4DR4I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4I00
4X64I 4LF8E 3J80C 2HFSA 4FN5A 2LJPA 2VF3A 4ED4A 4UT4A 4AQYE 5LMUE 3LPSA 2R3VA 4P52A 5IT9Q 1FWKA 4KQVA 2BV3A 1HNWE 4DV6I 1ZXNA 2ZM6E 4DR4I 3D4JA 2UXCE 3WU4A 1KIJA 4JI3E 4PU9A 1NHJA 4LFBI 3J80Q 4JI6E 4B3RI 4EMDA 2UUAI 3WU6A 4JI0E 4DR6E 2V2QA 5BR8E 1XMQI 1XMOE 2BM0A 4RPFA 4YY3E 3F0NA 1NHHA 3V2UC 4WUCA 5A2QC 1FNMA 3ZZUA 2EFGA 4NXNI 1Z0TA 1H7SA 1Z0EA 3H4LA 4DV3E 4DV4E 4KHPE 3GONA 1K47A 4LFCE 4X65E 3J7AG 1J5EE 2NPFA 4DR7E 4DU8A 2Q2EB 4LF7E 4HY1A 4DUYE 4B3SE 1KVKA 2HK2A 1PKPA 5A2QQ 2VQFI 1ZM3A 4B3TE 1XNQE 3WU5A 4NXME 2XEXA 2VQEE 1QZRA 3J7AM 2V2VA 4ZVIA 4GKJI 2F4VE 3B78A 4UTGA 2J7KA 1IBMI 1ZXMA 1N36I 2UXDI 1IBLE 4DR3E 1Z0WA 4FWDA 3QT8A 4DV1I 3ZKDA 1N32I 1N33I 4MYTA 1U2RA 4OX9I 1N0VC 4Z7YA 3ZM7A 3B82A 5L3JA 2OI2A 1Z0CA 1N0UA 4AQYI 3Q1QA 4JI8I 3K1JA 4WUDA 3OTOI 4MYUA 4LF9I 4JV5E 1N34E 4DPUA 2UXBE 4DV0E 2CZ9A 1IBKE 4LFAI 4JI2E 4JI7I 1BKNA 4DR6I 4JI1E 5BR8I 4YHHE 1ZM4A 1WUUA 1MG7A 1HNZE 4LF5E 1HR0E 1XNRE 2UUBE 1FJGI 1KTVA 2HK3A 2V34A 2X36A 4FWHA 1I94I 1ZM9A 4JYAI 4LF6E 4K0KE 3PYEA 4DV4I 4DV5I 4LF4I 4X62I 2UUCI 4HACB 4X64E 4DXLA 2E5LI 4B3MI 1HNXI 3T1HI 4DR7I 2V2ZA 1UEKA 1RREA 4M1KA 4DV6E 1OJ4A 4DR4E 3T1YI 1XNQI 4NXMI 4DPWA 2A2DA 3HULA 4DUZI 4DR5I 4LFBE 4JI4I 4B3RE 3JAMC 1FWLA 5FLXC 4PRVA 1XMQE 2HHHI 4DPYA 1Z5BA 3LTOA 4DV2I 4GKKI 2HKEA 4X66E 3B8HA 5LMNE 3J81C 2X7IA 5IWAE 4P7AA 4DR2E 4DU7A 4DV7I 3JAMQ 1Z0BA 3QT7A 2GS8A 4LF8I 4USMA 1PIEA 4DR1E 2R42A 3ZZTA 1ZM2A 1MU5A 4DPXA 3ZKBA 2HFUA 5LMUI 5GMEA 4JI2I 4USKA 1EI1A 3V5RA 3PYFA 1HNWI 2ZM6I 3M6AA 2UU9E 2UXCI 4JI3I 4FW9A 1VISA 1IBME 1EA6A 2UXDE 4JI6I 1FKAE 2A2CA 1Z0VA 4DV1E 3ZZ0A 1FI4A 4JI0I 1XHKA 1N32E 1S16A 1XMOI 1N33E 2V8PA 4YY3I 4OX9E 4XTJA 4WUBA 2DEIA 4JI8E 3OTOE 4DV3I 3QT5A 4JI5E 1A6FA 4KHPI 4LF9E 4HACA 4LFCI 4HYMA 2BM1A 3WU3A 4X65I 3LNUA 1D6TA 1J5EI 5LL6R 2E1RA 4LFAE 4LF7I 4DUYI 4B3SI 4JI7E 1ELOA 4B3TI 2ZITA 1FJGE 2VQEI 1B63A 2DEJA 4X66I 5LMNI 2F4VI 5IWAI 1Z5AA 1H72C 1I94E 4JYAE 4DR2I 2AJ4A 2UUAE 1IBLI 4DR3I 4PRXA 3K17A 2ZBKB 4DV5E 4LF4E 4X62E 2UUCE 1NHIA 2E5LE 1Z5CA 3CWVA 4B3ME 1HNXE 3QT6A 4DR1I 3T1HE 1Z0GA 4HXZA 1PVGA 1S4EA 4NXNE 1H73A 4JG4A 5FLXQ 1Z59A 1NZ0A 3T1YE 4JV5I 1DARA 1N34I 2UU9I 4R1FA 4DUZE 4DR5E 4FWGA 1B62A 2UXBI 4DV0I 4JI4E 3PYGA 1H74A 3J81Q 1IBKI 2WW4A 2VQFE 2HHHE 4URLA 1KKHA 2HKJA 4JI1I 4YHHI 4Z7CA 1RR9A 4DV2E 1HNZI 4GKKE 4LF5I 1HR0I 1XNRI 2UUBI 4GKJE 4I3HA 1N36E 4DPTA 1H7UA 5IT9C 4LF6I 3PYDA 4DV7E 4K0KI 1MX0A 4JI5I 5GMDA
