4DR3K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr3K00
4DV2K 4JI3K 5BR8K 4B3TK 3J81O 5LMUK 4OX9K 4GKKK 1XMQK 2UXDK 4NXNK 2UXCK 4DV7K 1N32K 4DV4K 3T1HK 1IBMK 1XNQK 4V19S 4CVNE 1FJGK 4DR4K 2UUCK 4LF5K 4LF6K 4LF7K 2UU9K 4X65K 4LF9K 4JYAK 5IT9O 4DV1K 4DR3K 5A2QO 2UXBK 4LFBK 4KHPK 5FLXO 4GKJK 1HNWK 1HNZK 4DV6K 4K0KK 5AJ3K 1IBKK 1XMOK 1N34K 4JI8K 1J5EK 4JI7K 2HHHK 1N33K 1XNRK 4DV5K 4LF4K 1HNXK 4DUYK 2VQFK 4X64K 4LF8K 4DV3K 1HR0K 4YHHK 4JI5K 4YY3K 2ZM6K 4NXMK 4JI6K 3JAMO 4JV5K 4DR2K 4LFCK 4B3MK 3OTOK 4LFAK 2E5LK 2VQEK 4B3RK 4X62K 4JI4K 4AQYK 1IBLK 2F4VK 5LMNK 4JI1K 4JI0K 3T1YK 4DV0K 4DUZK 3J7YP 4JI2K 4DR6K 1N36K 1I94K 3J80O 4DR1K 5IWAK 4DR7K 3J7AP 5LL6Z 2UUAK 4X66K 4DR5K 2UUBK 4B3SK 4CW7B
chains in the Genus database with same CATH superfamily
1D9DA 4E7LA 1S1TA 3TAGA 3CCQN 1HKBA 3TAEA 4GV6A 3QB0A 3SI6A 3L4QA 2FBTA 3VTIA 4H0VB 5AQPA 3VEOA 3O1BA 1VSDA 4Z4HA 3THWA 2J4RA 1E4FT 3P38A 4EFHA 3NCIA 1YJNN 3MEDA 2X6SA 4KREA 3CM5A 4M63C 5BN9A 4JD2B 1GLFO 1UWBA 4H5NA 3NDKA 3UE5A 4DSIA 3VF4A 3VMFB 3LZJA 4KI6A 4JKGB 3DJCA 3CQXA 4FVUA 3O4NA 4DLGA 3SV3A 3EYZA 2OANA 4DTUA 3DLKA 1TUUA 3MEGA 3TR8A 4E7JA 3CFPA 2O4IA 1A5XA 4CJVA 4HUFA 4CZGA 4CFCA 3O4WA 3MXMA 4LF8K 5E41A 2GV9A 4CZKA 1QZ5A 1WBBA 1P90A 3QIPA 2I7NA 4L8RB 1GLDG 4BRKA 4DTOA 4ILJA 3VEXA 4CJLA 3UKRB 4KH6A 3QEWA 4N47A 4I9QA 1BCOA 3AVHA 1RT2A 2FLOA 2HBJA 3VGMA 1Q82O 1W9HA 4B8CA 3S41A 2HF3A 1NGDA 2HNZA 3NBPA 5DM6L 3J80O 5AQNA 4WF9L 3ZSOA 3NH2A 1LV5A 1ZBHA 2FF3B 2G8HA 2F8SA 1BWFO 5BPLA 4B3SK 4LC9B 3VERA 4W5QA 1YJ9N 1ZXOA 3OYMA 2P9IB 3VEYA 5HOOA 3CETA 2F7TA 4RCHA 1HYSA 1Q86O 1SS6A 4K8XA 5AQOA 3VQQA 3TAQA 2ZGYA 4F4KA 3VEWA 1L5UA 5F1XA 4CVNE 4K8ZA 1KRPA 2ZJQL 4FYDA 4DR4K 1TK8A 3CCLN 3VPZA 1TVRA 1KAZA 4LF6K 3O3FA 2HW3A 4FWPA 1QSYA 4H5VA 4AHTA 3OYHA 1P8ZA 1XUPO 4XH1A 3C7NA 2BUPA 2F9WA 4PWDA 3WEEB 4WE1A 3O9TA 3D6RA 4BC3A 2VYPA 4CHZA 1TKDA 1CXQA 3CD6N 2GWKA 5AR0A 5EY4A 3U4LA 3ZX0A 3V1OA 4YOUA 3THXB 4ILGB 3D2FB 4H0PA 4JI7K 5JLHA 2P9KB 1ATNA 1C0UA 2IVOA 4BRQA 1VK0A 3L2VA 4FWLA 1SV5A 1NK7A 1JL2A 3MN7A 4B9SA 1VQON 4XH5A 4M3WA 3P4IA 3AVKA 4KRFA 2KFZA 5TKYA 3U9ZA 4E7HA 1KVCA 3BUZB 3TANA 1HR0K 4CJEA 4WCEL 1RDBA 3L0QA 2EX3A 4N5SA 4JI6K 3HXMA 2ZJRL 1RT4A 3HVTA 3OTOK 3V9WA 5AQRA 4BR9A 3IFRA 3MECA 3HJFA 2WC9A 1Q9XA 4CGFA 3OS0A 4BR0A 1C1AA 4FZZA 4AH9A 3RMAA 4Z94A 1JLCA 1SZ2A 3W3DA 1I94K 4HTUA 1BG3A 3FZHA 4KHSA 1LWFA 2PAVA 3ATUA 4FW2A 3CM6A 3VQEA 4A5BA 4JEPA 1WNSA 3D0PA 4CJUA 1RDUA 4DQIA 1YVUA 4H4MA 3DMJA 4DMNA 3B6OA 3GE1A 3ZSXA 2Q1NA 3LM2A 1BUPA 3NAEA 4K43A 5M1QA 4N76A 1LAVA 4C23A 4B3OA 3LZIA 1NK4A 4Y1CA 1N5YA 4V19S 4CECA 2FSNA 3KLEA 2D0BA 3WNFA 1JLEA 4OJRA 3AARA 1W97L 4RW8A 2O8EB 4U67L 3D45A 1XQSC 1Q9YA 1GOAA 4RW4A 1NJWA 1ATSA 2GX9A 2JGUA 4BRDA 1X3MA 4BR2A 1DKGD 5KGWA 1QHAA 4E89A 4AF1A 1VQ5N 3ATVA 4KFBA 2P5OA 2QWLA 4FWKA 5FPEA 4PKIA 3WT0A 4YOVA 3ZEUB 3KZBA 4BRNA 1EO1A 4KHNA 4FLVA 5M1NA 4E7KA 4EZ9A 2KQ2A 4E3SA 2Y1JA 4PKHA 4K25A 2YKMA 4CEQA 4LF4K 3M8RA 4CHNA 3SBGA 4FZYA 1GLAG 4YOYA 4JLHA 4YHHK 2NUBA 1NJYA 1RDDA 1S9EA 1TK0A 3EL2A 2Q97A 4ISGA 3DLEA 5T7BA 4BE1A 4NYFA 2W6KA 4CGDA 4ICLA 3JAMO 3ZT4A 1GLBG 1NK9A 2ZJPL 1S1VA 2OZMA 3VQ4A 3CJBA 1RBTA 3RSEB 4X62K 4J8FA 2HHQA 3OYLA 4KB0A 2D0AA 1X1PA 4Y0WA 3T1YK 3KLHA 3R9PA 4KHYA 1ZBFA 3LP1A 2RE2A 3IDHA 5AQZA 3CJ9A 2JLEA 2G8FA 1RBSA 3M8QA 3V4IA 3L6QA 2P9LB 1ASUA 1E3MA 1QZ6A 4OPJA 4DV2K 4TSXA 3V9XA 3MCPA 5E26A 3O6WA 2IOCA 3HTVA 4CD1A 2V7YA 5KPZA 1M1KO 1XMQK 1C0TA 2P9SB 3VGLA 5AQFA 1VQ9N 1S1XA 3T69A 1A5WA 4CZJA 2JWLA 1NGCA 4CEEA 1C0GA 1RBRA 3ULEA 4DFPA 5I42A 4OGEA 5GAEP 2HHXA 2W6LA 3C65A 4JKAA 1R0AA 1NK5A 3DLGA 1KCFA 2P9PB 5DK5A 4YDUC 3K5NA 4B1WB 3SPZA 4CJ7A 1VQNN 4AHVA 1KAYA 1O1WA 5J1EA 1ZBLA 3LAKA 1BA0A 5AZIB 3KD5E 4GNIA 4FOIA 4FJ9A 3R1XA 4CF0A 2R7YA 1HNZK 3KKRA 1YHQN 2F96A 3LDSA 2NNWA 3HT3A 3GDQA 3SNNA 2O8DB 1HNXK 1F21A 4CF9A 1CZBA 1IKXA 3S9HA 3H08A 4BC2A 4FLWA 4JKCA 4ISEA 4Z4CA 3O3HA 1QS4A 3QEPA 1JLAA 2ASOA 1TKZA 3SYZA 1S1WA 3FZFA 5C2FA 1LWEA 3L3VA 1J9AA 1FK9A 1X9JA 2FBYA 4B8AB 3HM8A 1RBUA 3E66A 4PHTX 4CHQA 2XY5A 3DLHA 1ASVA 4DSLA 4ZTFA 3A5OC 4LFAK 4JK9A 2Q0UA 4IOAL 2QTDA 3F5TA 1SL0A 1HRHA 4DF8A 4JI0K 3OBWA 3LWLA 2BANA 5FRMA 4DR6K 3SAFA 3HVRA 5AZJA 1VSMA 3KK2A 5SWMA 4DSJA 3GG4A 3P83D 3ISNC 1WSFA 4MDBA 2D0OA 4DS4A 4JD2A 3ZSYA 3EKSA 3I0SA 4UQGA 4JRPA 5JICA 3B8AX 3K0SA 4Z4IA 3J81O 5LMUK 4CCHA 4O0IA 1VQLN 4HVJA 1A5VA 3QFPA 4B08A 3JS6A 1BQMA 4F3OA 4JN4A 1TAUA 3ZSWA 2FXUA 3FE1A 1RDCA 3TTFA 3LL3A 3SBTA 1GLLO 3CXCM 2AJQA 2HHWA 3L2QA 1S6PA 3AVCA 4GY2B 3A5LC 3U3YA 2CH5A 1JJ2M 4LF7K 3IRXA 3NF6A 2UU9K 4FJGA 1Q81O 1Y97A 3CCMN 3OYIA 1KLMA 3H46O 2UXBK 3PSIA 3EE9A 1S1UA 1W7AA 3HPGA 4HHTA 3UKRA 3H1VX 3MCAB 3LALA 4DFMA 2E20A 3I33A 1S3XA 3OHRA 4FM2A 4LSNA 3OBYA 4PL8A 4H8KA 4KAZA 3JXUA 3G0ZA 3G25A 4ID5A 1FW6A 4Z4FA 3AA3A 1GOBA 1K9MO 3MDQA 3PIOL 3P31A 2VGMA 2D0CA 1NMNA 1LOTB 3K5LA 4FJNA 1IKWA 