  2P9K A;  4I9L A;  3M8P A;  2Z1H A;  3O80 A;  4YOT A;  3NAE A;  5M1F A;  1S9G A;  5GAD P;  2HHX A;  3CC2 N;  4DR5 K;  2F8S A;  2YJE A;  1H1V A;  2YNG A;  2HOE A;  3LPT A;  5KGW A;  1D5A A;  2YHY A;  4LSN A;  2ZWH A;  3T1A A;  1U2V A;  1NGH A;  4CEZ A;  2NRZ A;  4BR5 A;  4CJF A;  3CXC M;  4DS4 A;  4JHD A;  1ZBS A;  3AO4 A;  4NLB A;  3SV4 A;  2ZF5 O;  2VQF K;  3EKS A;  1NGF A;  3MX2 A;  1RBT A;  3S3O A;  3CQ8 A;  1TV6 A;  4YOR A;  2ITG A;  2Q3S A;  4PUO A;  3OYH A;  4HHT A;  2IS3 A;  2KLA A;  3MXJ A;  3CCV N;  1VQ5 N;  5K14 A;  3BEX A;  3ZSR A;  3VTH A;  1IKY A;  1VQN N;  3J80 O;  4RW9 A;  1NK6 A;  1HNV A;  3ZT0 A;  4PKI A;  4KB0 A;  2Y1I A;  1U47 A;  2WFB A;  3MN7 A;  3PIP L;  4B1X B;  4FWL A;  3R3L A;  3CCS N;  3H1V X;  4GV3 A;  1R0A A;  1K9M O;  3LAM A;  4CJE A;  1HYZ A;  3F9K A;  1NMD A;  3BZC A;  3QO9 A;  1Y64 A;  4KO0 A;  3QNO A;  2OTL N;  1S6P A;  4ILG B;  3OYL A;  1QQM A;  1VQ9 N;  4CJ7 A;  1ASV A;  1EX4 A;  4HCB A;  1NKB A;  3ALY A;  1LW2 A;  3E9O A;  1TKT A;  3CCL N;  5MLC Q;  3B6P A;  3CMA N;  4DB3 A;  3K5L A;  1KTQ A;  1TKX A;  2J4R A;  1ATS A;  1TYQ A;  1U04 A;  4YDU C;  3A0I X;  1ZBU A;  2KTQ A;  1SL1 A;  4CHY A;  1O1W A;  2G8V A;  4A2A A;  3WUH A;  4FW2 A;  4OLB A;  3M5R A;  4DV7 K;  1HYS A;  1VSI A;  2QWO A;  4ZTJ A;  4BRD A;  5AQM A;  2O4I A;  3KZB A;  4IFE A;  3EO3 A;  5ADX A;  4F3T A;  3BP8 A;  1QVG M;  1NNE A;  1ZBH A;  2QEX N;  2P9S A;  3ZSZ A;  4F9O A; 
#chains in the Genus database with same CATH homology
 1HNZ K;  4YHH K;  3J7Y P;  4DV6 K;  4OX9 K;  4JI5 K;  1I94 K;  4JI0 K;  4GKJ K;  4JI1 K;  5AJ3 K;  4LF8 K;  4B3T K;  4JI6 K;  4LF9 K;  1XMQ K;  4V19 S;  4B3R K;  1FJG K;  4KHP K;  2UXD K;  4CW7 B;  4X65 K;  1N32 K;  2VQF K;  3JAM O;  4DUY K;  1IBL K;  4B3S K;  5FLX O;  4DV2 K;  5IWA K;  4AQY K;  4LFB K;  2UU9 K;  2E5L K;  4JI4 K;  1J5E K;  1N34 K;  3J80 O;  4JI2 K;  4DR3 K;  2VQE K;  3T1H K;  4DR2 K;  4LF6 K;  1N36 K;  1HNX K;  1XMO K;  5LMU K;  4JI7 K;  4LFA K;  2UUB K;  4CVN E;  1N33 K;  4X64 K;  4DR7 K;  2HHH K;  3J81 O;  1HR0 K;  1XNR K;  4NXM K;  2UUC K;  4DUZ K;  4JI8 K;  5BR8 K;  4DR4 K;  4DR1 K;  5A2Q O;  4X62 K;  4B3M K;  3T1Y K;  2UUA K;  4JI3 K;  4LF5 K;  2UXC K;  3J7A P;  2ZM6 K;  4DV0 K;  1IBK K;  4X66 K;  4JYA K;  4YY3 K;  4GKK K;  2UXB K;  5LMN K;  4JV5 K;  4LFC K;  5IT9 O;  4DV4 K;  4DV7 K;  4DV3 K;  1IBM K;  5LL6 Z;  4NXN K;  4K0K K;  1XNQ K;  4LF7 K;  3OTO K;  4LF4 K;  1HNW K;  4DV5 K;  4DR5 K;  4DV1 K;  4DR6 K;  2F4V K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...