chains in the Genus database with same CATH superfamily
1OYSA 4LPFA 4X64I 4LF8E 3J80C 2CG9A 2HFSA 3GMEA 3PRYA 4FN5A 5EL9A 2LJPA 2VF3A 4ED4A 4UT4A 4IFDE 4AQYE 5LMUE 3LPSA 5JEAE 2R3VA 5ELWA 4P52A 3UHMA 5IT9Q 1FWKA 4KQVA 2BV3A 1HNWE 4DV6I 1ZXNA 2ZM6E 4DR4I 2C39B 3D4JA 2UXCE 3WU4A 1KIJA 4JI3E 3K85A 4PU9A 1NHJA 4LFBI 3J80Q 4JI6E 4B3RI 3P76A 4EMDA 2C37A 5C0XE 2UUAI 3WU6A 4JI0E 4DR6E 2V2QA 5BR8E 1XMQI 4U3BA 2F1DA 1XMOE 2BM0A 4RPFA 4YY3E 3F0NA 4IFDA 4MU0A 1NHHA 5JEAA 2PNZA 5DRRA 2NN6B 3V2UC 4WUCA 2JEAA 2BR2A 3GLLA 5A2QC 4BA1A 1FNMA 3ZZUA 2EFGA 4NXNI 2BA0D 1UDOA 1Z0TA 1H7SA 1Z0EA 3H4LA 4DV3E 1VI7A 4DV4E 2NN6C 1UDSA 2JE6B 4MU1A 3GONA 4KHPE 3KRNA 1K47A 4LFCE 4X65E 3J7AG 4AIDA 4FW6A 2JEBB 1J5EE 2NPFA 4QNKA 4DR7E 4DU8A 1E3PA 2Q2EB 4LF7E 4HY1A 2Z5EA 4DUYE 4B3SE 5K36B 1KVKA 2HK2A 1PKPA 1YHCA 5A2QQ 2VQFI 2IESA 1ZM3A 4AIMA 4B3TE 5C0XF 1XNQE 3WU5A 4NXME 2XEXA 5K36C 2VQEE 4FW7A 1QZRA 4LOMA 4OO1A 3J7AM 2V2VA 4ZVIA 4GKJI 2F4VE 3B78A 4UTGA 2J7KA 1IBMI 1ZXMA 1N36I 2UXDI 1IBLE 4DR3E 1Z0WA 4FWDA 4IFDD 3QT8A 4DV1I 5JEAD 3ZKDA 1N32I 2PO1A 4LCGA 1N33I 4MYTA 1U2RA 1XXEA 4OX9I 1N0VC 4FW4A 4Z7YA 5DRPA 3ZM7A 3B82A 5L3JA 4MQYA 2OI2A 1Z0CA 2CGEA 1N0UA 1Y60A 3M85G 4AQYI 3Q1QA 4JI8I 3U1KA 3K1JA 4WUDA 3OTOI 4MYUA 2BA1G 3B4TA 1E3HA 4LF9I 4JV5E 4NBQA 1N34E 3M85D 2AE8A 4IZKB 4DPUA 2J65A 2UXBE 4DV0E 2GO4A 2CZ9A 3H1CA 2BA1D 1IBKE 4LFAI 4JI2E 4JI7I 5EKWA 3Q6NA 1BKNA 4DR6I 4JI1E 5BR8I 4YHHE 1ZM4A 4IS9A 1WUUA 1MG7A 1YH8A 1HNZE 2C39A 4LF5E 3HJCA 1HR0E 2C38A 1XNRE 2C38B 2UUBE 1FJGI 2VESA 1KTVA 2HK3A 2V34A 2X36A 4FWHA 1HK7A 1I94I 1ZM9A 4JYAI 1Y6ZA 2PNMA 3PS3A 4LF6E 4K0KE 3PYEA 4DV4I 4DV5I 4LF4I 2Z5CB 4X62I 2UUCI 2BA0G 3DD6A 4HACB 4X64E 4DXLA 2NN6A 2E5LI 4B3MI 2WP8B 4OZEA 1HNXI 3P3EA 3T1HI 4DR7I 3P3GA 2V2ZA 1UEKA 4OO1E 1RREA 2PO2B 4M1KA 2JE6A 3U1YA 4DV6E 4IFDF 1OJ4A 5JEAF 4DR4E 3T1YI 2O1TA 4NXMI 1XNQI 4DPWA 3HKMA 2JEBA 2A2DA 3HULA 3NZKA 4DUZI 4DR5I 4LFBE 3M7ND 1USUA 4JI4I 4B3RE 3JAMC 5K36A 1FWLA 4IZJB 5FLXC 4PRVA 1XMQE 2HHHI 4DPYA 1Z5BA 4MU4A 3LTOA 5C0XB 4DV2I 1OYPA 4GKKI 2HKEA 4X66E 3B8HA 1P42A 3L7ZB 5LMNE 3J81C 2X7IA 4BA2A 5IWAE 4BA2B 4P7AA 4DR2E 1R6MA 3P06A 