4DR3L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr3L00
2HT1A 4DUZQ 1KL9A 2OQ0A 2R7FA 4AIMA 1VQ6A 4JI1Q 4DR5L 2RCNA 1WCMH 1S3OA 3CCMA 4YY3Q 1XMQQ 4HJ9A 3GDEA 1VQ8A 2WAQG 2WFWA 1SLJA 3RR5A 1NMFA 3G6EA 4JG2A 2UXCQ 1I3QH 5JJIA 1OTCA 1PFSA 4JI2Q 5IYBH 3UDGA 1PH2A 3GTOH 4DV3L 1YHAA 4X64Q 3H3VH 4X66L 2ZTEA 1E3PA 3RN5A 1FVIA 3CCVA 4HJ7A 2OCEA 3HOWG 4YHHQ 4HIOA 2Y0SG 4POGA 3CW2C 3M85A 2AMCB 1NBWA 4GN4B 5LMNQ 2F4VL 2IX1A 1KXLA 3WWVA 3UE0A 4AYBE 1V1QA 3DM3A 3J7ZC 2RHQB 1HJPA 4A3CG 1MKHA 4WJ4A 5C44H 1X55A 1Q1EA 3A74A 1UE5A 2I0QA 1WYDA 2MNAA 3GTJH 1GD7A 4YCWA 5IY0A 1K3RA 3GO5A 3HFZB 1J5EQ 3CCLA 1YJ9A 2EIFA 2YTVA 5AJ3Q 1Y1VG 2HQLA 2N8NA 4KLKA 4A3LG 4AQYL 2Q2TA 4DR1Q 4GOPB 4JI5Q 4A93G 2UXDQ 5IWAL 2H5XA 1K8AC 5GROA 4A75A 3F2BA 3RN2A 1UE7A 2Z6KC 4A3IH 3PO3G 4JI4Q 4GNXC 1QUQA 2K50A 3CCJA 1HH2P 4UP8A 4L5TA 4LUZA 2B63G 2JA7H 4DR4Q 3HOXH 1G51A 2DUDA 3D0FA 3Q8DA 5J3BA 4DV5Q 1JMCA 1VQKA 4TQUS 1YJWA 4JBWA 2YV5A 1FJGL 2KCMA 1X3FA 1L1OC 1YBYA 4LFAL 1L0WA 3RNUA 4DUYQ 2R6GA 4B3SQ 4A3KH 2JEBI 4UP9A 2VQEQ 2VUMG 4JBMA 1I94L 4IJHA 3S16H 5C0XJ 3G48A 1WFQA 3NENA 3W5OA 4LF8L 4BBRG 1CKNA 2UUBQ 4LF7Q 3L7ZC 4JI8Q 3PF5A 2R7ZH 4DR3L 1V43A 2VQFQ 4JI7L 1J6QA 3UE1A 4QGUA 3AEVA 4JYAQ 2OTJA 3KF8B 4YCVA 2NVYH 2R7DA 1JJ2A 5FLXc 1HNWQ 1PYSB 3KF6A 3K80C 5IP7G 3AYHB 4H02A 4JI6Q 3TRZA 3I4MG 1NMGA 3HOWH 3PIPA 1IBLL 1N9WA 1P16A 5C4JH 4IFDJ 1X56A 1GVPA 1U5KA 4LF4L 1VQDA 1AE2A 1YVCA 4DV2L 4L5RC 2ATWA 1C0AA 1EWIA 4O0AA 3F2DA 3CAMA 2NVXH 1Z47A 3EIVA 3MXNB 3ULPA 3SGIA 4DV6Q 4NPSA 1HR0L 2ZJPA 5IYCG 1WI5A 1V9PA 1KQSA 3NEMA 2K52A 2HIXA 1Q81C 1IBKQ 1VQGA 1BBUA 4R4CA 4JI0L 5FLMH 4UPAA 3CC2A 1N32L 1X9NA 4KHPQ 1Y1WG 4FDBA 4GN5A 3M9BA 4TVAB 2JA9A 3OW2A 2VY3A 4NXNL 3LGJA 4GKKQ 1VQ7A 4A3FH 2EXDA 3H0GH 4APVA 2UXBL 2NZOA 4DR5Q 2LXKA 3TREA 4B3TL 1IYJB 3I56A 1FGUA 1R9TH 1LYLA 5GADC 4BXXH 2PMZE 4P72A 5M3MG 4BBSH 2EQSA 2IX0A 3J81j 1EFWA 5IYDG 1XMOQ 1VCIA 2K5NA 1HR0W 4QQBX 1Q86C 3PUWA 4DV3Q 4X66Q 1PH8A 4BY1G 2MQHA 1HZAA 2FXQA 4WJ3M 1Q12A 1VQBA 1Q7YC 4LF5L 5C4XG 3PO2H 2JQOA 1X3GA 3GTMH 2PI2A 3HKSA 4A3MG 4JI3L 3IRBA 3F2CA 2HHHL 2B3GA 3U50C 5C3EG 2PI2E 2OTLA 4LF9L 2UU9L 1KRTA 1N33L 2AWNA 5FJ8H 3HOVH 3ULLA 2WAQE 3KDFB 1SR3A 4GNXB 4UP7A 1QZGA 3MEFA 1C9OA 4A3EG 4A3BH 4LFBL 3W1GA 4AQYQ 1BVSA 4RG1A 2JEAI 4IFDG 4P73A 2ZTDA 3TEHB 3L0OA 1YHQA 1N34Q 2A19A 4C3IH 4OWTB 5IWAQ 1PH9A 5DLQE 1PH4A 3J81i 1E7ZA 4DV1L 1KHIA 2ZTCA 2Y0SE 1L1OB 1YJNA 3BZCA 2A1AA 4DAMA 3CCUA 4PZ7A 5GAHC 2R92G 3CD6A 3I55A 1CKOA 1XNRL 2CWPA 3S14H 3B6YA 2QEXA 3AFPA 4LF6Q 4DR7L 4DV7L 4R4TA 1TWFH 3H15A 1QVFA 1VQEA 3KJPA 1XPRA 1HNXL 3M7NA 3S2HH 1YZ6A 4MTNA 2JA6G 2R93G 1GO3E 1B8AA 4QJFA 3FP9A 5BR8L 2UUAQ 1FJGQ 4A3DH 1VQOA 4B3RQ 4LFAQ 1CUKA 1GKHA 4A3GG 5JEAG 1S40A 1I94Q 1UWVA 4POFA 1JB7A 4NXML 4KHZA 1N36L 2PNHA 1AH9A 1Q1BA 3PV0A 4DPGA 4LF8Q 2UUCL 2MO0A 2ZJQA 3FKIG 2I5HA 3K7UC 3CQZH 5HY6A 4DR3Q 4Y7NH 3PUYA 1HNZL 4JV5Q 5IYDH 4JI7Q 1K8GA 1PYBA 3KLWA 3STBD 4GLAC 1PV4A 3M3YH 2ID0A 3S1NH 1DGSA 4BY1H 2AKWB 2GVAA 1IBLQ 5M3FG 1I5FA 1TWHH 1NY4A 2D0OA 3PO2G 4L5QA 3HOYG 1YNXA 1WOCA 2PQAB 3CXCA 1W3SA 1VQ5A 4LF4Q 1MJEA 2K5VA 4DV2Q 3S2DH 3UDXA 2KENA 3ERSX 5E7NA 4JCVE 4DR2L 2KHIA 3OYYA 3HOZG 1HR0Q 1MIUA 3UDIA 3KFUA 4X64L 1E22A 1I50H 3S1QH 2XGTA 2KBNA 1TWGH 4JI0Q 4OO1I 3U4VA 1N32Q 3CPFA 1RL2A 4YHHL 3I4NG 3S24A 4PZ6A 3RLOA 1VQCA 4J15A 4NXNQ 5LMNL 5GAGC 4LWCA 3VDYA 3J80i 3OTOL 1Z9FA 4X62Q 2JA8G 1KIXA 4BA1I 4BA2I 4XTCS 1KC8C 4LFCL 4B3TQ 4P75A 2I5LX 2BH2A 4MNOA 4K0KL 2IY5B 2C35B 5IP9G 1N8RC 4GS3A 2R93H 4A3CH 3S1RH 3AQQA 4LUVA 3TS2A 4HIMA 4L5SA 1PH1A 3DLLA 3ZJYC 2UXDL 1X65A 4C3HH 2XTIA 1YIJA 4NB3A 1G291 4OO1G 2F3IA 1Y1VH 4A3LH 3HOUG 2LXJA 1OXVA 2E5LL 2Q2HA 4AH6A 4JI3Q 1OXTA 4A93H 3KJOA 4GKJL 2HHHQ 3NELA 2MO1A 4HJ5A 3K81C 1IBML 2MFIA 5C0XI 1VQMA 1D8LA 4KI0A 1VQ4A 2UU9Q 5GAEC 1XPOA 4LF9Q 4C2MH 1N33Q 3PO3H 3F1ZA 1CKMA 3BJUA 5GQOA 1HZBA 4XIGS 3TQYA 3CF5A 5IYBG 1XNQL 2B63H 2JA5G 4MZ9A 3PUVA 4DUYL 3T1HL 1KD1C 2Q2UA 2IHFA 4OX9L 4YCUA 4IO9A 1IXRA 1VQLA 3PIOA 1YITA 3GTGH 2IHEA 1LM0A 1QUQB 1UE6A 1OXSC 2AWOA 4OWXB 3ER0A 1EQQA 3UDFA 4IFDI 4GLVB 1I6HH 1K73C 1P8LA 1WJJA 2VUMH 1NE3A 4P74A 5IT9c 3PSIA 3J81c 2E2JH 2JE6I 5C44G 4A76A 1D7QA 1YHBA 4R4QA 1XNRQ 4BBRH 4GOPA 2YYZA 1BBWA 5ELOA 5C0XG 2F4VQ 4DR7Q 3T1YL 4HIKA 1HNXQ 3E9IA 4LW1A 4IOCA 2Z0SA 5IP7H 1K83H 1EIFA 1YEZA 5EAYA 2V1CC 2JA8H 1CKNB 3I4MH 2JJQA 2B29A 3S15H 2BA1A 4OONA 1PH5A 3S17H 1JJCB 1Q46A 3KOJA 4NXMQ 2PQAA 1N36Q 4PG3A 1UEBA 4A3IG 1XJVA 3KF6B 1KRSA 4JBKA 1B7YB 1A62A 2BH8A 1IBKL 2E8GA 4YWMA 1C7YA 1HNZQ 3CC4A 4DR6L 2RHSB 2JA7G 2NVTH 2RF4A 4KHPL 3TS0A 2N3SA 4GLXA 1IZ6A 5IYCH 3PGZA 1A0IA 1XPUA 4PZ8A 1M1KC 3G4SA 1EYGA 1E1TA 3GTPH 4GKKL 3U4ZA 3HOUH 3S1MH 2WB1G 3U58A 1Y1WH 2YTYA 3CP0A 4JBJA 4A3KG 5LMUL 3JC66 3PCOB 1VQJA 1HZ9A 3PUXA 1CSPA 4R4IA 4JOIA 4DR2Q 2QA4A 2NN6I 2NZHA 4BY7G 1VS0A 4QL5A 3STBC 3CCQA 4GN3B 2R7ZG 4DV4L 2F52A 2GN5A 1EOVA 1XMOL 2JA5H 3CMAA 1PH7A 3ICEA 5JJKA 1FL0A 3JAMi 5M3MH 4B3ML 1CSQA 1EUJA 1H95A 3CCRA 1UE1A 1VQAA 3L2PA 1JJGA 2CQOA 4IPCA 2D62A 4DV0L 4OWWB 4X65L 2N78A 2ZM6L 2KHJA 1IL2A 2ASBA 4X6AH 1Q8KA 3OTOQ 2E2HH 4DUZL 4AYBG 3J80c 2K5HA 4LFCQ 5C4XH 1SMXA 4JI1L 2E2IH 4A3MH 1SROA 3RLNA 3RLFA 4YY3L 4EX5A 4A3JG 1XMQL 2DGYA 1SFOH 1PH3A 2OWOA 4K0KQ 2NN6G 5C3EH 2VS1A 3EBEA 5HGQA 5JJLA 5H1SE 1TWAH 2YU9H 2UXCL 1PHJA 5FLMG 3FHWA 5M5WH 1HZCA 3E9HA 1LTLA 4R1JA 3CMEA 1O7IA 1N34L 4JI2L 3EN2A 1VQNA 2BA0A 4QY7A 1M90C 4A3EH 1NJIC 3A0JA 4A3FG 3H0GG 1S72A 4JC0A 2E5LQ 4UY8C 4DK6C 1E24A 2ALYB 4GKJQ 4PMWA 1MJCA 3CPWA 4Y52H 4YWKA 1IBMQ 1OXUA 4C3JH 4LF6L 2CKZB 1Y14B 4IPHA 3J7A5 4BXXG 2UXBQ 5M5YH 2R92H 3A5ZB 4P71A 1EQRA 4BBSG 4B3RL 1KAWA 1RIPA 2UUAL 1A63A 3AFQA 1XNQQ 2HIVA 1J5EL 1G6PA 4ME3A 3T1HQ 4OX9Q 3M4QA 4HJ8A 2L15A 2JA6H 3KYHC 5AJ3L 1Q82C 3H3VI 2LSSA 1SRUA 1X6OA 2K75A 4DR1L 4BY7H 1E1OA 2K4KA 3I2ZA 1EIYB 1B70B 4JI5L 4JV5L 3KDFA 2CWAA 2Z6KA 3NBHB 4OXPA 4A3GH 4GNXA 4HJAA 1GM5A 4LF5Q 2YTXA 2I5MX 4JI4L 1VQFA 1WCMG 3FKIH 5FJ8G 4EQ5A 3HOVG 1LUZA 3T1YQ 5LMNW 4DR4L 1U0LA 2KCTA 3RZOH 2K14A 3E0EA 1T9HA 4GOPC 1VQHA 4A3BG 4DV5L 1QZHA 1TXYA 1L1OA 1A8VA 3BZKA 3K8AA 3M4PA 2CFMA 2IT1A 3K7AH 4O2DA 3GD7A 4A4IA 1YI2A 3RZDH 1PA6A 4LUOA 5M3FH 2AHOB 5ELNA 4B3SL 2VW9A 3HOYH 4A3JH 2QGQA 1K0RA 1K9MC 4QIWE 2VQEL 4LFBQ 3HKZE 1NTGA 1OXXK 4YWLA 3CCSA 1ASZA 2A8VA 4IPDA 3HKZG 4DR6Q 3I4OA 3I7FA 4HIDA 2UUBL 4LF7L 3W1BA 4DAYB 4JI8L 3CC7A 3GTQH 2WP8J 2JK8A 3GTLH 2CCZA 3HOZH 2VQFL 2ES2A 5K36G 1X3EA 2VL6A 2D0PA 1XTDA 4DV1Q 4JYAL 4LNQA 3PF4A 1ASYA 2VNUD 1QVCA 2ZJRA 4IJLA 4R4OA 4A3DG 1HNWL 5JEAJ 4DK3C 4JI6L 4X62L 1SE8A 4IOAA 3I4NH 4DV7Q 5LMUQ 1W2BA 2OQKA 2N49A 3ULJA 1QVGA 3BU2A 3PUZA 5BR8Q 4DKAC 3CCEA 1JT8A 1PVOA 3G71A 1BKBA 2Q2IA 4IPGA 4JOIC 4DV4Q 4DV6L 5M5XH 3M4OH 3K0XA 5IP9H 3GTKH 3F8TA 2UUCQ 4B3MQ 1SN8A 3D31A 5IE8A 1VQPA 1PH6A 3JAMc 2VZAA 1L2FA 4ALPA 3HOXG 1VQIA 4DV0Q 4RMFA 2NVQH 1X54A 4X65Q 2ZM6Q 1JE5A 1VQ9A 2GVBA 1AE3A 3A5UA 1TWCH 2WB1E 4DNIA
chains in the Genus database with same CATH superfamily
4X3KA 4B9XA 2HT1A 2OQ0A 2A68C 3MC0B 1VQ6A 2XN9C 2DN8A 4K8IA 5JVH3 5E1FA 2WFWA 1B3QA 3EROA 2UXCQ 1OTCA 4H13C 5IYBH 1PH2A 2K5QA 1YHAA 2ZTEA 4IUNA 3RN5A 1FVIA 5M3MB 1H9SB 3BVZA 2CQAA 4HIOA 2Y0SG 1JC7A 2KA7A 1YNND 1LTRD 2NB0A 5KRUA 2B2UA 1H9KA 1HJPA 5C44H 1SYFA 1IL8A 2MNAA 3GTJH 1GD7A 4YCWA 2OT2A 1I4GA 3Q22A 4A3MB 2MHVA 3CCLA 4C3HG 4QMGA 2YTVA 2K5WA 2OEOA 4KN7C 4AQYL 3G6JB 4GOPB 3KBGA 4JI5Q 5M5WB 2UXDQ 4ZKBB 5IWAL 2X6GA 2EYPA 5GROA 1MHWC 3NTHA 1BF4A 2ENBA 3H91A 3PO3G 4DK1A 4GNXC 3Q23A 1B3AA 3G7LA 2B63G 2JA7H 1G51A 2DUDA 2K03A 1JMCA 1V1PA 4TQUS 1PRTD 1G2SA 1YJWA 2R92B 3H3VC 2KCMA 1X3FA 2X69A 1L1OC 2JP1A 4QUCA 2L12A 2JEBI 5A2QE 1I94L 4IJHA 3NENA 4LF7Q 4BY7B 4QGUA 4HEDA 3OHXC 5E3FA 3MWYW 5IP7G 3KF6A 3AYHB 3TRZA 4ME5A 1TQOA 2Z4HA 3HOWH 3VA7A 3PIPA 1IBLL 2AQ2B 2K28A 1X56A 4CHTB 1YVCA 4DV2L 4L5RC 2ATWA 4O0AA 3F2DA 1GJXA 1HFNA 1Z47A 3EIVA 3FRPB 3SGIA 3RZDB 5M3FB 1HR0L 3PO2B 4A3JB 1A3VA 3OOCA 1WI5A 1V9PA 3NEMA 4R4CA 5FLMH 5CV9A 1X9NA 1F2MA 4TVAB 3HOZB 1T5EA 2VY3A 4NXNL 5KNCA 3H0GH 3R2IA 3V96A 4APVA 5IGCA 1PMRA 1TR5A 3TREA 4CDCC 4IZ8A 3I4NB 3HGBA 2XNAC 5KEEA 3FPPA 4BXXH 1CTMA 2ZXOA 2K01A 1EFWA 4KMUC 1XMOQ 1B53A 5A35A 2FFKB 4XXEA 2MQHA 1HZAA 3QIAA 4WJ3M 4LF5L 1Q7YC 1A6XA 4H0LC 3GTMH 4IUVA 2NVQB 3F2CA 5FKAC 5BN5A 1S5ED 3U50C 3GTLB 1F9PA 1GUGA 1SNCA 1SR3A 3GQBA 1QZGA 5C5LA 3K59A 4A3EG 4LFBL 4AQYQ 4RG1A 4P73A 2ZTDA 3IFTA 5DNFA 3TEHB 3NSWA 1YHQA 4ZRZA 2IX3A 5EQ0A 4C3IH 3J7AV 5IWAQ 3GTOB 4C3JG 1PH9A 1PH4A 4DV1L 1I4PA 2A1AA 4LAAA 3T13A 4DAMA 5GAHC 3CCUA 3AMUA 3CD6A 3I55A 1PDQA 2B8FA 3B6YA 3AFPA 3TSSA 2P5ZX 3CKIB 4LF6Q 1F2ZA 4DV7L 1C48A 1VQEA 3GV6A 3KJPA 3S2HH 1PZKD 2JA6G 4QJFA 4JK1C 1E2WA 3ND9A 5JEAG 1QJOA 1S40A 1I94Q 1XWEA 2E75C 4NXML 1AH9A 1Q1BA 1HCZA 1L0YB 5FOBB 2B2VC 1G6ZA 2MO0A 3RMHA 5CMDA 1QE6A 4KKTA 1K8GA 1PYBA 1J8IA 3I70A 4RGTA 2ID0A 3S1NH 1DXMA 1BR9A 3BVGA 3TP6A 1PYWD 4BY1H 4A3IB 2RKSA 4DAYA 1IBLQ 2D0OA 4DAPA 3HOXB 3HOYG 2F0NA 4DV2Q 1TY0A 3UDXA 4DR2L 3ERSX 2KHIA 3OYYA 3ERQA 2WB1B 1HR0Q 4K14A 4A3KB 1Z6HA 2EY6A 4U68A 3I73A 1RJTA 5CYUA 1DONA 3U4VA 1XX8A 1JQYD 5JAVA 2RBMA 2JXMB 4YHHL 2F0SA 4NXNQ 4ZUIA 5LMNL 2NVYB 1CFMA 4Z9CB 4BA1I 4LFCL 4MNOA 1O78A 3J81L 2Q8TA 1N8RC 2R93H 1IW7D 3QB3A 3TS2A 1NUCA 2NVXB 5CGKA 4AYBB 4HIMA 3DLLA 3C1EA 1WTHA 3ZJYC 4FF4A 1Q8IA 4C3HH 2XTIA 