4DR3K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr3K00
4LFAK 3T1YK 2HHHK 5A2QO 3J7AP 4JI0K 3OTOK 2UXBK 4NXMK 4JI3K 2ZM6K 1HNZK 1XNRK 1N36K 2E5LK 5LL6Z 4AQYK 1J5EK 4LFBK 1XMQK 4JI2K 2UU9K 5LMUK 4GKKK 4DV2K 4JYAK 4DV0K 4DV1K 4YY3K 4B3RK 3J80O 2VQEK 4JV5K 4DR5K 5IWAK 4JI8K 4JI1K 2UXCK 4DR6K 4GKJK 2F4VK 3J7YP 1IBMK 4JI7K 4JI5K 4X64K 4DUYK 5IT9O 3JAMO 1FJGK 4CVNE 4X66K 2UUBK 1N32K 4DV5K 4JI6K 4DV3K 4V19S 4JI4K 1IBKK 4LF4K 5AJ3K 5BR8K 4DR2K 4DV7K 2UUCK 4LFCK 1HNWK 4B3MK 5LMNK 4LF6K 2VQFK 4DR4K 3T1HK 4DUZK 4LF9K 4LF8K 1HNXK 1HR0K 4YHHK 3J81O 4DR1K 4DV6K 5FLXO 1XMOK 4DV4K 4OX9K 2UUAK 4B3TK 2UXDK 4X62K 4LF7K 1IBLK 4CW7B 4KHPK 4DR7K 1I94K 1N33K 4K0KK 4X65K 4DR3K 4B3SK 1N34K 4NXNK 4LF5K 1XNQK
chains in the Genus database with same CATH superfamily
1ZBSA 4H0VB 3V9ZA 1RTJA 3RSEB 1E3MA 4M42A 3CCSN 4DQQA 3ZSVA 1IG8A 3OYDA 2P51A 1EWRA 2Q97A 4LC9B 2ZJQL 1UA1A 3LDQA 4JI3K 2PFUA 2G8KA 4K41A 1HPZA 4ISEA 4LH4A 4F3TA 1TL1A 3PLAA 1IKWA 5HRRA 4CFBA 3VA3A 4DKWA 5CE3A 1NLVA 2BUPA 2RPIA 4PWDA 1ATRA 4JI1K 4QOZB 2JWLA 2F4VK 2YNIA 3CCJN 3PO5A 4M41A 5AQTA 1RDAA 4AF1A 3HK2A 4JKHA 1RILA 4IEIA 2O8CA 1U6ZA 3RWUA 3OS1A 3O9TA 1YUWA 4Q5VA 3NHGA 2E2NA 3MWTA 4B1XB 4V19S 1J54A 4NCAA 3BDPA 2QWMA 4BRDA 2YJEA 3A8YA 2DFEA 4I6MB 1YAGA 4PHTX 3OYAA 3E9PA 3PSIA 3CJ1A 4NLBA 4HWIA 4IXCA 3GDQA 1KCFA 3V9WA 3LDOA 1C6VA 4FJMA 1JLGA 1ILYA 2YJFA 3NVKA 2YNGA 3THVA 3CIPA 4DU4A 1NGJA 1SL2A 1XMOK 1WBBA 3I0RA 2IVNA 4OX9K 4FCYA 1E4FT 3I8BA 2DY4A 3AAPA 4L8RB 4Z4HA 3LWMA 4J2EA 1N33K 4C1NK 1TUYA 1RBSA 4FJJA 4X65K 4B3SK 2KW4A 1N34K 3LDPA 3DLEA 3DRRA 1JXBA 4YOVA 1KLMA 1VSFA 4AM7A 3RRGA 3M8QA 4KHWA 1HNVA 1JLAA 2P9LA 3UKRB 3ZX0A 1ZBLA 4CJ3A 2QWNA 5KRTA 4HUGA 4HCBA 4KHQA 4KH5A 3LANA 3EO3A 3VEZA 5E26A 5LL6Z 2P9NB 4FM0A 4B8AB 2ZJPL 4NYFA 3BZCA 3VF4A 4F9OA 4OLAA 4H4MA 3IG1A 5MLCQ 3HXMA 3RMBA 4FZZA 3J80O 1Y97A 3P83D 3AA3A 4JI8K 4N5SA 4B3OA 3QBXA 3CCQN 4CBWA 1J53A 1BQMA 1UA0A 3TU5A 3IUCA 2P9SA 5FPEA 4JI7K 2EWSA 4X64K 3DOKA 3OYFA 3S41A 4PKGA 2EHGA 4L3QA 1GLJO 3WT0A 4CVNE 1DKGD 2UUBK 3EZ5A 4CFAA 2VG6A 1RGIA 3ZT1A 4FZYA 4WE1A 3MX2A 5BR8K 4DR2K 2IC3A 1CXUA 5C42A 1WSEA 1IKYA 3U9DA 4DWIA 4N56A 3EYZA 2H3GX 1RT1A 1OH8A 3B8AX 2O8FB 3L4QA 3ZT4A 5JMVA 1K8KB 2A5XA 3QDKA 3VQPA 3CQXA 3OYIA 4CGJA 3CMAN 1QQCA 4U7BA 2NRTA 2ASOA 1W2BM 2ZWHA 1NNEA 3ZETB 5C0YA 3TR8A 1ZXOA 3OYEA 4KI4A 3HM9A 3AVKA 3AGRA 3SMPA 4Z94A 4A61A 1KAYA 3ZSWA 4EP4A 4HUEA 4CERA 1UOCA 3KVGA 3KK1A 5J2MA 1DTTA 1K6YA 4FW2A 1NU0A 1TAUA 1QQMA 5M1PA 3J7ZO 3SV3A 1TYQB 3PUFA 1XNQK 3HSTB 1P8ZA 5AFUH 4F2RA 1FW6A 3N4PA 3THYA 3O9SA 2GV9A 3AO4A 1RT4A 4E7LA 1NGFA 3QEXA 1D9FA 2GUIA 5CR4A 3D2EA 1N36K 1Y64A 1RT3A 4FO0A 1WSJA 4KO0A 4KHYA 3KTQA 3VGLA 4JKGB 1RDDA 2A42A 2G8VA 4JK8A 4CEFA 4DF8A 1JL1A 4JYAK 1U49A 3SPYA 4GNIA 1BA0A 3FZKA 3H6EA 1FKPA 3BUZB 2HBMA 2UXCK 4H03B 4DR6K 4J8FA 1XC3A 1C0GA 3GE1A 3DXKA 1K73O 5AQPA 4FLTA 1EQYA 3VETA 3ZYYX 3PIPL 3CCVN 3HO1A 4EHTA 4A2BA 5SWMA 1DT9A 2E1YA 4B1YB 1IG9A 4W5QA 3CCLN 2XY8A 3ZSQA 3AA2A 3V1RA 2E2OA 3KHYA 2GWJA 2OCEA 3VQCA 1NK0A 3MXJA 3FFIA 4KREA 4JK7A 2IVPA 3CJAA 4GV6A 1LAWA 2PBDA 4O0IA 1WAFA 4CJUA 4QS7A 4B9NA 1HNWK 3HSCA 2VQFK 1HLUA 1ASVA 3LM2A 1B92A 4GV3A 1HYVA 4BROA 4XEIA 4DCHA 3MCPA 4F8RA 5I9EB 4FPAA 3DXMB 4CZLA 1Z25A 3U3YA 5GIOA 4B9SA 1OKJA 4H4OA 4E7KA 4DTSA 4H0OA 4M63C 1A5VA 1SQKA 4JKDA 3S3NA 1T7PA 1NJYA 1REVA 2GELA 3NH0A 4DQ8A 1OH6A 5AQUA 2IS3A 2P9PB 2E1ZA 1J5OA 5F0XA 1YI2N 4PL8A 5BRHA 3MN5A 3BP8A 4DTUA 3WNEA 4FM2A 3GG4A 5AQHA 4DTRA 3O6WA 2UXBK 3SLCA 3U6FA 3ENBA 3QO9A 2FSNA 4MO5A 3WXKA 2P1JA 1VSMA 1RDUA 4ICLA 3OYLA 4CD3A 3NDKA 4KI6A 1S1UA 4I2PA 3FZLA 3IMXA 3CQ8A 4RW8A 5DM6L 4DV0K 4CGDA 5AR0A 3SI6A 3D2EB 1S6QA 3K57A 1SKRA 5HRNA 1RBTA 4K42A 1KLNA 3PX0A 4Z4FA 2CGJA 4KB1A 2F8TA 3DMJA 3QETA 3CM6A 3VGKA 2F9TA 3IAYA 2YCHA 4MQ3A 2A41A 2YHYA 4M3WA 3GBTA 4FOEA 3WXIA 3L2QA 2A3ZA 3OVNA 3NH2A 3AO2A 4IBNA 3AVLA 4DSKA 2E4LA 4OPAA 1WUAA 3CCRN 4DV7K 4IDKA 1KVBA 4Z4IA 4CBXA 1HMVA 4JKBA 1R59O 2Z1HA 3U3GA 3R6MA 4CIFA 3O3GA 4DUZK 4ILJA 4LF9K 2GBZA 3E1YA 3LDSA 5M1FA 4K8ZA 1YVNA 1WSIA 3D6RA 5CHIA 2CH6A 2AP1A 4B08A 3D2FA 1U2VB 3H1QA 2D5RA 1G99A 1VQ4N 5KGXA 4C8OA 1Z26A 5HP1A 3QESA 1C0FA 3P38A 3KK2A 1U45A 4FLVA 5C24A 4CJ5A 1R0AA 4CK2A 3TI0A 1EWQA 4WQ5A 3NF9A 3A5LC 3HOSA 4DU1A 4EFHA 2RE2A 1QSYA 4QCLA 5A2QO 3A2FA 2I5JA 4OJRA 2E8AA 2DTUA 3LP2A 4ELTA 4JRQA 1N8RO 1LOTB 2D4WA 3OBYA 4OGEA 1BGXT 4M3YA 1A5WA 4B9TA 4KFBA 2W6LA 2ASMA 3MDQA 2X6NA 4RTFD 3AVHA 1NK7A 4W5NA 4IJAA 2FBTA 4DTMA 1K8AO 4UQGA 1VQON 1N5YA 4FWRA 2Z1GA 1EXQA 1FK9A 3OYBA 1BCMA 3R9PA 3HBTA 2X6SA 1BU6O 1RT2A 2P9UA 4YOUA 3KK3A 4KTZA 2OYQA 1QE1A 5J2PA 2P9LB 4IFVA 4DG1A 3TAGA 4C8KA 1HKCA 2Q2RA 2YNFA 2NRZA 4BR9A 2X78A 4MDAA 1KXPA 5AQOA 5AJ3K 3CXCM 1JJ2M 5BN8A 1VK0A 3ZEUA 1XHXA 2HHTA 3SAGA 3OYKA 2HF3A 3K9JA 1IKVA 3VF2A 3O9QA 2B6AA 5KPRA 4CEQA 1NK6A 1I39A 2QM1A 3KJVA 4DFPA 4YHHK 1D5AA 2P5OA 