1WLJA 2Q3SA 3A8YA 4Q0BA 3R3LA 2E1ZA 4RWTA 4PY5A 5HRRA 2O8BA 2ZGZA 5LMNK 2OTJN 3TARA 1RTDA 5B8HA 1N36K 4BC5A 1G15A 3TSQA 3QBWA 4CGGA 4BE0A 1JXBA 1HQEA 1VRUA 2E1YA 2KW4A 3BF3A 3WNHA 4CF8A 4Y1DA 3CJCA 4CJWA 2PYLA 2VCPA 1IO2A 1B9DA 4IDHA 4OX9K 3VF2A 3QERA 3WEEA 3OY9A 3JSMA 5BPNA 3V1RA 4I6MB 3IUCA 4CZHA 5ADXH 2GWJA 3RMCA 3V9SA 4BR4A 5AQKA 4CEBA 3HRGA 3E9OA 5AFUH 5GAGP 4U7BA 3LM9A 4C8NA 1QVGM 2P9KA 3BZCA 3KWIA 2A41A 3NF8A 3OVNA 4LH5A 5AQUA 1RFQA 3F2KA 3U6FA 3SCXA 4LF5K 4Z4GA 5KPTA 3VOVA 5D3GA 5HP1A 4BWJA 3AAPA 3ZSRA 1K8KB 2GUIA 4JHDA 5IT9O 4QS8A 5LJWA 5AQHA 4RG8A 1MDUB 4CEFA 3CQ8A 5M1KA 1SKSA 3QFUA 3C6UA 3LPUA 3OYJA 1NNEA 1JL1A 5BN8A 1RT6A 2HMIA 1X9MA 4OPAA 2YX6A 1G99A 4DUYK 2O8FA 2VWKA 4FWSA 5FDLA 3HBTA 1TKTA 4CZLA 5DM7L 4IWVA 1HPMA 4MLEA 3QEIA 2XY8A 3M1FA 4E1NA 3I8BA 1HKGA 1LAWA 3I8DA 3TI0A 1NKCA 4EAHD 2YKNA 3SZ2A 1CXUA 1IV0A 4FLYA 2PBDA 4FJ5A 3HP9A 4YOWA 2YNFA 1WUAA 3DXMB 4BR5A 4HCCA 1IKYA 4NB4A 4CJRA 4DQQA 4YOTA 3HK2A 4DKWA 3K5OA 5AQGA 2IC3A 5EU7A 4QAGA 4BDZA 2F4VK 2DFHA 2VG7A 1RBVA 4HCBA 2P9UB 4JI2K 3EZ5A 3HZ6A 5AQSA 3P39A 1DTTA 4DTSA 3AVLA 2O8EA 3A2FA 2KKZA 2D5RA 1OH8A 3HO1A 4EIAA 2V7ZA 2ITMA 1JLFA 4MQ3A 4A62A 1U2VB 2ITGA 1EETA 3ZX2A 4DTNA 2E2QA 5KGXA 3KD1E 4CEOA 3VA0A 2UXDK 2NRXA 4YDUA 3ZEUA 3ZT0A 1D5AA 4R79A 3PX6A 4GVEA 5LY3A 4WQ5C 3I56N 4M7YA 2VWJA 1KD1O 4CJPA 1O13A 1BL3A 5BR9A 4CEAA 5CHIA 3PIPL 2XRIA 3NFAA 1D4XA 1NGIA 3SQ2A 1NGAA 5GADP 3CFRA 1OKJA 1BIZA 5AQWA 3QBXA 1VQPN 1T6CA 3VESA 1XWLA 1RTIA 2HNYA 3K5MA 1IG8A 1Z6RA 3QEXA 4CEDA 3KLIA 4MFBA 1N6QA 1NKEA 3VENA 5CZ2A 1HNVA 4GVMA 2G8VA 3LDPA 4N56A 3HI0A 3ASMA 3D2EA 3E01A 5FLXO 3FLCO 3ZT1A 3HP6A 4DQRA 3BZKA 1KFDA 2QWOA 4DFKA 3RSEA 1SL2A 1N33K 3UKUB 2WONA 3RRGA 3MXIA 3AA4A 4QCLA 4LY7A 1ZC6A 5SZTA 4J2BA 3AGKA 5HRNA 3SK3A 1MWKA 4JI5K 4HUEA 4YY3K 1QHTA 3FZLA 1L3SA 2ZE2A 2ZWHA 4CFBA 3PV8A 2HNDA 4K42A 2ASMA 2KZMA 4BRIA 4BRHA 5KTQA 4LFCK 1XHXA 1QQNA 3ZSQA 3G71N 5C10A 2QW9A 1HYVA 4DFJA 2IS3A 4A2AA 3R6MA 4HUGA 3EN9A 3CCJN 4EHTA 4AQYK 1SKRA 1UA1A 3CF5L 3WQUA 1CZAN 4JAXA 2CH6A 4NO7A 4M3ZA 1W2BM 5AQXA 2GBZA 1S5JA 4CJ3A 4DV0K 3CMEN 2NRRA 4DUZK 1N8RO 1VQKN 3P5JA 3TSPA 5J2MA 3AAQA 1WOQA 2QWRA 4DR7K 3AO2A 1I39A 5LL6Z 2UUAK 4X66K 4IG3A 4F2SA 2NZTA 4CD3A 2QWMA 2ZD1A 3AGRA 4FOEA 1BI4A 4RTFD 3THYA 4GV3A 4YOXA 5FPNA 2RPIA 4B1UB 3T3FA 4ZHRA 3CYMA 5AZIA 5AFUA 4AILC 2Q0RA 4BQZA 1FXXA 4BVOA 4EP5A 2YHWA 2G8KA 3LDOA 4M3YA 5C0YA 2E2OA 5KRSA 3K59A 5AQMA 2Y1IA 1KLNA 4M45A 4WQ4C 5CE3A 1HPZA 3C0BA 5AQTA 4BR7A 3VEZA 4K41A 1B9FA 4BRFA 3OYBA 3M8SA 3E9PA 4I9LA 4F9OA 1K73O 2O4GA 4DV1K 3IS9A 3DWLA 5GIOA 3CCSN 5H1SQ 1XHZA 4F2RA 1WN7A 4C8OA 1EXQA 4OLAA 4RW6A 4W5TA 4K0KK 4I2PA 4MLHA 1VSLA 4IG0A 2A5XA 3K2PA 2E2NA 1KAXA 5FROA 1TV6A 4DV5K 3AA5X 4FL9A 1ZYQA 4CHOA 3CQYA 2QI2A 4KHQA 1L3TA 2LSNA 1Z05A 4X64K 3CJ1A 3M8PA 1RNHA 2IDOA 2O8CA 2GTDA 3IMXA 3BGRA 1NGHA 3QIOA 3ZETB 1U49A 1FKOA 2KTQA 1XC9A 2A6AA 4KTWA 2QWNA 3R8EA 2OCEA 2VQEK 4UY8O 3LPTA 1EQYA 1TYQA 2WOMA 3OYAA 4JI1K 4DQSA 3SQ0A 1ZBIA 4DB3A 1WSHA 3PX0A 4CF1A 3VQDA 3O8MA 3J7AP 4FPAA 1KSPA 1HKCA 1BDGA 1YTAA 5CYMA 3F9KA 2GUPA 4WFBL 1BGXT 4MO4A 1MU2A 2UXCK 1ESVA 3CERA 1BA1A 1EP4A 3AVAA 3EE8A 5KI6A 2ASPA 3OYEA 1IBMK 1NLVA 5K14A 3QNNA 1X9SA 5C2DA 4ISFA 3W0LA 1VQ8N 5AQLA 1KVAA 1K6YA 3VETA 5GIPA 4FSVA 3SAHA 1QSSA 2I7PA 5HROA 2AP1A 1J54A 3AVNA 2WFBA 4ILHA 1BO5O 3IAYA 3D7EO 4H5WA 5AQJA 3S3NA 4FJJA 3ID6A 4IO8A 3M3ZA 3Q7BA 4GMJB 2E88A 3LWMA 3O5BA 4E19A 2Z1HA 1NOYA 4CZFA 3MN5A 3DI6A 2I5JA 4RW9A 2QA4N 2CGJA 3SJHA 1N34K 5FPDA 3MEEA 4MO5A 4F3TA 3AY9A 4DQ8A 5FRNA 2QEXN 1LWCA 4C8LA 5EOYA 3DLBA 2BH1A 1X3NA 2DTUA 2F8TA 4A2BA 4CJQA 3I0RA 1HLUA 3UB5A 3TAMA 1NBWA 3WNEA 4NXMK 2NRHA 3V9ZA 1U48A 2IVPA 4DTXA 5I3UA 4J2DA 4NCGA 4FLUA 1KC8O 3O08A 4A61A 2G8WA 4OVLA 3G4SN 5BPMA 4EHUA 1V4SA 4E0DA 3A5NC 3KK3A 1J53A 1DLOA 4YNQA 2FBXA 2UYTA 4O5BA 1V4TA 4BGAA 4CFAA 3HPHA 3DAWA 4WQ5A 3VGKA 5KRTA 1ITGA 2HB5A 3QETA 1KVBA 1FKPA 1B92A 4FJKA 4JI3K 1K8KA 3MAQA 3VEVA 4BREA 2KLAA 4BVPA 3ZCMA 3ENOA 3DRSA 3LDNA 3LP2A 2HBLA 2IVNA 3K58A 3LDLA 4CZEA 5GINA 4HTLA 4BACA 4H5RA 4KH4A 4FJLA 4DF4A 3ZX3A 1T05A 5AQQA 1C1CA 1TAQA 4E1JA 2D1KA 2KFNA 2RF2A 4G1QA 1VRTA 3OYNA 3TTDA 4JKGA 1LCUA 5AQIA 4IJNA 4IFEA 1GLCG 1S6QA 4X65K 2W42A 4FW1A 1QSLA 2IGIA 3DOLA 4FJIA 2IIRA 2OZSA 5F0XA 4H03B 1C0FA 4I2QA 4O8UA 3LAMA 4CJ5A 5HRPA 3ZSZA 4KV8A 4CBXA 1QE1A 4M3UA 4OLBA 2NLXA 4IJAA 1NJIO 2NRZA 3B6PA 3QO9A 4AM6A 3NH0A 4FLTA 2KZZA 1NKBA 3NGZA 3V1QA 3DLLL 3SLCA 1YAGA 3M6GA 2EHGA 4O4GA 2IAJA 1SUQA 1BOTO 5M1FA 5JS1A 3QDKA 1NG9A 2PZSA 1WSIA 1HJOA 4NLBA 2GEMA 4B1VA 1HX1A 4B9UA 2ZM6K 4KPYA 4FPBA 2ATQA 3O9UA 2D0PA 3TAFA 3HOTA 2BDPA 3DYAA 4DU1A 1UA0A 1YTUA 4PL7A 5J2PA 2OA8A 3VA3A 4JI4K 1CLQA 2G8UA 3SMPA 1YXQA 4IO9L 4GV9A 3KIOA 3WUHA 4Z0UA 4XH4A 2FBVA 3RTVA 4O0JA 4W5NA 1RDWX 1VSEA 3AO5A 2P9IA 1LW0A 1T44A 4FWNA 4I7FA 4CW7B 1LW2A 3OS2A 3KJVA 4WQ4A 3KWGA 2QWPA 