2IW3A 3HOUG 5EKLA 1MD2D 1S5CD 2TMPA 2F0LA 2EYLA 4RWSC 3NELA 4FF1A 1VQ4A 1Q90A 2B2WA 4I65A 4IURA 5EJWA 4A3FB 1SYCA 3PO3H 1D5ZC 4KKSA 3HRZC 3TQYA 4EQOA 4EQPA 4KY6A 2B63H 1GUWA 2HUGA 4CJ1B 3PUVA 1KD1C 4OX9L 4ABNA 2HCIA 3SE0A 4BBSB 1OXSC 1I6HH 1U4RA 2J4XA 1NE3A 4P74A 4RKLA 2MPMA 3M4YA 3C2PA 1V1PB 2MGSA 1J9OA 4IQZA 1CK1A 1G8ZD 2C9OA 2E74C 5DEHA 4LW1A 4BS9A 5IP7H 3E6ZX 5EAYA 2JA8H 1GUOA 1JJCB 1M4VA 3KOJA 4NXMQ 2PQAA 4CDDC 1QNKA 3FMCA 4KN4C 1XJVA 3KF6B 1KRSA 1SSOA 2CVRA 2RF4A 2D9UA 1A0IA 1SMYC 1XPUA 4PZ8A 1E1TA 1SNMA 1G91A 4CDEC 3CP0A 4JBJA 5LMUL 5L37A 1TWFB 3PCOB 2VB3X 1VQJA 1VF7A 3D8GA 5LL6S 4DR2Q 4B08A 3RUZA 4RAUC 1VS0A 2R7ZG 1CZGA 1EOVA 4Q5VA 2JA5H 3CMAA 1PH7A 2O5JC 1FL0A 4B3ML 4KJOA 1CSQA 1OO9B 1UE1A 1HA6A 4OWWB 1HHVA 1IL2A 2KHJA 2ASBA 1EY0A 1M8AA 3P75A 3TP5A 1XTCD 3OIQA 4LFCQ 2FHTA 1SROA 1TWHB 5C0XH 4KD3A 1F9SA 2DY8A 5H1SE 1TWAH 3SK5A 3R8BA 5KNBA 1YNJD 2XRQD 4RA8A 1HZCA 3CMEA 1O7IA 5D3DA 4C1NK 1EIHA 1PXUA 1K0SA 4QY7A 1M90C 4A3EH 2WAQB 3A0JA 3S1QB 2AQ1B 5ISRA 4UY8C 4DK6C 2SNMA 3CPWA 4TKOB 2F0IA 4C3JH 4IPHA 2UXBQ 4P71A 1EQRA 1KAWA 1RIPA 1LTBD 3DHQA 4OX9Q 3WDNA 2JA6H 3H3VI 2LSSA 3S1RB 2K75A 4DR1L 4WRDA 1EIYB 1EL0A 4JV5L 5JPMC 5JEAH 4GNXA 2YTXA 1Y8PB 4JI4L 5BN3A 3HOVG 4DR4L 4A93B 4IUUA 3BG3A 3E0EA 1X32A 1SAPA 4DV5L 2MJ8A 4A3BG 1L1OA 3JAML 2AQ3B 3SHLA 3OWEB 3M4PA 5CR3A 5HGTA 1YI2A 3GD7A 1TU2B 5ELNA 1WTWA 1STBA 3HOYH 2QGQA 4QIWE 2VQEL 1U4PA 1EEID 1NTGA 1BXTA 4YWLA 5E4WC 1B2TA 2XWJB 2UUBL 1T5XD 4DAYB 1KDCA 1X3EA 4LNQA 2E2JB 4A3DG 4R4OA 1FNVA 4JI6L 1SE8A 4HCSA 4CBVA 5LMUQ 3SK8A 3BDOA 3ULJA 3BU2A 4DKAC 1EY7A 1I4RA 1STHA 1JT8A 1K83B 3I4MB 5COYA 3G71A 4IPGA 2F0QA 3J81E 3S17B 1LO5D 1PFMA 1TKWB 3IKJA 2UUCQ 4B3MQ 5IE8A 1VQPA 3K5LA 2VZAA 3N6RA 1EEFD 3FVQA 1X54A 1VQ9A 2GVBA 1C8CA 2PZTA 1TWCH 4DNIA 1MSHA 2ICEC 1NAPA 5DM73 4AIMA 2PW5A 3S1MB 4ZAIA 1Y1WB 3GDEA 3KLRA 1SLJA 3G6EA 1PFBA 2Z6BA 1YNNC 1I3QH 1A2UA 1B50A 2EY5A 1PFSA 1PTOH 1A15A 4DV3L 1FD7D 4X66L 3N52A 1UAPA 2OCEA 4HMIA 3TZDA 3HOWG 3TN2A 4POGA 3M85A 1WTPA 2IX1A 2F4VL 1V8QA 3J7ZC 1V1QA 2XIWA 2EZVA 3L3OC 4WJ4A 3I91A 1UE5A 2I0QA 1WYDA 3E5SA 5IY0A 1K3RA 2N88A 2F0TA 1SFOB 5FLXL 2LKVA 1Y1VG 4NP5A 2G9HD 2YU9B 5D14A 3DEPA 4DR1Q 2SNSA 1LABA 3I3CA 5FO7B 1PRTC 1K8AC 5CC4A 5C5MA 4J1MA 2JYOA 4JI4Q 1EWHA 1HH2P 2A74C 3Q6SA 4DR4Q 3VYUA 3W2DA 3K58A 3X3NA 3P1HA 5J3BA 4DV5Q 5NUCA 5M5YB 2YV5A 1ENCA 3MZ5A 1D2BA 4LFAL 1L0WA 3R2TA 3OMGA 3SXHA 2VQEQ 1GOZA 1LTTD 2B2VA 4JBMA 2VUMG 2V4DA 1HTPA 5C0XJ 2FMMA 1NSNS 2UUBQ 3PF5A 2R7ZH 1V43A 1VMPA 1JJ2A 4RGMA 2WKCA 4JI6Q 4H02A 5BN4A 1NMGA 1SNOA 3FKIB 1LV9A 1P16A 3BYYB 3RZOB 1JR0D 4XT1B 5KIXA 1C0AA 3CAMA 4KHVA 4HSPA 3K7AB 4C3IG 5IGFA 2KCNA 2ZJPA 1I4QA 2K52A 3MTSA 5JVG3 1IBKQ 5KNDA 1N32L 4FDBA 3D4DA 2GA4B 4R9WA 2FINB 4R8NA 1STYA 3MFGA 1JICA 1HUMA 4NW2A 2R61A 3CRLC 2PCFB 3SR1A 5LL6X 4XYOA 3I56A 1FGUA 5M3MG 1E2ZA 4H44C 4F88A 1VCIA 3PUWA 4FF3A 4DV3Q 5M5XB 4X66Q 3PQIA 1X3PA 4BY1G 3AU7A 2FXQA 3GTKB 2XRSD 1FR3A 2L0CA 2Z8LA 2KOLA 4A3MG 3IRBA 2HHHL 4F87A 2B3GA 5I6YA 1ESFA 2OTLA 1A2TA 1BUVT 2UU9L 4LF9L 3HOVH 1WTRA 1WCMB 1SNDA 5EGTA 4GNXB 4L6TB 4A3BH 2EYJA 1BVSA 3A7LA 2JEAI 4IFDG 1MBYA 2IJ0A 3L0OA 2LMCB 1N34Q 1WD0A 1E7ZA 2Y0SE 1L1OB 1YJNA 1D5XC 3QG1A 2R92G 1KDBA 3NWTA 1CKOA 3HKZB 2CWPA 3S14H 4DGZA 3ZYYX 3NBHA 4RCNA 1RHPA 3H15A 2Z4IA 3NUCA 2R93G 4DNRB 1GO3E 2Q8IB 1B8AA 4A3DH 3FP9A 5BR8L 4B3RQ 1ZXTA 2HCCA 4LFAQ 2XWBB 1LT4D 1JB7A 1CM9A 1GUTA 2PNHA 4K5XA 4KHZA 1KDAA 3PV0A 4DPGA 1HRJA 3PUYA 4FXDA 5IGDA 4GLAC 3M3YH 2F0EA 1MSGA 4IALA 2AKWB 1KLUD 1EU4A 5M3FG 3PO2G 3FEWX 3KBXA 1WOCA 3CXCA 2EY2A 3S2DH 4JCVE 2NZ1D 5DM63 5IGEA 3HOZG 4I7ZC 1ENAA 1I4XA 4X64L 1I50H 3S16B 2KBNA 1N32Q 1HUNA 1SBBB 1RL2A 3V2TA 3I4NG 3RLOA 1VQCA 4J15A 3T51B 4NMZA 1ESRA 1EY5A 4LWCA 1Z9FA 3GP7A 4X62Q 2JA8G 2O5IC 4XTCS 2BH2A 2VXWA 5C4JB 4K0KL 1A3UA 2C35B 4GS3A 3FDTA 3K6OA 4DNTB 1JWMD 2J0TD 3BYTB 5C3WA 1YIJA 1CQFA 1G291 2F3IA 1Y1VH 3SEBA 3EFXD 2E5LL 4AH6A 1WTXA 1OXTA 4GKJL 3KJOA 4QUFA 2HHHQ 3TDQA 3K81C 5G3LF 1IBML 4OL7A 5IIFA 4NKLA 4LF9Q 2UU9Q 5GAEC 3H6MA 1HZBA 4XIGS 1HQMC 1JWUD 2JA5G 1GXDC 2QW7A 4ZYSA 4DUYL 4YCUA 1IXRA 1TS2A 4U673 1R9TB 2EPBA 1LM0A 2AWOA 4OGQC 4OWXB 3K0YA 4OHJA 1P8LA 1WJJA 2B8GA 1CT1D 2VUMH 2IPKD 1B1ZA 3J81c 1SYGA 1YHBA 2KJXA 2F0PA 5IGGA 5C0XG 2B39A 3T1YL 2F0GA 2F1MA 4IOCA 1RTOA 5EBDA 4ZK9B 4ZUJA 1UEBA 4A3IG 3J80L 2RQXA 2F03A 1B7YB 1A62A 1LT6D 4DR6L 4YWMA 3CC4A 2NVTH 4KHPL 3TS0A 2N3SA 5IODA 4GLXA 3PGZA 2JN4A 1M1KC 4GKKL 5D3IB 3S9WA 2WB1G 3U58A 1I4HA 4CKBA 2F0FA 4A3KG 2EJGC 3JC66 3KF8A 3PUXA 1CSPA 3LNNA 1TS5A 4DK0A 2NZHA 2EJMA 3STBC 3TBIB 3MEHA 1UEAB 4DV4L 1AZQA 3OIPA 2D5DA 3ICEA 5M3MH 4QCLA 2M00A 3L2PA 3CQZB 4IPCA 4Y7NB 2ZM6L 3LWUA 2EYHA 3P20A 1YNJC 1Q8KA 3U9SA 5KYIA 2A6HD 4DUZL 1L0XB 4AYBG 4P2CB 4JI1L 4A3MH 3RLNA 1SYDA 1PH3A 4K0KQ 4EX5A 1O80A 2NN6G 2OF1A 5I9OA 2VS1A 1LTGD 1S5FD 3I4LA 4IUQA 3DXJC 5M5WH 1CA5A 3E9HA 1LTLA 4R1JA 4JI2L 1BCPF 2BDOA 2RVLA 3OMCA 1VMCA 1NJIC 2A5HA 4A3FG 1S72A 4IFDH 3NBIA 2L55A 1TWGB 4R8IA 2E5LQ 5J1ZA 5ELDA 1ENFA 4GKJQ 1ZYRD 3K57A 4YWKA 1IBMQ 3J7A5 2R92H 4BBSG 4KY7A 4ODGA 2UUAL 1J5EL 1G6PA 4C1NI 4JVZA 3M4QA 2L15A 3KYHC 3I90A 5DAUA 4BY7H 2K4KA 3F2UA 3NBHB 3A8IE 1BCPB 3BDCA 4LF5Q 1VQFA 2RSNA 5FJ8G 4EQ5A 5T1IA 4KY5A 3T1YQ 2KCTA 2K14A 3KLSA 3EJIA 2PNRC 1O7YA 1ET9A 4C2MB 3K8AA 4A4IA 2RSOA 2CFMA 2ZXRA 3SK6A 1CQVA 2VB2X 4LUOA 5M3FH 3RZDH 1FNUA 3VA5A 3PO2H 5EPKA 4A3JH 1K0RA 1K9MC 4LFBQ 3CCSA 1EZ6A 2QF7A 4FXKC 3VR6A 2A8VA 3GTGB 2PZWA 4DR6Q 3I4OA 3I7FA 2E2DC 3W1BA 4JI8L 5FO8B 3CC7A 4EQNA 2JK8A 3HOZH 2CCZA 2VQFL 2ES2A 4DV1Q 1K28A 1XTDA 4JYAL 3IAYA 1FNWA 4HCEA 4X3SA 1ASYA 5FK9C 4BBRB 3I4NH 4DV7Q 2OQKA 1QVGA 1QWYA 3PUZA 3MA2B 1PVOA 5FO9B 5HURA 4DV4Q 2Q2IA 4JOIC 3S15B 3K0XA 5IOCA 4HAEA 3F8TA 3D31A 1PH6A 3JAMc 3K5NA 1L2FA 4ALPA 1VQIA 2NVQH 2ZM6Q 1JE5A 4K2KA 1HPCA 1WD1A 3GTLH 2H4OA 2O2LD 4DUZQ 3WOEA 3GTPB 3HOUB 4JI1Q 2RDGA 2RCNA 1S3OA 4BWGB 2F0OA 1IHZA 2WAQG 1NR2A 3RR5A 1NMFA 4N9TA 2F3VA 4FP5D 2I07B 1DCZA 4JI2Q 1AZPA 2KHSA 4UAIA 3GTOH 4I7AA 1PZJD 2F3WA 1EFID 1E3PA 1PFNA 1WTOA 4YHHQ 3HEJA 3CW2C 1LACA 2AMCB 3TP8A 1NBWA 1EY4A 4GN4B 5LMNQ 4K5WA 3WWVA 3UE0A 3DM3A 2RHQB 3QJYA 2E2HB 4TSSA 1Q1EA 1EU3A 3A74A 5C4XB 1DOMA 2PO4A 2E2IB 3GO5A 1J5EQ 1MI2A 4O1NA 1YJ9A 2EIFA 2PYKA 5JOBA 2N8NA 2HQLA 4KLKA 5C3EB 4A3LG 1QG7A 2KECA 4A93G 1EWCA 1LTSD 3J80E 2E76C 1UE7A 2Z6KC 4A3IH 1AEXA 5T1GA 4UP8A 4GZYC 2K32A 4LUZA 4CJ0B 3HOXH 1K3BC 5C3XA 3D0FA 3Q8DA 1S4ZA 5G3LD 1PTOC 1FJGL 2A73B 1YBYA 3RNUA 4A3KH 4UP9A 1BQQT 4G57A 2SOBA 3G48A 1WFQA 3T53B 4LF8L 1CKNA 3L7ZC 4JI8Q 2VQFQ 4JI7L 1J6QA 3UE1A 3AEVA 4A3GB 4JYAQ 2OTJA 3KF8B 4YCVA 2NVYH 5FLXc 3K80C 4CGYB 4XDXA 3I4MG 1U9RA 4IFDJ 2PW7A 3UI2A 1GVPA 4PMCA 1EWIA 3T56B 2NVXH 3ULPA 3IFDA 1JB3A 2DY7A 2PZUA 1HFGA 2NN6H 4DAVA 1Q81C 1BBUA 3CC2A 4UPAA 1Y1WG 3VR5A 3GTQB 1ILQA 3M9BA 2JA9A 4KD4A 1VQ7A 4A3FH 1STAA 2A69C 1S5BD 1GUNA 2NZOA 2LXKA 5EPLA 2LS01 1IYJB 1BDOA 1LYLA 3PMFA 5GADC 2PMZE 4BBSH 2EQSA 4V190 1JWSD 4KJNA 1HR0W 4F7XA 2ZT9C 3M4OB 1PH8A 3A8KE 3HS0C 1Q12A 1VQBA 3MHBA 1X3GA 3HKSA 4ID6A 4JI3L 5CV8A 2PI2E 1KRTA 1N33L 1F9RA 1TVXA 1PRTB 3RD4A 5FJ8H 2BE5D 2F0DA 4UP7A 1EY8A 1C9OA 4RGNA 1HA5A 2A19A 1KLGD 4M8AA 2EXZA 5DLQE 1BCPD 1BOSA 3J81i 4EGVA 2I46A 2F0JA 4N8FA 4PZ7A 4QIWB 2QEXA 4DR7L 4FO2A 3C46A 1TWFH 1QVFA 1EYAA 1XPRA 1HNXL 3M7NA 4V0BA 4MTNA 5C44B 1FJGQ 3ND8A 3QOJA 1VQOA 3GTJB 1CUKA 4CDFC 1GKHA 5TSSA 1O7LA 1UWVA 1D1IA 1WVLA 4LF8Q 2ZJQA 3FKIG 1UUPA 5HY6A 4JV5Q 2XVSA 5IYDH 4JI7Q 3KLWA 1U4MA 1VDZA 1DGSA 3MVVA 3PIO3 2ICIA 3DWAA 2WIIB 1I5FA 1TWHH 1NY4A 3VYTA 2JA7B 1YNXA 2PQAB 1W3SA 1VQ5A 2RCFA 1H9RA 3QR8A 4MN3A 3VYRA 5J39A 2KENA 1R4QB 1VF5C 3R3OA 3J7AF 1MIUA 1CA6A 4DU9A 2F0KA 4XQQA 3UDIA 1STGA 1QB5D 1E2VA 1PLFA 1SYEA 2HDLA 3S1QH 1EOTA 4HR7B 5EPJA 5JJZA 3HG9A 3VDYA 2AUJD 5M9OA 1KIXA 1AN8A 1K8OA 4BA2I 2HQEA 1KC8C 2NUCA 3HOWB 5ELBA 2I5LX 3NTIA 3E3XA 3NXWA 3NPPA 5IT9L 2EDGA 5IP9G 4K5VA 3S1RH 2OXPA 1AFPA 4L5SA 4ZKCB 2AUKA 2UXDL 3KLSX 4NB3A 4OO1G 1CHQD 4A3LH 2QKIC 2QEJC 4ZCKA 4JI3Q 4A93H 2DJFC 1AW7A 2MO1A 2SEBD 2MFIA 5C0XI 1VQMA 1D8LA 1KNAA 4KI0A 1XPOA 1N33Q 1RKNA 3H0GB 3F1ZA 1EYCA 2Q2UA 3T1HL 4IO9A 1VQLA 1SNQA 3PIOA 1YITA 2BDNA 1UE6A 2IHEA 1NNXA 4O42A 4GLVB 1R4PB 1XYIA 5KYLA 3OSOA 3D3RA 3PSIA 2E2JH 2JE6I 1MGSA 4A76A 1SXTA 4WJWA 2YYZA 5ELOA 4FNFA 2F4VQ 3GTMB 4DR7Q 4HIKA 2NBFA 1HNXQ 1LT3D 2B2YC 2Z0SA 1K83H 1EIFA 1TS4A 1YEZA 2V1CC 1CKNB 3I4MH 3S17H 2B29A 2BA1A 4OONA 1PH5A 1Q46A 3JAME 2KCCA 1Q3LA 3CHBD 5I9PA 4KTAA 4JBKA 2BH8A 1JOQA 4G7ZC 4C3IB 2KEEA 4WFN3 2F0WA 3E0JA 3U4ZA 2WV6D 3FPUB 4IN3A 2K33A 3S1MH 1RTNA 3IL8A 4LJZC 1Y1WH 2WKDA 1HZ9A 3S2HB 4R4IA 1ICWA 4JOIA 1K8MA 2L1BA 3CRKC 2QA4A 2NN6I 2QDLA 4BY7G 1GUSA 4YIJA 2MUYA 1XMOL 3C3LA 4OEMB 2A6HC 3PIP3 4G4KA 1KAAA 3JAMi 1H95A 3MXNA 3CCRA 1JJGA 2WINB 1CI3M 2N78A 4EVOA 3S1NB 4F8MA 4X6AH 4BY1B 3J80c 2K5HA 3RLFA 4YY3L 4A3JG 1XMQL 1SFOH 2F0VA 4HN7A 2OWOA 5CBAE 5CV4A 1RCVD 1ZYRC 4MIUA 2YU9H 2A6ED 3ITPA 3FHWA 1VQNA 4Q0FA 3EN2A 2CW0D 2BA0A 4K6DA 3HZXA 4RCOA 1EY9A 1ZEQX 2DJGC 4PMWA 1IW7C 1MJCA 4Y52H 4LF6L 2CKZB 1Y14B 1SEBD 3J7YW 5M5YH 1II3A 2KQ3A 4PV1C 3AFQA 2RDHA 2Y0SB 4ME3A 3T1HQ 2KEDA 4HJ8A 2R93B 5AJ3L 1EY6A 1SRUA 3A8JE 4J8QA 5CBEE 2G5DA 2L11A 1E1OA 5FLXE 3I2ZA 3DM1A 4JPBW 1B70B 3KDFA 2Z6KA 3NE5B 4C3HB 4HJAA 1GM5A 2I5MX 1SE4A 3FKIH 3KK7A 1LUZA 4RHSA 