1NGBA 5E84A 4DV4K 1LWCA 3M6GA 1SKSA 1JLBA 4B3TK 3VENA 4I6MA 1OVQA 5C25A 2XHBA 2RF2A 4Y1CA 4A5BA 4IO8A 4HTUA 1HNIA 4AHRA 4FXDA 1W0HA 4O4GA 3RR8A 3U9ZA 3G4SN 3A0IX 4ZTJA 2KTQA 4NCGA 1VQ6N 2ZGYA 2QWQA 4MO4A 4RG8A 3EKUA 3GL1A 1I3AA 4KRFA 3QBWA 2XY7A 4E7HA 1KFSA 4Z4CA 1RFQA 1KAZA 3ZT0A 5KRSA 3LAKA 3VF6A 3CF5L 2IGIA 3C0BA 2ZM6K 4KPYA 3NBPA 5HRSA 4GW6A 2OPSA 2O8BA 3SJHA 1JCFA 1QVFM 5GAHP 2ITGA 2ZE2A 1WLJA 5HOOA 4DTNA 3F73A 4O5FA 2PYJA 4DTXA 4FWNA 1ZBUA 1SUQA 1HX1A 3VTIA 4DS5A 1Z05A 3BZKA 4EAHD 2O8EB 4CF1A 3C6UA 4FLUA 3ENOA 5ADXA 3K5OA 4OPHA 3OY9A 1Q9YA 3AAQA 4BRHA 3SUNA 3AVJA 4H5NA 4I9QA 5JVHL 3VQQA 1IJJA 1CZAN 2P9PA 3VEVA 2YHBA 4BREA 4DUYK 1NKEA 3H1VX 1VSLA 2BH1A 1Q82O 2ASPA 1YHQN 4XH5A 4A59A 1VQ7N 4ELUA 1V4SA 4DV5K 1BQNA 4NYNA 3CG7A 1XUPO 4EZ9A 3SZ2A 2YKNA 2IOCA 1JCEA 3K0SA 4WFAL 4KHNA 3WQUA 2HNYA 1BI4A 1IH7A 1LWFA 3ULEA 4YDUC 1JKHA 3L2RA 4CEBA 4IKFA 3RTVA 3BY5A 3FZFA 3QFPA 5C10A 4FLZA 1HJRA 3K5MA 3V9SA 5EVZA 4OKEA 1TKZA 3TTCA 3M5RA 5FLXO 4FM1A 3E66A 3K59A 5GAGP 3DJCA 5KQDA 1RBUA 2F7TA 3R3LA 2VYPA 4Z4EA 1M90O 5H1SQ 4YNQA 1VQNN 4DR3K 3NGZA 3EE8A 2NRHA 5BREA 2W6KA 3MCAB 4N41A 4KKOA 1T3VA 3DXKB 3NGYA 1NOZA 4H0TB 2YHAA 3LM9A 3M1FA 4M3ZA 1C1BA 2V7YA 1WSHA 2HSTA 3LZJA 3OYCA 4B9LA 4LFBK 2P9KB 1ZC6A 2UU9K 2FBXA 2VGMA 2O8BB 1TGOA 1NKBA 1ZYQA 1VHXA 1OH5A 3G25A 4JN4A 3QIPA 3PX6A 2WBNA 4KBOA 3S3OA 3H3NO 1LAVA 3M8SA 5CZ1A 3MN6A 4I2QA 4XIUA 1J9AA 3LDLA 5AZJB 4Q0BA 5AZJA 3G6EN 4CJSA 5AQVA 3MEGA 4BC4A 2HNDA 1IO2A 4CGHA 4H5VA 1D4XA 4JS5A 3OHRA 1S6PA 5CYQA 3HI0A 2G8FA 3TAEA 4LD0A 3IKMA 1U47A 1B9DA 5M1QA 1X9WA 1KFDA 5EOYA 2QKKA 1WSGA 4CJLA 3MK6A 2V52B 4AHVA 3LDNA 3SAFA 4IFYA 4DS4A 3CETA 4CFDA 1QSSA 4CZGA 1S1VA 3TSQA 4LF8K 1LV5A 1YTUA 4CESA 1MA9B 3WQTA 4E19A 4C8LA 3J81O 4CHZA 3ZEUB 4DV6K 3KWGA 2GWKA 3VQ5A 2IAJA 3L3UA 1MWKA 4PL7A 1VSEA 4BE1A 2XRIA 5M1NA 2KQ2A 3ZX2A 3QEPA 3NE6A 4B9UA 2NUBA 4KHUA 5AQQA 4IOXA 1YT3A 1MDUB 2ZD1A 1BCOA 2W40A 3UKUA 4CK3A 3KWIA 3P39A 2IVOA 3OS2A 4GV9A 4M3XA 1QHAA 5FROA 1VRTA 3JYTA 4JS4A 5FPMA 5J2QA 3Q7BA 4FL9A 4J2DA 4NXMK 3PV8A 2KFNA 1YF5L 4DU3A 3DXMA 3U8XA 3CCUN 3TAMA 3O1WA 4QAGA 1NGCA 3C7NA 4RW4A 3NF8A 1GOBA 4JI2K 3ZSZA 3ULEB 4MLHA 4IDHA 4DTJA 4PUOA 4YY3K 3L6QA 4TSXA 4HTLA 4BDPA 5KGWA 5GADP 2A1RA 5FPNA 3ALYA 4CF9A 3T19A 1S1TA 2ATQA 3TTDA 3QLHA 1WSFA 4BDZA 1ZBFA 3DWLA 4DFMA 4EIAA 2FLOA 3A5NC 1LW2A 4LF4K 4FJKA 4FJ9A 4PA1A 1KTQA 3KIOA 3IFRA 4CZEA 1CZBA 2GTDA 4IWVA 4CHNA 2NZTA 3V4IA 1XI1A 2HHWA 1KAXA 3ZT2A 3V9XA 4H0PA 3I8DA 2HHSA 1ATSA 4B1ZA 5LY3A 2E88A 2E6MA 2HBKA 1Q8IA 3CC2N 4CJFA 3LWLA 1L3TA 3VOVA 4FK4A 1QHTA 4DSEA 3QEVA 2IIRA 2QXLA 2VWKA 3CC4N 3CPEA 4EHUA 2G8HA 1I94K 3SBGA 3C6TA 3LP1A 4CEDA 4BRLA 4AILC 1ZBIA 3ID6A 4G9ZA 2QKBA 4B1WB 4RW7A 4Z4GA 2WUSA 3AVMA 3CJ7A 1EO1A 4FJXA 1RT5A 4LFAK 1X9JA 3SYZA 3BF1A 3SUOA 5FDLA 2G8WA 3V1QA 4AH9A 2HHXA 5GINA 3KLIA 1GLFO 5HL7L 4E7IA 3VQEA 4FLXA 1U48A 3NF6A 3L3VA 1NGHA 3AVNA 2E5LK 2V7ZA 2A6AA 2NNWA 1B9FA 3O3HA 3L4IA 2Q36A 2KFZA 1BIUA 4O5BA 2G8IA 3HRGA 3OYHA 2JWKA 1QVGM 2BANA 3HVTA 2QWRA 3DLGA 1TK5A 2YHWA 1HRHA 2A40A 5CY4A 4O8UA 2O8FA 4H5WA 3HZ6A 3J8AA 2KZZA 3DYAA 2WTUA 3VQAA 1TV6A 2YNHA 1IBMK 1V4TA 3VEOA 3M8RA 4HUFA 5B8HA 3DLHA 3CFOA 5IT9O 4C23A 1DTQA 2ZJRL 4ISFA 3FE1A 2YV0X 3HJFA 3O4QA 5AQSA 1Q81O 2PY5A 4PY5A 4H5TA 1N32K 2FSKA 2P9SB 4JI4K 1NK5A 3D45A 1ZBHA 1JLQA 3T1AA 4DMNA 4RWTA 2HVHA 2LSNA 4UY8O 5LMNK 3HVRA 1U4BA 2D0PA 3O5BA 4B1VA 3ZT3A 4JHDB 5BRFA 4FK2A 1RDWX 5CYMA 3IS9A 4DQRA 5M1OA 1HNXK 3C6AA 4DSIA 4XH1A 3O80A 1HR0K 3C7NB 3E9LA 2DFFA 2PZSA 3TAQA 5HROA 3QEWA 1U04A 3ISNC 1GLCG 3TTFA 1M1KO 3MWPA 2RHKA 4X62K 3F9KA 4FOIA 4CW7B 4CECA 4KHPK 3O1BA 1Q9XA 2PYLA 4OGCA 3CD6N 4W5OA 3OA9A 2G8UA 1ASUA 3CPWM 4QS8A 3PY8A 2E20A 1T8EA 2Q31A 3AVCA 3SAHA 5BPNA 3DLLL 1S72N 1NGGA 1HJOA 2OANA 3B6OA 3CJ9A 3OYJA 2UYTA 1QS4A 2O8EA 1U2VA 3WNHA 4DB3A 5M1KA 5FRNA 3T69A 2QXFA 3C65A 4JKCA 4Y1DA 3RVCA 3MN9A 3KD5E 4DSJA 2HBLA 3LPUA 5AQRA 1VAZA 2OZMA 4FYDA 3PX4A 4JKGA 4O0JA 4DR5K 3EL2A 1Q86O 2HMPA 4CF2A 2CH5A 3EN9A 3MXMA 2VGNA 4IEEA 3D7EO 3SQ4A 2EX3A 2HOEA 4ID5A 3UIQA 4JLHA 3MAQA 3A5OC 4CZFA 3U4LA 2HNZA 4CI6A 2NLXA 3TWHA 4NLCA 3ZSXA 2O8CB 4BDYA 1WOQA 5BRDA 3MEEA 4F3OA 3EEQA 2F8SA 4Z0UA 4H0XB 1VSJA 3SQ0A 4Y0WA 4C1NI 1NJWA 4FWLA 3WUHA 3OJSA 1NGEA 4OKJA 4BE2A 3RMDA 4PQUA 4BR7A 2P9IB 2KZMA 3ZETA 3A5MC 4YOYA 3TPQA 1VRUA 2F96A 1NGAA 2HW3A 3LP3A 3NVMA 2D0AA 2ZF5O 5KPZA 2ZQBA 1XWLA 3ZX3A 1H1VA 1LCUA 5C12A 3VQ9A 3HTVA 3I55N 3UE5A 2BDPA 5J1EA 4BRMA 1NGIA 4CHOA 4E0DA 2Q0UA 4E1NA 1T44A 4CJ7A 3H3OB 3AO5A 4NB4A 4BC2A 1T05A 2DFHA 4R5PA 1S22A 3KKRA 1ASWA 3EE9A 4CJKA 2OA8A 3MMVA 1KVAA 3AO3A 3EY1A 1W9HA 1K9MO 3RMCA 2HVIA 3HT3A 3FR0A 1QQOA 2XY6A 3F5TA 1S1XA 1QSLA 3I0SA 4BRIA 4FJ7A 3SCXA 1HQUA 4ISGA 4ILHA 4FJLA 4CEEA 1X1PA 3BEXA 3AO1A 4FVMA 4BRNA 3SMSA 1CXQA 5LMUK 5DK5A 3EKSA 4JAXA 4E1JA 5FRMA 3LAMA 1VQ9N 4A62A 4KTQA 3QNOA 5IWAK 3K5NA 4GKJK 