2Z5BB 2WNRB 4FW5A 4DU7A 4DV7I 3JAMQ 5C0XC 1Z0BA 3QT7A 2PNLA 4OO1F 1Y5YA 2GS8A 4LF8I 1USVA 4USMA 1PIEA 4DR1E 2R42A 3ZZTA 3CDJA 1ZM2A 4QNJA 2PO0B 1MU5A 4DPXA 3ZKBA 2HFUA 5LMUI 4U3DA 2O1VA 5GMEA 4JI2I 4USKA 1EI1A 3V5RA 3PYFA 2CVEA 1HNWI 2ZM6I 3M6AA 2UU9E 2UXCI 4IZKA 4JI3I 4FW9A 1VISA 1IBME 1EA6A 4N3OA 2UXDE 4JI6I 1FKAE 2A2CA 2NN6E 1Z0VA 4MU3A 4LCFA 4DV1E 3ZZ0A 1FI4A 4JI0I 1XHKA 1N32E 1S16A 1XMOI 4OO1D 1N33E 2V8PA 4YY3I 2GO3A 1UDQA 4OX9E 4XTJA 2IOQA 4WUBA 2DEIA 4JI8E 3OTOE 4DV3I 3QT5A 4JI5E 2Z5CA 1A6FA 4KHPI 4LF9E 3CDIA 5K36E 4HACA 5DRQA 4LFCI 4HYMA 2BM1A 3PS2A 3WU3A 4X65I 3LNUA 1D6TA 4OKGA 2WP8A 1J5EI 5LL6R 3GCMA 3P3CA 2E1RA 4LFAE 4LF7I 4DUYI 4B3SI 2C37B 3PS1A 4JI7E 2O1UA 1ELOA 3M7NG 2PO2A 4B3TI 2ZITA 4IFDB 2NN6F 1RHYA 5JEAB 2PNZB 4GQUA 2VQEI 1B63A 1FJGE 2DEJA 4X66I 2IOPA 2JEAB 5LMNI 2BR2B 2F4VI 5IWAI 1Z5AA 1H72C 4BA1B 1I94E 4JYAE 4DR2I 2AJ4A 2UUAE 4IZJA 1IBLI 4MDTA 4IFDC 4DR3I 4PRXA 5JEAC 3K17A 4AM3A 2ZBKB 4LCHA 5DNLA 4DV5E 4LF4E 4X62E 2UUCE 1NHIA 5C0XA 2E5LE 1Z5CA 3CWVA 4B3ME 3L7ZA 1HNXE 3QT6A 4DR1I 3T1HE 1Z0GA 4HXZA 5K36F 2O1WA 1PVGA 1S4EA 1Y4SA 2Z5BA 4NXNE 2WNRA 1H73A 4JG4A 5FLXQ 2NN6D 5DROA 4FW3A 1Z59A 1NZ0A 3T1YE 4JV5I 1DARA 1N34I 2UU9I 4OO1B 4R1FA 4DUZE 4DR5E 4FWGA 1B62A 3Q6MA 2UXBI 4J3DA 4DV0I 4JI4E 2PO0A 3PYGA 1Y4UA 1H74A 3J81Q 2O3ZA 1IBKI 2WW4A 2VQFE 4ISAA 2HHHE 2GQ0A 4URLA 4OO1C 1KKHA 2HKJA 4JI1I 4YHHI 2JT2A 2PO1B 4Z7CA 1RR9A 4DV2E 1HNZI 4GKKE 5FWKA 4LF5I 1HR0I 1XNRI 5K36D 2UUBI 4GKJE 4IZJD 4I3HA 5DNXA 1N36E 4DPTA 1H7UA 1UDNA 1OYRA 5IT9C 4LF6I 3PYDA 4DV7E 2IERA 4K0KI 5C0XD 1R6LA 1MX0A 4JI5I 5GMDA
chains in the Genus database with same CATH topology
4X64I 4LF8E 3J80C 2CG9A 2HFSA 3PRYA 4FN5A 2LJPA 2VF3A 4ED4A 4UT4A 4AQYE 5LMUE 3LPSA 2R3VA 4P52A 5IT9Q 1FWKA 4KQVA 2BV3A 1HNWE 4DV6I 1ZXNA 2ZM6E 4DR4I 3D4JA 2UXCE 3WU4A 1KIJA 4JI3E 3K85A 4PU9A 1NHJA 4LFBI 3J80Q 4JI6E 4B3RI 4EMDA 2UUAI 3WU6A 4JI0E 4DR6E 2V2QA 5BR8E 1XMQI 1XMOE 2BM0A 4RPFA 4YY3E 3F0NA 1NHHA 3V2UC 4WUCA 5A2QC 1FNMA 3ZZUA 2EFGA 4NXNI 1Z0TA 1H7SA 1Z0EA 3H4LA 4DV3E 4DV4E 4KHPE 3GONA 1K47A 4LFCE 4X65E 3J7AG 1J5EE 2NPFA 4DR7E 4DU8A 2Q2EB 4LF7E 4HY1A 2Z5EA 4DUYE 4B3SE 1KVKA 2HK2A 1PKPA 5A2QQ 2VQFI 1ZM3A 4B3TE 1XNQE 3WU5A 4NXME 2XEXA 2VQEE 1QZRA 3J7AM 2V2VA 4ZVIA 4GKJI 2F4VE 3B78A 4UTGA 2J7KA 1IBMI 1ZXMA 1N36I 2UXDI 