3RZOH 2EYOA 3H94A 4GOPC 1VQHA 4HSVA 4RKBA 1ET6A 3PO3B 3BZKA 3K7AH 3H09A 4ILWA 1PA6A 1B4OA 2AHOB 2B63B 4B3SL 3DWQA 1KNEA 1OXXK 1ASZA 2F0MA 2K6AA 2O4XA 4HMJA 1RODA 1TS3A 4HIDA 2K05A 2ZXPA 4KKUA 2WP8J 1I6HB 5K36G 3PF4A 1IYUA 1QVCA 2VNUD 4IJLA 1HNWL 1DM0B 3OW7A 4DK3C 2EJFC 2N49A 3A7AB 2BCOA 4M1UB 5BR8Q 2L9HA 2JA8B 5IT9E 1BKBA 1IYVA 4DV6L 1B44D 5M5XH 5C4ZA 2SDFA 5IP9H 3GTKH 5EKKA 3WOFA 1ONLA 2CH4A 2TSSA 3HOXG 3MXPA 2F4IA 2LFNA 4OO1H 3OPOA 2WB1E 1SJED 2FJ2A 1KL9A 1SE3A 1F2LA 2R7FA 4CKCA 3NK9A 4DR5L 1WCMH 4OIJA 3CCMA 4YY3Q 1XMQQ 1DD2A 1F2YA 4HJ9A 1VQ8A 2EY1A 5C6AA 1TIID 4JG2A 1DOLA 5CV7A 5JJIA 1BBXC 1D5MC 3UDGA 3MXGA 4MHEA 2CHBD 4X64Q 2A68D 3H3VH 2JA5B 1SJHD 5EKIA 3I8ZA 4G7OC 4HJ7A 3R93A 3CCVA 4K6LA 1GHKA 2EOTA 3NWSA 2XSCA 1STEA 5CORA 1QCBD 2DNCA 1KXLA 2PPBC 3NQTA 4AYBE 3EA6A 4A3CG 1I6VC 2M9VA 1MKHA 1X55A 1HTLD 2K5DA 3HFZB 1NR4A 3TMEA 5AJ3Q 2X6LA 3EQLC 1TWAB 2Q2TA 1HXYD 3W3AA 4FF2A 1SYBA 1RD9D 1FGBD 2WACA 2H5XA 4DF7A 4A75A 3F2BA 3RN2A 4A3EB 4MTKA 1QUQA 2K50A 3CCJA 3M7GA 4C56C 5I2YA 2EYMA 4L5TA 1NCVA 4C3JB 1VQKA 1JE4A 4JBWA 2BOSA 3MAQA 1A3TA 4DUYQ 2R6GA 4B3SQ 2RDFA 3S16H 2JA6B 5EBCA 1EIGA 3D4WA 3W5OA 3BS1A 4BBRG 1LT5D 4CKEA 1LLRD 3Q24A 3HP3A 2NTSA 4DR3L 3NQIA 3T4AC 5I2XA 1BO0A 2R7DA 3NP8A 1HNWQ 1PYSB 2K7VA 1ILPA 4K2LA 1N9WA 2B2TC 5C4JH 2J7ZA 1U5KA 4LF4L 1VQDA 1AE2A 4ZQ3A 3MXNB 1DYQA 4DV6Q 4NPSA 1RDPD 3HOYB 5IYCG 4WORA 1KQSA 1D1KA 2HIXA 1VQGA 4JI0L 2HDMA 2K1BA 2QILA 4KHPQ 2K04A 4GN5A 3OW2A 1BNZA 3LGJA 4GKKQ 5I6WA 2EXDA 2UXBL 5ELFA 4DR5Q 1WTQA 4B3TL 1CHPD 3DWPA 1R9TH 5D65A 4ULLA 4RGOS 1D6EC 4P72A 2F0UA 2IX0A 3J81j 5IYDG 1PTOF 5KGUA 4QQBX 2K5NA 1Q86C 2F0HA 4IUTA 4B9WA 1WTVA 1KABA 2BE5C 1G2TA 2Z1CA 5C4XG 2JQOA 3K5MA 2PI2A 4X3TA 5C3EG 1TWCB 3LX0A 3A54A 1V1OA 2AWNA 2B2UC 1RF2D 3ULLA 1BCPC 2WAQE 3KDFB 3NTKA 1X3QA 3MEFA 3W1GA 1IKLA 1I3QB 5ELEA 1EZ8A 1PTOB 4OWTB 2M2LA 1KHIA 2ZTCA 3BZCA 3BDLA 4PQXA 3TP7A 1XNRL 1JOKA 5CV5A 2B2YA 5K36H 4R4TA 1JCKB 1W6KA 1YZ6A 4DN4M 1ICFB 1DOKA 2UUAQ 4A3GG 2EVBA 4K8JA 4POFA 1N36L 1LTAD 2UUCL 2I5HA 3K7UC 3CQZH 1HNZL 4DR3Q 4Y7NH 5E4XA 3STBD 1PV4A 4X3UA 3EVQA 3BZDB 4UHVA 2GVAA 1EQVA 3CU7A 4OELB 2Z9HA 4L5QA 2HD3A 3OWFA 4LF4Q 1MJEA 2K5VA 3DMUA 5E7NA 1Y8OB 1Y69U 4OIKA 3KFUA 1E22A 3KUPA 1DZ1A 2XGTA 3A55A 1TWGH 4JI0Q 4OO1I 3CPFA 3MXUA 3S24A 2R7ZB 4PZ6A 4JW0A 2Q8RE 4XQJA 2IL8A 5GAGC 3J80i 3OTOL 1AP0A 4B3TQ 4LK1C 4P75A 2IY5B 4A3CH 1SDFA 1IKMA 3AQQA 4RH6A 3U9OA 4J6HA 4LUVA 3NHHA 2L4NA 4DA2A 1PH1A 3X3MA 3DEOA 2N55A 1X65A 4N9PA 2LXJA 2EYFA 1OXVA 4XYQA 2Q2HA 3O13A 4HJ5A 1B9NA 1PRTF 1FYCA 4C2MH 2MP1A 1H9SA 1CKMA 3BJUA 5CV6A 5GQOA 3CF5A 5IYBG 1XNQL 4MZ9A 1QOHA 2R3ZA 2IHFA 4KK7A 4LMQD 5JPNC 2PQEA 1HQRD 3V05A 3VYSA 2H1EA 3GTGH 1QUQB 1ZKOA 1EQQA 1ML0D 3ER0A 3UDFA 4IFDI 1K73C 4QF4A 4UDUC 4RFBA 5K5PA 5IT9c 2CH4W 5C44G 1D7QA 2KVMA 4R4QA 1XNRQ 4BBRH 4GOPA 1BBWA 1LTID 3E9IA 5ELCA 2JJQA 3S15H 3HOVB 4ZLTF 1N36Q 1KTKA 4PG3A 4A3BB 3GV3A 4PMBA 5J22A 2QCPX 1IBKL 1C7YA 2E8GA 1HNZQ 3SVMA 2RHSB 2JA7G 4RHRA 1Z7TA 1EYDA 1TY2A 1IZ6A 4N8X1 5IYCH 3D4RA 3I72A 3QWNA 4IUPA 1EYGA 3G4SA 3GTPH 3HOUH 3S14B 1EQTA 2YTYA 4PNYA 5AFWA 4XT3B 1QILA 3K5OA 5A2QL 4A3DB 4FXGC 4QL5A 1SMYD 2QDBA 3CCQA 2NTTA 4GN3B 3BVMA 2F52A 2GN5A 3QOLA 1CZWA 3SDZA 5JJKA 5I4DA 3A56A 1H9MA 1EUJA 1UNSA 1VQAA 2CQOA 2D62A 4DV0L 2PMZB 4X65L 3M3YB 2A6EC 3OTOQ 1SE2A 2E2HH 3AB9A 4KV6A 1B9MA 1SMXA 1U4LA 2CW0C 5C4XH 2E2IH 1GHJA 2L5TA 2DGYA 5C3EH 3EBEA 5HGQA 5JJLA 1F77A 3S2DB 2UXCL 2FMCA 2EE1A 5FLMG 1PHJA 4FVMA 4XQNA 3URYA 1N34L 3VR2A 4FYDA 1I50B 5F2DA 3H0GG 1QNUA 5IGBA 1PZID 4JC0A 1E24A 2ALYB 3P7JA 1DJRD 1OXUA 3DUZA 3VR4A 3D6CA 4BXXG 3A5ZB 3D6WA 1F9QA 2JSOA 4B3RL 1A63A 3QO2A 1XNQQ 2B2WC 2HIVA 2IWHA 1Q82C 4L63B 1O7ZA 1X6OA 1TT2A 1Y8NB 4JI5L 1PTOD 3ONAB 2CWAA 4OXPA 4A3GH 4DFAA 1Y1VB 1JORA 2RA4A 4TRDA 3VR3A 2KUMA 2LY7A 1WCMG 1SNPA 5LMNW 1U0LA 3MFYA 4DXFA 1T9HA 1E0BA 1QZHA 1TXYA 4G7HC 1A8VA 2IT1A 4O2DA 2VW9A 3HKZE 4S3SA 3T16A 1STNA 1XXGA 2DNEA 4IPDA 3HKZG 4LF7L 3GTQH 3Q0AA 2VL6A 2D0PA 4HTHA 2VUMB 2NWGA 4E6IA 2G9DA 2B2TA 2ZJRA 3L9AX 5JEAJ 4X62L 3LWEA 4H7BA 4IOAA 2C5CA 5C4HA 1W2BA 4CJ2C 3CCEA 4L8JA 4QB4A 4DXGA 1H9JA 2A69D 3M4OH 1C4QA 3SK4A 4NDXA 2NYZD 1SN8A 3TZUA 1W6JA 1S5DD 1JOOA 2D2CC 4RMFA 4DV0Q 4X65Q 2NVTB 5LHY1 1AE3A 3C1FA 3A5UA
chains in the Genus database with same CATH topology
2HT1A 4DUZQ 1KL9A 2OQ0A 2R7FA 4AIMA 1VQ6A 4JI1Q 4DR5L 2RCNA 1WCMH 1S3OA 3CCMA 4YY3Q 1XMQQ 4HJ9A 3GDEA 1VQ8A 2WAQG 2WFWA 1SLJA 3RR5A 1NMFA 3G6EA 4JG2A 2UXCQ 1I3QH 5JJIA 1OTCA 1PFSA 4JI2Q 5IYBH 3UDGA 1PH2A 3GTOH 4DV3L 1YHAA 4X64Q 3H3VH 4X66L 2ZTEA 1E3PA 3RN5A 1FVIA 3CCVA 4HJ7A 2OCEA 3HOWG 4YHHQ 4HIOA 2Y0SG 4POGA 3CW2C 3M85A 2AMCB 1NBWA 4GN4B 5LMNQ 2F4VL 2IX1A 1KXLA 3WWVA 3UE0A 4AYBE 1V1QA 3DM3A 3J7ZC 2RHQB 1HJPA 4A3CG 1MKHA 4WJ4A 5C44H 1X55A 1Q1EA 3A74A 1UE5A 2I0QA 1WYDA 2MNAA 3GTJH 1GD7A 4YCWA 5IY0A 1K3RA 3GO5A 3HFZB 1J5EQ 3CCLA 1YJ9A 2EIFA 2YTVA 5AJ3Q 1Y1VG 2HQLA 2N8NA 4KLKA 4A3LG 4AQYL 2Q2TA 4DR1Q 4GOPB 4JI5Q 4A93G 2UXDQ 5IWAL 2H5XA 1K8AC 5GROA 4A75A 3F2BA 3RN2A 1UE7A 2Z6KC 4A3IH 3PO3G 4JI4Q 4GNXC 1QUQA 2K50A 3CCJA 1HH2P 4UP8A 4L5TA 4LUZA 2B63G 2JA7H 4DR4Q 3HOXH 1G51A 2DUDA 3D0FA 3Q8DA 5J3BA 4DV5Q 1JMCA 1VQKA 4TQUS 1YJWA 4JBWA 2YV5A 1FJGL 2KCMA 1X3FA 1L1OC 1YBYA 4LFAL 1L0WA 3RNUA 4DUYQ 2R6GA 4B3SQ 4A3KH 2JEBI 4UP9A 2VQEQ 2VUMG 4JBMA 1I94L 4IJHA 3S16H 5C0XJ 3G48A 1WFQA 3NENA 3W5OA 4LF8L 4BBRG 1CKNA 2UUBQ 4LF7Q 3L7ZC 4JI8Q 3PF5A 2R7ZH 4DR3L 1V43A 2VQFQ 4JI7L 1J6QA 3UE1A 4QGUA 3AEVA 4JYAQ 2OTJA 3KF8B 4YCVA 2NVYH 2R7DA 1JJ2A 5FLXc 1HNWQ 1PYSB 3KF6A 3K80C 5IP7G 3AYHB 4H02A 4JI6Q 3TRZA 3I4MG 1NMGA 3HOWH 3PIPA 1IBLL 1N9WA 1P16A 5C4JH 4IFDJ 1X56A 1GVPA 1U5KA 4LF4L 1VQDA 1AE2A 1YVCA 4DV2L 4L5RC 2ATWA 1C0AA 1EWIA 4O0AA 3F2DA 3CAMA 2NVXH 1Z47A 3EIVA 3MXNB 3ULPA 3SGIA 4DV6Q 4NPSA 1HR0L 2ZJPA 5IYCG 1WI5A 1V9PA 1KQSA 3NEMA 2K52A 2HIXA 1Q81C 1IBKQ 1VQGA 1BBUA 4R4CA 4JI0L 5FLMH 4UPAA 3CC2A 1N32L 1X9NA 4KHPQ 1Y1WG 4FDBA 4GN5A 3M9BA 4TVAB 2JA9A 3OW2A 2VY3A 4NXNL 3LGJA 4GKKQ 1VQ7A 4A3FH 2EXDA 3H0GH 4APVA 2UXBL 2NZOA 4DR5Q 2LXKA 3TREA 4B3TL 1IYJB 3I56A 1FGUA 1R9TH 1LYLA 5GADC 4BXXH 2PMZE 4P72A 5M3MG 4BBSH 2EQSA 2IX0A 3J81j 1EFWA 5IYDG 1XMOQ 1VCIA 2K5NA 1HR0W 4QQBX 1Q86C 3PUWA 4DV3Q 4X66Q 1PH8A 4BY1G 2MQHA 1HZAA 2FXQA 4WJ3M 1Q12A 1VQBA 1Q7YC 4LF5L 5C4XG 3PO2H 2JQOA 1X3GA 3GTMH 2PI2A 3HKSA 4A3MG 4JI3L 3IRBA 3F2CA 2HHHL 2B3GA 3U50C 5C3EG 2PI2E 2OTLA 4LF9L 2UU9L 1KRTA 1N33L 2AWNA 5FJ8H 3HOVH 3ULLA 2WAQE 3KDFB 1SR3A 4GNXB 4UP7A 1QZGA 3MEFA 1C9OA 4A3EG 4A3BH 4LFBL 3W1GA 4AQYQ 1BVSA 4RG1A 2JEAI 4IFDG 4P73A 2ZTDA 3TEHB 3L0OA 1YHQA 1N34Q 2A19A 4C3IH 4OWTB 5IWAQ 1PH9A 5DLQE 1PH4A 3J81i 1E7ZA 4DV1L 1KHIA 2ZTCA 2Y0SE 1L1OB 1YJNA 3BZCA 2A1AA 4DAMA 3CCUA 4PZ7A 5GAHC 2R92G 3CD6A 3I55A 1CKOA 1XNRL 2CWPA 3S14H 3B6YA 2QEXA 3AFPA 4LF6Q 4DR7L 4DV7L 4R4TA 1TWFH 3H15A 1QVFA 1VQEA 3KJPA 1XPRA 1HNXL 3M7NA 3S2HH 1YZ6A 4MTNA 2JA6G 2R93G 1GO3E 1B8AA 4QJFA 3FP9A 5BR8L 2UUAQ 1FJGQ 4A3DH 1VQOA 4B3RQ 4LFAQ 1CUKA 1GKHA 4A3GG 5JEAG 1S40A 1I94Q 1UWVA 4POFA 1JB7A 4NXML 4KHZA 1N36L 2PNHA 1AH9A 1Q1BA 3PV0A 4DPGA 4LF8Q 2UUCL 2MO0A 2ZJQA 3FKIG 2I5HA 3K7UC 3CQZH 5HY6A 4DR3Q 4Y7NH 3PUYA 1HNZL 4JV5Q 5IYDH 4JI7Q 1K8GA 1PYBA 3KLWA 3STBD 4GLAC 1PV4A 3M3YH 2ID0A 3S1NH 1DGSA 4BY1H 2AKWB 2GVAA 1IBLQ 5M3FG 1I5FA 1TWHH 1NY4A 2D0OA 3PO2G 4L5QA 3HOYG 1YNXA 1WOCA 2PQAB 3CXCA 1W3SA 1VQ5A 4LF4Q 1MJEA 2K5VA 4DV2Q 3S2DH 3UDXA 2KENA 3ERSX 5E7NA 4JCVE 4DR2L 2KHIA 3OYYA 3HOZG 1HR0Q 1MIUA 3UDIA 3KFUA 4X64L 1E22A 1I50H 3S1QH 2XGTA 2KBNA 1TWGH 4JI0Q 4OO1I 3U4VA 1N32Q 3CPFA 1RL2A 4YHHL 3I4NG 3S24A 4PZ6A 3RLOA 1VQCA 4J15A 4NXNQ 5LMNL 5GAGC 4LWCA 3VDYA 3J80i 3OTOL 1Z9FA 4X62Q 2JA8G 1KIXA 4BA1I 4BA2I 4XTCS 1KC8C 4LFCL 4B3TQ 4P75A 2I5LX 2BH2A 4MNOA 4K0KL 2IY5B 2C35B 5IP9G 1N8RC 4GS3A 2R93H 4A3CH 3S1RH 3AQQA 4LUVA 3TS2A 4HIMA 4L5SA 1PH1A 3DLLA 3ZJYC 2UXDL 1X65A 4C3HH 2XTIA 1YIJA 4NB3A 1G291 4OO1G 2F3IA 1Y1VH 4A3LH 3HOUG 2LXJA 1OXVA 2E5LL 2Q2HA 4AH6A 4JI3Q 1OXTA 4A93H 3KJOA 4GKJL 2HHHQ 3NELA 2MO1A 4HJ5A 3K81C 1IBML 2MFIA 5C0XI 1VQMA 1D8LA 4KI0A 1VQ4A 2UU9Q 5GAEC 1XPOA 4LF9Q 4C2MH 1N33Q 3PO3H 3F1ZA 1CKMA 3BJUA 5GQOA 1HZBA 4XIGS 3TQYA 3CF5A 5IYBG 1XNQL 2B63H 2JA5G 4MZ9A 3PUVA 4DUYL 3T1HL 1KD1C 2Q2UA 2IHFA 4OX9L 4YCUA 4IO9A 1IXRA 1VQLA 3PIOA 1YITA 3GTGH 2IHEA 1LM0A 1QUQB 1UE6A 1OXSC 2AWOA 4OWXB 3ER0A 1EQQA 3UDFA 4IFDI 4GLVB 1I6HH 1K73C 1P8LA 1WJJA 2VUMH 1NE3A 4P74A 5IT9c 3PSIA 3J81c 2E2JH 2JE6I 5C44G 4A76A 1D7QA 1YHBA 4R4QA 1XNRQ 4BBRH 4GOPA 2YYZA 1BBWA 5ELOA 5C0XG 2F4VQ 4DR7Q 3T1YL 4HIKA 1HNXQ 3E9IA 4LW1A 4IOCA 2Z0SA 5IP7H 1K83H 1EIFA 1YEZA 5EAYA 2V1CC 2JA8H 1CKNB 3I4MH 2JJQA 2B29A 3S15H 2BA1A 4OONA 1PH5A 3S17H 1JJCB 1Q46A 3KOJA 4NXMQ 2PQAA 1N36Q 4PG3A 1UEBA 4A3IG 1XJVA 3KF6B 1KRSA 4JBKA 1B7YB 1A62A 2BH8A 1IBKL 2E8GA 4YWMA 1C7YA 1HNZQ 3CC4A 4DR6L 2RHSB 2JA7G 2NVTH 2RF4A 4KHPL 3TS0A 2N3SA 4GLXA 1IZ6A 5IYCH 3PGZA 1A0IA 1XPUA 4PZ8A 1M1KC 3G4SA 1EYGA 1E1TA 3GTPH 4GKKL 3U4ZA 3HOUH 3S1MH 2WB1G 3U58A 1Y1WH 2YTYA 3CP0A 4JBJA 4A3KG 5LMUL 3JC66 3PCOB 1VQJA 1HZ9A 3PUXA 1CSPA 4R4IA 4JOIA 4DR2Q 2QA4A 2NN6I 2NZHA 4BY7G 1VS0A 4QL5A 3STBC 3CCQA 4GN3B 2R7ZG 4DV4L 2F52A 2GN5A 1EOVA 1XMOL 2JA5H 3CMAA 1PH7A 3ICEA 5JJKA 1FL0A 3JAMi 5M3MH 4B3ML 1CSQA 1EUJA 1H95A 3CCRA 1UE1A 1VQAA 3L2PA 1JJGA 2CQOA 4IPCA 2D62A 4DV0L 