3UKRA 4CZKA 3J7YP 4KTWA 4OLBA 4RW6A 4IG0A 2GEMA 1RDCA 4YDUA 4AM6A 5AQNA 4CFCA 4JD2A 4CZIA 4E3SA 5GAEP 4AHUA 2CGLA 3WXMB 2D0OA 4MDBA 4EP5A 1SZ2A 3CHWA 3MX5A 4K8XA 4BRAA 4JI6K 3VEWA 3QFUA 4KH4A 3CFRA 3VQBA 5I3UA 3DRSA 2P5GA 4AHCA 1UAXA 2UUCK 3KKSA 5JLHA 4FW1A 3SUQA 2YKMA 4H0YB 5BPMA 1BHLA 4CEOA 3VEXA 4DR4K 2VWBA 3MECA 3WEEA 4BWJA 4JRPA 4FSVA 3RRHA 2KLAA 4O44A 3AA5X 4OPKA 1T6DA 4BRCA 3P31A 4KB0A 2KHOA 2OPQA 4BRGA 4CEAA 1S9EA 3THXA 4O8KA 3IRXA 2W41A 4CGFA 3PO4A 4WFNL 5AQGA 3ULDA 1NM1A 3G71N 4GMJB 4CJ4A 5AQWA 1C0MA 1SAZA 4WFBL 3QERA 3T1YK 3VQ7A 3DLKA 3C94A 1NK9A 4A5AA 2QW9A 2YX6A 1NMNA 3L2VA 4JKAA 3SV4A 1RNHA 4FWOA 3NFAA 3L2WA 4NO7A 1HNZK 2FC0A 4IZ9A 2PAVA 3ZSRA 4YORA 5TKYA 5HBMA 3HPOA 3I33A 3O9RA 3HM8A 5F2RA 5K14A 4YOWA 1ITGA 4M3UA 2Z1JA 4B3RK 5DMRA 3TSPA 3TAFA 5I42A 1NJZA 4JV5K 4RCHA 5JS1A 1L5UA 1C1CA 4M3TA 1L3UA 4AHSA 4BWMA 2HMIA 2D0BA 2V51B 1JLCA 5FPDA 1BL3A 3AGKA 1WNSA 4CJRA 1D9DA 3VGMA 4IOAL 2WONA 1KVCA 3RSEA 1HUXA 4CJTA 4FJIA 5AQIA 4GVEA 4CGGA 1S1WA 2Q0RA 5D3GA 3JS6A 1SV5A 3HL8A 3O08A 3SQ1A 1BWFO 3JAMO 3QICA 3CYMA 4CJVA 4DLGA 4CE9A 3JXUA 1NK8A 4CGIA 4OKKA 4WQ5C 1P90A 2P9UB 3ZSYA 3VEYA 3O8MA 3H08A 2HB5A 3OBWA 4B3MK 1QZ6A 4LF6K 4CHYA 2OPRA 3M3ZA 1TKDA 5T7BA 3RMAA 3VA0A 4BY9C 1SL0A 2OZSA 1C0TA 1JLFA 1RBVA 4U67L 3CJBA 3FFKB 3SK3A 1GLLO 4FPBA 4YOXA 1Z6RA 3CJCA 3OS0A 5CZ2A 3P4IA 4WCEL 2I7NA 5EU7A 5JICA 4IJNA 3CC7N 4H5RA 3FGUA 2Q3SA 5EY4A 2O8DB 3NF7A 1KSPA 2BE2A 4K0KK 3QEIA 2RKIA 1G15A 3HP6A 4WYBA 2QK9A 3HPGA 4HVJA 2YHXA 3LZIA 3DLBA 4A57A 1X3NA 4BG8A 2XY5A 3VQ8A 3WXJA 3J7AP 4BR4A 1LWEA 1F21A 3JSMA 3DAWA 3K5LA 3D2FB 4JEPA 5TKWA 3L8BA 1BA1A 4CD1A 4CBUA 1NG9A 5SZTA 3OYMA 4AQYK 2BGGA 1NKCA 3NMUA 1A5XA 1RT6A 1RT7A 4AHTA 2I7PA 3WEEB 3KK7A 4DV2K 1TVRA 4BR2A 3F2KA 3QIOA 3G0ZA 1N6QA 2RN2A 3KLHA 1UWBA 2QI2A 2ITMA 4JNEA 4CJQA 1HYZA 3HPHA 4I9LA 3AV9A 3VERA 4MFBA 5JLFA 1XHZA 2WOMA 1VSHA 3RR7A 2HF4A 1YTAA 2FF6A 3SJJA 4M45A 4B9QA 3D0PA 4M7YA 2VWJA 3CCMN 3THYB 3AVAA 1KC8O 4BC3A 1DEJA 3S3MA 4LH5A 5LJWA 4DQIA 1YJNN 1BISA 2O4GA 1VQMN 1RCHA 2E2PA 1JLEA 4DF4A 4LSNA 3C6HA 1IBKK 4FJ8A 4B9VA 1LW0A 3QINA 3CFPA 1Q18A 4KHSA 1HYSA 3WNFA 4ZTFA 4CIEA 1GLAG 3AARA 3KZBA 2FSJA 1WAJA 2OPPA 5AQZA 1ATNA 2B4JA 1TAQA 1QQNA 2WC9A 3ASMA 3KD1E 1K8KA 2W42A 3L0QA 3O4NA 3S9HA 1VQ8N 4IOCL 5AQMA 5C15A 3TABA 1TK0A 2Y1IA 1DGKN 4OVLA 1FXXA 4M7XA 5E41A 4LF7K 1IBLK 4QS9A 5AFUA 4FWMA 3E01A 3IDHA 5AQXA 3MN7A 4C8NA 1YJ9N 4DTPA 3P5JA 4R79A 4DQPA 1YXQA 1WN7A 3F9MA 1NJXA 1SKWA 4BQZA 1BUPA 1BO5O 1KQSM 4DTOA 4CZMA 3QB0A 1TUUA 5AQYA 3CQYA 2YI1A 3T7ZA 4F2SA 2ETJA 4FK0A 3BGRA 1J5EK 4FZXC 1RTDA 1J6ZA 3SNNA 5C2FA 4K25A 4DHYA 5JS2A 5KQ8A 4HHTA 2ZGZA 4WQ4C 4J2BA 2Y1JA 4E1MA 2QA4N 3AA4A 2P9IA 4CJWA 2VQEK 1VQ5N 4NCBA 4BVOA 2VG7A 3KLEA 3CERA 5BR9A 3H46O 1NWKA 3ZSOA 4CHQA 4OPJA 1VQLN 3ITHA 2AJQA 4XH4A 4BR0A 4CJPA 3FZMA 5HLFA 3ENHA 3KLGA 4BRFA 4FWQA 1FJGK 1MU2A 3LALA 4X66K 1WBDA 2CGKA 3HP9A 4DV3K 1NK4A 3DI6A 3THXB 4CZHA 3K9KA 4BRPA 2KKZA 3G10A 1EKEA 1X9MA 4LFCK 4ZHRA 1TK8A 3PSFA 1GLDG 3W0LA 3T1HK 4BC5A 4BGAA 1YJWN 4FLYA 1TL3A 1S3XA 4DSLA 3HYFA 4CHPA 1D8YA 4H8KA 3ATVA 3MXIA 1MWMA 3O9UA 5F1XA 4DR1K 3TARA 3MEDA 3THWB 4BQLA 2UXDK 5AZIB 3AVIA 3ZLJA 4RW9A 3M8PA 2NRVA 3OW2M 3GOIA 2HHVA 3W3DA 4FLWA 4FJNA 2D1KA 3EZWA 4MLEA 5LJVA 4J2AA 4PKHA 4KAZA 1TYQA 1L3SA 3V9UA 1Q7YO 4DLEA 1X9SA 2QWPA 2HHHK 4DFJA 3R1XA 2Q1NA 4JI0K 5KI6A 3OTOK 4IO9L 2A1SA 2X74A 3FLCO 1RBRA 1XNRK 4LY7A 3VESA 2XO7A 2BTFA 5C2DA 3CMEN 3VMFB 2VG5A 2E2QA 3UB5A 1XMQK 2NRXA 5ELZA 3KLFA 3WXLA 4DSFA 1O13A 3R8EA 3B6PA 1TKTA 3VPZA 1W7AA 1GOCA 1S9GA 4CCHA 1XC9A 1IV0A 3C95A 3T3FA 1GLEG 2E6LA 4CK1A 4GY2B 2NRWA 3DM2A 4GVMA 3NGIA 4BACA 4E89A 1CLQA 4CIGA 3OJUA 2HHQA 4B9MA 4JI5K 3P1GA 3V1OA 3SBTA 3AVGA 2O4IA 3DLRA 2QWOA 2GX9A 4E7JA 3Q7CA 3HOTA 5AQFA 1EP4A 4BG9A 3QNNA 1VSDA 4DQSA 4FWPA 1HKGA 5BPLA 3ID8A 4OO1J 3NCIA 4F4KA 3AY9A 1YITN 4B1UB 5KPTA 4JK9A 4ID1A 5EXWA 4FJ5A 5AQKA 2QTDA 4FWKA 4CF0A 4W5RA 2HBJA 2HHUA 1FKOA 1NMDA 3O4WA 5HRPA 3E9OA 3BF3A 3SQ2A 1QTMA 2B5JA 2GUPA 3CCEN 1JCGA 3ATUA 1HKBA 3FZHA 1XQSC 2P9NA 3VQ4A 3VQ6A 1DLOA 3NAEA 1SL1A 1X3MA 3I56N 3DOLA 5EX5A 3SUPA 3L2UA 4BVPA 4KH6A 2AA4A 1OVYA 1S5JA 5GIPA 4ELVA 1JXEA 4M3RA 1QZ5A 4WQ4A 1VQPN 3PIOL 3H45C 4DR7K 2FF3B 3OYGA 1BOTO 3TSUA 5JVGL 3AVFA 3ZCMA 1NOYA 4NXNK 4YFUA 1BIZA 4PKIA 1L3VA 2NRRA 3AVBA 4CZJA 4A2AA 4FJHA 2J4RA 1GOAA 3LPTA 1VQKN 4BRKA 3V81A 1ESVA 4O55A 5KTQA 5AZIA 3DRPA 3THWA 4KV8A 4BRQA 3QMLA 4CF8A 1VSIA 3LL3A 3VN5A 4N76A 3VTHA 3VQDA 3NH1A 1E4GT 4CJEA 4GKKK 2P9KA 1W97L 1WB9A 1JL2A 4DV1K 2FBVA 1TKXA 1IKXA 2JLEA 4N47A 4HCCA 2OTJN 4JKFA 2FBYA 3TANA 4EZ6A 4YOTA 4IFEA 1KRPA 2WFBA 2DPNA 1O1WA 4IG3A 3O3FA 3WNGA 2OTLN 3N4QA 4ILGB 4K43A 4W5TA 3V6DA 4JD2B 5BN9A 2F9WA 3CM5A 4BGBA 2O8DA 5AQJA 1SS6A 3CI5A 1NJIO 4I7FA 4JKEA 2D0CA 1HPMA 4CEZA 3TAPA 4BR5A 1BG3A 4DFKA 4FWSA 1VSKA 1GLBG 4LSLA 1HQEA 4FJGA 2FXUA 5ADXH 4C8MA 4WF9L 1EETA 4G1QA 1YVUA 1C0UA 2JGUA 3SPZA 5J2NA 1KD1O 4JHDA 2Z1IA 1RDBA 1BDGA 4B8CA 1BI4B 1C1AA 3LP0A 3OYNA 5DM7L 1NGDA 2UUAK 1CZ9A 1EX4A 2QWLA 2R7YA 1RTHA 5AQLA 3K2PA 1YIJN 2QEXN 1T03A 1OH7A 2IDOA 3UKUB 1RTIA 1NBWA 3K58A 4FVUA 4LF5K 4BE0A 2VCPA 1T6CA