3OYFA 5AQYA 3KHYA 5CR4A 3N4PA 4DU4A 3MWPA 4DTJA 1WAFA 3QNOA 2HOEA 4CIGA 1JCGA 3PO5A 5M1OA 5JS2A 1VSJA 4IOXA 4DV4K 3HSTB 2B6AA 1I3AA 1HQUA 3V81A 1OVQA 1VSHA 1S9GA 4CE9A 3EKUA 4A5AA 3TTCA 1OVYA 1BCMA 1HMVA 4CGIA 3C94A 4BG9A 1UAXA 1VAZA 3H3NO 1SKWA 4EZ6A 1R59O 1IJJA 2D4WA 4FO0A 1C6VA 3DXKB 4JS4A 4KHPK 3T7ZA 4GKJK 3THXA 3CIPA 1HNWK 1W0HA 3D2FA 1CZ9A 5EVZA 4IEEA 3ITHA 5AJ3K 3N4QA 5KQ8A 1YI2N 3QINA 1RT3A 3ZT3A 4QOZB 2FF6A 3HSCA 1RGIA 1UOCA 5BRDA 3EY1A 5BRHA 3ENBA 3WXKA 1IG9A 2WTUA 4ZTJA 4H4OA 3SJJA 3CFOA 3FGUA 3FZMA 5EX5A 3CC2N 2Z1IA 1SAZA 4CJSA 5C15A 3ID8A 4DR2K 2YV0X 4WFAL 5C24A 3NGIA 4AHCA 4LSLA 1D8YA 1WSGA 2P9NB 2YCHA 2V52B 4J2AA 2HVIA 2A3ZA 2NRVA 2ZQBA 4OPKA 3VQ7A 4N41A 3KK1A 4OKKA 4CIFA 4KHWA 4E7IA 3OW2M 4DR1K 4B9NA 2FSKA 3O1WA 4QS9A 2RN2A 3DRRA 3OYCA 4FK0A 5AZJB 5J2NA 2UUBK 3MMVA 3OA9A 4BDPA 3G6EN 1U6ZA 4DTRA 2HBMA 3BP8A 2VGNA 4BRCA 4B3TK 3RR8A 5DMRA 1RTJA 3BEXA 3FFIA 3CC7N 2ETJA 3TU5A 1S22A 2OPRA 3ULDA 4B9MA 3KVGA 5FPMA 2OPQA 4A59A 2EWSA 2QXFA 4OKJA 3ZSVA 3KLFA 3QMLA 4BG8A 3T1HK 3H1QA 4NLCA 3PLAA 4FVMA 4IEIA 1KFSA 2YNIA 4BGBA 5E84A 4B1XB 1KTQA 3HPOA 3NGYA 3VQ8A 4W5RA 4JK7A 3OYGA 4KI4A 4FJMA 3DRPA 4KHUA 4B1YB 1L3VA 3ZETA 4DR3K 2WBNA 4LFBK 3O80A 4R5PA 4H0TB 1BIUA 3O9QA 1RDAA 1OH6A 3O4QA 2BGGA 4KTZA 3HM9A 1IBKK 2HSTA 1QTMA 4O5FA 4L3QA 2X74A 4B9LA 4M3RA 2DY4A 2VWBA 4NCAA 4CJTA 1M90O 2QXLA 4CK2A 3C6HA 4FCYA 4FXDA 2OYQA 1RCHA 3VQ5A 2DFEA 3WXIA 1YVNA 3TSUA 3VQBA 3HOSA 2X78A 2Q31A 4CZIA 4DTMA 4H5TA 3QESA 3K57A 1JCFA 2Q2RA 3CC4N 3LP3A 4FWRA 1DGKN 4G9ZA 2QM1A 3V9UA 1YUWA 2O8BB 3VQ6A 1NGEA 1TK5A 3CPEA 4CESA 2P9LA 1C0MA 4KBOA 1KXPA 2XY6A 3SMSA 5LJVA 3U9DA 2H3GX 2W40A 4IOCL 3OYDA 1VQ6N 3LDQA 4W5OA 2HF4A 1C1BA 2P9SA 1SQKA 3TWHA 3E9LA 3AVIA 1Y64A 1T8EA 1TGOA 4NXNK 4OGCA 1NGGA 2E2PA 2OPPA 1J6ZA 1NM1A 1VQ7N 2B4JA 1N32K 4DCHA 3O3GA 3AVBA 2A42A 4KTQA 4AHUA 4M42A 2VG6A 3NVKA 1EWQA 3JYTA 2OTLN 2P9PA 3NVMA 3P1GA 3VQAA 3Q7CA 2UUCK 3EEQA 3IG1A 1JXEA 3SAGA 3H45C 1X9WA 5JLFA 5C12A 2XO7A 4DSFA 5ADXA 3SV4A 1JCEA 2E8AA 3HL8A 3CJAA 2WUSA 1EWRA 3H6EA 1EKEA 2YJEA 4JHDB 1Z26A 2E6LA 4CGHA 1NJXA 5CY4A 2YHAA 3THVA 4DV6K 1ATRA 3THWB 2AA4A 1BQNA 3RMDA 2O8DA 2VG5A 5F2RA 4DG1A 3KKSA 5JVHL 4IKFA 3EO3A 2OPSA 1VQ4N 2O8FB 4DV3K 3ZLJA 4DS5A 5BREA 1J5OA 4JK8A 3BF1A 4XEIA 3RRHA 4IBNA 2PYJA 4OO1J 2HVHA 4CERA 4ELUA 3LP0A 4BRGA 4Z4EA 4FM0A 5CYQA 1E4GT 4JRQA 3E1YA 4M3TA 1QQOA 1IH7A 4BQLA 2E5LK 5GAHP 1NOZA 4F8RA 2E4LA 3NE6A 4ELTA 5J2QA 4PA1A 3AO4A 5I9EB 2ZF5O 4KH5A 4RW7A 1DTQA 3GBTA 1RTHA 3VTHA 3O9RA 1JLGA 1U45A 1HUXA 4M7XA 2HHTA 3QEVA 3A0IX 3M5RA 3RWUA 2Z1GA 3L4IA 4CJ4A 3GOIA 4ELVA 1VSKA 2DPNA 3BY5A 2BE2A 2P5GA 2X6NA 4FM1A 4CEZA 4AHSA 1YT3A 1QQMA 4CFDA 5HRSA 3C95A 5KPRA 3MXJA 4IXCA 4CBWA 2YJFA 4FLZA 1YITN 1QQCA 3S3MA 1JKHA 3H3OB 1WSJA 3CI5A 2XY7A 4B9TA 2V51B 2GELA 4JYAK 4NYNA 3DM2A 2XHBA 1U47A 4CI6A 3SQ4A 3BDPA 2HBKA 4WYBA 4CJFA 1Q18A 1XC3A 3AV9A 3MK6A 4JKHA 4BRMA 1YJWN 3K9KA 4BWMA 4IFYA 3CJ7A 3D2EB 4E1MA 3MX5A 4PQUA 4BROA 3RMBA 1OH7A 4BRLA 4CJKA 4IFVA 3C7NB 3I55N 1NGFA 1JLQA 1MA9B 1NMDA 5C25A 4CHPA 4JV5K 4M3XA 3CCEN 4FZXC 3HYFA 4C8MA 4JKBA 3AVGA 1ASWA 4LD0A 2KHOA 1GOCA 3PUFA 3CPWM 4O55A 4B3RK 3FFKB 3CHWA 4JS5A 1T6DA 3L2WA 4NCBA 4FJXA 1RT1A 4BC4A 3J7YP 2QK9A 1Z25A 4M41A 1NGBA 1RT7A 1NWKA 4IDKA 4GW6A 2PY5A 3C6AA 3SUPA 4KKOA 3J8AA 2HHSA 3O9SA 3NHGA 1T3VA 4JKFA 1RT5A 5CZ1A 3TAPA 2CGLA 3A5MC 3PX4A 3L2RA 3ZYYX 4KB1A 2QWQA 3AVFA 2A40A 2P51A 2Q36A 4I6MA 2HHVA 3T19A 2P1JA 3U3GA 4FWMA 3DXKA 4FLXA 1BI4B 3THYB 2HHUA 1VSIA 4CK1A 3KLGA 5C42A 4A57A 4DTPA 3UIQA 3AVJA 4DSEA 1FJGK 2HMPA 4H0XB 3ENHA 1BU6O 1SL1A 4O8KA 1MWMA 4FK2A 2F9TA 3WXMB 4C1NI 4MDAA 1OH5A 4IZ9A 3WNGA 4DHYA 3CG7A 5TKWA 3IKMA 3NMUA 4LF9K 2QKKA 1Q7YO 1HNIA 5A2QO 4DWIA 4CK3A 1ZBUA 3F73A 3S3OA 3PSFA 4PKGA 5AQVA 3C6TA 4DSKA 2P9NA 4JI8K 1U04A 1WAJA 2RKIA 1J5EK 1BHLA 3CCVN 1XNRK 4BDYA 1TKXA 3FR0A 4FJ7A 3CCUN 3U8XA 1H1VA 2G8IA 3SQ1A 4H0OA 2PFUA 3QLHA 4LH4A 1T03A 4ID1A 1WBDA 4FJ8A 3PO4A 4QS7A 2YI1A 2O8CB 3DXMA 2YHXA 3F9MA 3WQTA 3G10A 2QKBA 3DLRA 4OKEA 5M1PA 4FK4A 3L3UA 1BISA 1WB9A 4PUOA 2JWKA 1K8AO 3ZT2A 4B9QA 4B9VA 4WFNL 3ALYA 3SUNA 2P9UA 1IBLK 2DFFA 3OYKA 4JNEA 3QICA 1NGJA 1TYQB 4FWQA 3RR7A 4B1ZA 3KK7A 5KQDA 2RHKA 4BRAA 3NH1A 3AO3A 4AM7A 4XIUA 5EXWA 1U2VA 1IKVA 3VQPA 3FZKA 4JKEA 5BR8K 2W41A 2YHYA 2YHBA 3VQCA 3J7ZO 4GKKK 4FWOA 2A1SA 1XI1A 1NK6A 4FJHA 2A1RA 1ILYA 4DV7K 3SPYA 3SUQA 1NK0A 3VN5A 1VQMN 1HYZA 1VSFA 3OJUA 5ELZA 1XNQK 1DT9A 3AVMA 1U4BA 1TL3A 1YIJN 3MX2A 3TPQA 1TL1A 1REVA 3DOKA 1NU0A 2FSJA 2NRTA 4C1NK 4J2EA 4KO0A 1HJRA 3EZWA 4EP4A 3WXLA 1NJZA 3VF6A 3OS1A 5BRFA 3MWTA 3LANA 1QVFM 5MLCQ 4CBUA 4H0YB 1NK8A 3MN9A 4YFUA 1GLJO 3AO1A 3GL1A 1TUYA 2YNHA 3UKUA 3OJSA 1XMOK 3ULEB 5HLFA 4CF2A 2HHHK 1T7PA 4CZMA 1RILA 2VQFK 1ZBSA 5HL7L 2BTFA 3T1AA 3VQ9A 3MN6A 4Q5VA 4BE2A 4BY9C 4CIEA 4O44A 1KQSM 4YORA 4DLEA 3KTQA 4AHRA 1WSEA 4DQPA 4HWIA 3TABA 3L2UA 1S72N 1JLBA 4B3MK 4CHYA 3NF7A 1EX4A 3CCRN 2NRWA 3V6DA 4C8KA 1YF5L 4CGJA 1L3UA 1Q8IA 4DU3A 3SUOA 3AA2A 1D9FA 1GLEG 3PY8A 1VHXA 2Z1JA 3L8BA 3RVCA 2CGKA 2E6MA 3NF9A 5JMVA 3WXJA 5HBMA 5IWAK 2B5JA 2FC0A 4JKDA 4DR5K 4OPHA 5JVGL 4BRPA 3K9JA 3CMAN 1DEJA 2YNGA