4OWWB 4X65L 2N78A 2ZM6L 2KHJA 1IL2A 2ASBA 4X6AH 1Q8KA 3OTOQ 2E2HH 4DUZL 4AYBG 3J80c 2K5HA 4LFCQ 5C4XH 1SMXA 4JI1L 2E2IH 4A3MH 1SROA 3RLNA 3RLFA 4YY3L 4EX5A 4A3JG 1XMQL 2DGYA 1SFOH 1PH3A 2OWOA 4K0KQ 2NN6G 5C3EH 2VS1A 3EBEA 5HGQA 5JJLA 5H1SE 1TWAH 2YU9H 2UXCL 1PHJA 5FLMG 3FHWA 5M5WH 1HZCA 3E9HA 1LTLA 4R1JA 3CMEA 1O7IA 1N34L 4JI2L 3EN2A 1VQNA 2BA0A 4QY7A 1M90C 4A3EH 1NJIC 3A0JA 4A3FG 3H0GG 1S72A 4JC0A 2E5LQ 4UY8C 4DK6C 1E24A 2ALYB 4GKJQ 4PMWA 1MJCA 3CPWA 4Y52H 4YWKA 1IBMQ 1OXUA 4C3JH 4LF6L 2CKZB 1Y14B 4IPHA 3J7A5 4BXXG 2UXBQ 5M5YH 2R92H 3A5ZB 4P71A 1EQRA 4BBSG 4B3RL 1KAWA 1RIPA 2UUAL 1A63A 3AFQA 1XNQQ 2HIVA 1J5EL 1G6PA 4ME3A 3T1HQ 4OX9Q 3M4QA 4HJ8A 2L15A 2JA6H 3KYHC 5AJ3L 1Q82C 3H3VI 2LSSA 1SRUA 1X6OA 2K75A 4DR1L 4BY7H 1E1OA 2K4KA 3I2ZA 1EIYB 1B70B 4JI5L 4JV5L 3KDFA 2CWAA 2Z6KA 3NBHB 4OXPA 4A3GH 4GNXA 4HJAA 1GM5A 4LF5Q 2YTXA 2I5MX 4JI4L 1VQFA 1WCMG 3FKIH 5FJ8G 4EQ5A 3HOVG 1LUZA 3T1YQ 5LMNW 4DR4L 1U0LA 2KCTA 3RZOH 2K14A 3E0EA 1T9HA 4GOPC 1VQHA 4A3BG 4DV5L 1QZHA 1TXYA 1L1OA 1A8VA 3BZKA 3K8AA 3M4PA 2CFMA 2IT1A 3K7AH 4O2DA 3GD7A 4A4IA 1YI2A 3RZDH 1PA6A 4LUOA 5M3FH 2AHOB 5ELNA 4B3SL 2VW9A 3HOYH 4A3JH 2QGQA 1K0RA 1K9MC 4QIWE 2VQEL 4LFBQ 3HKZE 1NTGA 1OXXK 4YWLA 3CCSA 1ASZA 2A8VA 4IPDA 3HKZG 4DR6Q 3I4OA 3I7FA 4HIDA 2UUBL 4LF7L 3W1BA 4DAYB 4JI8L 3CC7A 3GTQH 2WP8J 2JK8A 3GTLH 2CCZA 3HOZH 2VQFL 2ES2A 5K36G 1X3EA 2VL6A 2D0PA 1XTDA 4DV1Q 4JYAL 4LNQA 3PF4A 1ASYA 2VNUD 1QVCA 2ZJRA 4IJLA 4R4OA 4A3DG 1HNWL 5JEAJ 4DK3C 4JI6L 4X62L 1SE8A 4IOAA 3I4NH 4DV7Q 5LMUQ 1W2BA 2OQKA 2N49A 3ULJA 1QVGA 3BU2A 3PUZA 5BR8Q 4DKAC 3CCEA 1JT8A 1PVOA 3G71A 1BKBA 2Q2IA 4IPGA 4JOIC 4DV4Q 4DV6L 5M5XH 3M4OH 3K0XA 5IP9H 3GTKH 3F8TA 2UUCQ 4B3MQ 1SN8A 3D31A 5IE8A 1VQPA 1PH6A 3JAMc 2VZAA 1L2FA 4ALPA 3HOXG 1VQIA 4DV0Q 4RMFA 2NVQH 1X54A 4X65Q 2ZM6Q 1JE5A 1VQ9A 2GVBA 1AE3A 3A5UA 1TWCH 2WB1E 4DNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HT1 A;  4DUZ Q;  1KL9 A;  2OQ0 A;  2R7F A;  4AIM A;  1VQ6 A;  4JI1 Q;  4DR5 L;  2RCN A;  1WCM H;  1S3O A;  3CCM A;  4YY3 Q;  1XMQ Q;  4HJ9 A;  3GDE A;  1VQ8 A;  2WAQ G;  2WFW A;  1SLJ A;  3RR5 A;  1NMF A;  3G6E A;  4JG2 A;  2UXC Q;  1I3Q H;  5JJI A;  1OTC A;  1PFS A;  4JI2 Q;  5IYB H;  3UDG A;  1PH2 A;  3GTO H;  4DV3 L;  1YHA A;  4X64 Q;  3H3V H;  4X66 L;  2ZTE A;  1E3P A;  3RN5 A;  1FVI A;  3CCV A;  4HJ7 A;  2OCE A;  3HOW G;  4YHH Q;  4HIO A;  2Y0S G;  4POG A;  3CW2 C;  3M85 A;  2AMC B;  1NBW A;  4GN4 B;  5LMN Q;  2F4V L;  2IX1 A;  1KXL A;  3WWV A;  3UE0 A;  4AYB E;  1V1Q A;  3DM3 A;  3J7Z C;  2RHQ B;  1HJP A;  4A3C G;  1MKH A;  4WJ4 A;  5C44 H;  1X55 A;  1Q1E A;  3A74 A;  1UE5 A;  2I0Q A;  1WYD A;  2MNA A;  3GTJ H;  1GD7 A;  4YCW A;  5IY0 A;  1K3R A;  3GO5 A;  3HFZ B;  1J5E Q;  3CCL A;  1YJ9 A;  2EIF A;  2YTV A;  5AJ3 Q;  1Y1V G;  2HQL A;  2N8N A;  4KLK A;  4A3L G;  4AQY L;  2Q2T A;  4DR1 Q;  4GOP B;  4JI5 Q;  4A93 G;  2UXD Q;  5IWA L;  2H5X A;  1K8A C;  5GRO A;  4A75 A;  3F2B A;  3RN2 A;  1UE7 A;  2Z6K C;  4A3I H;  3PO3 G;  4JI4 Q;  4GNX C;  1QUQ A;  2K50 A;  3CCJ A;  1HH2 P;  4UP8 A;  4L5T A;  4LUZ A;  2B63 G;  2JA7 H;  4DR4 Q;  3HOX H;  1G51 A;  2DUD A;  3D0F A;  3Q8D A;  5J3B A;  4DV5 Q;  1JMC A;  1VQK A;  4TQU S;  1YJW A;  4JBW A;  2YV5 A;  1FJG L;  2KCM A;  1X3F A;  1L1O C;  1YBY A;  4LFA L;  1L0W A;  3RNU A;  4DUY Q;  2R6G A;  4B3S Q;  4A3K H;  2JEB I;  4UP9 A;  2VQE Q;  2VUM G;  4JBM A;  1I94 L;  4IJH A;  3S16 H;  5C0X J;  3G48 A;  1WFQ A;  3NEN A;  3W5O A;  4LF8 L;  4BBR G;  1CKN A;  2UUB Q;  4LF7 Q;  3L7Z C;  4JI8 Q;  3PF5 A;  2R7Z H;  4DR3 L;  1V43 A;  2VQF Q;  4JI7 L;  1J6Q A;  3UE1 A;  4QGU A;  3AEV A;  4JYA Q;  2OTJ A;  3KF8 B;  4YCV A;  2NVY H;  2R7D A;  1JJ2 A;  5FLX c;  1HNW Q;  1PYS B;  3KF6 A;  3K80 C;  5IP7 G;  3AYH B;  4H02 A;  4JI6 Q;  3TRZ A;  3I4M G;  1NMG A;  3HOW H;  3PIP A;  1IBL L;  1N9W A;  1P16 A;  5C4J H;  4IFD J;  1X56 A;  1GVP A;  1U5K A;  4LF4 L;  1VQD A;  1AE2 A;  1YVC A;  4DV2 L;  4L5R C;  2ATW A;  1C0A A;  1EWI A;  4O0A A;  3F2D A;  3CAM A;  2NVX H;  1Z47 A;  3EIV A;  3MXN B;  3ULP A;  3SGI A;  4DV6 Q;  4NPS A;  1HR0 L;  2ZJP A;  5IYC G;  1WI5 A;  1V9P A;  1KQS A;  3NEM A;  2K52 A;  2HIX A;  1Q81 C;  1IBK Q;  1VQG A;  1BBU A;  4R4C A;  4JI0 L;  5FLM H;  4UPA A;  3CC2 A;  1N32 L;  1X9N A;  4KHP Q;  1Y1W G;  4FDB A;  4GN5 A;  3M9B A;  4TVA B;  2JA9 A;  3OW2 A;  2VY3 A;  4NXN L;  3LGJ A;  4GKK Q;  1VQ7 A;  4A3F H;  2EXD A;  3H0G H;  4APV A;  2UXB L;  2NZO A;  4DR5 Q;  2LXK A;  3TRE A;  4B3T L;  1IYJ B;  3I56 A;  1FGU A;  1R9T H;  1LYL A;  5GAD C;  4BXX H;  2PMZ E;  4P72 A;  5M3M G;  4BBS H;  2EQS A;  2IX0 A;  3J81 j;  1EFW A;  5IYD G;  1XMO Q;  1VCI A;  2K5N A;  1HR0 W;  4QQB X;  1Q86 C;  3PUW A;  4DV3 Q;  4X66 Q;  1PH8 A;  4BY1 G;  2MQH A;  1HZA A;  2FXQ A;  4WJ3 M;  1Q12 A;  1VQB A;  1Q7Y C;  4LF5 L;  5C4X G;  3PO2 H;  2JQO A;  1X3G A;  3GTM H;  2PI2 A;  3HKS A;  4A3M G;  4JI3 L;  3IRB A;  3F2C A;  2HHH L;  2B3G A;  3U50 C;  5C3E G;  2PI2 E;  2OTL A;  4LF9 L;  2UU9 L;  1KRT A;  1N33 L;  2AWN A;  5FJ8 H;  3HOV H;  3ULL A;  2WAQ E;  3KDF B;  1SR3 A;  4GNX B;  4UP7 A;  1QZG A;  3MEF A;  1C9O A;  4A3E G;  4A3B H;  4LFB L;  3W1G A;  4AQY Q;  1BVS A;  4RG1 A;  2JEA I;  4IFD G;  4P73 A;  2ZTD A;  3TEH B;  3L0O A;  1YHQ A;  1N34 Q;  2A19 A;  4C3I H;  4OWT B;  5IWA Q;  1PH9 A;  5DLQ E;  1PH4 A;  3J81 i;  1E7Z A;  4DV1 L;  1KHI A;  2ZTC A;  2Y0S E;  1L1O B;  1YJN A;  3BZC A;  2A1A A;  4DAM A;  3CCU A;  4PZ7 A;  5GAH C;  2R92 G;  3CD6 A;  3I55 A;  1CKO A;  1XNR L;  2CWP A;  3S14 H;  3B6Y A;  2QEX A;  3AFP A;  4LF6 Q;  4DR7 L;  4DV7 L;  4R4T A;  1TWF H;  3H15 A;  1QVF A;  1VQE A;  3KJP A;  1XPR A;  1HNX L;  3M7N A;  3S2H H;  1YZ6 A;  4MTN A;  2JA6 G;  2R93 G;  1GO3 E;  1B8A A;  4QJF A;  3FP9 A;  5BR8 L;  2UUA Q;  1FJG Q;  4A3D H;  1VQO A;  4B3R Q;  4LFA Q;  1CUK A;  1GKH A;  4A3G G;  5JEA G;  1S40 A;  1I94 Q;  1UWV A;  4POF A;  1JB7 A;  4NXM L;  4KHZ A;  1N36 L;  2PNH A;  1AH9 A;  1Q1B A;  3PV0 A;  4DPG A;  4LF8 Q;  2UUC L;  2MO0 A;  2ZJQ A;  3FKI G;  2I5H A;  3K7U C;  3CQZ H;  5HY6 A;  4DR3 Q;  4Y7N H;  3PUY A;  1HNZ L;  4JV5 Q;  5IYD H;  4JI7 Q;  1K8G A;  1PYB A;  3KLW A;  3STB D;  4GLA C;  1PV4 A;  3M3Y H;  2ID0 A;  3S1N H;  1DGS A;  4BY1 H;  2AKW B;  2GVA A;  1IBL Q;  5M3F G;  1I5F A;  1TWH H;  1NY4 A;  2D0O A;  3PO2 G;  4L5Q A;  3HOY G;  1YNX A;  1WOC A;  2PQA B;  3CXC A;  1W3S A;  1VQ5 A;  4LF4 Q;  1MJE A;  2K5V A;  4DV2 Q;  3S2D H;  3UDX A;  2KEN A;  3ERS X;  5E7N A;  4JCV E;  4DR2 L;  2KHI A;  3OYY A;  3HOZ G;  1HR0 Q;  1MIU A;  3UDI A;  3KFU A;  4X64 L;  1E22 A;  1I50 H;  3S1Q H;  2XGT A;  2KBN A;  1TWG H;  4JI0 Q;  4OO1 I;  3U4V A;  1N32 Q;  3CPF A;  1RL2 A;  4YHH L;  3I4N G;  3S24 A;  4PZ6 A;  3RLO A;  1VQC A;  4J15 A;  4NXN Q;  5LMN L;  5GAG C;  4LWC A;  3VDY A;  3J80 i;  3OTO L;  1Z9F A;  4X62 Q;  2JA8 G;  1KIX A;  4BA1 I;  4BA2 I;  4XTC S;  1KC8 C;  4LFC L;  4B3T Q;  4P75 A;  2I5L X;  2BH2 A;  4MNO A;  4K0K L;  2IY5 B;  2C35 B;  5IP9 G;  1N8R C;  4GS3 A;  2R93 H;  4A3C H;  3S1R H;  3AQQ A;  4LUV A;  3TS2 A;  4HIM A;  4L5S A;  1PH1 A;  3DLL A;  3ZJY C;  2UXD L;  1X65 A;  4C3H H;  2XTI A;  1YIJ A;  4NB3 A;  1G29 1;  4OO1 G;  2F3I A;  1Y1V H;  4A3L H;  3HOU G;  2LXJ A;  1OXV A;  2E5L L;  2Q2H A;  4AH6 A;  4JI3 Q;  1OXT A;  4A93 H;  3KJO A;  4GKJ L;  2HHH Q;  3NEL A;  2MO1 A;  4HJ5 A;  3K81 C;  1IBM L;  2MFI A;  5C0X I;  1VQM A;  1D8L A;  4KI0 A;  1VQ4 A;  2UU9 Q;  5GAE C;  1XPO A;  4LF9 Q;  4C2M H;  1N33 Q;  3PO3 H;  3F1Z A;  1CKM A;  3BJU A;  5GQO A;  1HZB A;  4XIG S;  3TQY A;  3CF5 A;  5IYB G;  1XNQ L;  2B63 H;  2JA5 G;  4MZ9 A;  3PUV A;  4DUY L;  3T1H L;  1KD1 C;  2Q2U A;  2IHF A;  4OX9 L;  4YCU A;  4IO9 A;  1IXR A;  1VQL A;  3PIO A;  1YIT A;  3GTG H;  2IHE A;  1LM0 A;  1QUQ B;  1UE6 A;  1OXS C;  2AWO A;  4OWX B;  3ER0 A;  1EQQ A;  3UDF A;  4IFD I;  4GLV B;  1I6H H;  1K73 C;  1P8L A;  1WJJ A;  2VUM H;  1NE3 A;  4P74 A;  5IT9 c;  3PSI A;  3J81 c;  2E2J H;  2JE6 I;  5C44 G;  4A76 A;  1D7Q A;  1YHB A;  4R4Q A;  1XNR Q;  4BBR H;  4GOP A;  2YYZ A;  1BBW A;  5ELO A;  5C0X G;  2F4V Q;  4DR7 Q;  3T1Y L;  4HIK A;  1HNX Q;  3E9I A;  4LW1 A;  4IOC A;  2Z0S A;  5IP7 H;  1K83 H;  1EIF A;  1YEZ A;  5EAY A;  2V1C C;  2JA8 H;  1CKN B;  3I4M H;  2JJQ A;  2B29 A;  3S15 H;  2BA1 A;  4OON A;  1PH5 A;  3S17 H;  1JJC B;  1Q46 A;  3KOJ A;  4NXM Q;  2PQA A;  1N36 Q;  4PG3 A;  1UEB A;  4A3I G;  1XJV A;  3KF6 B;  1KRS A;  4JBK A;  1B7Y B;  1A62 A;  2BH8 A;  1IBK L;  2E8G A;  4YWM A;  1C7Y A;  1HNZ Q;  3CC4 A;  4DR6 L;  2RHS B;  2JA7 G;  2NVT H;  2RF4 A;  4KHP L;  3TS0 A;  2N3S A;  4GLX A;  1IZ6 A;  5IYC H;  3PGZ A;  1A0I A;  1XPU A;  4PZ8 A;  1M1K C;  3G4S A;  1EYG A;  1E1T A;  3GTP H;  4GKK L;  3U4Z A;  3HOU H;  3S1M H;  2WB1 G;  3U58 A;  1Y1W H;  2YTY A;  3CP0 A;  4JBJ A;  4A3K G;  5LMU L;  3JC6 6;  3PCO B;  1VQJ A;  1HZ9 A;  3PUX A;  1CSP A;  4R4I A;  4JOI A;  4DR2 Q;  2QA4 A;  2NN6 I;  2NZH A;  4BY7 G;  1VS0 A;  4QL5 A;  3STB C;  3CCQ A;  4GN3 B;  2R7Z G;  4DV4 L;  2F52 A;  2GN5 A;  1EOV A;  1XMO L;  2JA5 H;  3CMA A;  1PH7 A;  3ICE A;  5JJK A;  1FL0 A;  3JAM i;  5M3M H;  4B3M L;  1CSQ A;  1EUJ A;  1H95 