chains in the Genus database with same CATH topology
4LFAK 3T1YK 2HHHK 5A2QO 3J7AP 4JI0K 3OTOK 2UXBK 4NXMK 4JI3K 2ZM6K 1HNZK 1XNRK 1N36K 2E5LK 5LL6Z 4AQYK 1J5EK 4LFBK 1XMQK 4JI2K 2UU9K 5LMUK 4GKKK 4DV2K 4JYAK 4DV0K 4DV1K 4YY3K 4B3RK 3J80O 2VQEK 4JV5K 4DR5K 5IWAK 4JI8K 4JI1K 2UXCK 4DR6K 4GKJK 2F4VK 3J7YP 1IBMK 4JI7K 4JI5K 4X64K 4DUYK 5IT9O 3JAMO 1FJGK 4CVNE 4X66K 2UUBK 1N32K 4DV5K 4JI6K 4DV3K 4V19S 4JI4K 1IBKK 4LF4K 5AJ3K 5BR8K 4DR2K 4DV7K 2UUCK 4LFCK 1HNWK 4B3MK 5LMNK 4LF6K 2VQFK 4DR4K 3T1HK 4DUZK 4LF9K 4LF8K 1HNXK 1HR0K 4YHHK 3J81O 4DR1K 4DV6K 5FLXO 1XMOK 4DV4K 4OX9K 2UUAK 4B3TK 2UXDK 4X62K 4LF7K 1IBLK 4CW7B 4KHPK 4DR7K 1I94K 1N33K 4K0KK 4X65K 4DR3K 4B3SK 1N34K 4NXNK 4LF5K 1XNQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA K;  3T1Y K;  2HHH K;  5A2Q O;  3J7A P;  4JI0 K;  3OTO K;  2UXB K;  4NXM K;  4JI3 K;  2ZM6 K;  1HNZ K;  1XNR K;  1N36 K;  2E5L K;  5LL6 Z;  4AQY K;  1J5E K;  4LFB K;  1XMQ K;  4JI2 K;  2UU9 K;  5LMU K;  4GKK K;  4DV2 K;  4JYA K;  4DV0 K;  4DV1 K;  4YY3 K;  4B3R K;  3J80 O;  2VQE K;  4JV5 K;  4DR5 K;  5IWA K;  4JI8 K;  4JI1 K;  2UXC K;  4DR6 K;  4GKJ K;  2F4V K;  3J7Y P;  1IBM K;  4JI7 K;  4JI5 K;  4X64 K;  4DUY K;  5IT9 O;  3JAM O;  1FJG K;  4CVN E;  4X66 K;  2UUB K;  1N32 K;  4DV5 K;  4JI6 K;  4DV3 K;  4V19 S;  4JI4 K;  1IBK K;  4LF4 K;  5AJ3 K;  5BR8 K;  4DR2 K;  4DV7 K;  2UUC K;  4LFC K;  1HNW K;  4B3M K;  5LMN K;  4LF6 K;  2VQF K;  4DR4 K;  3T1H K;  4DUZ K;  4LF9 K;  4LF8 K;  1HNX K;  1HR0 K;  4YHH K;  3J81 O;  4DR1 K;  4DV6 K;  5FLX O;  1XMO K;  4DV4 K;  4OX9 K;  2UUA K;  4B3T K;  2UXD K;  4X62 K;  4LF7 K;  1IBL K;  4CW7 B;  4KHP K;  4DR7 K;  1I94 K;  1N33 K;  4K0K K;  4X65 K;  4DR3 K;  4B3S K;  1N34 K;  4NXN K;  4LF5 K;  1XNQ K; 
#chains in the Genus database with same CATH topology
 1ZBS A;  4H0V B;  3V9Z A;  1RTJ A;  3RSE B;  1E3M A;  4M42 A;  3CCS N;  4DQQ A;  3ZSV A;  1IG8 A;  3OYD A;  2P51 A;  1EWR A;  2Q97 A;  4LC9 B;  2ZJQ L;  1UA1 A;  3LDQ A;  4JI3 K;  2PFU A;  2G8K A;  4K41 A;  1HPZ A;  4ISE A;  4LH4 A;  4F3T A;  1TL1 A;  3PLA A;  1IKW A;  5HRR A;  4CFB A;  3VA3 A;  4DKW A;  5CE3 A;  1NLV A;  2BUP A;  2RPI A;  4PWD A;  1ATR A;  4JI1 K;  4QOZ B;  2JWL A;  2F4V K;  2YNI A;  3CCJ N;  3PO5 A;  4M41 A;  5AQT A;  1RDA A;  4AF1 A;  3HK2 A;  4JKH A;  1RIL A;  4IEI A;  2O8C A;  1U6Z A;  3RWU A;  3OS1 A;  3O9T A;  1YUW A;  4Q5V A;  3NHG A;  2E2N A;  3MWT A;  4B1X B;  4V19 S;  1J54 A;  4NCA A;  3BDP A;  2QWM A;  4BRD A;  2YJE A;  3A8Y A;  2DFE A;  4I6M B;  1YAG A;  4PHT X;  3OYA A;  3E9P A;  3PSI A;  3CJ1 A;  4NLB A;  4HWI A;  4IXC A;  3GDQ A;  1KCF A;  3V9W A;  3LDO A;  1C6V A;  4FJM A;  1JLG A;  1ILY A;  2YJF A;  3NVK A;  2YNG A;  3THV A;  3CIP A;  4DU4 A;  1NGJ A;  1SL2 A;  1XMO K;  1WBB A;  3I0R A;  2IVN A;  4OX9 K;  4FCY A;  1E4F T;  3I8B A;  2DY4 A;  3AAP A;  4L8R B;  4Z4H A;  3LWM A;  4J2E A;  1N33 K;  4C1N K;  1TUY A;  1RBS A;  4FJJ A;  4X65 K;  4B3S K;  2KW4 A;  1N34 K;  3LDP A;  3DLE A;  3DRR A;  1JXB A;  4YOV A;  1KLM A;  1VSF A;  4AM7 A;  3RRG A;  3M8Q A;  4KHW A;  1HNV A;  1JLA A;  2P9L A;  3UKR B;  3ZX0 A;  1ZBL A;  4CJ3 A;  2QWN A;  5KRT A;  4HUG A;  4HCB A;  4KHQ A;  4KH5 A;  3LAN A;  3EO3 A;  3VEZ A;  5E26 A;  5LL6 Z;  2P9N B;  4FM0 A;  4B8A B;  2ZJP L;  4NYF A;  3BZC A;  3VF4 A;  4F9O A;  4OLA A;  4H4M A;  3IG1 A;  5MLC Q;  3HXM A;  3RMB A;  4FZZ A;  3J80 O;  1Y97 A;  3P83 D;  3AA3 A;  4JI8 K;  4N5S A;  4B3O A;  3QBX A;  3CCQ N;  4CBW A;  1J53 A;  1BQM A;  1UA0 A;  3TU5 A;  3IUC A;  2P9S A;  5FPE A;  4JI7 K;  2EWS A;  4X64 K;  3DOK A;  3OYF A;  3S41 A;  4PKG A;  2EHG A;  4L3Q A;  1GLJ O;  3WT0 A;  4CVN E;  1DKG D;  2UUB K;  3EZ5 A;  4CFA A;  2VG6 A;  1RGI A;  3ZT1 A;  4FZY A;  4WE1 A;  3MX2 A;  5BR8 K;  4DR2 K;  2IC3 A;  1CXU A;  5C42 A;  1WSE A;  1IKY A;  3U9D A;  4DWI A;  4N56 A;  3EYZ A;  2H3G X;  1RT1 A;  1OH8 A;  3B8A X;  2O8F B;  3L4Q A;  3ZT4 A;  5JMV A;  1K8K B;  2A5X A;  3QDK A;  3VQP A;  3CQX A;  3OYI A;  4CGJ A;  3CMA N;  1QQC A;  4U7B A;  2NRT A;  2ASO A;  1W2B M;  2ZWH A;  1NNE A;  3ZET B;  5C0Y A;  3TR8 A;  1ZXO A;  3OYE A;  4KI4 A;  3HM9 A;  3AVK A;  3AGR A;  3SMP A;  4Z94 A;  4A61 A;  1KAY A;  3ZSW A;  4EP4 A;  4HUE A;  4CER A;  1UOC A;  3KVG A;  3KK1 A;  5J2M A;  1DTT A;  1K6Y A;  4FW2 A;  1NU0 A;  1TAU A;  1QQM A;  5M1P A;  3J7Z O;  3SV3 A;  1TYQ B;  3PUF A;  1XNQ K;  3HST B;  1P8Z A;  5AFU H;  4F2R A;  1FW6 A;  3N4P A;  3THY A;  3O9S A;  2GV9 A;  3AO4 A;  1RT4 A;  4E7L A;  1NGF A;  3QEX A;  1D9F A;  2GUI A;  5CR4 