chains in the Genus database with same CATH topology
4DV2K 4JI3K 5BR8K 4B3TK 3J81O 5LMUK 4OX9K 4GKKK 1XMQK 2UXDK 4NXNK 2UXCK 4DV7K 1N32K 4DV4K 3T1HK 1IBMK 1XNQK 4V19S 4CVNE 1FJGK 4DR4K 2UUCK 4LF5K 4LF6K 4LF7K 2UU9K 4X65K 4LF9K 4JYAK 5IT9O 4DV1K 4DR3K 5A2QO 2UXBK 4LFBK 4KHPK 5FLXO 4GKJK 1HNWK 1HNZK 4DV6K 4K0KK 5AJ3K 1IBKK 1XMOK 1N34K 4JI8K 1J5EK 4JI7K 2HHHK 1N33K 1XNRK 4DV5K 4LF4K 1HNXK 4DUYK 2VQFK 4X64K 4LF8K 4DV3K 1HR0K 4YHHK 4JI5K 4YY3K 2ZM6K 4NXMK 4JI6K 3JAMO 4JV5K 4DR2K 4LFCK 4B3MK 3OTOK 4LFAK 2E5LK 2VQEK 4B3RK 4X62K 4JI4K 4AQYK 1IBLK 2F4VK 5LMNK 4JI1K 4JI0K 3T1YK 4DV0K 4DUZK 3J7YP 4JI2K 4DR6K 1N36K 1I94K 3J80O 4DR1K 5IWAK 4DR7K 3J7AP 5LL6Z 2UUAK 4X66K 4DR5K 2UUBK 4B3SK 4CW7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 K;  4JI3 K;  5BR8 K;  4B3T K;  3J81 O;  5LMU K;  4OX9 K;  4GKK K;  1XMQ K;  2UXD K;  4NXN K;  2UXC K;  4DV7 K;  1N32 K;  4DV4 K;  3T1H K;  1IBM K;  1XNQ K;  4V19 S;  4CVN E;  1FJG K;  4DR4 K;  2UUC K;  4LF5 K;  4LF6 K;  4LF7 K;  2UU9 K;  4X65 K;  4LF9 K;  4JYA K;  5IT9 O;  4DV1 K;  4DR3 K;  5A2Q O;  2UXB K;  4LFB K;  4KHP K;  5FLX O;  4GKJ K;  1HNW K;  1HNZ K;  4DV6 K;  4K0K K;  5AJ3 K;  1IBK K;  1XMO K;  1N34 K;  4JI8 K;  1J5E K;  4JI7 K;  2HHH K;  1N33 K;  1XNR K;  4DV5 K;  4LF4 K;  1HNX K;  4DUY K;  2VQF K;  4X64 K;  4LF8 K;  4DV3 K;  1HR0 K;  4YHH K;  4JI5 K;  4YY3 K;  2ZM6 K;  4NXM K;  4JI6 K;  3JAM O;  4JV5 K;  4DR2 K;  4LFC K;  4B3M K;  3OTO K;  4LFA K;  2E5L K;  2VQE K;  4B3R K;  4X62 K;  4JI4 K;  4AQY K;  1IBL K;  2F4V K;  5LMN K;  4JI1 K;  4JI0 K;  3T1Y K;  4DV0 K;  4DUZ K;  3J7Y P;  4JI2 K;  4DR6 K;  1N36 K;  1I94 K;  3J80 O;  4DR1 K;  5IWA K;  4DR7 K;  3J7A P;  5LL6 Z;  2UUA K;  4X66 K;  4DR5 K;  2UUB K;  4B3S K;  4CW7 B; 
#chains in the Genus database with same CATH topology
 1D9D A;  4E7L A;  1S1T A;  3TAG A;  3CCQ N;  1HKB A;  3TAE A;  4GV6 A;  3QB0 A;  3SI6 A;  3L4Q A;  2FBT A;  3VTI A;  4H0V B;  5AQP A;  3VEO A;  3O1B A;  1VSD A;  4Z4H A;  3THW A;  2J4R A;  1E4F T;  3P38 A;  4EFH A;  3NCI A;  1YJN N;  3MED A;  2X6S A;  4KRE A;  3CM5 A;  4M63 C;  5BN9 A;  4JD2 B;  1GLF O;  1UWB A;  4H5N A;  3NDK A;  3UE5 A;  4DSI A;  3VF4 A;  3VMF B;  3LZJ A;  4KI6 A;  4JKG B;  3DJC A;  3CQX A;  4FVU A;  3O4N A;  4DLG A;  3SV3 A;  3EYZ A;  2OAN A;  4DTU A;  3DLK A;  1TUU A;  3MEG A;  3TR8 A;  4E7J A;  3CFP A;  2O4I A;  1A5X A;  4CJV A;  4HUF A;  4CZG A;  4CFC A;  3O4W A;  3MXM A;  4LF8 K;  5E41 A;  2GV9 A;  4CZK A;  1QZ5 A;  1WBB A;  1P90 A;  3QIP A;  2I7N A;  4L8R B;  1GLD G;  4BRK A;  4DTO A;  4ILJ A;  3VEX A;  4CJL A;  3UKR B;  4KH6 A;  3QEW A;  4N47 A;  4I9Q A;  1BCO A;  3AVH A;  1RT2 A;  2FLO A;  2HBJ A;  3VGM A;  1Q82 O;  1W9H A;  4B8C A;  3S41 A;  2HF3 A;  1NGD A;  2HNZ A;  3NBP A;  5DM6 L;  3J80 O;  5AQN A;  4WF9 L;  3ZSO A;  3NH2 A;  1LV5 A;  1ZBH A;  2FF3 B;  2G8H A;  2F8S A;  1BWF O;  5BPL A;  4B3S K;  4LC9 B;  3VER A;  4W5Q A;  1YJ9 N;  1ZXO A;  3OYM A;  2P9I B;  3VEY A;  5HOO A;  3CET A;  2F7T A;  4RCH A;  1HYS A;  1Q86 O;  1SS6 A;  4K8X A;  5AQO A;  3VQQ A;  3TAQ A;  2ZGY A;  4F4K A;  3VEW A;  1L5U A;  5F1X A;  4CVN E;  4K8Z A;  1KRP A;  2ZJQ L;  4FYD A;  4DR4 K;  1TK8 A;  3CCL N;  3VPZ A;  1TVR A;  1KAZ A;  4LF6 K;  3O3F A;  2HW3 A;  4FWP A;  1QSY A;  4H5V A;  4AHT A;  3OYH A;  1P8Z A;  1XUP O;  4XH1 A;  3C7N A;  2BUP A;  2F9W A;  4PWD A;  3WEE B;  4WE1 A;  3O9T A;  3D6R A;  4BC3 A;  2VYP A;  4CHZ A;  1TKD A;  1CXQ A;  3CD6 N;  2GWK A;  5AR0 A;  5EY4 A;  3U4L A;  3ZX0 A;  3V1O A;  4YOU A;  3THX B;  4ILG B;  3D2F B;  4H0P A;  4JI7 K;  5JLH A;  2P9K B;  1ATN A;  1C0U A;  2IVO A;  4BRQ A;  1VK0 A;  3L2V A;  4FWL A;  1SV5 A;  1NK7 A;  1JL2 A;  3MN7 A;  4B9S A;  1VQO N;  4XH5 A;  4M3W A;  3P4I A;  3AVK A;  4KRF A;  2KFZ A;  5TKY A;  3U9Z A;  4E7H A;  1KVC A;  3BUZ B;  3TAN A;  1HR0 K;  4CJE A;  4WCE L;  1RDB A;  3L0Q A;  2EX3 A;  4N5S A;  4JI6 K;  3HXM A;  2ZJR L;  1RT4 A;  3HVT A;  3OTO K;  3V9W A;  5AQR A;  4BR9 A;  3IFR A;  3MEC A;  3HJF A;  2WC9 A;  1Q9X A;  4CGF A;  3OS0 A;  4BR0 A;  1C1A A;  4FZZ A;  4AH9 A;  3RMA A;  4Z94 A;  1JLC A;  1SZ2 A;  3W3D A;  1I94 K;  4HTU A;  1BG3 A;  3FZH A;  4KHS A;  1LWF A;  2PAV A;  3ATU A;  4FW2 A;  3CM6 A;  3VQE A;  4A5B A;  4JEP A;  1WNS A;  3D0P A;  4CJU A;  1RDU A;  4DQI A;  1YVU A;  4H4M A;  3DMJ A;  4DMN A;  3B6O A;  3GE1 A;  3ZSX A;  2Q1N A;  3LM2 A;  1BUP A;  3NAE A;  4K43 A;  5M1Q A;  4N76 A;  1LAV A;  4C23 A;  4B3O A;  3LZI A;  1NK4 A;  4Y1C A;  1N5Y A;  4V19 S;  4CEC A;  2FSN A;  3KLE A;  2D0B