A;  3CCR A;  1UE1 A;  1VQA A;  3L2P A;  1JJG A;  2CQO A;  4IPC A;  2D62 A;  4DV0 L;  4OWW B;  4X65 L;  2N78 A;  2ZM6 L;  2KHJ A;  1IL2 A;  2ASB A;  4X6A H;  1Q8K A;  3OTO Q;  2E2H H;  4DUZ L;  4AYB G;  3J80 c;  2K5H A;  4LFC Q;  5C4X H;  1SMX A;  4JI1 L;  2E2I H;  4A3M H;  1SRO A;  3RLN A;  3RLF A;  4YY3 L;  4EX5 A;  4A3J G;  1XMQ L;  2DGY A;  1SFO H;  1PH3 A;  2OWO A;  4K0K Q;  2NN6 G;  5C3E H;  2VS1 A;  3EBE A;  5HGQ A;  5JJL A;  5H1S E;  1TWA H;  2YU9 H;  2UXC L;  1PHJ A;  5FLM G;  3FHW A;  5M5W H;  1HZC A;  3E9H A;  1LTL A;  4R1J A;  3CME A;  1O7I A;  1N34 L;  4JI2 L;  3EN2 A;  1VQN A;  2BA0 A;  4QY7 A;  1M90 C;  4A3E H;  1NJI C;  3A0J A;  4A3F G;  3H0G G;  1S72 A;  4JC0 A;  2E5L Q;  4UY8 C;  4DK6 C;  1E24 A;  2ALY B;  4GKJ Q;  4PMW A;  1MJC A;  3CPW A;  4Y52 H;  4YWK A;  1IBM Q;  1OXU A;  4C3J H;  4LF6 L;  2CKZ B;  1Y14 B;  4IPH A;  3J7A 5;  4BXX G;  2UXB Q;  5M5Y H;  2R92 H;  3A5Z B;  4P71 A;  1EQR A;  4BBS G;  4B3R L;  1KAW A;  1RIP A;  2UUA L;  1A63 A;  3AFQ A;  1XNQ Q;  2HIV A;  1J5E L;  1G6P A;  4ME3 A;  3T1H Q;  4OX9 Q;  3M4Q A;  4HJ8 A;  2L15 A;  2JA6 H;  3KYH C;  5AJ3 L;  1Q82 C;  3H3V I;  2LSS A;  1SRU A;  1X6O A;  2K75 A;  4DR1 L;  4BY7 H;  1E1O A;  2K4K A;  3I2Z A;  1EIY B;  1B70 B;  4JI5 L;  4JV5 L;  3KDF A;  2CWA A;  2Z6K A;  3NBH B;  4OXP A;  4A3G H;  4GNX A;  4HJA A;  1GM5 A;  4LF5 Q;  2YTX A;  2I5M X;  4JI4 L;  1VQF A;  1WCM G;  3FKI H;  5FJ8 G;  4EQ5 A;  3HOV G;  1LUZ A;  3T1Y Q;  5LMN W;  4DR4 L;  1U0L A;  2KCT A;  3RZO H;  2K14 A;  3E0E A;  1T9H A;  4GOP C;  1VQH A;  4A3B G;  4DV5 L;  1QZH A;  1TXY A;  1L1O A;  1A8V A;  3BZK A;  3K8A A;  3M4P A;  2CFM A;  2IT1 A;  3K7A H;  4O2D A;  3GD7 A;  4A4I A;  1YI2 A;  3RZD H;  1PA6 A;  4LUO A;  5M3F H;  2AHO B;  5ELN A;  4B3S L;  2VW9 A;  3HOY H;  4A3J H;  2QGQ A;  1K0R A;  1K9M C;  4QIW E;  2VQE L;  4LFB Q;  3HKZ E;  1NTG A;  1OXX K;  4YWL A;  3CCS A;  1ASZ A;  2A8V A;  4IPD A;  3HKZ G;  4DR6 Q;  3I4O A;  3I7F A;  4HID A;  2UUB L;  4LF7 L;  3W1B A;  4DAY B;  4JI8 L;  3CC7 A;  3GTQ H;  2WP8 J;  2JK8 A;  3GTL H;  2CCZ A;  3HOZ H;  2VQF L;  2ES2 A;  5K36 G;  1X3E A;  2VL6 A;  2D0P A;  1XTD A;  4DV1 Q;  4JYA L;  4LNQ A;  3PF4 A;  1ASY A;  2VNU D;  1QVC A;  2ZJR A;  4IJL A;  4R4O A;  4A3D G;  1HNW L;  5JEA J;  4DK3 C;  4JI6 L;  4X62 L;  1SE8 A;  4IOA A;  3I4N H;  4DV7 Q;  5LMU Q;  1W2B A;  2OQK A;  2N49 A;  3ULJ A;  1QVG A;  3BU2 A;  3PUZ A;  5BR8 Q;  4DKA C;  3CCE A;  1JT8 A;  1PVO A;  3G71 A;  1BKB A;  2Q2I A;  4IPG A;  4JOI C;  4DV4 Q;  4DV6 L;  5M5X H;  3M4O H;  3K0X A;  5IP9 H;  3GTK H;  3F8T A;  2UUC Q;  4B3M Q;  1SN8 A;  3D31 A;  5IE8 A;  1VQP A;  1PH6 A;  3JAM c;  2VZA A;  1L2F A;  4ALP A;  3HOX G;  1VQI A;  4DV0 Q;  4RMF A;  2NVQ H;  1X54 A;  4X65 Q;  2ZM6 Q;  1JE5 A;  1VQ9 A;  2GVB A;  1AE3 A;  3A5U A;  1TWC H;  2WB1 E;  4DNI A; 
#chains in the Genus database with same CATH topology
 4X3K A;  4B9X A;  2HT1 A;  2OQ0 A;  2A68 C;  3MC0 B;  1VQ6 A;  2XN9 C;  2DN8 A;  4K8I A;  5JVH 3;  5E1F A;  2WFW A;  1B3Q A;  3ERO A;  2UXC Q;  1OTC A;  4H13 C;  5IYB H;  1PH2 A;  2K5Q A;  1YHA A;  2ZTE A;  4IUN A;  3RN5 A;  1FVI A;  5M3M B;  1H9S B;  3BVZ A;  2CQA A;  4HIO A;  2Y0S G;  1JC7 A;  2KA7 A;  1YNN D;  1LTR D;  2NB0 A;  5KRU A;  2B2U A;  1H9K A;  1HJP A;  5C44 H;  1SYF A;  1IL8 A;  2MNA A;  3GTJ H;  1GD7 A;  4YCW A;  2OT2 A;  1I4G A;  3Q22 A;  4A3M B;  2MHV A;  3CCL A;  4C3H G;  4QMG A;  2YTV A;  2K5W A;  2OEO A;  4KN7 C;  4AQY L;  3G6J B;  4GOP B;  3KBG A;  4JI5 Q;  5M5W B;  2UXD Q;  4ZKB B;  5IWA L;  2X6G A;  2EYP A;  5GRO A;  1MHW C;  3NTH A;  1BF4 A;  2ENB A;  3H91 A;  3PO3 G;  4DK1 A;  4GNX C;  3Q23 A;  1B3A A;  3G7L A;  2B63 G;  2JA7 H;  1G51 A;  2DUD A;  2K03 A;  1JMC A;  1V1P A;  4TQU S;  1PRT D;  1G2S A;  1YJW A;  2R92 B;  3H3V C;  2KCM A;  1X3F A;  2X69 A;  1L1O C;  2JP1 A;  4QUC A;  2L12 A;  2JEB I;  5A2Q E;  1I94 L;  4IJH A;  3NEN A;  4LF7 Q;  4BY7 B;  4QGU A;  4HED A;  3OHX C;  5E3F A;  3MWY W;  5IP7 G;  3KF6 A;  3AYH B;  3TRZ A;  4ME5 A;  1TQO A;  2Z4H A;  3HOW H;  3VA7 A;  3PIP A;  1IBL L;  2AQ2 B;  2K28 A;  1X56 A;  4CHT B;  1YVC A;  4DV2 L;  4L5R C;  2ATW A;  4O0A A;  3F2D A;  1GJX A;  1HFN A;  1Z47 A;  3EIV A;  3FRP B;  3SGI A;  3RZD B;  5M3F B;  1HR0 L;  3PO2 B;  4A3J B;  1A3V A;  3OOC A;  1WI5 A;  1V9P A;  3NEM A;  4R4C A;  5FLM H;  5CV9 A;  1X9N A;  1F2M A;  4TVA B;  3HOZ B;  1T5E A;  2VY3 A;  4NXN L;  5KNC A;  3H0G H;  3R2I A;  3V96 A;  4APV A;  5IGC A;  1PMR A;  1TR5 A;  3TRE A;  4CDC C;  4IZ8 A;  3I4N B;  3HGB A;  2XNA C;  5KEE A;  3FPP A;  4BXX H;  1CTM A;  2ZXO A;  2K01 A;  1EFW A;  4KMU C;  1XMO Q;  1B53 A;  5A35 A;  2FFK B;  4XXE A;  2MQH A;  1HZA A;  3QIA A;  4WJ3 M;  4LF5 L;  1Q7Y C;  1A6X A;  4H0L C;  3GTM H;  4IUV A;  2NVQ B;  3F2C A;  5FKA C;  5BN5 A;  1S5E D;  3U50 C;  3GTL B;  1F9P A;  1GUG A;  1SNC A;  1SR3 A;  3GQB A;  1QZG A;  5C5L A;  3K59 A;  4A3E G;  4LFB L;  4AQY Q;  4RG1 A;  4P73 A;  2ZTD A;  3IFT A;  5DNF A;  3TEH B;  3NSW A;  1YHQ A;  4ZRZ A;  2IX3 A;  5EQ0 A;  4C3I H;  3J7A V;  5IWA Q;  3GTO B;  4C3J G;  1PH9 A;  1PH4 A;  4DV1 L;  1I4P A;  2A1A A;  4LAA A;  3T13 A;  4DAM A;  5GAH C;  3CCU A;  3AMU A;  3CD6 A;  3I55 A;  1PDQ A;  2B8F A;  3B6Y A;  3AFP A;  3TSS A;  2P5Z X;  3CKI B;  4LF6 Q;  1F2Z A;  4DV7 L;  1C48 A;  1VQE A;  3GV6 A;  3KJP A;  3S2H H;  1PZK D;  2JA6 G;  4QJF A;  4JK1 C;  1E2W A;  3ND9 A;  5JEA G;  1QJO A;  1S40 A;  1I94 Q;  1XWE A;  2E75 C;  4NXM L;  1AH9 A;  1Q1B A;  1HCZ A;  1L0Y B;  5FOB B;  2B2V C;  1G6Z A;  2MO0 A;  3RMH A;  5CMD A;  1QE6 A;  4KKT A;  1K8G A;  1PYB A;  1J8I A;  3I70 A;  4RGT A;  2ID0 A;  3S1N H;  1DXM A;  1BR9 A;  3BVG A;  3TP6 A;  1PYW D;  4BY1 H;  4A3I B;  2RKS A;  4DAY A;  1IBL Q;  2D0O A;  4DAP A;  3HOX B;  3HOY G;  2F0N A;  4DV2 Q;  1TY0 A;  3UDX A;  4DR2 L;  3ERS X;  2KHI A;  3OYY A;  3ERQ A;  2WB1 B;  1HR0 Q;  4K14 A;  4A3K B;  1Z6H A;  2EY6 A;  4U68 A;  3I73 A;  1RJT A;  5CYU A;  1DON A;  3U4V A;  1XX8 A;  1JQY D;  5JAV A;  2RBM A;  2JXM B;  4YHH L;  2F0S A;  4NXN Q;  4ZUI A;  5LMN L;  2NVY B;  1CFM A;  4Z9C B;  4BA1 I;  4LFC L;  4MNO A;  1O78 A;  3J81 L;  2Q8T A;  1N8R C;  2R93 H;  1IW7 D;  3QB3 A;  3TS2 A;  1NUC A;  2NVX B;  5CGK A;  4AYB B;  4HIM A;  3DLL A;  3C1E A;  1WTH A;  3ZJY C;  4FF4 A;  1Q8I A;  4C3H H;  2XTI A;  2IW3 A;  3HOU G;  5EKL A;  1MD2 D;  1S5C D;  2TMP A;  2F0L A;  2EYL A;  4RWS C;  3NEL A;  4FF1 A;  1VQ4 A;  1Q90 A;  2B2W A;  4I65 A;  4IUR A;  5EJW A;  4A3F B;  1SYC A;  3PO3 H;  1D5Z C;  4KKS A;  3HRZ C;  3TQY A;  4EQO A;  4EQP A;  4KY6 A;  2B63 H;  1GUW A;  2HUG A;  4CJ1 B;  3PUV A;  1KD1 C;  4OX9 L;  4ABN A;  2HCI A;  3SE0 A;  4BBS B;  1OXS C;  1I6H H;  1U4R A;  2J4X A;  1NE3 A;  4P74 A;  4RKL A;  2MPM A;  3M4Y A;  3C2P A;  1V1P B;  2MGS A;  1J9O A;  4IQZ A;  1CK1 A;  1G8Z D;  2C9O A;  2E74 C;  5DEH A;  4LW1 A;  4BS9 A;  5IP7 H;  3E6Z X;  5EAY A;  2JA8 H;  1GUO A;  1JJC B;  1M4V A;  3KOJ A;  4NXM Q;  2PQA A;  4CDD C;  1QNK A;  3FMC A;  4KN4 C;  1XJV A;  3KF6 B;  1KRS A;  1SSO A;  2CVR A;  2RF4 A;  2D9U A;  1A0I A;  1SMY C;  1XPU A;  4PZ8 A;  1E1T A;  1SNM A;  1G91 A;  4CDE C;  3CP0 A;  4JBJ A;  5LMU L;  5L37 A;  1TWF B;  3PCO B;  2VB3 X;  1VQJ A;  1VF7 A;  3D8G A;  5LL6 S;  4DR2 Q;  4B08 A;  3RUZ A;  4RAU C;  1VS0 A;  2R7Z G;  1CZG A;  1EOV A;  4Q5V A;  2JA5 H;  3CMA A;  1PH7 A;  2O5J C;  1FL0 A;  4B3M L;  4KJO A;  1CSQ A;  1OO9 B;  1UE1 A;  1HA6 A;  4OWW B;  1HHV A;  1IL2 A;  2KHJ A;  2ASB A;  1EY0 A;  1M8A A;  3P75 A;  3TP5 A;  1XTC D;  3OIQ A;  4LFC Q;  2FHT A;  1SRO A;  1TWH B;  5C0X H;  4KD3 A;  1F9S A;  2DY8 A;  5H1S E;  1TWA H;  3SK5 A;  3R8B A;  5KNB A;  1YNJ D;  2XRQ D;  4RA8 A;  1HZC A;  3CME A;  1O7I A;  5D3D A;  4C1N K;  1EIH A;  1PXU A;  1K0S A;  4QY7 A;  1M90 C;  4A3E H;  2WAQ B;  3A0J A;  3S1Q B;  2AQ1 B;  5ISR A;  4UY8 C;  4DK6 C;  2SNM A;  3CPW A;  4TKO B;  2F0I A;  4C3J H;  4IPH A;  2UXB Q;  4P71 A;  1EQR A;  1KAW A;  1RIP A;  1LTB D;  3DHQ A;  4OX9 Q;  3WDN A;  2JA6 H;  3H3V I;  2LSS A;  3S1R B;  2K75 A;  4DR1 L;  4WRD A;  1EIY B;  1EL0 A;  4JV5 L;  5JPM C;  5JEA H;  4GNX A;  2YTX A;  1Y8P B;  4JI4 L;  5BN3 A;  3HOV G;  4DR4 L;  4A93 B;  4IUU A;  3BG3 A;  3E0E A;  1X32 A;  1SAP A;  4DV5 L;  2MJ8 A;  4A3B G;  1L1O A;  3JAM L;  2AQ3 B;  3SHL A;  3OWE B;  3M4P A;  5CR3 A;  5HGT A;  1YI2 A;  3GD7 A;  1TU2 B;  5ELN A;  1WTW A;  1STB A;  3HOY H;  2QGQ A;  4QIW E;  2VQE L;  1U4P A;  1EEI D;  1NTG A;  1BXT A;  4YWL A;  5E4W C;  1B2T A;  2XWJ B;  2UUB L;  1T5X D;  4DAY B;  1KDC A;  1X3E A;  4LNQ A;  2E2J B;  4A3D G;  4R4O A;  1FNV A;  4JI6 L;  1SE8 A;  4HCS A;  4CBV A;  5LMU Q;  3SK8 A;  3BDO A;  3ULJ A;  3BU2 A;  4DKA C;  1EY7 A;  1I4R A;  1STH A;  1JT8 A;  1K83 B;  3I4M B;  5COY A;  3G71 A;  4IPG A;  2F0Q A;  3J81 E;  3S17 B;  1LO5 D;  1PFM A;  1TKW B;  3IKJ A;  2UUC Q;  4B3M Q;  5IE8 A;  1VQP A;  3K5L A;  2VZA A;  3N6R A;  1EEF D;  3FVQ A;  1X54 A;  1VQ9 A;  2GVB A;  1C8C A;  2PZT A;  1TWC H;  4DNI A;  1MSH A;  2ICE C;  1NAP A;  5DM7 3;  4AIM A;  2PW5 A;  3S1M B;  4ZAI A;  1Y1W B;  3GDE A;  3KLR A;  1SLJ A;  3G6E A;  1PFB A;  