A;  3D2E A;  1N36 K;  1Y64 A;  1RT3 A;  4FO0 A;  1WSJ A;  4KO0 A;  4KHY A;  3KTQ A;  3VGL A;  4JKG B;  1RDD A;  2A42 A;  2G8V A;  4JK8 A;  4CEF A;  4DF8 A;  1JL1 A;  4JYA K;  1U49 A;  3SPY A;  4GNI A;  1BA0 A;  3FZK A;  3H6E A;  1FKP A;  3BUZ B;  2HBM A;  2UXC K;  4H03 B;  4DR6 K;  4J8F A;  1XC3 A;  1C0G A;  3GE1 A;  3DXK A;  1K73 O;  5AQP A;  4FLT A;  1EQY A;  3VET A;  3ZYY X;  3PIP L;  3CCV N;  3HO1 A;  4EHT A;  4A2B A;  5SWM A;  1DT9 A;  2E1Y A;  4B1Y B;  1IG9 A;  4W5Q A;  3CCL N;  2XY8 A;  3ZSQ A;  3AA2 A;  3V1R A;  2E2O A;  3KHY A;  2GWJ A;  2OCE A;  3VQC A;  1NK0 A;  3MXJ A;  3FFI A;  4KRE A;  4JK7 A;  2IVP A;  3CJA A;  4GV6 A;  1LAW A;  2PBD A;  4O0I A;  1WAF A;  4CJU A;  4QS7 A;  4B9N A;  1HNW K;  3HSC A;  2VQF K;  1HLU A;  1ASV A;  3LM2 A;  1B92 A;  4GV3 A;  1HYV A;  4BRO A;  4XEI A;  4DCH A;  3MCP A;  4F8R A;  5I9E B;  4FPA A;  3DXM B;  4CZL A;  1Z25 A;  3U3Y A;  5GIO A;  4B9S A;  1OKJ A;  4H4O A;  4E7K A;  4DTS A;  4H0O A;  4M63 C;  1A5V A;  1SQK A;  4JKD A;  3S3N A;  1T7P A;  1NJY A;  1REV A;  2GEL A;  3NH0 A;  4DQ8 A;  1OH6 A;  5AQU A;  2IS3 A;  2P9P B;  2E1Z A;  1J5O A;  5F0X A;  1YI2 N;  4PL8 A;  5BRH A;  3MN5 A;  3BP8 A;  4DTU A;  3WNE A;  4FM2 A;  3GG4 A;  5AQH A;  4DTR A;  3O6W A;  2UXB K;  3SLC A;  3U6F A;  3ENB A;  3QO9 A;  2FSN A;  4MO5 A;  3WXK A;  2P1J A;  1VSM A;  1RDU A;  4ICL A;  3OYL A;  4CD3 A;  3NDK A;  4KI6 A;  1S1U A;  4I2P A;  3FZL A;  3IMX A;  3CQ8 A;  4RW8 A;  5DM6 L;  4DV0 K;  4CGD A;  5AR0 A;  3SI6 A;  3D2E B;  1S6Q A;  3K57 A;  1SKR A;  5HRN A;  1RBT A;  4K42 A;  1KLN A;  3PX0 A;  4Z4F A;  2CGJ A;  4KB1 A;  2F8T A;  3DMJ A;  3QET A;  3CM6 A;  3VGK A;  2F9T A;  3IAY A;  2YCH A;  4MQ3 A;  2A41 A;  2YHY A;  4M3W A;  3GBT A;  4FOE A;  3WXI A;  3L2Q A;  2A3Z A;  3OVN A;  3NH2 A;  3AO2 A;  4IBN A;  3AVL A;  4DSK A;  2E4L A;  4OPA A;  1WUA A;  3CCR N;  4DV7 K;  4IDK A;  1KVB A;  4Z4I A;  4CBX A;  1HMV A;  4JKB A;  1R59 O;  2Z1H A;  3U3G A;  3R6M A;  4CIF A;  3O3G A;  4DUZ K;  4ILJ A;  4LF9 K;  2GBZ A;  3E1Y A;  3LDS A;  5M1F A;  4K8Z A;  1YVN A;  1WSI A;  3D6R A;  5CHI A;  2CH6 A;  2AP1 A;  4B08 A;  3D2F A;  1U2V B;  3H1Q A;  2D5R A;  1G99 A;  1VQ4 N;  5KGX A;  4C8O A;  1Z26 A;  5HP1 A;  3QES A;  1C0F A;  3P38 A;  3KK2 A;  1U45 A;  4FLV A;  5C24 A;  4CJ5 A;  1R0A A;  4CK2 A;  3TI0 A;  1EWQ A;  4WQ5 A;  3NF9 A;  3A5L C;  3HOS A;  4DU1 A;  4EFH A;  2RE2 A;  1QSY A;  4QCL A;  5A2Q O;  3A2F A;  2I5J A;  4OJR A;  2E8A A;  2DTU A;  3LP2 A;  4ELT A;  4JRQ A;  1N8R O;  1LOT B;  2D4W A;  3OBY A;  4OGE A;  1BGX T;  4M3Y A;  1A5W A;  4B9T A;  4KFB A;  2W6L A;  2ASM A;  3MDQ A;  2X6N A;  4RTF D;  3AVH A;  1NK7 A;  4W5N A;  4IJA A;  2FBT A;  4DTM A;  1K8A O;  4UQG A;  1VQO N;  1N5Y A;  4FWR A;  2Z1G A;  1EXQ A;  1FK9 A;  3OYB A;  1BCM A;  3R9P A;  3HBT A;  2X6S A;  1BU6 O;  1RT2 A;  2P9U A;  4YOU A;  3KK3 A;  4KTZ A;  2OYQ A;  1QE1 A;  5J2P A;  2P9L B;  4IFV A;  4DG1 A;  3TAG A;  4C8K A;  1HKC A;  2Q2R A;  2YNF A;  2NRZ A;  4BR9 A;  2X78 A;  4MDA A;  1KXP A;  5AQO A;  5AJ3 K;  3CXC M;  1JJ2 M;  5BN8 A;  1VK0 A;  3ZEU A;  1XHX A;  2HHT A;  3SAG A;  3OYK A;  2HF3 A;  3K9J A;  1IKV A;  3VF2 A;  3O9Q A;  2B6A A;  5KPR A;  4CEQ A;  1NK6 A;  1I39 A;  2QM1 A;  3KJV A;  4DFP A;  4YHH K;  1D5A A;  2P5O A;  1NGB A;  5E84 A;  4DV4 K;  1LWC A;  3M6G A;  1SKS A;  1JLB A;  4B3T K;  3VEN A;  4I6M A;  1OVQ A;  5C25 A;  2XHB A;  2RF2 A;  4Y1C A;  4A5B A;  4IO8 A;  4HTU A;  1HNI A;  4AHR A;  4FXD A;  1W0H A;  4O4G A;  3RR8 A;  3U9Z A;  3G4S N;  3A0I X;  4ZTJ A;  2KTQ A;  4NCG A;  1VQ6 N;  2ZGY A;  2QWQ A;  4MO4 A;  4RG8 A;  3EKU A;  3GL1 A;  1I3A A;  4KRF A;  3QBW A;  2XY7 A;  4E7H A;  1KFS A;  4Z4C A;  1RFQ A;  1KAZ A;  3ZT0 A;  5KRS A;  3LAK A;  3VF6 A;  3CF5 L;  2IGI A;  3C0B A;  2ZM6 K;  4KPY A;  3NBP A;  5HRS A;  4GW6 A;  2OPS A;  2O8B A;  3SJH A;  1JCF A;  1QVF M;  5GAH P;  2ITG A;  2ZE2 A;  1WLJ A;  5HOO A;  4DTN A;  3F73 A;  4O5F A;  2PYJ A;  4DTX A;  4FWN A;  1ZBU A;  1SUQ A;  1HX1 A;  3VTI A;  4DS5 A;  1Z05 A;  3BZK A;  4EAH D;  2O8E B;  4CF1 A;  3C6U A;  4FLU A;  3ENO A;  5ADX A;  3K5O A;  4OPH A;  3OY9 A;  1Q9Y A;  3AAQ A;  4BRH A;  3SUN A;  3AVJ A;  4H5N A;  4I9Q A;  5JVH L;  3VQQ A;  1IJJ A;  1CZA N;  2P9P A;  3VEV A;  2YHB A;  4BRE A;  4DUY K;  1NKE A;  3H1V X;  1VSL A;  2BH1 A;  1Q82 O;  2ASP A;  1YHQ N;  4XH5 A;  4A59 A;  1VQ7 N;  4ELU A;  1V4S A;  4DV5 K;  1BQN A;  4NYN A;  3CG7 A;  1XUP O;  4EZ9 A;  3SZ2 A;  2YKN A;  2IOC A;  1JCE A;  3K0S A;  4WFA L;  4KHN A;  3WQU A;  2HNY A;  1BI4 A;  1IH7 A;  1LWF A;  3ULE A;  4YDU C;  1JKH A;  3L2R A;  4CEB A;  4IKF A;  3RTV A;  3BY5 A;  3FZF A;  3QFP A;  5C10 A;  4FLZ A;  1HJR A;  3K5M A;  3V9S A;  5EVZ A;  4OKE A;  1TKZ A;  3TTC A;  3M5R A;  5FLX O;  4FM1 A;  3E66 A;  3K59 