A;  3WNF A;  1JLE A;  4OJR A;  3AAR A;  1W97 L;  4RW8 A;  2O8E B;  4U67 L;  3D45 A;  1XQS C;  1Q9Y A;  1GOA A;  4RW4 A;  1NJW A;  1ATS A;  2GX9 A;  2JGU A;  4BRD A;  1X3M A;  4BR2 A;  1DKG D;  5KGW A;  1QHA A;  4E89 A;  4AF1 A;  1VQ5 N;  3ATV A;  4KFB A;  2P5O A;  2QWL A;  4FWK A;  5FPE A;  4PKI A;  3WT0 A;  4YOV A;  3ZEU B;  3KZB A;  4BRN A;  1EO1 A;  4KHN A;  4FLV A;  5M1N A;  4E7K A;  4EZ9 A;  2KQ2 A;  4E3S A;  2Y1J A;  4PKH A;  4K25 A;  2YKM A;  4CEQ A;  4LF4 K;  3M8R A;  4CHN A;  3SBG A;  4FZY A;  1GLA G;  4YOY A;  4JLH A;  4YHH K;  2NUB A;  1NJY A;  1RDD A;  1S9E A;  1TK0 A;  3EL2 A;  2Q97 A;  4ISG A;  3DLE A;  5T7B A;  4BE1 A;  4NYF A;  2W6K A;  4CGD A;  4ICL A;  3JAM O;  3ZT4 A;  1GLB G;  1NK9 A;  2ZJP L;  1S1V A;  2OZM A;  3VQ4 A;  3CJB A;  1RBT A;  3RSE B;  4X62 K;  4J8F A;  2HHQ A;  3OYL A;  4KB0 A;  2D0A A;  1X1P A;  4Y0W A;  3T1Y K;  3KLH A;  3R9P A;  4KHY A;  1ZBF A;  3LP1 A;  2RE2 A;  3IDH A;  5AQZ A;  3CJ9 A;  2JLE A;  2G8F A;  1RBS A;  3M8Q A;  3V4I A;  3L6Q A;  2P9L B;  1ASU A;  1E3M A;  1QZ6 A;  4OPJ A;  4DV2 K;  4TSX A;  3V9X A;  3MCP A;  5E26 A;  3O6W A;  2IOC A;  3HTV A;  4CD1 A;  2V7Y A;  5KPZ A;  1M1K O;  1XMQ K;  1C0T A;  2P9S B;  3VGL A;  5AQF A;  1VQ9 N;  1S1X A;  3T69 A;  1A5W A;  4CZJ A;  2JWL A;  1NGC A;  4CEE A;  1C0G A;  1RBR A;  3ULE A;  4DFP A;  5I42 A;  4OGE A;  5GAE P;  2HHX A;  2W6L A;  3C65 A;  4JKA A;  1R0A A;  1NK5 A;  3DLG A;  1KCF A;  2P9P B;  5DK5 A;  4YDU C;  3K5N A;  4B1W B;  3SPZ A;  4CJ7 A;  1VQN N;  4AHV A;  1KAY A;  1O1W A;  5J1E A;  1ZBL A;  3LAK A;  1BA0 A;  5AZI B;  3KD5 E;  4GNI A;  4FOI A;  4FJ9 A;  3R1X A;  4CF0 A;  2R7Y A;  1HNZ K;  3KKR A;  1YHQ N;  2F96 A;  3LDS A;  2NNW A;  3HT3 A;  3GDQ A;  3SNN A;  2O8D B;  1HNX K;  1F21 A;  4CF9 A;  1CZB A;  1IKX A;  3S9H A;  3H08 A;  4BC2 A;  4FLW A;  4JKC A;  4ISE A;  4Z4C A;  3O3H A;  1QS4 A;  3QEP A;  1JLA A;  2ASO A;  1TKZ A;  3SYZ A;  1S1W A;  3FZF A;  5C2F A;  1LWE A;  3L3V A;  1J9A A;  1FK9 A;  1X9J A;  2FBY A;  4B8A B;  3HM8 A;  1RBU A;  3E66 A;  4PHT X;  4CHQ A;  2XY5 A;  3DLH A;  1ASV A;  4DSL A;  4ZTF A;  3A5O C;  4LFA K;  4JK9 A;  2Q0U A;  4IOA L;  2QTD A;  3F5T A;  1SL0 A;  1HRH A;  4DF8 A;  4JI0 K;  3OBW A;  3LWL A;  2BAN A;  5FRM A;  4DR6 K;  3SAF A;  3HVR A;  5AZJ A;  1VSM A;  3KK2 A;  5SWM A;  4DSJ A;  3GG4 A;  3P83 D;  3ISN C;  1WSF A;  4MDB A;  2D0O A;  4DS4 A;  4JD2 A;  3ZSY A;  3EKS A;  3I0S A;  4UQG A;  4JRP A;  5JIC A;  3B8A X;  3K0S A;  4Z4I A;  3J81 O;  5LMU K;  4CCH A;  4O0I A;  1VQL N;  4HVJ A;  1A5V A;  3QFP A;  4B08 A;  3JS6 A;  1BQM A;  4F3O A;  4JN4 A;  1TAU A;  3ZSW A;  2FXU A;  3FE1 A;  1RDC A;  3TTF A;  3LL3 A;  3SBT A;  1GLL O;  3CXC M;  2AJQ A;  2HHW A;  3L2Q A;  1S6P A;  3AVC A;  4GY2 B;  3A5L C;  3U3Y A;  2CH5 A;  1JJ2 M;  4LF7 K;  3IRX A;  3NF6 A;  2UU9 K;  4FJG A;  1Q81 O;  1Y97 A;  3CCM N;  3OYI A;  1KLM A;  3H46 O;  2UXB K;  3PSI A;  3EE9 A;  1S1U A;  1W7A A;  3HPG A;  4HHT A;  3UKR A;  3H1V X;  3MCA B;  3LAL A;  4DFM A;  2E20 A;  3I33 A;  1S3X A;  3OHR A;  4FM2 A;  4LSN A;  3OBY A;  4PL8 A;  4H8K A;  4KAZ A;  3JXU A;  3G0Z A;  3G25 A;  4ID5 A;  1FW6 A;  4Z4F A;  3AA3 A;  1GOB A;  1K9M O;  3MDQ A;  3PIO L;  3P31 A;  2VGM A;  2D0C A;  1NMN A;  1LOT B;  3K5L A;  4FJN A;  1IKW A;  1WLJ A;  2Q3S A;  3A8Y A;  4Q0B A;  3R3L A;  2E1Z A;  4RWT A;  4PY5 A;  5HRR A;  2O8B A;  2ZGZ A;  5LMN K;  2OTJ N;  3TAR A;  1RTD A;  5B8H A;  1N36 K;  4BC5 A;  1G15 A;  3TSQ A;  3QBW A;  4CGG A;  4BE0 A;  1JXB A;  1HQE A;  1VRU A;  2E1Y A;  2KW4 A;  3BF3 A;  3WNH A;  4CF8 A;  4Y1D A;  3CJC A;  4CJW A;  2PYL A;  2VCP A;  1IO2 A;  1B9D A;  4IDH A;  4OX9 K;  3VF2 A;  3QER A;  3WEE A;  3OY9 A;  3JSM A;  5BPN A;  3V1R A;  4I6M B;  3IUC A;  4CZH A;  5ADX H;  2GWJ A;  3RMC A;  3V9S A;  4BR4 A;  5AQK A;  4CEB A;  3HRG A;  3E9O A;  5AFU H;  5GAG P;  4U7B A;  3LM9 A;  4C8N A;  1QVG M;  2P9K A;  3BZC A;  3KWI A;  2A41 A;  3NF8 A;  3OVN A;  4LH5 A;  5AQU A;  1RFQ A;  3F2K A;  3U6F A;  3SCX A;  4LF5 K;  4Z4G A;  5KPT A;  3VOV A;  5D3G A;  5HP1 A;  4BWJ A;  3AAP A;  3ZSR A;  1K8K B;  2GUI A;  4JHD A;  5IT9 O;  4QS8 A;  5LJW A;  5AQH A;  4RG8 A;  1MDU B;  4CEF A;  3CQ8 A;  5M1K A;  1SKS A;  3QFU A;  3C6U A;  3LPU A;  3OYJ A;  1NNE A;  1JL1 A;  5BN8 A;  1RT6 A;  2HMI A;  1X9M A;  4OPA A;  2YX6 A;  1G99 A;  4DUY K;  2O8F A;  2VWK A;  4FWS A;  5FDL A;  3HBT A;  1TKT A;  4CZL A;  5DM7 L;  4IWV A;  1HPM A;  4MLE A;  3QEI A;  2XY8 A;  3M1F A;  4E1N A;  3I8B A;  1HKG A;  1LAW A;  3I8D A;  3TI0 A;  1NKC A;  4EAH D;  2YKN A;  3SZ2 A;  1CXU A;  1IV0 A;  4FLY A;  2PBD A;  4FJ5 A;  3HP9 A;  4YOW A;  2YNF A;  1WUA A;  3DXM B;  4BR5 A;  4HCC A;  1IKY A;  4NB4 A;  4CJR A;  4DQQ A;  4YOT A;  3HK2 A;  4DKW A;  3K5O A;  5AQG A;  2IC3 A;  5EU7 A;  4QAG