1IBLE 4DR3E 1Z0WA 4FWDA 3QT8A 4DV1I 3ZKDA 1N32I 1N33I 4MYTA 1U2RA 4OX9I 1N0VC 4Z7YA 3ZM7A 3B82A 5L3JA 2OI2A 1Z0CA 2CGEA 1N0UA 4AQYI 3Q1QA 4JI8I 3K1JA 4WUDA 3OTOI 4MYUA 4LF9I 4JV5E 1N34E 4IZKB 4DPUA 2UXBE 4DV0E 2CZ9A 1IBKE 4LFAI 4JI2E 4JI7I 3Q6NA 1BKNA 4DR6I 4JI1E 5BR8I 4YHHE 1ZM4A 1WUUA 1MG7A 1HNZE 4LF5E 3HJCA 1HR0E 1XNRE 2UUBE 1FJGI 1KTVA 2HK3A 2V34A 2X36A 4FWHA 1HK7A 1I94I 1ZM9A 4JYAI 1Y6ZA 2PNMA 4LF6E 4K0KE 3PYEA 4DV4I 4DV5I 4LF4I 2Z5CB 4X62I 2UUCI 4HACB 4X64E 4DXLA 2E5LI 4B3MI 1HNXI 3T1HI 4DR7I 2V2ZA 1UEKA 1RREA 4M1KA 4DV6E 1OJ4A 4DR4E 3T1YI 2O1TA 4NXMI 1XNQI 4DPWA 2A2DA 3HULA 4DUZI 4DR5I 4LFBE 1USUA 4JI4I 4B3RE 3JAMC 1FWLA 4IZJB 5FLXC 4PRVA 1XMQE 2HHHI 4DPYA 1Z5BA 3LTOA 4DV2I 4GKKI 2HKEA 4X66E 3B8HA 5LMNE 3J81C 2X7IA 5IWAE 4P7AA 4DR2E 3P06A 2Z5BB 4DU7A 4DV7I 3JAMQ 1Z0BA 3QT7A 2PNLA 2GS8A 4LF8I 1USVA 4USMA 1PIEA 4DR1E 2R42A 3ZZTA 1ZM2A 1MU5A 4DPXA 3ZKBA 2HFUA 5LMUI 2O1VA 5GMEA 4JI2I 4USKA 1EI1A 3V5RA 3PYFA 1HNWI 2ZM6I 3M6AA 2UU9E 2UXCI 4IZKA 4JI3I 4FW9A 1VISA 1IBME 1EA6A 4N3OA 2UXDE 4JI6I 1FKAE 2A2CA 1Z0VA 4DV1E 3ZZ0A 1FI4A 4JI0I 1XHKA 1N32E 1S16A 1XMOI 1N33E 2V8PA 4YY3I 4OX9E 4XTJA 2IOQA 4WUBA 2DEIA 4JI8E 3OTOE 4DV3I 3QT5A 4JI5E 2Z5CA 1A6FA 4KHPI 4LF9E 4HACA 4LFCI 4HYMA 2BM1A 3WU3A 4X65I 3LNUA 1D6TA 1J5EI 5LL6R 2E1RA 4LFAE 4LF7I 4DUYI 4B3SI 4JI7E 2O1UA 1ELOA 4B3TI 2ZITA 1FJGE 2VQEI 1B63A 2DEJA 4X66I 2IOPA 5LMNI 2F4VI 5IWAI 1Z5AA 1H72C 1I94E 4JYAE 4DR2I 2AJ4A 2UUAE 4IZJA 1IBLI 4DR3I 4PRXA 3K17A 2ZBKB 4DV5E 4LF4E 4X62E 2UUCE 1NHIA 2E5LE 1Z5CA 3CWVA 4B3ME 1HNXE 3QT6A 4DR1I 3T1HE 1Z0GA 4HXZA 2O1WA 1PVGA 1S4EA 1Y4SA 2Z5BA 4NXNE 1H73A 4JG4A 5FLXQ 1Z59A 3T1YE 1NZ0A 4JV5I 1DARA 1N34I 2UU9I 4R1FA 4DUZE 4DR5E 4FWGA 1B62A 3Q6MA 2UXBI 4DV0I 4JI4E 3PYGA 1Y4UA 1H74A 3J81Q 1IBKI 2WW4A 2VQFE 2HHHE 2GQ0A 4URLA 1KKHA 2HKJA 4JI1I 4YHHI 4Z7CA 1RR9A 4DV2E 1HNZI 4GKKE 5FWKA 4LF5I 1HR0I 1XNRI 2UUBI 4GKJE 4IZJD 4I3HA 1N36E 4DPTA 1H7UA 5IT9C 4LF6I 3PYDA 4DV7E 4K0KI 1MX0A 4JI5I 5GMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 I;  4LF8 E;  3J80 C;  2HFS A;  4FN5 A;  2LJP A;  2VF3 A;  4ED4 A;  4UT4 A;  4AQY E;  5LMU E;  3LPS A;  2R3V A;  4P52 A;  5IT9 Q;  1FWK A;  4KQV A;  2BV3 A;  1HNW E;  4DV6 I;  1ZXN A;  2ZM6 E;  4DR4 I;  3D4J A;  2UXC E;  3WU4 A;  1KIJ A;  4JI3 E;  4PU9 A;  1NHJ A;  4LFB