A;  5GAG P;  3DJC A;  5KQD A;  1RBU A;  2F7T A;  3R3L A;  2VYP A;  4Z4E A;  1M90 O;  5H1S Q;  4YNQ A;  1VQN N;  4DR3 K;  3NGZ A;  3EE8 A;  2NRH A;  5BRE A;  2W6K A;  3MCA B;  4N41 A;  4KKO A;  1T3V A;  3DXK B;  3NGY A;  1NOZ A;  4H0T B;  2YHA A;  3LM9 A;  3M1F A;  4M3Z A;  1C1B A;  2V7Y A;  1WSH A;  2HST A;  3LZJ A;  3OYC A;  4B9L A;  4LFB K;  2P9K B;  1ZC6 A;  2UU9 K;  2FBX A;  2VGM A;  2O8B B;  1TGO A;  1NKB A;  1ZYQ A;  1VHX A;  1OH5 A;  3G25 A;  4JN4 A;  3QIP A;  3PX6 A;  2WBN A;  4KBO A;  3S3O A;  3H3N O;  1LAV A;  3M8S A;  5CZ1 A;  3MN6 A;  4I2Q A;  4XIU A;  1J9A A;  3LDL A;  5AZJ B;  4Q0B A;  5AZJ A;  3G6E N;  4CJS A;  5AQV A;  3MEG A;  4BC4 A;  2HND A;  1IO2 A;  4CGH A;  4H5V A;  1D4X A;  4JS5 A;  3OHR A;  1S6P A;  5CYQ A;  3HI0 A;  2G8F A;  3TAE A;  4LD0 A;  3IKM A;  1U47 A;  1B9D A;  5M1Q A;  1X9W A;  1KFD A;  5EOY A;  2QKK A;  1WSG A;  4CJL A;  3MK6 A;  2V52 B;  4AHV A;  3LDN A;  3SAF A;  4IFY A;  4DS4 A;  3CET A;  4CFD A;  1QSS A;  4CZG A;  1S1V A;  3TSQ A;  4LF8 K;  1LV5 A;  1YTU A;  4CES A;  1MA9 B;  3WQT A;  4E19 A;  4C8L A;  3J81 O;  4CHZ A;  3ZEU B;  4DV6 K;  3KWG A;  2GWK A;  3VQ5 A;  2IAJ A;  3L3U A;  1MWK A;  4PL7 A;  1VSE A;  4BE1 A;  2XRI A;  5M1N A;  2KQ2 A;  3ZX2 A;  3QEP A;  3NE6 A;  4B9U A;  2NUB A;  4KHU A;  5AQQ A;  4IOX A;  1YT3 A;  1MDU B;  2ZD1 A;  1BCO A;  2W40 A;  3UKU A;  4CK3 A;  3KWI A;  3P39 A;  2IVO A;  3OS2 A;  4GV9 A;  4M3X A;  1QHA A;  5FRO A;  1VRT A;  3JYT A;  4JS4 A;  5FPM A;  5J2Q A;  3Q7B A;  4FL9 A;  4J2D A;  4NXM K;  3PV8 A;  2KFN A;  1YF5 L;  4DU3 A;  3DXM A;  3U8X A;  3CCU N;  3TAM A;  3O1W A;  4QAG A;  1NGC A;  3C7N A;  4RW4 A;  3NF8 A;  1GOB A;  4JI2 K;  3ZSZ A;  3ULE B;  4MLH A;  4IDH A;  4DTJ A;  4PUO A;  4YY3 K;  3L6Q A;  4TSX A;  4HTL A;  4BDP A;  5KGW A;  5GAD P;  2A1R A;  5FPN A;  3ALY A;  4CF9 A;  3T19 A;  1S1T A;  2ATQ A;  3TTD A;  3QLH A;  1WSF A;  4BDZ A;  1ZBF A;  3DWL A;  4DFM A;  4EIA A;  2FLO A;  3A5N C;  1LW2 A;  4LF4 K;  4FJK A;  4FJ9 A;  4PA1 A;  1KTQ A;  3KIO A;  3IFR A;  4CZE A;  1CZB A;  2GTD A;  4IWV A;  4CHN A;  2NZT A;  3V4I A;  1XI1 A;  2HHW A;  1KAX A;  3ZT2 A;  3V9X A;  4H0P A;  3I8D A;  2HHS A;  1ATS A;  4B1Z A;  5LY3 A;  2E88 A;  2E6M A;  2HBK A;  1Q8I A;  3CC2 N;  4CJF A;  3LWL A;  1L3T A;  3VOV A;  4FK4 A;  1QHT A;  4DSE A;  3QEV A;  2IIR A;  2QXL A;  2VWK A;  3CC4 N;  3CPE A;  4EHU A;  2G8H A;  1I94 K;  3SBG A;  3C6T A;  3LP1 A;  4CED A;  4BRL A;  4AIL C;  1ZBI A;  3ID6 A;  4G9Z A;  2QKB A;  4B1W B;  4RW7 A;  4Z4G A;  2WUS A;  3AVM A;  3CJ7 A;  1EO1 A;  4FJX A;  1RT5 A;  4LFA K;  1X9J A;  3SYZ A;  3BF1 A;  3SUO A;  5FDL A;  2G8W A;  3V1Q A;  4AH9 A;  2HHX A;  5GIN A;  3KLI A;  1GLF O;  5HL7 L;  4E7I A;  3VQE A;  4FLX A;  1U48 A;  3NF6 A;  3L3V A;  1NGH A;  3AVN A;  2E5L K;  2V7Z A;  2A6A A;  2NNW A;  1B9F A;  3O3H A;  3L4I A;  2Q36 A;  2KFZ A;  1BIU A;  4O5B A;  2G8I A;  3HRG A;  3OYH A;  2JWK A;  1QVG M;  2BAN A;  3HVT A;  2QWR A;  3DLG A;  1TK5 A;  2YHW A;  1HRH A;  2A40 A;  5CY4 A;  4O8U A;  2O8F A;  4H5W A;  3HZ6 A;  3J8A A;  2KZZ A;  3DYA A;  2WTU A;  3VQA A;  1TV6 A;  2YNH A;  1IBM K;  1V4T A;  3VEO A;  3M8R A;  4HUF A;  5B8H A;  3DLH A;  3CFO A;  5IT9 O;  4C23 A;  1DTQ A;  2ZJR L;  4ISF A;  3FE1 A;  2YV0 X;  3HJF A;  3O4Q A;  5AQS A;  1Q81 O;  2PY5 A;  4PY5 A;  4H5T A;  1N32 K;  2FSK A;  2P9S B;  4JI4 K;  1NK5 A;  3D45 A;  1ZBH A;  1JLQ A;  3T1A A;  4DMN A;  4RWT A;  2HVH A;  2LSN A;  4UY8 O;  5LMN K;  3HVR A;  1U4B A;  2D0P A;  3O5B A;  4B1V A;  3ZT3 A;  4JHD B;  5BRF A;  4FK2 A;  1RDW X;  5CYM A;  3IS9 A;  4DQR A;  5M1O A;  1HNX K;  3C6A A;  4DSI A;  4XH1 A;  3O80 A;  1HR0 K;  3C7N B;  3E9L A;  2DFF A;  2PZS A;  3TAQ A;  5HRO A;  3QEW A;  1U04 A;  3ISN C;  1GLC G;  3TTF A;  1M1K O;  3MWP A;  2RHK A;  4X62 K;  3F9K A;  4FOI A;  4CW7 B;  4CEC A;  4KHP K;  3O1B A;  1Q9X A;  2PYL A;  4OGC A;  3CD6 N;  4W5O A;  3OA9 A;  2G8U A;  1ASU A;  3CPW M;  4QS8 A;  3PY8 A;  2E20 A;  1T8E A;  2Q31 A;  3AVC A;  3SAH A;  5BPN A;  3DLL L;  1S72 N;  1NGG A;  1HJO A;  2OAN A;  3B6O A;  3CJ9 A;  3OYJ A;  2UYT A;  1QS4 A;  2O8E A;  1U2V A;  3WNH A;  4DB3 A;  5M1K A;  5FRN A;  3T69 A;  2QXF A;  3C65 A;  4JKC A;  4Y1D A;  3RVC A;  3MN9 A;  3KD5 E;  4DSJ A;  2HBL A;  3LPU A;  5AQR A;  1VAZ A;  2OZM A;  4FYD A;  3PX4 A;  4JKG A;  4O0J A;  4DR5 K;  3EL2 A;  1Q86 O;  2HMP A;  4CF2 A;  2CH5 A;  3EN9 A;  3MXM A;  2VGN A;  4IEE A;  3D7E O;  3SQ4 A;  2EX3 A;  2HOE A;  4ID5 A;  3UIQ A;  4JLH A;  3MAQ A;  3A5O C;  4CZF A;  3U4L A;  2HNZ A;  4CI6 A;  2NLX A;  3TWH A;  4NLC A;  3ZSX A;  2O8C B;  4BDY A;  1WOQ A;  5BRD A;  3MEE A;  4F3O A;  3EEQ A;  2F8S A;  4Z0U A;  4H0X B;  1VSJ A;  3SQ0 A;  4Y0W A;  4C1N I;  1NJW A;  4FWL A;  3WUH A;  3OJS A;  1NGE A;  4OKJ A;  4BE2 A;  