2Z6B A;  1YNN C;  1I3Q H;  1A2U A;  1B50 A;  2EY5 A;  1PFS A;  1PTO H;  1A15 A;  4DV3 L;  1FD7 D;  4X66 L;  3N52 A;  1UAP A;  2OCE A;  4HMI A;  3TZD A;  3HOW G;  3TN2 A;  4POG A;  3M85 A;  1WTP A;  2IX1 A;  2F4V L;  1V8Q A;  3J7Z C;  1V1Q A;  2XIW A;  2EZV A;  3L3O C;  4WJ4 A;  3I91 A;  1UE5 A;  2I0Q A;  1WYD A;  3E5S A;  5IY0 A;  1K3R A;  2N88 A;  2F0T A;  1SFO B;  5FLX L;  2LKV A;  1Y1V G;  4NP5 A;  2G9H D;  2YU9 B;  5D14 A;  3DEP A;  4DR1 Q;  2SNS A;  1LAB A;  3I3C A;  5FO7 B;  1PRT C;  1K8A C;  5CC4 A;  5C5M A;  4J1M A;  2JYO A;  4JI4 Q;  1EWH A;  1HH2 P;  2A74 C;  3Q6S A;  4DR4 Q;  3VYU A;  3W2D A;  3K58 A;  3X3N A;  3P1H A;  5J3B A;  4DV5 Q;  5NUC A;  5M5Y B;  2YV5 A;  1ENC A;  3MZ5 A;  1D2B A;  4LFA L;  1L0W A;  3R2T A;  3OMG A;  3SXH A;  2VQE Q;  1GOZ A;  1LTT D;  2B2V A;  4JBM A;  2VUM G;  2V4D A;  1HTP A;  5C0X J;  2FMM A;  1NSN S;  2UUB Q;  3PF5 A;  2R7Z H;  1V43 A;  1VMP A;  1JJ2 A;  4RGM A;  2WKC A;  4JI6 Q;  4H02 A;  5BN4 A;  1NMG A;  1SNO A;  3FKI B;  1LV9 A;  1P16 A;  3BYY B;  3RZO B;  1JR0 D;  4XT1 B;  5KIX A;  1C0A A;  3CAM A;  4KHV A;  4HSP A;  3K7A B;  4C3I G;  5IGF A;  2KCN A;  2ZJP A;  1I4Q A;  2K52 A;  3MTS A;  5JVG 3;  1IBK Q;  5KND A;  1N32 L;  4FDB A;  3D4D A;  2GA4 B;  4R9W A;  2FIN B;  4R8N A;  1STY A;  3MFG A;  1JIC A;  1HUM A;  4NW2 A;  2R61 A;  3CRL C;  2PCF B;  3SR1 A;  5LL6 X;  4XYO A;  3I56 A;  1FGU A;  5M3M G;  1E2Z A;  4H44 C;  4F88 A;  1VCI A;  3PUW A;  4FF3 A;  4DV3 Q;  5M5X B;  4X66 Q;  3PQI A;  1X3P A;  4BY1 G;  3AU7 A;  2FXQ A;  3GTK B;  2XRS D;  1FR3 A;  2L0C A;  2Z8L A;  2KOL A;  4A3M G;  3IRB A;  2HHH L;  4F87 A;  2B3G A;  5I6Y A;  1ESF A;  2OTL A;  1A2T A;  1BUV T;  2UU9 L;  4LF9 L;  3HOV H;  1WTR A;  1WCM B;  1SND A;  5EGT A;  4GNX B;  4L6T B;  4A3B H;  2EYJ A;  1BVS A;  3A7L A;  2JEA I;  4IFD G;  1MBY A;  2IJ0 A;  3L0O A;  2LMC B;  1N34 Q;  1WD0 A;  1E7Z A;  2Y0S E;  1L1O B;  1YJN A;  1D5X C;  3QG1 A;  2R92 G;  1KDB A;  3NWT A;  1CKO A;  3HKZ B;  2CWP A;  3S14 H;  4DGZ A;  3ZYY X;  3NBH A;  4RCN A;  1RHP A;  3H15 A;  2Z4I A;  3NUC A;  2R93 G;  4DNR B;  1GO3 E;  2Q8I B;  1B8A A;  4A3D H;  3FP9 A;  5BR8 L;  4B3R Q;  1ZXT A;  2HCC A;  4LFA Q;  2XWB B;  1LT4 D;  1JB7 A;  1CM9 A;  1GUT A;  2PNH A;  4K5X A;  4KHZ A;  1KDA A;  3PV0 A;  4DPG A;  1HRJ A;  3PUY A;  4FXD A;  5IGD A;  4GLA C;  3M3Y H;  2F0E A;  1MSG A;  4IAL A;  2AKW B;  1KLU D;  1EU4 A;  5M3F G;  3PO2 G;  3FEW X;  3KBX A;  1WOC A;  3CXC A;  2EY2 A;  3S2D H;  4JCV E;  2NZ1 D;  5DM6 3;  5IGE A;  3HOZ G;  4I7Z C;  1ENA A;  1I4X A;  4X64 L;  1I50 H;  3S16 B;  2KBN A;  1N32 Q;  1HUN A;  1SBB B;  1RL2 A;  3V2T A;  3I4N G;  3RLO A;  1VQC A;  4J15 A;  3T51 B;  4NMZ A;  1ESR A;  1EY5 A;  4LWC A;  1Z9F A;  3GP7 A;  4X62 Q;  2JA8 G;  2O5I C;  4XTC S;  2BH2 A;  2VXW A;  5C4J B;  4K0K L;  1A3U A;  2C35 B;  4GS3 A;  3FDT A;  3K6O A;  4DNT B;  1JWM D;  2J0T D;  3BYT B;  5C3W A;  1YIJ A;  1CQF A;  1G29 1;  2F3I A;  1Y1V H;  3SEB A;  3EFX D;  2E5L L;  4AH6 A;  1WTX A;  1OXT A;  4GKJ L;  3KJO A;  4QUF A;  2HHH Q;  3TDQ A;  3K81 C;  5G3L F;  1IBM L;  4OL7 A;  5IIF A;  4NKL A;  4LF9 Q;  2UU9 Q;  5GAE C;  3H6M A;  1HZB A;  4XIG S;  1HQM C;  1JWU D;  2JA5 G;  1GXD C;  2QW7 A;  4ZYS A;  4DUY L;  4YCU A;  1IXR A;  1TS2 A;  4U67 3;  1R9T B;  2EPB A;  1LM0 A;  2AWO A;  4OGQ C;  4OWX B;  3K0Y A;  4OHJ A;  1P8L A;  1WJJ A;  2B8G A;  1CT1 D;  2VUM H;  2IPK D;  1B1Z A;  3J81 c;  1SYG A;  1YHB A;  2KJX A;  2F0P A;  5IGG A;  5C0X G;  2B39 A;  3T1Y L;  2F0G A;  2F1M A;  4IOC A;  1RTO A;  5EBD A;  4ZK9 B;  4ZUJ A;  1UEB A;  4A3I G;  3J80 L;  2RQX A;  2F03 A;  1B7Y B;  1A62 A;  1LT6 D;  4DR6 L;  4YWM A;  3CC4 A;  2NVT H;  4KHP L;  3TS0 A;  2N3S A;  5IOD A;  4GLX A;  3PGZ A;  2JN4 A;  1M1K C;  4GKK L;  5D3I B;  3S9W A;  2WB1 G;  3U58 A;  1I4H A;  4CKB A;  2F0F A;  4A3K G;  2EJG C;  3JC6 6;  3KF8 A;  3PUX A;  1CSP A;  3LNN A;  1TS5 A;  4DK0 A;  2NZH A;  2EJM A;  3STB C;  3TBI B;  3MEH A;  1UEA B;  4DV4 L;  1AZQ A;  3OIP A;  2D5D A;  3ICE A;  5M3M H;  4QCL A;  2M00 A;  3L2P A;  3CQZ B;  4IPC A;  4Y7N B;  2ZM6 L;  3LWU A;  2EYH A;  3P20 A;  1YNJ C;  1Q8K A;  3U9S A;  5KYI A;  2A6H D;  4DUZ L;  1L0X B;  4AYB G;  4P2C B;  4JI1 L;  4A3M H;  3RLN A;  1SYD A;  1PH3 A;  4K0K Q;  4EX5 A;  1O80 A;  2NN6 G;  2OF1 A;  5I9O A;  2VS1 A;  1LTG D;  1S5F D;  3I4L A;  4IUQ A;  3DXJ C;  5M5W H;  1CA5 A;  3E9H A;  1LTL A;  4R1J A;  4JI2 L;  1BCP F;  2BDO A;  2RVL A;  3OMC A;  1VMC A;  1NJI C;  2A5H A;  4A3F G;  1S72 A;  4IFD H;  3NBI A;  2L55 A;  1TWG B;  4R8I A;  2E5L Q;  5J1Z A;  5ELD A;  1ENF A;  4GKJ Q;  1ZYR D;  3K57 A;  4YWK A;  1IBM Q;  3J7A 5;  2R92 H;  4BBS G;  4KY7 A;  4ODG A;  2UUA L;  1J5E L;  1G6P A;  4C1N I;  4JVZ A;  3M4Q A;  2L15 A;  3KYH C;  3I90 A;  5DAU A;  4BY7 H;  2K4K A;  3F2U A;  3NBH B;  3A8I E;  1BCP B;  3BDC A;  4LF5 Q;  1VQF A;  2RSN A;  5FJ8 G;  4EQ5 A;  5T1I A;  4KY5 A;  3T1Y Q;  2KCT A;  2K14 A;  3KLS A;  3EJI A;  2PNR C;  1O7Y A;  1ET9 A;  4C2M B;  3K8A A;  4A4I A;  2RSO A;  2CFM A;  2ZXR A;  3SK6 A;  1CQV A;  2VB2 X;  4LUO A;  5M3F H;  3RZD H;  1FNU A;  3VA5 A;  3PO2 H;  5EPK A;  4A3J H;  1K0R A;  1K9M C;  4LFB Q;  3CCS A;  1EZ6 A;  2QF7 A;  4FXK C;  3VR6 A;  2A8V A;  3GTG B;  2PZW A;  4DR6 Q;  3I4O A;  3I7F A;  2E2D C;  3W1B A;  4JI8 L;  5FO8 B;  3CC7 A;  4EQN A;  2JK8 A;  3HOZ H;  2CCZ A;  2VQF L;  2ES2 A;  4DV1 Q;  1K28 A;  1XTD A;  4JYA L;  3IAY A;  1FNW A;  4HCE A;  4X3S A;  1ASY A;  5FK9 C;  4BBR B;  3I4N H;  4DV7 Q;  2OQK A;  1QVG A;  1QWY A;  3PUZ A;  3MA2 B;  1PVO A;  5FO9 B;  5HUR A;  4DV4 Q;  2Q2I A;  4JOI C;  3S15 B;  3K0X A;  5IOC A;  4HAE A;  3F8T A;  3D31 A;  1PH6 A;  3JAM c;  3K5N A;  1L2F A;  4ALP A;  1VQI A;  2NVQ H;  2ZM6 Q;  1JE5 A;  4K2K A;  1HPC A;  1WD1 A;  3GTL H;  2H4O A;  2O2L D;  4DUZ Q;  3WOE A;  3GTP B;  3HOU B;  4JI1 Q;  2RDG A;  2RCN A;  1S3O A;  4BWG B;  2F0O A;  1IHZ A;  2WAQ G;  1NR2 A;  3RR5 A;  1NMF A;  4N9T A;  2F3V A;  4FP5 D;  2I07 B;  1DCZ A;  4JI2 Q;  1AZP A;  2KHS A;  4UAI A;  3GTO H;  4I7A A;  1PZJ D;  2F3W A;  1EFI D;  1E3P A;  1PFN A;  1WTO A;  4YHH Q;  3HEJ A;  3CW2 C;  1LAC A;  2AMC B;  3TP8 A;  1NBW A;  1EY4 A;  4GN4 B;  5LMN Q;  4K5W A;  3WWV A;  3UE0 A;  3DM3 A;  2RHQ B;  3QJY A;  2E2H B;  4TSS A;  1Q1E A;  1EU3 A;  3A74 A;  5C4X B;  1DOM A;  2PO4 A;  2E2I B;  3GO5 A;  1J5E Q;  1MI2 A;  4O1N A;  1YJ9 A;  2EIF A;  2PYK A;  5JOB A;  2N8N A;  2HQL A;  4KLK A;  5C3E B;  4A3L G;  1QG7 A;  2KEC A;  4A93 G;  1EWC A;  1LTS D;  3J80 E;  2E76 C;  1UE7 A;  2Z6K C;  4A3I H;  1AEX A;  5T1G A;  4UP8 A;  4GZY C;  2K32 A;  4LUZ A;  4CJ0 B;  3HOX H;  1K3B C;  5C3X A;  3D0F A;  3Q8D A;  1S4Z A;  5G3L D;  1PTO C;  1FJG L;  2A73 B;  1YBY A;  3RNU A;  4A3K H;  4UP9 A;  1BQQ T;  4G57 A;  2SOB A;  3G48 A;  1WFQ A;  3T53 B;  4LF8 L;  1CKN A;  3L7Z C;  4JI8 Q;  2VQF Q;  4JI7 L;  1J6Q A;  3UE1 A;  3AEV A;  4A3G B;  4JYA Q;  2OTJ A;  3KF8 B;  4YCV A;  2NVY H;  5FLX c;  3K80 C;  4CGY B;  4XDX A;  3I4M G;  1U9R A;  4IFD J;  2PW7 A;  3UI2 A;  1GVP A;  4PMC A;  1EWI A;  3T56 B;  2NVX H;  3ULP A;  3IFD A;  1JB3 A;  2DY7 A;  2PZU A;  1HFG A;  2NN6 H;  4DAV A;  1Q81 C;  1BBU A;  3CC2 A;  4UPA A;  1Y1W G;  3VR5 A;  3GTQ B;  1ILQ A;  3M9B A;  2JA9 A;  4KD4 A;  1VQ7 A;  4A3F H;  1STA A;  2A69 C;  1S5B D;  1GUN A;  2NZO A;  2LXK A;  5EPL A;  2LS0 1;  1IYJ B;  1BDO A;  1LYL A;  3PMF A;  5GAD C;  2PMZ E;  4BBS H;  2EQS A;  4V19 0;  1JWS D;  4KJN A;  1HR0 W;  4F7X A;  2ZT9 C;  3M4O B;  1PH8 A;  3A8K E;  3HS0 C;  1Q12 A;  1VQB A;  3MHB A;  1X3G A;  3HKS A;  4ID6 A;  4JI3 L;  5CV8 A;  2PI2 E;  1KRT A;  1N33 L;  1F9R A;  1TVX A;  1PRT B;  3RD4 A;  5FJ8 H;  2BE5 D;  2F0D A;  4UP7 A;  1EY8 A;  1C9O A;  4RGN A;  1HA5 A;  2A19 A;  1KLG D;  4M8A A;  2EXZ A;  5DLQ E;  1BCP D;  1BOS A;  3J81 i;  4EGV A;  2I46 A;  2F0J A;  4N8F A;  4PZ7 A;  4QIW B;  2QEX A;  4DR7 L;  4FO2 A;  3C46 A;  1TWF H;  1QVF A;  1EYA A;  1XPR A;  1HNX L;  3M7N A;  4V0B A;  4MTN A;  5C44 B;  1FJG Q;  3ND8 A;  3QOJ A;  1VQO A;  3GTJ B;  1CUK A;  4CDF C;  1GKH A;  5TSS A;  1O7L A;  1UWV A;  1D1I A;  1WVL A;  4LF8 Q;  2ZJQ A;  3FKI G;  1UUP A;  5HY6 A;  4JV5 Q;  2XVS A;  5IYD H;  4JI7 Q;  3KLW A;  1U4M A;  1VDZ A;  1DGS A;  3MVV A;  3PIO 3;  2ICI A;  3DWA A;  2WII B;  1I5F A;  1TWH H;  1NY4 A;  3VYT A;  2JA7 B;  1YNX A;  2PQA B;  1W3S A;  1VQ5 A;  2RCF A;  1H9R A;  3QR8 A;  4MN3 A;  3VYR A;  5J39 A;  2KEN A;  1R4Q B;  1VF5 C;  3R3O A;  3J7A F;  1MIU A;  1CA6 A;  4DU9 A;  2F0K A;  4XQQ A;  3UDI A;  1STG A;  1QB5 D;  1E2V A;  1PLF A;  1SYE A;  2HDL A;  3S1Q H;  1EOT A;  4HR7 B;  5EPJ A;  5JJZ A;  3HG9 A;  3VDY A;  2AUJ D;  5M9O A;  1KIX A;  1AN8 A;  1K8O A;  4BA2 I;  2HQE A;  1KC8 C;  2NUC A;  3HOW B;  5ELB A;  2I5L X;  3NTI A;  3E3X A;  3NXW A;  3NPP A;  5IT9 L;  2EDG A;  5IP9 G;  4K5V A;  3S1R H;  2OXP A;  1AFP A;  4L5S A;  4ZKC B;  2AUK A;  2UXD L;  3KLS X;  4NB3 A;  4OO1 G;  1CHQ D;  4A3L H;  2QKI C;  2QEJ C;  4ZCK A;  4JI3 Q;  4A93 H;  2DJF C;  1AW7 A;  2MO1 A;  2SEB D;  2MFI A;  5C0X I;  1VQM A;  1D8L A;  1KNA A;  4KI0 A;  1XPO A;  1N33 Q;  1RKN A;  3H0G B;  3F1Z