I;  3J80 Q;  4JI6 E;  4B3R I;  4EMD A;  2UUA I;  3WU6 A;  4JI0 E;  4DR6 E;  2V2Q A;  5BR8 E;  1XMQ I;  1XMO E;  2BM0 A;  4RPF A;  4YY3 E;  3F0N A;  1NHH A;  3V2U C;  4WUC A;  5A2Q C;  1FNM A;  3ZZU A;  2EFG A;  4NXN I;  1Z0T A;  1H7S A;  1Z0E A;  3H4L A;  4DV3 E;  4DV4 E;  4KHP E;  3GON A;  1K47 A;  4LFC E;  4X65 E;  3J7A G;  1J5E E;  2NPF A;  4DR7 E;  4DU8 A;  2Q2E B;  4LF7 E;  4HY1 A;  4DUY E;  4B3S E;  1KVK A;  2HK2 A;  1PKP A;  5A2Q Q;  2VQF I;  1ZM3 A;  4B3T E;  1XNQ E;  3WU5 A;  4NXM E;  2XEX A;  2VQE E;  1QZR A;  3J7A M;  2V2V A;  4ZVI A;  4GKJ I;  2F4V E;  3B78 A;  4UTG A;  2J7K A;  1IBM I;  1ZXM A;  1N36 I;  2UXD I;  1IBL E;  4DR3 E;  1Z0W A;  4FWD A;  3QT8 A;  4DV1 I;  3ZKD A;  1N32 I;  1N33 I;  4MYT A;  1U2R A;  4OX9 I;  1N0V C;  4Z7Y A;  3ZM7 A;  3B82 A;  5L3J A;  2OI2 A;  1Z0C A;  1N0U A;  4AQY I;  3Q1Q A;  4JI8 I;  3K1J A;  4WUD A;  3OTO I;  4MYU A;  4LF9 I;  4JV5 E;  1N34 E;  4DPU A;  2UXB E;  4DV0 E;  2CZ9 A;  1IBK E;  4LFA I;  4JI2 E;  4JI7 I;  1BKN A;  4DR6 I;  4JI1 E;  5BR8 I;  4YHH E;  1ZM4 A;  1WUU A;  1MG7 A;  1HNZ E;  4LF5 E;  1HR0 E;  1XNR E;  2UUB E;  1FJG I;  1KTV A;  2HK3 A;  2V34 A;  2X36 A;  4FWH A;  1I94 I;  1ZM9 A;  4JYA I;  4LF6 E;  4K0K E;  3PYE A;  4DV4 I;  4DV5 I;  4LF4 I;  4X62 I;  2UUC I;  4HAC B;  4X64 E;  4DXL A;  2E5L I;  4B3M I;  1HNX I;  3T1H I;  4DR7 I;  2V2Z A;  1UEK A;  1RRE A;  4M1K A;  4DV6 E;  1OJ4 A;  4DR4 E;  3T1Y I;  1XNQ I;  4NXM I;  4DPW A;  2A2D A;  3HUL A;  4DUZ I;  4DR5 I;  4LFB E;  4JI4 I;  4B3R E;  3JAM C;  1FWL A;  5FLX C;  4PRV A;  1XMQ E;  2HHH I;  4DPY A;  1Z5B A;  3LTO A;  4DV2 I;  4GKK I;  2HKE A;  4X66 E;  3B8H A;  5LMN E;  3J81 C;  2X7I A;  5IWA E;  4P7A A;  4DR2 E;  4DU7 A;  4DV7 I;  3JAM Q;  1Z0B A;  3QT7 A;  2GS8 A;  4LF8 I;  4USM A;  1PIE A;  4DR1 E;  2R42 A;  3ZZT A;  1ZM2 A;  1MU5 A;  4DPX A;  3ZKB A;  2HFU A;  5LMU I;  5GME A;  4JI2 I;  4USK A;  1EI1 A;  3V5R A;  3PYF A;  1HNW I;  2ZM6 I;  3M6A A;  2UU9 E;  2UXC I;  4JI3 I;  4FW9 A;  1VIS A;  1IBM E;  1EA6 A;  2UXD E;  4JI6 I;  1FKA E;  2A2C A;  1Z0V A;  4DV1 E;  3ZZ0 A;  1FI4 A;  4JI0 I;  1XHK A;  1N32 E;  1S16 A;  1XMO I;  1N33 E;  2V8P A;  4YY3 I;  4OX9 E;  4XTJ A;  4WUB A;  2DEI A;  4JI8 E;  3OTO E;  4DV3 I;  3QT5 A;  4JI5 E;  1A6F A;  4KHP I;  4LF9 