3RMD A;  4PQU A;  4BR7 A;  2P9I B;  2KZM A;  3ZET A;  3A5M C;  4YOY A;  3TPQ A;  1VRU A;  2F96 A;  1NGA A;  2HW3 A;  3LP3 A;  3NVM A;  2D0A A;  2ZF5 O;  5KPZ A;  2ZQB A;  1XWL A;  3ZX3 A;  1H1V A;  1LCU A;  5C12 A;  3VQ9 A;  3HTV A;  3I55 N;  3UE5 A;  2BDP A;  5J1E A;  4BRM A;  1NGI A;  4CHO A;  4E0D A;  2Q0U A;  4E1N A;  1T44 A;  4CJ7 A;  3H3O B;  3AO5 A;  4NB4 A;  4BC2 A;  1T05 A;  2DFH A;  4R5P A;  1S22 A;  3KKR A;  1ASW A;  3EE9 A;  4CJK A;  2OA8 A;  3MMV A;  1KVA A;  3AO3 A;  3EY1 A;  1W9H A;  1K9M O;  3RMC A;  2HVI A;  3HT3 A;  3FR0 A;  1QQO A;  2XY6 A;  3F5T A;  1S1X A;  1QSL A;  3I0S A;  4BRI A;  4FJ7 A;  3SCX A;  1HQU A;  4ISG A;  4ILH A;  4FJL A;  4CEE A;  1X1P A;  3BEX A;  3AO1 A;  4FVM A;  4BRN A;  3SMS A;  1CXQ A;  5LMU K;  5DK5 A;  3EKS A;  4JAX A;  4E1J A;  5FRM A;  3LAM A;  1VQ9 N;  4A62 A;  4KTQ A;  3QNO A;  5IWA K;  3K5N A;  4GKJ K;  3UKR A;  4CZK A;  3J7Y P;  4KTW A;  4OLB A;  4RW6 A;  4IG0 A;  2GEM A;  1RDC A;  4YDU A;  4AM6 A;  5AQN A;  4CFC A;  4JD2 A;  4CZI A;  4E3S A;  5GAE P;  4AHU A;  2CGL A;  3WXM B;  2D0O A;  4MDB A;  4EP5 A;  1SZ2 A;  3CHW A;  3MX5 A;  4K8X A;  4BRA A;  4JI6 K;  3VEW A;  3QFU A;  4KH4 A;  3CFR A;  3VQB A;  5I3U A;  3DRS A;  2P5G A;  4AHC A;  1UAX A;  2UUC K;  3KKS A;  5JLH A;  4FW1 A;  3SUQ A;  2YKM A;  4H0Y B;  5BPM A;  1BHL A;  4CEO A;  3VEX A;  4DR4 K;  2VWB A;  3MEC A;  3WEE A;  4BWJ A;  4JRP A;  4FSV A;  3RRH A;  2KLA A;  4O44 A;  3AA5 X;  4OPK A;  1T6D A;  4BRC A;  3P31 A;  4KB0 A;  2KHO A;  2OPQ A;  4BRG A;  4CEA A;  1S9E A;  3THX A;  4O8K A;  3IRX A;  2W41 A;  4CGF A;  3PO4 A;  4WFN L;  5AQG A;  3ULD A;  1NM1 A;  3G71 N;  4GMJ B;  4CJ4 A;  5AQW A;  1C0M A;  1SAZ A;  4WFB L;  3QER A;  3T1Y K;  3VQ7 A;  3DLK A;  3C94 A;  1NK9 A;  4A5A A;  2QW9 A;  2YX6 A;  1NMN A;  3L2V A;  4JKA A;  3SV4 A;  1RNH A;  4FWO A;  3NFA A;  3L2W A;  4NO7 A;  1HNZ K;  2FC0 A;  4IZ9 A;  2PAV A;  3ZSR A;  4YOR A;  5TKY A;  5HBM A;  3HPO A;  3I33 A;  3O9R A;  3HM8 A;  5F2R A;  5K14 A;  4YOW A;  1ITG A;  4M3U A;  2Z1J A;  4B3R K;  5DMR A;  3TSP A;  3TAF A;  5I42 A;  1NJZ A;  4JV5 K;  4RCH A;  5JS1 A;  1L5U A;  1C1C A;  4M3T A;  1L3U A;  4AHS A;  4BWM A;  2HMI A;  2D0B A;  2V51 B;  1JLC A;  5FPD A;  1BL3 A;  3AGK A;  1WNS A;  4CJR A;  1D9D A;  3VGM A;  4IOA L;  2WON A;  1KVC A;  3RSE A;  1HUX A;  4CJT A;  4FJI A;  5AQI A;  4GVE A;  4CGG A;  1S1W A;  2Q0R A;  5D3G A;  3JS6 A;  1SV5 A;  3HL8 A;  3O08 A;  3SQ1 A;  1BWF O;  3JAM O;  3QIC A;  3CYM A;  4CJV A;  4DLG A;  4CE9 A;  3JXU A;  1NK8 A;  4CGI A;  4OKK A;  4WQ5 C;  1P90 A;  2P9U B;  3ZSY A;  3VEY A;  3O8M A;  3H08 A;  2HB5 A;  3OBW A;  4B3M K;  1QZ6 A;  4LF6 K;  4CHY A;  2OPR A;  3M3Z A;  1TKD A;  5T7B A;  3RMA A;  3VA0 A;  4BY9 C;  1SL0 A;  2OZS A;  1C0T A;  1JLF A;  1RBV A;  4U67 L;  3CJB A;  3FFK B;  3SK3 A;  1GLL O;  4FPB A;  4YOX A;  1Z6R A;  3CJC A;  3OS0 A;  5CZ2 A;  3P4I A;  4WCE L;  2I7N A;  5EU7 A;  5JIC A;  4IJN A;  3CC7 N;  4H5R A;  3FGU A;  2Q3S A;  5EY4 A;  2O8D B;  3NF7 A;  1KSP A;  2BE2 A;  4K0K K;  3QEI A;  2RKI A;  1G15 A;  3HP6 A;  4WYB A;  2QK9 A;  3HPG A;  4HVJ A;  2YHX A;  3LZI A;  3DLB A;  4A57 A;  1X3N A;  4BG8 A;  2XY5 A;  3VQ8 A;  3WXJ A;  3J7A P;  4BR4 A;  1LWE A;  1F21 A;  3JSM A;  3DAW A;  3K5L A;  3D2F B;  4JEP A;  5TKW A;  3L8B A;  1BA1 A;  4CD1 A;  4CBU A;  1NG9 A;  5SZT A;  3OYM A;  4AQY K;  2BGG A;  1NKC A;  3NMU A;  1A5X A;  1RT6 A;  1RT7 A;  4AHT A;  2I7P A;  3WEE B;  3KK7 A;  4DV2 K;  1TVR A;  4BR2 A;  3F2K A;  3QIO A;  3G0Z A;  1N6Q A;  2RN2 A;  3KLH A;  1UWB A;  2QI2 A;  2ITM A;  4JNE A;  4CJQ A;  1HYZ A;  3HPH A;  4I9L A;  3AV9 A;  3VER A;  4MFB A;  5JLF A;  1XHZ A;  2WOM A;  1VSH A;  3RR7 A;  2HF4 A;  1YTA A;  2FF6 A;  3SJJ A;  4M45 A;  4B9Q A;  3D0P A;  4M7Y A;  2VWJ A;  3CCM N;  3THY B;  3AVA A;  1KC8 O;  4BC3 A;  1DEJ A;  3S3M A;  4LH5 A;  5LJW A;  4DQI A;  1YJN N;  1BIS A;  2O4G A;  1VQM N;  1RCH A;  2E2P A;  1JLE A;  4DF4 A;  4LSN A;  3C6H A;  1IBK K;  4FJ8 A;  4B9V A;  1LW0 A;  3QIN A;  3CFP A;  1Q18 A;  4KHS A;  1HYS A;  3WNF A;  4ZTF A;  4CIE A;  1GLA G;  3AAR A;  3KZB A;  2FSJ A;  1WAJ A;  2OPP A;  5AQZ A;  1ATN A;  2B4J A;  1TAQ A;  1QQN A;  2WC9 A;  3ASM A;  3KD1 E;  1K8K A;  2W42 A;  3L0Q A;  3O4N A;  3S9H A;  1VQ8 N;  4IOC L;  5AQM A;  5C15 A;  3TAB A;  1TK0 A;  2Y1I A;  1DGK N;  4OVL A;  1FXX A;  4M7X A;  5E41 A;  4LF7 K;  1IBL K;  4QS9 A;  5AFU A;  4FWM A;  3E01 A;  3IDH A;  5AQX A;  3MN7 A;  4C8N A;  1YJ9 N;  4DTP A;  3P5J A;  4R79 A;  4DQP A;  1YXQ A;  1WN7 A;  3F9M A;  1NJX A;  1SKW A;  4BQZ A;  1BUP A;  1BO5 O;  1KQS M;  4DTO A;  4CZM A;  3QB0 A;  1TUU A;  5AQY A;  3CQY A;  2YI1 A;  3T7Z A;  4F2S A;  2ETJ A;  4FK0 A;  3BGR A;  1J5E K;  4FZX C;  1RTD A;  1J6Z A;  3SNN A;  5C2F A;  4K25 A;  4DHY A;  