A;  1EYC A;  2Q2U A;  3T1H L;  4IO9 A;  1VQL A;  1SNQ A;  3PIO A;  1YIT A;  2BDN A;  1UE6 A;  2IHE A;  1NNX A;  4O42 A;  4GLV B;  1R4P B;  1XYI A;  5KYL A;  3OSO A;  3D3R A;  3PSI A;  2E2J H;  2JE6 I;  1MGS A;  4A76 A;  1SXT A;  4WJW A;  2YYZ A;  5ELO A;  4FNF A;  2F4V Q;  3GTM B;  4DR7 Q;  4HIK A;  2NBF A;  1HNX Q;  1LT3 D;  2B2Y C;  2Z0S A;  1K83 H;  1EIF A;  1TS4 A;  1YEZ A;  2V1C C;  1CKN B;  3I4M H;  3S17 H;  2B29 A;  2BA1 A;  4OON A;  1PH5 A;  1Q46 A;  3JAM E;  2KCC A;  1Q3L A;  3CHB D;  5I9P A;  4KTA A;  4JBK A;  2BH8 A;  1JOQ A;  4G7Z C;  4C3I B;  2KEE A;  4WFN 3;  2F0W A;  3E0J A;  3U4Z A;  2WV6 D;  3FPU B;  4IN3 A;  2K33 A;  3S1M H;  1RTN A;  3IL8 A;  4LJZ C;  1Y1W H;  2WKD A;  1HZ9 A;  3S2H B;  4R4I A;  1ICW A;  4JOI A;  1K8M A;  2L1B A;  3CRK C;  2QA4 A;  2NN6 I;  2QDL A;  4BY7 G;  1GUS A;  4YIJ A;  2MUY A;  1XMO L;  3C3L A;  4OEM B;  2A6H C;  3PIP 3;  4G4K A;  1KAA A;  3JAM i;  1H95 A;  3MXN A;  3CCR A;  1JJG A;  2WIN B;  1CI3 M;  2N78 A;  4EVO A;  3S1N B;  4F8M A;  4X6A H;  4BY1 B;  3J80 c;  2K5H A;  3RLF A;  4YY3 L;  4A3J G;  1XMQ L;  1SFO H;  2F0V A;  4HN7 A;  2OWO A;  5CBA E;  5CV4 A;  1RCV D;  1ZYR C;  4MIU A;  2YU9 H;  2A6E D;  3ITP A;  3FHW A;  1VQN A;  4Q0F A;  3EN2 A;  2CW0 D;  2BA0 A;  4K6D A;  3HZX A;  4RCO A;  1EY9 A;  1ZEQ X;  2DJG C;  4PMW A;  1IW7 C;  1MJC A;  4Y52 H;  4LF6 L;  2CKZ B;  1Y14 B;  1SEB D;  3J7Y W;  5M5Y H;  1II3 A;  2KQ3 A;  4PV1 C;  3AFQ A;  2RDH A;  2Y0S B;  4ME3 A;  3T1H Q;  2KED A;  4HJ8 A;  2R93 B;  5AJ3 L;  1EY6 A;  1SRU A;  3A8J E;  4J8Q A;  5CBE E;  2G5D A;  2L11 A;  1E1O A;  5FLX E;  3I2Z A;  3DM1 A;  4JPB W;  1B70 B;  3KDF A;  2Z6K A;  3NE5 B;  4C3H B;  4HJA A;  1GM5 A;  2I5M X;  1SE4 A;  3FKI H;  3KK7 A;  1LUZ A;  4RHS A;  3RZO H;  2EYO A;  3H94 A;  4GOP C;  1VQH A;  4HSV A;  4RKB A;  1ET6 A;  3PO3 B;  3BZK A;  3K7A H;  3H09 A;  4ILW A;  1PA6 A;  1B4O A;  2AHO B;  2B63 B;  4B3S L;  3DWQ A;  1KNE A;  1OXX K;  1ASZ A;  2F0M A;  2K6A A;  2O4X A;  4HMJ A;  1ROD A;  1TS3 A;  4HID A;  2K05 A;  2ZXP A;  4KKU A;  2WP8 J;  1I6H B;  5K36 G;  3PF4 A;  1IYU A;  1QVC A;  2VNU D;  4IJL A;  1HNW L;  1DM0 B;  3OW7 A;  4DK3 C;  2EJF C;  2N49 A;  3A7A B;  2BCO A;  4M1U B;  5BR8 Q;  2L9H A;  2JA8 B;  5IT9 E;  1BKB A;  1IYV A;  4DV6 L;  1B44 D;  5M5X H;  5C4Z A;  2SDF A;  5IP9 H;  3GTK H;  5EKK A;  3WOF A;  1ONL A;  2CH4 A;  2TSS A;  3HOX G;  3MXP A;  2F4I A;  2LFN A;  4OO1 H;  3OPO A;  2WB1 E;  1SJE D;  2FJ2 A;  1KL9 A;  1SE3 A;  1F2L A;  2R7F A;  4CKC A;  3NK9 A;  4DR5 L;  1WCM H;  4OIJ A;  3CCM A;  4YY3 Q;  1XMQ Q;  1DD2 A;  1F2Y A;  4HJ9 A;  1VQ8 A;  2EY1 A;  5C6A A;  1TII D;  4JG2 A;  1DOL A;  5CV7 A;  5JJI A;  1BBX C;  1D5M C;  3UDG A;  3MXG A;  4MHE A;  2CHB D;  4X64 Q;  2A68 D;  3H3V H;  2JA5 B;  1SJH D;  5EKI A;  3I8Z A;  4G7O C;  4HJ7 A;  3R93 A;  3CCV A;  4K6L A;  1GHK A;  2EOT A;  3NWS A;  2XSC A;  1STE A;  5COR A;  1QCB D;  2DNC A;  1KXL A;  2PPB C;  3NQT A;  4AYB E;  3EA6 A;  4A3C G;  1I6V C;  2M9V A;  1MKH A;  1X55 A;  1HTL D;  2K5D A;  3HFZ B;  1NR4 A;  3TME A;  5AJ3 Q;  2X6L A;  3EQL C;  1TWA B;  2Q2T A;  1HXY D;  3W3A A;  4FF2 A;  1SYB A;  1RD9 D;  1FGB D;  2WAC A;  2H5X A;  4DF7 A;  4A75 A;  3F2B A;  3RN2 A;  4A3E B;  4MTK A;  1QUQ A;  2K50 A;  3CCJ A;  3M7G A;  4C56 C;  5I2Y A;  2EYM A;  4L5T A;  1NCV A;  4C3J B;  1VQK A;  1JE4 A;  4JBW A;  2BOS A;  3MAQ A;  1A3T A;  4DUY Q;  2R6G A;  4B3S Q;  2RDF A;  3S16 H;  2JA6 B;  5EBC A;  1EIG A;  3D4W A;  3W5O A;  3BS1 A;  4BBR G;  1LT5 D;  4CKE A;  1LLR D;  3Q24 A;  3HP3 A;  2NTS A;  4DR3 L;  3NQI A;  3T4A C;  5I2X A;  1BO0 A;  2R7D A;  3NP8 A;  1HNW Q;  1PYS B;  2K7V A;  1ILP A;  4K2L A;  1N9W A;  2B2T C;  5C4J H;  2J7Z A;  1U5K A;  4LF4 L;  1VQD A;  1AE2 A;  4ZQ3 A;  3MXN B;  1DYQ A;  4DV6 Q;  4NPS A;  1RDP D;  3HOY B;  5IYC G;  4WOR A;  1KQS A;  1D1K A;  2HIX A;  1VQG A;  4JI0 L;  2HDM A;  2K1B A;  2QIL A;  4KHP Q;  2K04 A;  4GN5 A;  3OW2 A;  1BNZ A;  3LGJ A;  4GKK Q;  5I6W A;  2EXD A;  2UXB L;  5ELF A;  4DR5 Q;  1WTQ A;  4B3T L;  1CHP D;  3DWP A;  1R9T H;  5D65 A;  4ULL A;  4RGO S;  1D6E C;  4P72 A;  2F0U A;  2IX0 A;  3J81 j;  5IYD G;  1PTO F;  5KGU A;  4QQB X;  2K5N A;  1Q86 C;  2F0H A;  4IUT A;  4B9W A;  1WTV A;  1KAB A;  2BE5 C;  1G2T A;  2Z1C A;  5C4X G;  2JQO A;  3K5M A;  2PI2 A;  4X3T A;  5C3E G;  1TWC B;  3LX0 A;  3A54 A;  1V1O A;  2AWN A;  2B2U C;  1RF2 D;  3ULL A;  1BCP C;  2WAQ E;  3KDF B;  3NTK A;  1X3Q A;  3MEF A;  3W1G A;  1IKL A;  1I3Q B;  5ELE A;  1EZ8 A;  1PTO B;  4OWT B;  2M2L A;  1KHI A;  2ZTC A;  3BZC A;  3BDL A;  4PQX A;  3TP7 A;  1XNR L;  1JOK A;  5CV5 A;  2B2Y A;  5K36 H;  4R4T A;  1JCK B;  1W6K A;  1YZ6 A;  4DN4 M;  1ICF B;  1DOK A;  2UUA Q;  4A3G G;  2EVB A;  4K8J A;  4POF A;  1N36 L;  1LTA D;  2UUC L;  2I5H A;  3K7U C;  3CQZ H;  1HNZ L;  4DR3 Q;  4Y7N H;  5E4X A;  3STB D;  1PV4 A;  4X3U A;  3EVQ A;  3BZD B;  4UHV A;  2GVA A;  1EQV A;  3CU7 A;  4OEL B;  2Z9H A;  4L5Q A;  2HD3 A;  3OWF A;  4LF4 Q;  1MJE A;  2K5V A;  3DMU A;  5E7N A;  1Y8O B;  1Y69 U;  4OIK A;  3KFU A;  1E22 A;  3KUP A;  1DZ1 A;  2XGT A;  3A55 A;  1TWG H;  4JI0 Q;  4OO1 I;  3CPF A;  3MXU A;  3S24 A;  2R7Z B;  4PZ6 A;  4JW0 A;  2Q8R E;  4XQJ A;  2IL8 A;  5GAG C;  3J80 i;  3OTO L;  1AP0 A;  4B3T Q;  4LK1 C;  4P75 A;  2IY5 B;  4A3C H;  1SDF A;  1IKM A;  3AQQ A;  4RH6 A;  3U9O A;  4J6H A;  4LUV A;  3NHH A;  2L4N A;  4DA2 A;  1PH1 A;  3X3M A;  3DEO A;  2N55 A;  1X65 A;  4N9P A;  2LXJ A;  2EYF A;  1OXV A;  4XYQ A;  2Q2H A;  3O13 A;  4HJ5 A;  1B9N A;  1PRT F;  1FYC A;  4C2M H;  2MP1 A;  1H9S A;  1CKM A;  3BJU A;  5CV6 A;  5GQO A;  3CF5 A;  5IYB G;  1XNQ L;  4MZ9 A;  1QOH A;  2R3Z A;  2IHF A;  4KK7 A;  4LMQ D;  5JPN C;  2PQE A;  1HQR D;  3V05 A;  3VYS A;  2H1E A;  3GTG H;  1QUQ B;  1ZKO A;  1EQQ A;  1ML0 D;  3ER0 A;  3UDF A;  4IFD I;  1K73 C;  4QF4 A;  4UDU C;  4RFB A;  5K5P A;  5IT9 c;  2CH4 W;  5C44 G;  1D7Q A;  2KVM A;  4R4Q A;  1XNR Q;  4BBR H;  4GOP A;  1BBW A;  1LTI D;  3E9I A;  5ELC A;  2JJQ A;  3S15 H;  3HOV B;  4ZLT F;  1N36 Q;  1KTK A;  4PG3 A;  4A3B B;  3GV3 A;  4PMB A;  5J22 A;  2QCP X;  1IBK L;  1C7Y A;  2E8G A;  1HNZ Q;  3SVM A;  2RHS B;  2JA7 G;  4RHR A;  1Z7T A;  1EYD A;  1TY2 A;  1IZ6 A;  4N8X 1;  5IYC H;  3D4R A;  3I72 A;  3QWN A;  4IUP A;  1EYG A;  3G4S A;  3GTP H;  3HOU H;  3S14 B;  1EQT A;  2YTY A;  4PNY A;  5AFW A;  4XT3 B;  1QIL A;  3K5O A;  5A2Q L;  4A3D B;  4FXG C;  4QL5 A;  1SMY D;  2QDB A;  3CCQ A;  2NTT A;  4GN3 B;  3BVM A;  2F52 A;  2GN5 A;  3QOL A;  1CZW A;  3SDZ A;  5JJK A;  5I4D A;  3A56 A;  1H9M A;  1EUJ A;  1UNS A;  1VQA A;  2CQO A;  2D62 A;  4DV0 L;  2PMZ B;  4X65 L;  3M3Y B;  2A6E C;  3OTO Q;  1SE2 A;  2E2H H;  3AB9 A;  4KV6 A;  1B9M A;  1SMX A;  1U4L A;  2CW0 C;  5C4X H;  2E2I H;  1GHJ A;  2L5T A;  2DGY A;  5C3E H;  3EBE A;  5HGQ A;  5JJL A;  1F77 A;  3S2D B;  2UXC L;  2FMC A;  2EE1 A;  5FLM G;  1PHJ A;  4FVM A;  4XQN A;  3URY A;  1N34 L;  3VR2 A;  4FYD A;  1I50 B;  5F2D A;  3H0G G;  1QNU A;  5IGB A;  1PZI D;  4JC0 A;  1E24 A;  2ALY B;  3P7J A;  1DJR D;  1OXU A;  3DUZ A;  3VR4 A;  3D6C A;  4BXX G;  3A5Z B;  3D6W A;  1F9Q A;  2JSO A;  4B3R L;  1A63 A;  3QO2 A;  1XNQ Q;  2B2W C;  2HIV A;  2IWH A;  1Q82 C;  4L63 B;  1O7Z A;  1X6O A;  1TT2 A;  1Y8N B;  4JI5 L;  1PTO D;  3ONA B;  2CWA A;  4OXP A;  4A3G H;  4DFA A;  1Y1V B;  1JOR A;  2RA4 A;  4TRD A;  3VR3 A;  2KUM A;  2LY7 A;  1WCM G;  1SNP A;  5LMN W;  1U0L A;  3MFY A;  4DXF A;  1T9H A;  1E0B A;  1QZH A;  1TXY A;  4G7H C;  1A8V A;  2IT1 A;  4O2D A;  2VW9 A;  3HKZ E;  4S3S A;  3T16 A;  1STN A;  1XXG A;  2DNE A;  4IPD A;  3HKZ G;  4LF7 L;  3GTQ H;  3Q0A A;  2VL6 A;  2D0P A;  4HTH A;  2VUM B;  2NWG A;  4E6I A;  2G9D A;  2B2T A;  2ZJR A;  3L9A X;  5JEA J;  4X62 L;  3LWE A;  4H7B A;  4IOA A;  2C5C A;  5C4H A;  1W2B A;  4CJ2 C;  3CCE A;  4L8J A;  4QB4 A;  4DXG A;  1H9J A;  2A69 D;  3M4O H;  1C4Q A;  3SK4 A;  4NDX A;  2NYZ D;  1SN8 A;  3TZU A;  1W6J A;  1S5D D;  1JOO A;  2D2C C;  4RMF A;  4DV0 Q;  4X65 Q;  2NVT B;  5LHY 1;  1AE3 A;  3C1F A;  3A5U A; 
#chains in the Genus database with same CATH homology