E;  4HAC A;  4LFC I;  4HYM A;  2BM1 A;  3WU3 A;  4X65 I;  3LNU A;  1D6T A;  1J5E I;  5LL6 R;  2E1R A;  4LFA E;  4LF7 I;  4DUY I;  4B3S I;  4JI7 E;  1ELO A;  4B3T I;  2ZIT A;  1FJG E;  2VQE I;  1B63 A;  2DEJ A;  4X66 I;  5LMN I;  2F4V I;  5IWA I;  1Z5A A;  1H72 C;  1I94 E;  4JYA E;  4DR2 I;  2AJ4 A;  2UUA E;  1IBL I;  4DR3 I;  4PRX A;  3K17 A;  2ZBK B;  4DV5 E;  4LF4 E;  4X62 E;  2UUC E;  1NHI A;  2E5L E;  1Z5C A;  3CWV A;  4B3M E;  1HNX E;  3QT6 A;  4DR1 I;  3T1H E;  1Z0G A;  4HXZ A;  1PVG A;  1S4E A;  4NXN E;  1H73 A;  4JG4 A;  5FLX Q;  1Z59 A;  1NZ0 A;  3T1Y E;  4JV5 I;  1DAR A;  1N34 I;  2UU9 I;  4R1F A;  4DUZ E;  4DR5 E;  4FWG A;  1B62 A;  2UXB I;  4DV0 I;  4JI4 E;  3PYG A;  1H74 A;  3J81 Q;  1IBK I;  2WW4 A;  2VQF E;  2HHH E;  4URL A;  1KKH A;  2HKJ A;  4JI1 I;  4YHH I;  4Z7C A;  1RR9 A;  4DV2 E;  1HNZ I;  4GKK E;  4LF5 I;  1HR0 I;  1XNR I;  2UUB I;  4GKJ E;  4I3H A;  1N36 E;  4DPT A;  1H7U A;  5IT9 C;  4LF6 I;  3PYD A;  4DV7 E;  4K0K I;  1MX0 A;  4JI5 I;  5GMD A; 
#chains in the Genus database with same CATH topology
 1OYS A;  4LPF A;  4X64 I;  4LF8 E;  3J80 C;  2CG9 A;  2HFS A;  3GME A;  3PRY A;  4FN5 A;  5EL9 A;  2LJP A;  2VF3 A;  4ED4 A;  4UT4 A;  4IFD E;  4AQY E;  5LMU E;  3LPS A;  5JEA E;  2R3V A;  5ELW A;  4P52 A;  3UHM A;  5IT9 Q;  1FWK A;  4KQV A;  2BV3 A;  1HNW E;  4DV6 I;  1ZXN A;  2ZM6 E;  4DR4 I;  2C39 B;  3D4J A;  2UXC E;  3WU4 A;  1KIJ A;  4JI3 E;  3K85 A;  4PU9 A;  1NHJ A;  4LFB I;  3J80 Q;  4JI6 E;  4B3R I;  3P76 A;  4EMD A;  2C37 A;  5C0X E;  2UUA I;  3WU6 A;  4JI0 E;  4DR6 E;  2V2Q A;  5BR8 E;  1XMQ I;  4U3B A;  2F1D A;  1XMO E;  2BM0 A;  4RPF A;  4YY3 E;  3F0N A;  4IFD A;  4MU0 A;  1NHH A;  5JEA A;  2PNZ A;  5DRR A;  2NN6 B;  3V2U C;  4WUC A;  2JEA A;  2BR2 A;  3GLL A;  5A2Q C;  4BA1 A;  1FNM A;  3ZZU A;  2EFG A;  4NXN I;  2BA0 D;  1UDO A;  1Z0T A;  1H7S A;  1Z0E A;  3H4L A;  4DV3 E;  1VI7 A;  4DV4 E;  2NN6 C;  1UDS A;  2JE6 B;  4MU1 A;  3GON A;  4KHP E;  3KRN A;  1K47 A;  4LFC E;  4X65 E;  3J7A G;  4AID A;  4FW6 A;  2JEB B;  1J5E E;  2NPF A;  4QNK A;  4DR7 E;  4DU8 A;  1E3P A;  2Q2E B;  4LF7 E;  4HY1 A;  2Z5E A;  4DUY E;  4B3S E;  5K36 B;  1KVK A;  2HK2 A;  1PKP A;  1YHC A;  5A2Q Q;  2VQF I;  2IES A;  1ZM3 A;  4AIM A;  4B3T E;  5C0X F;  1XNQ E;  3WU5 