A;  4BDZ A;  2F4V K;  2DFH A;  2VG7 A;  1RBV A;  4HCB A;  2P9U B;  4JI2 K;  3EZ5 A;  3HZ6 A;  5AQS A;  3P39 A;  1DTT A;  4DTS A;  3AVL A;  2O8E A;  3A2F A;  2KKZ A;  2D5R A;  1OH8 A;  3HO1 A;  4EIA A;  2V7Z A;  2ITM A;  1JLF A;  4MQ3 A;  4A62 A;  1U2V B;  2ITG A;  1EET A;  3ZX2 A;  4DTN A;  2E2Q A;  5KGX A;  3KD1 E;  4CEO A;  3VA0 A;  2UXD K;  2NRX A;  4YDU A;  3ZEU A;  3ZT0 A;  1D5A A;  4R79 A;  3PX6 A;  4GVE A;  5LY3 A;  4WQ5 C;  3I56 N;  4M7Y A;  2VWJ A;  1KD1 O;  4CJP A;  1O13 A;  1BL3 A;  5BR9 A;  4CEA A;  5CHI A;  3PIP L;  2XRI A;  3NFA A;  1D4X A;  1NGI A;  3SQ2 A;  1NGA A;  5GAD P;  3CFR A;  1OKJ A;  1BIZ A;  5AQW A;  3QBX A;  1VQP N;  1T6C A;  3VES A;  1XWL A;  1RTI A;  2HNY A;  3K5M A;  1IG8 A;  1Z6R A;  3QEX A;  4CED A;  3KLI A;  4MFB A;  1N6Q A;  1NKE A;  3VEN A;  5CZ2 A;  1HNV A;  4GVM A;  2G8V A;  3LDP A;  4N56 A;  3HI0 A;  3ASM A;  3D2E A;  3E01 A;  5FLX O;  3FLC O;  3ZT1 A;  3HP6 A;  4DQR A;  3BZK A;  1KFD A;  2QWO A;  4DFK A;  3RSE A;  1SL2 A;  1N33 K;  3UKU B;  2WON A;  3RRG A;  3MXI A;  3AA4 A;  4QCL A;  4LY7 A;  1ZC6 A;  5SZT A;  4J2B A;  3AGK A;  5HRN A;  3SK3 A;  1MWK A;  4JI5 K;  4HUE A;  4YY3 K;  1QHT A;  3FZL A;  1L3S A;  2ZE2 A;  2ZWH A;  4CFB A;  3PV8 A;  2HND A;  4K42 A;  2ASM A;  2KZM A;  4BRI A;  4BRH A;  5KTQ A;  4LFC K;  1XHX A;  1QQN A;  3ZSQ A;  3G71 N;  5C10 A;  2QW9 A;  1HYV A;  4DFJ A;  2IS3 A;  4A2A A;  3R6M A;  4HUG A;  3EN9 A;  3CCJ N;  4EHT A;  4AQY K;  1SKR A;  1UA1 A;  3CF5 L;  3WQU A;  1CZA N;  4JAX A;  2CH6 A;  4NO7 A;  4M3Z A;  1W2B M;  5AQX A;  2GBZ A;  1S5J A;  4CJ3 A;  4DV0 K;  3CME N;  2NRR A;  4DUZ K;  1N8R O;  1VQK N;  3P5J A;  3TSP A;  5J2M A;  3AAQ A;  1WOQ A;  2QWR A;  4DR7 K;  3AO2 A;  1I39 A;  5LL6 Z;  2UUA K;  4X66 K;  4IG3 A;  4F2S A;  2NZT A;  4CD3 A;  2QWM A;  2ZD1 A;  3AGR A;  4FOE A;  1BI4 A;  4RTF D;  3THY A;  4GV3 A;  4YOX A;  5FPN A;  2RPI A;  4B1U B;  3T3F A;  4ZHR A;  3CYM A;  5AZI A;  5AFU A;  4AIL C;  2Q0R A;  4BQZ A;  1FXX A;  4BVO A;  4EP5 A;  2YHW A;  2G8K A;  3LDO A;  4M3Y A;  5C0Y A;  2E2O A;  5KRS A;  3K59 A;  5AQM A;  2Y1I A;  1KLN A;  4M45 A;  4WQ4 C;  5CE3 A;  1HPZ A;  3C0B A;  5AQT A;  4BR7 A;  3VEZ A;  4K41 A;  1B9F A;  4BRF A;  3OYB A;  3M8S A;  3E9P A;  4I9L A;  4F9O A;  1K73 O;  2O4G A;  4DV1 K;  3IS9 A;  3DWL A;  5GIO A;  3CCS N;  5H1S Q;  1XHZ A;  4F2R A;  1WN7 A;  4C8O A;  1EXQ A;  4OLA A;  4RW6 A;  4W5T A;  4K0K K;  4I2P A;  4MLH A;  1VSL A;  4IG0 A;  2A5X A;  3K2P A;  2E2N A;  1KAX A;  5FRO A;  1TV6 A;  4DV5 K;  3AA5 X;  4FL9 A;  1ZYQ A;  4CHO A;  3CQY A;  2QI2 A;  4KHQ A;  1L3T A;  2LSN A;  1Z05 A;  4X64 K;  3CJ1 A;  3M8P A;  1RNH A;  2IDO A;  2O8C A;  2GTD A;  3IMX A;  3BGR A;  1NGH A;  3QIO A;  3ZET B;  1U49 A;  1FKO A;  2KTQ A;  1XC9 A;  2A6A A;  4KTW A;  2QWN A;  3R8E A;  2OCE A;  2VQE K;  4UY8 O;  3LPT A;  1EQY A;  1TYQ A;  2WOM A;  3OYA A;  4JI1 K;  4DQS A;  3SQ0 A;  1ZBI A;  4DB3 A;  1WSH A;  3PX0 A;  4CF1 A;  3VQD A;  3O8M A;  3J7A P;  4FPA A;  1KSP A;  1HKC A;  1BDG A;  1YTA A;  5CYM A;  3F9K A;  2GUP A;  4WFB L;  1BGX T;  4MO4 A;  1MU2 A;  2UXC K;  1ESV A;  3CER A;  1BA1 A;  1EP4 A;  3AVA A;  3EE8 A;  5KI6 A;  2ASP A;  3OYE A;  1IBM K;  1NLV A;  5K14 A;  3QNN A;  1X9S A;  5C2D A;  4ISF A;  3W0L A;  1VQ8 N;  5AQL A;  1KVA A;  1K6Y A;  3VET A;  5GIP A;  4FSV A;  3SAH A;  1QSS A;  2I7P A;  5HRO A;  2AP1 A;  1J54 A;  3AVN A;  2WFB A;  4ILH A;  1BO5 O;  3IAY A;  3D7E O;  4H5W A;  5AQJ A;  3S3N A;  4FJJ A;  3ID6 A;  4IO8 A;  3M3Z A;  3Q7B A;  4GMJ B;  2E88 A;  3LWM A;  3O5B A;  4E19 A;  2Z1H A;  1NOY A;  4CZF A;  3MN5 A;  3DI6 A;  2I5J A;  4RW9 A;  2QA4 N;  2CGJ A;  3SJH A;  1N34 K;  5FPD A;  3MEE A;  4MO5 A;  4F3T A;  3AY9 A;  4DQ8 A;  5FRN A;  2QEX N;  1LWC A;  4C8L A;  5EOY A;  3DLB A;  2BH1 A;  1X3N A;  2DTU A;  2F8T A;  4A2B A;  4CJQ A;  3I0R A;  1HLU A;  3UB5 A;  3TAM A;  1NBW A;  3WNE A;  4NXM K;  2NRH A;  3V9Z A;  1U48 A;  2IVP A;  4DTX A;  5I3U A;  4J2D A;  4NCG A;  4FLU A;  1KC8 O;  3O08 A;  4A61 A;  2G8W A;  4OVL A;  3G4S N;  5BPM A;  4EHU A;  1V4S A;  4E0D A;  3A5N C;  3KK3 A;  1J53 A;  1DLO A;  4YNQ A;  2FBX A;  2UYT A;  4O5B A;  1V4T A;  4BGA A;  4CFA A;  3HPH A;  3DAW A;  4WQ5 A;  3VGK A;  5KRT A;  1ITG A;  2HB5 A;  3QET A;  1KVB A;  1FKP A;  1B92 A;  4FJK A;  4JI3 K;  1K8K A;  3MAQ A;  3VEV A;  4BRE A;  2KLA A;  4BVP A;  3ZCM A;  3ENO A;  3DRS A;  3LDN A;  3LP2 A;  2HBL A;  2IVN A;  3K58 A;  3LDL A;  4CZE A;  5GIN A;  4HTL A;  4BAC A;  4H5R A;  4KH4 A;  4FJL A;  4DF4 A;  3ZX3 A;  1T05 A;  5AQQ A;  1C1C A;  1TAQ A;  4E1J A;  2D1K A;  2KFN A;  2RF2 A;  4G1Q A;  1VRT A;  3OYN A;  3TTD A;  4JKG A;  1LCU A;  5AQI A;  4IJN A;  4IFE A;  1GLC G;  1S6Q A;  4X65 K;  2W42 A;  4FW1 A;  1QSL A;  2IGI A;  3DOL A;  4FJI A;  2IIR A;  