 2HT1 A;  4DUZ Q;  1KL9 A;  2OQ0 A;  2R7F A;  4AIM A;  1VQ6 A;  4JI1 Q;  4DR5 L;  2RCN A;  1WCM H;  1S3O A;  3CCM A;  4YY3 Q;  1XMQ Q;  4HJ9 A;  3GDE A;  1VQ8 A;  2WAQ G;  2WFW A;  1SLJ A;  3RR5 A;  1NMF A;  3G6E A;  4JG2 A;  2UXC Q;  1I3Q H;  5JJI A;  1OTC A;  1PFS A;  4JI2 Q;  5IYB H;  3UDG A;  1PH2 A;  3GTO H;  4DV3 L;  1YHA A;  4X64 Q;  3H3V H;  4X66 L;  2ZTE A;  1E3P A;  3RN5 A;  1FVI A;  3CCV A;  4HJ7 A;  2OCE A;  3HOW G;  4YHH Q;  4HIO A;  2Y0S G;  4POG A;  3CW2 C;  3M85 A;  2AMC B;  1NBW A;  4GN4 B;  5LMN Q;  2F4V L;  2IX1 A;  1KXL A;  3WWV A;  3UE0 A;  4AYB E;  1V1Q A;  3DM3 A;  3J7Z C;  2RHQ B;  1HJP A;  4A3C G;  1MKH A;  4WJ4 A;  5C44 H;  1X55 A;  1Q1E A;  3A74 A;  1UE5 A;  2I0Q A;  1WYD A;  2MNA A;  3GTJ H;  1GD7 A;  4YCW A;  5IY0 A;  1K3R A;  3GO5 A;  3HFZ B;  1J5E Q;  3CCL A;  1YJ9 A;  2EIF A;  2YTV A;  5AJ3 Q;  1Y1V G;  2HQL A;  2N8N A;  4KLK A;  4A3L G;  4AQY L;  2Q2T A;  4DR1 Q;  4GOP B;  4JI5 Q;  4A93 G;  2UXD Q;  5IWA L;  2H5X A;  1K8A C;  5GRO A;  4A75 A;  3F2B A;  3RN2 A;  1UE7 A;  2Z6K C;  4A3I H;  3PO3 G;  4JI4 Q;  4GNX C;  1QUQ A;  2K50 A;  3CCJ A;  1HH2 P;  4UP8 A;  4L5T A;  4LUZ A;  2B63 G;  2JA7 H;  4DR4 Q;  3HOX H;  1G51 A;  2DUD A;  3D0F A;  3Q8D A;  5J3B A;  4DV5 Q;  1JMC A;  1VQK A;  4TQU S;  1YJW A;  4JBW A;  2YV5 A;  1FJG L;  2KCM A;  1X3F A;  1L1O C;  1YBY A;  4LFA L;  1L0W A;  3RNU A;  4DUY Q;  2R6G A;  4B3S Q;  4A3K H;  2JEB I;  4UP9 A;  2VQE Q;  2VUM G;  4JBM A;  1I94 L;  4IJH A;  3S16 H;  5C0X J;  3G48 A;  1WFQ A;  3NEN A;  3W5O A;  4LF8 L;  4BBR G;  1CKN A;  2UUB Q;  4LF7 Q;  3L7Z C;  4JI8 Q;  3PF5 A;  2R7Z H;  4DR3 L;  1V43 A;  2VQF Q;  4JI7 L;  1J6Q A;  3UE1 A;  4QGU A;  3AEV A;  4JYA Q;  2OTJ A;  3KF8 B;  4YCV A;  2NVY H;  2R7D A;  1JJ2 A;  5FLX c;  1HNW Q;  1PYS B;  3KF6 A;  3K80 C;  5IP7 G;  3AYH B;  4H02 A;  4JI6 Q;  3TRZ A;  3I4M G;  1NMG A;  3HOW H;  3PIP A;  1IBL L;  1N9W A;  1P16 A;  5C4J H;  4IFD J;  1X56 A;  1GVP A;  1U5K A;  4LF4 L;  1VQD A;  1AE2 A;  1YVC A;  4DV2 L;  4L5R C;  2ATW A;  1C0A A;  1EWI A;  4O0A A;  3F2D A;  3CAM A;  2NVX H;  1Z47 A;  3EIV A;  3MXN B;  3ULP A;  3SGI A;  4DV6 Q;  4NPS A;  1HR0 L;  2ZJP A;  5IYC G;  1WI5 A;  1V9P A;  1KQS A;  3NEM A;  2K52 A;  2HIX A;  1Q81 C;  1IBK Q;  1VQG A;  1BBU A;  4R4C A;  4JI0 L;  5FLM H;  4UPA A;  3CC2 A;  1N32 L;  1X9N A;  4KHP Q;  1Y1W G;  4FDB A;  4GN5 A;  3M9B A;  4TVA B;  2JA9 A;  3OW2 A;  2VY3 A;  4NXN L;  3LGJ A;  4GKK Q;  1VQ7 A;  4A3F H;  2EXD A;  3H0G H;  4APV A;  2UXB L;  2NZO A;  4DR5 Q;  2LXK A;  3TRE A;  4B3T L;  1IYJ B;  3I56 A;  1FGU A;  1R9T H;  1LYL A;  5GAD C;  4BXX H;  2PMZ E;  4P72 A;  5M3M G;  4BBS H;  2EQS A;  2IX0 A;  3J81 j;  1EFW A;  5IYD G;  1XMO Q;  1VCI A;  2K5N A;  1HR0 W;  4QQB X;  1Q86 C;  3PUW A;  4DV3 Q;  4X66 Q;  1PH8 A;  4BY1 G;  2MQH A;  1HZA A;  2FXQ A;  4WJ3 M;  1Q12 A;  1VQB A;  1Q7Y C;  4LF5 L;  5C4X G;  3PO2 H;  2JQO A;  1X3G A;  3GTM H;  2PI2 A;  3HKS A;  4A3M G;  4JI3 L;  3IRB A;  3F2C A;  2HHH L;  2B3G A;  3U50 C;  5C3E G;  2PI2 E;  2OTL A;  4LF9 L;  2UU9 L;  1KRT A;  1N33 L;  2AWN A;  5FJ8 H;  3HOV H;  3ULL A;  2WAQ E;  3KDF B;  1SR3 A;  4GNX B;  4UP7 A;  1QZG A;  3MEF A;  1C9O A;  4A3E G;  4A3B H;  4LFB L;  3W1G A;  4AQY Q;  1BVS A;  4RG1 A;  2JEA I;  4IFD G;  4P73 A;  2ZTD A;  3TEH B;  3L0O A;  1YHQ A;  1N34 Q;  2A19 A;  4C3I H;  4OWT B;  5IWA Q;  1PH9 A;  5DLQ E;  1PH4 A;  3J81 i;  1E7Z A;  4DV1 L;  1KHI A;  2ZTC A;  2Y0S E;  1L1O B;  1YJN A;  3BZC A;  2A1A A;  4DAM A;  3CCU A;  4PZ7 A;  5GAH C;  2R92 G;  3CD6 A;  3I55 A;  1CKO A;  1XNR L;  2CWP A;  3S14 H;  3B6Y A;  2QEX A;  3AFP A;  4LF6 Q;  4DR7 L;  4DV7 L;  4R4T A;  1TWF H;  3H15 A;  1QVF A;  1VQE A;  3KJP A;  1XPR A;  1HNX L;  3M7N A;  3S2H H;  1YZ6 A;  4MTN A;  2JA6 G;  2R93 G;  1GO3 E;  1B8A A;  4QJF A;  3FP9 A;  5BR8 L;  2UUA Q;  1FJG Q;  4A3D H;  1VQO A;  4B3R Q;  4LFA Q;  1CUK A;  1GKH A;  4A3G G;  5JEA G;  1S40 A;  1I94 Q;  1UWV A;  4POF A;  1JB7 A;  4NXM L;  4KHZ A;  1N36 L;  2PNH A;  1AH9 A;  1Q1B A;  3PV0 A;  4DPG A;  4LF8 Q;  2UUC L;  2MO0 A;  2ZJQ A;  3FKI G;  2I5H A;  3K7U C;  3CQZ H;  5HY6 A;  4DR3 Q;  4Y7N H;  3PUY A;  1HNZ L;  4JV5 Q;  5IYD H;  4JI7 Q;  1K8G A;  1PYB A;  3KLW A;  3STB D;  4GLA C;  1PV4 A;  3M3Y H;  2ID0 A;  3S1N H;  1DGS A;  4BY1 H;  2AKW B;  2GVA A;  1IBL Q;  5M3F G;  1I5F A;  1TWH H;  1NY4 A;  2D0O A;  3PO2 G;  4L5Q A;  3HOY G;  1YNX A;  1WOC A;  2PQA B;  3CXC A;  1W3S A;  1VQ5 A;  4LF4 Q;  1MJE A;  2K5V A;  4DV2 Q;  3S2D H;  3UDX A;  2KEN A;  3ERS X;  5E7N A;  4JCV E;  4DR2 L;  2KHI A;  3OYY A;  3HOZ G;  1HR0 Q;  1MIU A;  3UDI A;  3KFU A;  4X64 L;  1E22 A;  1I50 H;  3S1Q H;  2XGT A;  2KBN A;  1TWG H;  4JI0 Q;  4OO1 I;  3U4V A;  1N32 Q;  3CPF A;  1RL2 A;  4YHH L;  3I4N G;  3S24 A;  4PZ6 A;  3RLO A;  1VQC A;  4J15 A;  4NXN Q;  5LMN L;  5GAG C;  4LWC A;  3VDY A;  3J80 i;  3OTO L;  1Z9F A;  4X62 Q;  2JA8 G;  1KIX A;  4BA1 I;  4BA2 I;  4XTC S;  1KC8 C;  4LFC L;  4B3T Q;  4P75 A;  2I5L X;  2BH2 A;  4MNO A;  4K0K L;  2IY5 B;  2C35 B;  5IP9 G;  1N8R C;  4GS3 A;  2R93 H;  4A3C H;  3S1R H;  3AQQ A;  4LUV A;  3TS2 A;  4HIM A;  4L5S A;  1PH1 A;  3DLL A;  3ZJY C;  2UXD L;  1X65 A;  4C3H H;  2XTI A;  1YIJ A;  4NB3 A;  1G29 1;  4OO1 G;  2F3I A;  1Y1V H;  4A3L H;  3HOU G;  2LXJ A;  1OXV A;  2E5L L;  2Q2H A;  4AH6 A;  4JI3 Q;  1OXT A;  4A93 H;  3KJO A;  4GKJ L;  2HHH Q;  3NEL A;  2MO1 A;  4HJ5 A;  3K81 C;  1IBM L;  2MFI A;  5C0X I;  1VQM A;  1D8L A;  4KI0 A;  1VQ4 A;  2UU9 Q;  5GAE C;  1XPO A;  4LF9 Q;  4C2M H;  1N33 Q;  3PO3 H;  3F1Z A;  1CKM A;  3BJU A;  5GQO A;  1HZB A;  4XIG S;  3TQY A;  3CF5 A;  5IYB G;  1XNQ L;  2B63 H;  2JA5 G;  4MZ9 A;  3PUV A;  4DUY L;  3T1H L;  1KD1 C;  2Q2U A;  2IHF A;  4OX9 L;  4YCU A;  4IO9 A;  1IXR A;  1VQL A;  3PIO A;  1YIT A;  3GTG H;  2IHE A;  1LM0 A;  1QUQ B;  1UE6 A;  1OXS C;  2AWO A;  4OWX B;  3ER0 A;  1EQQ A;  3UDF A;  4IFD I;  4GLV B;  1I6H H;  1K73 C;  1P8L A;  1WJJ A;  2VUM H;  1NE3 A;  4P74 A;  5IT9 c;  3PSI A;  3J81 c;  2E2J H;  2JE6 I;  5C44 G;  4A76 A;  1D7Q A;  1YHB A;  4R4Q A;  1XNR Q;  4BBR H;  4GOP A;  2YYZ A;  1BBW A;  5ELO A;  5C0X G;  2F4V Q;  4DR7 Q;  3T1Y L;  4HIK A;  1HNX Q;  3E9I A;  4LW1 A;  4IOC A;  2Z0S A;  5IP7 H;  1K83 H;  1EIF A;  1YEZ A;  5EAY A;  2V1C C;  2JA8 H;  1CKN B;  3I4M H;  2JJQ A;  2B29 A;  3S15 H;  2BA1 A;  4OON A;  1PH5 A;  3S17 H;  1JJC B;  1Q46 A;  3KOJ A;  4NXM Q;  2PQA A;  1N36 Q;  4PG3 A;  1UEB A;  4A3I G;  1XJV A;  3KF6 B;  1KRS A;  4JBK A;  1B7Y B;  1A62 A;  2BH8 A;  1IBK L;  2E8G A;  4YWM A;  1C7Y A;  1HNZ Q;  3CC4 A;  4DR6 L;  2RHS B;  2JA7 G;  2NVT H;  2RF4 A;  4KHP L;  3TS0 A;  2N3S A;  4GLX A;  1IZ6 A;  5IYC H;  3PGZ A;  1A0I A;  1XPU A;  4PZ8 A;  1M1K C;  3G4S A;  1EYG A;  1E1T A;  3GTP H;  4GKK L;  3U4Z A;  3HOU H;  3S1M H;  2WB1 G;  3U58 A;  1Y1W H;  2YTY A;  3CP0 A;  4JBJ A;  4A3K G;  5LMU L;  3JC6 6;  3PCO B;  1VQJ A;  1HZ9 A;  3PUX A;  1CSP A;  4R4I A;  4JOI A;  4DR2 Q;  2QA4 A;  2NN6 I;  2NZH A;  4BY7 G;  1VS0 A;  4QL5 A;  3STB C;  3CCQ A;  4GN3 B;  2R7Z G;  4DV4 L;  2F52 A;  2GN5 A;  1EOV A;  1XMO L;  2JA5 H;  3CMA A;  1PH7 A;  3ICE A;  5JJK A;  1FL0 A;  3JAM i;  5M3M H;  4B3M L;  1CSQ A;  1EUJ A;  1H95 A;  3CCR A;  1UE1 A;  1VQA A;  3L2P A;  1JJG A;  2CQO A;  4IPC A;  2D62 A;  4DV0 L;  4OWW B;  4X65 L;  2N78 A;  2ZM6 L;  2KHJ A;  1IL2 A;  2ASB A;  4X6A H;  1Q8K A;  3OTO Q;  2E2H H;  4DUZ L;  4AYB G;  3J80 c;  2K5H A;  4LFC Q;  5C4X H;  1SMX A;  4JI1 L;  2E2I H;  4A3M H;  1SRO A;  3RLN A;  3RLF A;  4YY3 L;  4EX5 A;  4A3J G;  1XMQ L;  2DGY A;  1SFO H;  1PH3 A;  2OWO A;  4K0K Q;  2NN6 G;  5C3E H;  2VS1 A;  3EBE A;  5HGQ A;  5JJL A;  5H1S E;  1TWA H;  2YU9 H;  2UXC L;  1PHJ A;  5FLM G;  3FHW A;  5M5W H;  1HZC A;  3E9H A;  1LTL A;  4R1J A;  3CME A;  1O7I A;  1N34 L;  4JI2 L;  3EN2 A;  1VQN A;  2BA0 A;  4QY7 A;  1M90 C;  4A3E H;  1NJI C;  3A0J A;  4A3F G;  3H0G G;  1S72 A;  4JC0 A;  2E5L Q;  4UY8 C;  4DK6 C;  1E24 A;  2ALY B;  4GKJ Q;  4PMW A;  1MJC A;  3CPW A;  4Y52 H;  4YWK A;  1IBM Q;  1OXU A;  4C3J H;  4LF6 L;  2CKZ B;  1Y14 B;  4IPH A;  3J7A 5;  4BXX G;  2UXB Q;  5M5Y H;  2R92 H;  3A5Z B;  4P71 A;  1EQR A;  4BBS G;  4B3R L;  1KAW A;  1RIP A;  2UUA L;  1A63 A;  3AFQ A;  1XNQ Q;  2HIV A;  1J5E L;  1G6P A;  4ME3 A;  3T1H Q;  4OX9 Q;  3M4Q A;  4HJ8 A;  2L15 A;  2JA6 H;  3KYH C;  5AJ3 L;  1Q82 C;  3H3V I;  2LSS A;  1SRU A;  1X6O A;  2K75 A;  4DR1 L;  4BY7 H;  1E1O A;  2K4K A;  3I2Z A;  1EIY B;  1B70 B;  4JI5 L;  4JV5 L;  3KDF A;  2CWA A;  2Z6K A;  3NBH B;  4OXP A;  4A3G H;  4GNX A;  4HJA A;  1GM5 A;  4LF5 Q;  2YTX A;  2I5M X;  4JI4 L;  1VQF A;  1WCM G;  3FKI H;  5FJ8 G;  4EQ5 A;  3HOV G;  1LUZ A;  3T1Y Q;  5LMN W;  4DR4 L;  1U0L A;  2KCT A;  3RZO H;  2K14 A;  3E0E A;  1T9H A;  4GOP C;  1VQH A;  4A3B G;  4DV5 L;  1QZH A;  1TXY A;  1L1O A;  1A8V A;  3BZK A;  3K8A A;  3M4P A;  2CFM A;  2IT1 A;  3K7A H;  4O2D A;  3GD7 A;  4A4I A;  1YI2 A;  3RZD H;  1PA6 A;  4LUO A;  5M3F H;  2AHO B;  5ELN A;  4B3S L;  2VW9 A;  3HOY H;  4A3J H;  2QGQ A;  1K0R A;  1K9M C;  4QIW E;  2VQE L;  4LFB Q;  3HKZ E;  1NTG A;  1OXX K;  4YWL A;  3CCS A;  1ASZ A;  2A8V A;  4IPD A;  3HKZ G;  4DR6 Q;  3I4O A;  3I7F A;  4HID A;  2UUB L;  4LF7 L;  3W1B A;  4DAY B;  4JI8 L;  3CC7 A;  3GTQ H;  2WP8 J;  2JK8 A;  3GTL H;  2CCZ A;  3HOZ H;  2VQF L;  2ES2 A;  5K36 G;  1X3E A;  2VL6 A;  2D0P A;  1XTD A;  4DV1 Q;  4JYA L;  4LNQ A;  3PF4 A;  1ASY A;  2VNU D;  1QVC A;  2ZJR A;  4IJL A;  4R4O A;  4A3D G;  1HNW L;  5JEA J;  4DK3 C;  4JI6 L;  4X62 L;  1SE8 A;  4IOA A;  3I4N H;  4DV7 Q;  5LMU Q;  1W2B A;  2OQK A;  2N49 A;  3ULJ A;  1QVG A;  3BU2 A;  3PUZ A;  5BR8 Q;  4DKA C;  3CCE A;  1JT8 A;  1PVO A;  3G71 A;  1BKB A;  2Q2I A;  4IPG A;  4JOI C;  4DV4 Q;  4DV6 L;  5M5X H;  3M4O H;  3K0X A;  5IP9 H;  3GTK H;  3F8T A;  2UUC Q;  4B3M Q;  1SN8 A;  3D31 A;  5IE8 A;  1VQP A;  1PH6 A;  3JAM c;  2VZA A;  1L2F A;  4ALP A;  3HOX G;  1VQI A;  4DV0 Q;  4RMF A;  2NVQ H;  1X54 A;  4X65 Q;  2ZM6 Q;  1JE5 A;  1VQ9 A;  2GVB A;  1AE3 A;  3A5U A;  1TWC H;  2WB1 E;  4DNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...