A;  4NXM E;  2XEX A;  5K36 C;  2VQE E;  4FW7 A;  1QZR A;  4LOM A;  4OO1 A;  3J7A M;  2V2V A;  4ZVI A;  4GKJ I;  2F4V E;  3B78 A;  4UTG A;  2J7K A;  1IBM I;  1ZXM A;  1N36 I;  2UXD I;  1IBL E;  4DR3 E;  1Z0W A;  4FWD A;  4IFD D;  3QT8 A;  4DV1 I;  5JEA D;  3ZKD A;  1N32 I;  2PO1 A;  4LCG A;  1N33 I;  4MYT A;  1U2R A;  1XXE A;  4OX9 I;  1N0V C;  4FW4 A;  4Z7Y A;  5DRP A;  3ZM7 A;  3B82 A;  5L3J A;  4MQY A;  2OI2 A;  1Z0C A;  2CGE A;  1N0U A;  1Y60 A;  3M85 G;  4AQY I;  3Q1Q A;  4JI8 I;  3U1K A;  3K1J A;  4WUD A;  3OTO I;  4MYU A;  2BA1 G;  3B4T A;  1E3H A;  4LF9 I;  4JV5 E;  4NBQ A;  1N34 E;  3M85 D;  2AE8 A;  4IZK B;  4DPU A;  2J65 A;  2UXB E;  4DV0 E;  2GO4 A;  2CZ9 A;  3H1C A;  2BA1 D;  1IBK E;  4LFA I;  4JI2 E;  4JI7 I;  5EKW A;  3Q6N A;  1BKN A;  4DR6 I;  4JI1 E;  5BR8 I;  4YHH E;  1ZM4 A;  4IS9 A;  1WUU A;  1MG7 A;  1YH8 A;  1HNZ E;  2C39 A;  4LF5 E;  3HJC A;  1HR0 E;  2C38 A;  1XNR E;  2C38 B;  2UUB E;  1FJG I;  2VES A;  1KTV A;  2HK3 A;  2V34 A;  2X36 A;  4FWH A;  1HK7 A;  1I94 I;  1ZM9 A;  4JYA I;  1Y6Z A;  2PNM A;  3PS3 A;  4LF6 E;  4K0K E;  3PYE A;  4DV4 I;  4DV5 I;  4LF4 I;  2Z5C B;  4X62 I;  2UUC I;  2BA0 G;  3DD6 A;  4HAC B;  4X64 E;  4DXL A;  2NN6 A;  2E5L I;  4B3M I;  2WP8 B;  4OZE A;  1HNX I;  3P3E A;  3T1H I;  4DR7 I;  3P3G A;  2V2Z A;  1UEK A;  4OO1 E;  1RRE A;  2PO2 B;  4M1K A;  2JE6 A;  3U1Y A;  4DV6 E;  4IFD F;  1OJ4 A;  5JEA F;  4DR4 E;  3T1Y I;  2O1T A;  4NXM I;  1XNQ I;  4DPW A;  3HKM A;  2JEB A;  2A2D A;  3HUL A;  3NZK A;  4DUZ I;  4DR5 I;  4LFB E;  3M7N D;  1USU A;  4JI4 I;  4B3R E;  3JAM C;  5K36 A;  1FWL A;  4IZJ B;  5FLX C;  4PRV A;  1XMQ E;  2HHH I;  4DPY A;  1Z5B A;  4MU4 A;  3LTO A;  5C0X B;  4DV2 I;  1OYP A;  4GKK I;  2HKE A;  4X66 E;  3B8H A;  1P42 A;  3L7Z B;  5LMN E;  3J81 C;  2X7I A;  4BA2 A;  5IWA E;  4BA2 B;  4P7A A;  4DR2 E;  1R6M A;  3P06 A;  2Z5B B;  2WNR B;  4FW5 A;  4DU7 A;  4DV7 I;  3JAM Q;  5C0X C;  1Z0B A;  3QT7 A;  2PNL A;  4OO1 F;  1Y5Y A;  2GS8 A;  4LF8 I;  1USV A;  4USM A;  1PIE A;  4DR1 E;  2R42 A;  3ZZT A;  3CDJ A;  1ZM2 A;  4QNJ A;  2PO0 B;  1MU5 A;  4DPX A;  3ZKB A;  2HFU A;  5LMU I;  4U3D A;  2O1V A;  5GME A;  4JI2 I;  4USK A;  1EI1 A;  3V5R A;  3PYF A;  2CVE A;  1HNW I;  2ZM6 I;  3M6A A;  2UU9 E;  2UXC I;  4IZK A;  4JI3 