5JS2 A;  5KQ8 A;  4HHT A;  2ZGZ A;  4WQ4 C;  4J2B A;  2Y1J A;  4E1M A;  2QA4 N;  3AA4 A;  2P9I A;  4CJW A;  2VQE K;  1VQ5 N;  4NCB A;  4BVO A;  2VG7 A;  3KLE A;  3CER A;  5BR9 A;  3H46 O;  1NWK A;  3ZSO A;  4CHQ A;  4OPJ A;  1VQL N;  3ITH A;  2AJQ A;  4XH4 A;  4BR0 A;  4CJP A;  3FZM A;  5HLF A;  3ENH A;  3KLG A;  4BRF A;  4FWQ A;  1FJG K;  1MU2 A;  3LAL A;  4X66 K;  1WBD A;  2CGK A;  3HP9 A;  4DV3 K;  1NK4 A;  3DI6 A;  3THX B;  4CZH A;  3K9K A;  4BRP A;  2KKZ A;  3G10 A;  1EKE A;  1X9M A;  4LFC K;  4ZHR A;  1TK8 A;  3PSF A;  1GLD G;  3W0L A;  3T1H K;  4BC5 A;  4BGA A;  1YJW N;  4FLY A;  1TL3 A;  1S3X A;  4DSL A;  3HYF A;  4CHP A;  1D8Y A;  4H8K A;  3ATV A;  3MXI A;  1MWM A;  3O9U A;  5F1X A;  4DR1 K;  3TAR A;  3MED A;  3THW B;  4BQL A;  2UXD K;  5AZI B;  3AVI A;  3ZLJ A;  4RW9 A;  3M8P A;  2NRV A;  3OW2 M;  3GOI A;  2HHV A;  3W3D A;  4FLW A;  4FJN A;  2D1K A;  3EZW A;  4MLE A;  5LJV A;  4J2A A;  4PKH A;  4KAZ A;  1TYQ A;  1L3S A;  3V9U A;  1Q7Y O;  4DLE A;  1X9S A;  2QWP A;  2HHH K;  4DFJ A;  3R1X A;  2Q1N A;  4JI0 K;  5KI6 A;  3OTO K;  4IO9 L;  2A1S A;  2X74 A;  3FLC O;  1RBR A;  1XNR K;  4LY7 A;  3VES A;  2XO7 A;  2BTF A;  5C2D A;  3CME N;  3VMF B;  2VG5 A;  2E2Q A;  3UB5 A;  1XMQ K;  2NRX A;  5ELZ A;  3KLF A;  3WXL A;  4DSF A;  1O13 A;  3R8E A;  3B6P A;  1TKT A;  3VPZ A;  1W7A A;  1GOC A;  1S9G A;  4CCH A;  1XC9 A;  1IV0 A;  3C95 A;  3T3F A;  1GLE G;  2E6L A;  4CK1 A;  4GY2 B;  2NRW A;  3DM2 A;  4GVM A;  3NGI A;  4BAC A;  4E89 A;  1CLQ A;  4CIG A;  3OJU A;  2HHQ A;  4B9M A;  4JI5 K;  3P1G A;  3V1O A;  3SBT A;  3AVG A;  2O4I A;  3DLR A;  2QWO A;  2GX9 A;  4E7J A;  3Q7C A;  3HOT A;  5AQF A;  1EP4 A;  4BG9 A;  3QNN A;  1VSD A;  4DQS A;  4FWP A;  1HKG A;  5BPL A;  3ID8 A;  4OO1 J;  3NCI A;  4F4K A;  3AY9 A;  1YIT N;  4B1U B;  5KPT A;  4JK9 A;  4ID1 A;  5EXW A;  4FJ5 A;  5AQK A;  2QTD A;  4FWK A;  4CF0 A;  4W5R A;  2HBJ A;  2HHU A;  1FKO A;  1NMD A;  3O4W A;  5HRP A;  3E9O A;  3BF3 A;  3SQ2 A;  1QTM A;  2B5J A;  2GUP A;  3CCE N;  1JCG A;  3ATU A;  1HKB A;  3FZH A;  1XQS C;  2P9N A;  3VQ4 A;  3VQ6 A;  1DLO A;  3NAE A;  1SL1 A;  1X3M A;  3I56 N;  3DOL A;  5EX5 A;  3SUP A;  3L2U A;  4BVP A;  4KH6 A;  2AA4 A;  1OVY A;  1S5J A;  5GIP A;  4ELV A;  1JXE A;  4M3R A;  1QZ5 A;  4WQ4 A;  1VQP N;  3PIO L;  3H45 C;  4DR7 K;  2FF3 B;  3OYG A;  1BOT O;  3TSU A;  5JVG L;  3AVF A;  3ZCM A;  1NOY A;  4NXN K;  4YFU A;  1BIZ A;  4PKI A;  1L3V A;  2NRR A;  3AVB A;  4CZJ A;  4A2A A;  4FJH A;  2J4R A;  1GOA A;  3LPT A;  1VQK N;  4BRK A;  3V81 A;  1ESV A;  4O55 A;  5KTQ A;  5AZI A;  3DRP A;  3THW A;  4KV8 A;  4BRQ A;  3QML A;  4CF8 A;  1VSI A;  3LL3 A;  3VN5 A;  4N76 A;  3VTH A;  3VQD A;  3NH1 A;  1E4G T;  4CJE A;  4GKK K;  2P9K A;  1W97 L;  1WB9 A;  1JL2 A;  4DV1 K;  2FBV A;  1TKX A;  1IKX A;  2JLE A;  4N47 A;  4HCC A;  2OTJ N;  4JKF A;  2FBY A;  3TAN A;  4EZ6 A;  4YOT A;  4IFE A;  1KRP A;  2WFB A;  2DPN A;  1O1W A;  4IG3 A;  3O3F A;  3WNG A;  2OTL N;  3N4Q A;  4ILG B;  4K43 A;  4W5T A;  3V6D A;  4JD2 B;  5BN9 A;  2F9W A;  3CM5 A;  4BGB A;  2O8D A;  5AQJ A;  1SS6 A;  3CI5 A;  1NJI O;  4I7F A;  4JKE A;  2D0C A;  1HPM A;  4CEZ A;  3TAP A;  4BR5 A;  1BG3 A;  4DFK A;  4FWS A;  1VSK A;  1GLB G;  4LSL A;  1HQE A;  4FJG A;  2FXU A;  5ADX H;  4C8M A;  4WF9 L;  1EET A;  4G1Q A;  1YVU A;  1C0U A;  2JGU A;  3SPZ A;  5J2N A;  1KD1 O;  4JHD A;  2Z1I A;  1RDB A;  1BDG A;  4B8C A;  1BI4 B;  1C1A A;  3LP0 A;  3OYN A;  5DM7 L;  1NGD A;  2UUA K;  1CZ9 A;  1EX4 A;  2QWL A;  2R7Y A;  1RTH A;  5AQL A;  3K2P A;  1YIJ N;  2QEX N;  1T03 A;  1OH7 A;  2IDO A;  3UKU B;  1RTI A;  1NBW A;  3K58 A;  4FVU A;  4LF5 K;  4BE0 A;  2VCP A;  1T6C A; 
#chains in the Genus database with same CATH homology
 4LFA K;  3T1Y K;  2HHH K;  5A2Q O;  3J7A P;  4JI0 K;  3OTO K;  2UXB K;  4NXM K;  4JI3 K;  2ZM6 K;  1HNZ K;  1XNR K;  1N36 K;  2E5L K;  5LL6 Z;  4AQY K;  1J5E K;  4LFB K;  1XMQ K;  4JI2 K;  2UU9 K;  5LMU K;  4GKK K;  4DV2 K;  4JYA K;  4DV0 K;  4DV1 K;  4YY3 K;  4B3R K;  3J80 O;  2VQE K;  4JV5 K;  4DR5 K;  5IWA K;  4JI8 K;  4JI1 K;  2UXC K;  4DR6 K;  4GKJ K;  2F4V K;  3J7Y P;  1IBM K;  4JI7 K;  4JI5 K;  4X64 K;  4DUY K;  5IT9 O;  3JAM O;  1FJG K;  4CVN E;  4X66 K;  2UUB K;  1N32 K;  4DV5 K;  4JI6 K;  4DV3 K;  4V19 S;  4JI4 K;  1IBK K;  4LF4 K;  5AJ3 K;  5BR8 K;  4DR2 K;  4DV7 K;  2UUC K;  4LFC K;  1HNW K;  4B3M K;  5LMN K;  4LF6 K;  2VQF K;  4DR4 K;  3T1H K;  4DUZ K;  4LF9 K;  4LF8 K;  1HNX K;  1HR0 K;  4YHH K;  3J81 O;  4DR1 K;  4DV6 K;  5FLX O;  1XMO K;  4DV4 K;  4OX9 K;  2UUA K;  4B3T K;  2UXD K;  4X62 K;  4LF7 K;  1IBL K;  4CW7 B;  4KHP K;  4DR7 K;  1I94 K;  1N33 K;  4K0K K;  4X65 K;  4DR3 K;  4B3S K;  1N34 K;  4NXN K;  4LF5 K;  1XNQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...