2OZS A;  5F0X A;  4H03 B;  1C0F A;  4I2Q A;  4O8U A;  3LAM A;  4CJ5 A;  5HRP A;  3ZSZ A;  4KV8 A;  4CBX A;  1QE1 A;  4M3U A;  4OLB A;  2NLX A;  4IJA A;  1NJI O;  2NRZ A;  3B6P A;  3QO9 A;  4AM6 A;  3NH0 A;  4FLT A;  2KZZ A;  1NKB A;  3NGZ A;  3V1Q A;  3DLL L;  3SLC A;  1YAG A;  3M6G A;  2EHG A;  4O4G A;  2IAJ A;  1SUQ A;  1BOT O;  5M1F A;  5JS1 A;  3QDK A;  1NG9 A;  2PZS A;  1WSI A;  1HJO A;  4NLB A;  2GEM A;  4B1V A;  1HX1 A;  4B9U A;  2ZM6 K;  4KPY A;  4FPB A;  2ATQ A;  3O9U A;  2D0P A;  3TAF A;  3HOT A;  2BDP A;  3DYA A;  4DU1 A;  1UA0 A;  1YTU A;  4PL7 A;  5J2P A;  2OA8 A;  3VA3 A;  4JI4 K;  1CLQ A;  2G8U A;  3SMP A;  1YXQ A;  4IO9 L;  4GV9 A;  3KIO A;  3WUH A;  4Z0U A;  4XH4 A;  2FBV A;  3RTV A;  4O0J A;  4W5N A;  1RDW X;  1VSE A;  3AO5 A;  2P9I A;  1LW0 A;  1T44 A;  4FWN A;  4I7F A;  4CW7 B;  1LW2 A;  3OS2 A;  3KJV A;  4WQ4 A;  3KWG A;  2QWP A;  3OYF A;  5AQY A;  3KHY A;  5CR4 A;  3N4P A;  4DU4 A;  3MWP A;  4DTJ A;  1WAF A;  3QNO A;  2HOE A;  4CIG A;  1JCG A;  3PO5 A;  5M1O A;  5JS2 A;  1VSJ A;  4IOX A;  4DV4 K;  3HST B;  2B6A A;  1I3A A;  1HQU A;  3V81 A;  1OVQ A;  1VSH A;  1S9G A;  4CE9 A;  3EKU A;  4A5A A;  3TTC A;  1OVY A;  1BCM A;  1HMV A;  4CGI A;  3C94 A;  4BG9 A;  1UAX A;  1VAZ A;  3H3N O;  1SKW A;  4EZ6 A;  1R59 O;  1IJJ A;  2D4W A;  4FO0 A;  1C6V A;  3DXK B;  4JS4 A;  4KHP K;  3T7Z A;  4GKJ K;  3THX A;  3CIP A;  1HNW K;  1W0H A;  3D2F A;  1CZ9 A;  5EVZ A;  4IEE A;  3ITH A;  5AJ3 K;  3N4Q A;  5KQ8 A;  1YI2 N;  3QIN A;  1RT3 A;  3ZT3 A;  4QOZ B;  2FF6 A;  3HSC A;  1RGI A;  1UOC A;  5BRD A;  3EY1 A;  5BRH A;  3ENB A;  3WXK A;  1IG9 A;  2WTU A;  4ZTJ A;  4H4O A;  3SJJ A;  3CFO A;  3FGU A;  3FZM A;  5EX5 A;  3CC2 N;  2Z1I A;  1SAZ A;  4CJS A;  5C15 A;  3ID8 A;  4DR2 K;  2YV0 X;  4WFA L;  5C24 A;  3NGI A;  4AHC A;  4LSL A;  1D8Y A;  1WSG A;  2P9N B;  2YCH A;  2V52 B;  4J2A A;  2HVI A;  2A3Z A;  2NRV A;  2ZQB A;  4OPK A;  3VQ7 A;  4N41 A;  3KK1 A;  4OKK A;  4CIF A;  4KHW A;  4E7I A;  3OW2 M;  4DR1 K;  4B9N A;  2FSK A;  3O1W A;  4QS9 A;  2RN2 A;  3DRR A;  3OYC A;  4FK0 A;  5AZJ B;  5J2N A;  2UUB K;  3MMV A;  3OA9 A;  4BDP A;  3G6E N;  1U6Z A;  4DTR A;  2HBM A;  3BP8 A;  2VGN A;  4BRC A;  4B3T K;  3RR8 A;  5DMR A;  1RTJ A;  3BEX A;  3FFI A;  3CC7 N;  2ETJ A;  3TU5 A;  1S22 A;  2OPR A;  3ULD A;  4B9M A;  3KVG A;  5FPM A;  2OPQ A;  4A59 A;  2EWS A;  2QXF A;  4OKJ A;  3ZSV A;  3KLF A;  3QML A;  4BG8 A;  3T1H K;  3H1Q A;  4NLC A;  3PLA A;  4FVM A;  4IEI A;  1KFS A;  2YNI A;  4BGB A;  5E84 A;  4B1X B;  1KTQ A;  3HPO A;  3NGY A;  3VQ8 A;  4W5R A;  4JK7 A;  3OYG A;  4KI4 A;  4FJM A;  3DRP A;  4KHU A;  4B1Y B;  1L3V A;  3ZET A;  4DR3 K;  2WBN A;  4LFB K;  3O80 A;  4R5P A;  4H0T B;  1BIU A;  3O9Q A;  1RDA A;  1OH6 A;  3O4Q A;  2BGG A;  4KTZ A;  3HM9 A;  1IBK K;  2HST A;  1QTM A;  4O5F A;  4L3Q A;  2X74 A;  4B9L A;  4M3R A;  2DY4 A;  2VWB A;  4NCA A;  4CJT A;  1M90 O;  2QXL A;  4CK2 A;  3C6H A;  4FCY A;  4FXD A;  2OYQ A;  1RCH A;  3VQ5 A;  2DFE A;  3WXI A;  1YVN A;  3TSU A;  3VQB A;  3HOS A;  2X78 A;  2Q31 A;  4CZI A;  4DTM A;  4H5T A;  3QES A;  3K57 A;  1JCF A;  2Q2R A;  3CC4 N;  3LP3 A;  4FWR A;  1DGK N;  4G9Z A;  2QM1 A;  3V9U A;  1YUW A;  2O8B B;  3VQ6 A;  1NGE A;  1TK5 A;  3CPE A;  4CES A;  2P9L A;  1C0M A;  4KBO A;  1KXP A;  2XY6 A;  3SMS A;  5LJV A;  3U9D A;  2H3G X;  2W40 A;  4IOC L;  3OYD A;  1VQ6 N;  3LDQ A;  4W5O A;  2HF4 A;  1C1B A;  2P9S A;  1SQK A;  3TWH A;  3E9L A;  3AVI A;  1Y64 A;  1T8E A;  1TGO A;  4NXN K;  4OGC A;  1NGG A;  2E2P A;  2OPP A;  1J6Z A;  1NM1 A;  1VQ7 N;  2B4J A;  1N32 K;  4DCH A;  3O3G A;  3AVB A;  2A42 A;  4KTQ A;  4AHU A;  4M42 A;  2VG6 A;  3NVK A;  1EWQ A;  3JYT A;  2OTL N;  2P9P A;  3NVM A;  3P1G A;  3VQA A;  3Q7C A;  2UUC K;  3EEQ A;  3IG1 A;  1JXE A;  3SAG A;  3H45 C;  1X9W A;  5JLF A;  5C12 A;  2XO7 A;  4DSF A;  5ADX A;  3SV4 A;  1JCE A;  2E8A A;  3HL8 A;  3CJA A;  2WUS A;  1EWR A;  3H6E A;  1EKE A;  2YJE A;  4JHD B;  1Z26 A;  2E6L A;  4CGH A;  1NJX A;  5CY4 A;  2YHA A;  3THV A;  4DV6 K;  1ATR A;  3THW B;  2AA4 A;  1BQN A;  3RMD A;  2O8D A;  2VG5 A;  5F2R A;  4DG1 A;  3KKS A;  5JVH L;  4IKF A;  3EO3 A;  2OPS A;  1VQ4 N;  2O8F B;  4DV3 K;  3ZLJ A;  4DS5 A;  5BRE A;  1J5O A;  4JK8 A;  3BF1 A;  4XEI A;  3RRH A;  4IBN A;  2PYJ A;  4OO1 J;  2HVH A;  4CER A;  4ELU A;  3LP0 A;  4BRG A;  4Z4E A;  4FM0 A;  5CYQ A;  1E4G T;  4JRQ A;  3E1Y A;  4M3T A;  1QQO A;  1IH7 A;  4BQL A;  2E5L K;  5GAH P;  1NOZ A;  4F8R A;  2E4L A;  3NE6 A;  4ELT A;  5J2Q A;  4PA1 A;  3AO4 A;  5I9E B;  2ZF5 O;  4KH5 A;  4RW7 A;  1DTQ A;  3GBT A;  1RTH A;  3VTH A;  3O9R A;  1JLG A;  1U45 A;  1HUX A;  4M7X A;  2HHT A;  3QEV A;  3A0I X;  3M5R A;  3RWU A;  2Z1G A;  3L4I A;  4CJ4 A;  3GOI A;  4ELV A;  1VSK A;  2DPN A;  3BY5 A;  2BE2 A;  2P5G A;  2X6N A;  4FM1 A;  4CEZ A;  4AHS A;  1YT3 A;  1QQM A;  4CFD A;  5HRS A;  3C95 A;  5KPR A;  3MXJ A;  4IXC A;  4CBW A;  2YJF A;  4FLZ A;  1YIT N;  1QQC A;  3S3M A;  1JKH A;  3H3O B;  1WSJ A;  3CI5 A;  2XY7 A;  4B9T A;  2V51 B;  2GEL A;  4JYA K;  4NYN A;  3DM2 A;  2XHB A;  1U47 A;  4CI6 A;  3SQ4 A;  3BDP A;  2HBK A;  4WYB A;  4CJF A;  1Q18 A;  1XC3 A;  3AV9 A;  3MK6 A;  4JKH A;  4BRM A;  1YJW N;  3K9K A;  4BWM A;  4IFY A;  3CJ7 A;  3D2E B;  4E1M A;  3MX5 A;  4PQU A;  4BRO A;  3RMB A;  1OH7 A;  4BRL A;  4CJK A;  4IFV A;  3C7N B;  3I55 N;  1NGF A;  1JLQ A;  1MA9 B;  1NMD A;  5C25 A;  4CHP A;  4JV5 K;  4M3X A;  3CCE N;  4FZX C;  3HYF A;  4C8M A;  4JKB A;  3AVG A;  1ASW A;  4LD0 A;  2KHO A;  1GOC A;  3PUF A;  3CPW M;  4O55 A;  4B3R K;  3FFK B;  3CHW A;  4JS5 A;  1T6D A;  3L2W A;  4NCB A;  4FJX A;  1RT1 A;  4BC4 A;  3J7Y P;  2QK9 A;  1Z25 A;  4M41 A;  1NGB A;  1RT7 A;  1NWK A;  4IDK A;  4GW6 A;  2PY5 A;  3C6A A;  3SUP A;  4KKO A;  3J8A A;  2HHS A;  3O9S A;  3NHG A;  1T3V A;  4JKF A;  1RT5 A;  5CZ1 A;  3TAP A;  2CGL A;  3A5M C;  3PX4 A;  3L2R A;  3ZYY X;  4KB1 A;  2QWQ A;  3AVF A;  2A40 A;  2P51 A;  2Q36 A;  4I6M A;  2HHV A;  3T19 A;  2P1J A;  3U3G A;  4FWM A;  3DXK A;  4FLX A;  1BI4 B;  3THY B;  2HHU A;  1VSI A;  4CK1 A;  3KLG A;  5C42 A;  4A57 A;  4DTP A;  3UIQ A;  3AVJ A;  4DSE A;  1FJG K;  2HMP A;  4H0X B;  3ENH A;  1BU6 O;  1SL1 A;  4O8K A;  1MWM A;  4FK2 A;  2F9T A;  3WXM B;  4C1N I;  4MDA A;  1OH5 A;  4IZ9 A;  3WNG A;  4DHY A;  3CG7 A;  5TKW A;  3IKM A;  3NMU A;  4LF9 K;  2QKK A;  1Q7Y O;  1HNI A;  5A2Q O;  4DWI A;  4CK3 A;  1ZBU A;  3F73 A;  3S3O A;  3PSF A;  4PKG A;  5AQV A;  3C6T A;  4DSK A;  2P9N A;  4JI8 K;  1U04 A;  1WAJ A;  2RKI A;  1J5E K;  1BHL A;  3CCV N;  1XNR K;  4BDY A;  1TKX A;  3FR0 A;  4FJ7 A;  3CCU N;  3U8X A;  1H1V A;  2G8I A;  3SQ1 A;  4H0O A;  2PFU A;  3QLH A;  4LH4 A;  1T03 A;  4ID1 A;  1WBD A;  4FJ8 A;  3PO4 A;  4QS7 A;  2YI1 A;  2O8C B;  3DXM A;  2YHX A;  3F9M A;  3WQT A;  3G10 A;  2QKB A;  3DLR A;  4OKE A;  5M1P A;  4FK4 A;  3L3U A;  1BIS A;  1WB9 A;  4PUO A;  2JWK A;  1K8A O;  3ZT2 A;  4B9Q A;  4B9V A;  4WFN L;  3ALY A;  3SUN A;  2P9U A;  1IBL K;  2DFF A;  3OYK A;  4JNE A;  3QIC A;  1NGJ A;  1TYQ B;  4FWQ A;  3RR7 A;  4B1Z A;  3KK7 A;  5KQD A;  2RHK A;  4BRA A;  3NH1 A;  3AO3 A;  4AM7 A;  4XIU A;  5EXW A;  1U2V A;  1IKV A;  3VQP A;  3FZK A;  4JKE A;  5BR8 K;  2W41 A;  2YHY A;  2YHB A;  3VQC A;  3J7Z O;  4GKK K;  4FWO A;  2A1S A;  1XI1 A;  1NK6 A;  4FJH A;  2A1R A;  1ILY A;  4DV7 K;  3SPY A;  3SUQ A;  1NK0 A;  3VN5 A;  1VQM N;  1HYZ A;  1VSF A;  3OJU A;  5ELZ A;  1XNQ K;  1DT9 A;  3AVM A;  1U4B A;  1TL3 A;  1YIJ N;  3MX2 A;  3TPQ A;  1TL1 A;  1REV A;  3DOK A;  1NU0 A;  2FSJ A;  2NRT A;  4C1N K;  4J2E A;  4KO0 A;  1HJR A;  3EZW A;  4EP4 A;  3WXL A;  1NJZ A;  3VF6 A;  3OS1 A;  5BRF A;  3MWT A;  3LAN A;  1QVF M;  5MLC Q;  4CBU A;  4H0Y B;  1NK8 A;  3MN9 A;  4YFU A;  1GLJ O;  3AO1 A;  3GL1 A;  1TUY A;  2YNH A;  3UKU A;  3OJS A;  1XMO K;  3ULE B;  5HLF A;  4CF2 A;  2HHH K;  1T7P A;  4CZM A;  1RIL A;  2VQF K;  1ZBS A;  5HL7 L;  2BTF A;  3T1A A;  3VQ9 A;  3MN6 A;  4Q5V A;  4BE2 A;  4BY9 C;  4CIE A;  4O44 A;  1KQS M;  4YOR A;  4DLE A;  3KTQ A;  4AHR A;  1WSE A;  4DQP A;  4HWI A;  3TAB A;  3L2U A;  1S72 N;  1JLB A;  4B3M K;  4CHY A;  3NF7 A;  1EX4 A;  3CCR N;  2NRW A;  3V6D A;  4C8K A;  1YF5 L;  4CGJ A;  1L3U A;  1Q8I A;  4DU3 A;  3SUO A;  3AA2 A;  1D9F A;  1GLE G;  3PY8 A;  1VHX A;  2Z1J A;  3L8B A;  3RVC A;  2CGK A;  2E6M A;  3NF9 A;  5JMV A;  3WXJ A;  5HBM A;  5IWA K;  2B5J A;  2FC0 A;  4JKD A;  4DR5 K;  4OPH A;  5JVG L;  4BRP A;  3K9J A;  3CMA N;  1DEJ A;  2YNG A; 
#chains in the Genus database with same CATH homology
 4DV2 K;  4JI3 K;  5BR8 K;  4B3T K;  3J81 O;  5LMU K;  4OX9 K;  4GKK K;  1XMQ K;  2UXD K;  4NXN K;  2UXC K;  4DV7 K;  1N32 K;  4DV4 K;  3T1H K;  1IBM K;  1XNQ K;  4V19 S;  4CVN E;  1FJG K;  4DR4 K;  2UUC K;  4LF5 K;  4LF6 K;  4LF7 K;  2UU9 K;  4X65 K;  4LF9 K;  4JYA K;  5IT9 O;  4DV1 K;  4DR3 K;  5A2Q O;  2UXB K;  4LFB K;  4KHP K;  5FLX O;  4GKJ K;  1HNW K;  1HNZ K;  4DV6 K;  4K0K K;  5AJ3 K;  1IBK K;  1XMO K;  1N34 K;  4JI8 K;  1J5E K;  4JI7 K;  2HHH K;  1N33 K;  1XNR K;  4DV5 K;  4LF4 K;  1HNX K;  4DUY K;  2VQF K;  4X64 K;  4LF8 K;  4DV3 K;  1HR0 K;  4YHH K;  4JI5 K;  4YY3 K;  2ZM6 K;  4NXM K;  4JI6 K;  3JAM O;  4JV5 K;  4DR2 K;  4LFC K;  4B3M K;  3OTO K;  4LFA K;  2E5L K;  2VQE K;  4B3R K;  4X62 K;  4JI4 K;  4AQY K;  1IBL K;  2F4V K;  5LMN K;  4JI1 K;  4JI0 K;  3T1Y K;  4DV0 K;  4DUZ K;  3J7Y P;  4JI2 K;  4DR6 K;  1N36 K;  1I94 K;  3J80 O;  4DR1 K;  5IWA K;  4DR7 K;  3J7A P;  5LL6 Z;  2UUA K;  4X66 K;  4DR5 K;  2UUB K;  4B3S K;  4CW7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...