I;  4FW9 A;  1VIS A;  1IBM E;  1EA6 A;  4N3O A;  2UXD E;  4JI6 I;  1FKA E;  2A2C A;  2NN6 E;  1Z0V A;  4MU3 A;  4LCF A;  4DV1 E;  3ZZ0 A;  1FI4 A;  4JI0 I;  1XHK A;  1N32 E;  1S16 A;  1XMO I;  4OO1 D;  1N33 E;  2V8P A;  4YY3 I;  2GO3 A;  1UDQ A;  4OX9 E;  4XTJ A;  2IOQ A;  4WUB A;  2DEI A;  4JI8 E;  3OTO E;  4DV3 I;  3QT5 A;  4JI5 E;  2Z5C A;  1A6F A;  4KHP I;  4LF9 E;  3CDI A;  5K36 E;  4HAC A;  5DRQ A;  4LFC I;  4HYM A;  2BM1 A;  3PS2 A;  3WU3 A;  4X65 I;  3LNU A;  1D6T A;  4OKG A;  2WP8 A;  1J5E I;  5LL6 R;  3GCM A;  3P3C A;  2E1R A;  4LFA E;  4LF7 I;  4DUY I;  4B3S I;  2C37 B;  3PS1 A;  4JI7 E;  2O1U A;  1ELO A;  3M7N G;  2PO2 A;  4B3T I;  2ZIT A;  4IFD B;  2NN6 F;  1RHY A;  5JEA B;  2PNZ B;  4GQU A;  2VQE I;  1B63 A;  1FJG E;  2DEJ A;  4X66 I;  2IOP A;  2JEA B;  5LMN I;  2BR2 B;  2F4V I;  5IWA I;  1Z5A A;  1H72 C;  4BA1 B;  1I94 E;  4JYA E;  4DR2 I;  2AJ4 A;  2UUA E;  4IZJ A;  1IBL I;  4MDT A;  4IFD C;  4DR3 I;  4PRX A;  5JEA C;  3K17 A;  4AM3 A;  2ZBK B;  4LCH A;  5DNL A;  4DV5 E;  4LF4 E;  4X62 E;  2UUC E;  1NHI A;  5C0X A;  2E5L E;  1Z5C A;  3CWV A;  4B3M E;  3L7Z A;  1HNX E;  3QT6 A;  4DR1 I;  3T1H E;  1Z0G A;  4HXZ A;  5K36 F;  2O1W A;  1PVG A;  1S4E A;  1Y4S A;  2Z5B A;  4NXN E;  2WNR A;  1H73 A;  4JG4 A;  5FLX Q;  2NN6 D;  5DRO A;  4FW3 A;  1Z59 A;  1NZ0 A;  3T1Y E;  4JV5 I;  1DAR A;  1N34 I;  2UU9 I;  4OO1 B;  4R1F A;  4DUZ E;  4DR5 E;  4FWG A;  1B62 A;  3Q6M A;  2UXB I;  4J3D A;  4DV0 I;  4JI4 E;  2PO0 A;  3PYG A;  1Y4U A;  1H74 A;  3J81 Q;  2O3Z A;  1IBK I;  2WW4 A;  2VQF E;  4ISA A;  2HHH E;  2GQ0 A;  4URL A;  4OO1 C;  1KKH A;  2HKJ A;  4JI1 I;  4YHH I;  2JT2 A;  2PO1 B;  4Z7C A;  1RR9 A;  4DV2 E;  1HNZ I;  4GKK E;  5FWK A;  4LF5 I;  1HR0 I;  1XNR I;  5K36 D;  2UUB I;  4GKJ E;  4IZJ D;  4I3H A;  5DNX A;  1N36 E;  4DPT A;  1H7U A;  1UDN A;  1OYR A;  5IT9 C;  4LF6 I;  3PYD A;  4DV7 E;  2IER A;  4K0K I;  5C0X D;  1R6L A;  1MX0 A;  4JI5 I;  5GMD A; 
#chains in the Genus database with same CATH homology
 4X64 I;  4LF8 E;  3J80 C;  2CG9 A;  2HFS A;  3PRY A;  4FN5 A;  2LJP A;  2VF3 A;  4ED4 A;  4UT4 A;  4AQY E;  5LMU E;  3LPS A;  2R3V A;  4P52 A;  5IT9 Q;  1FWK A;  4KQV A;  2BV3 A;  1HNW E;  4DV6 I;  1ZXN A;  2ZM6 E;  4DR4 I;  3D4J A;  2UXC E;  3WU4 A;  1KIJ A;  4JI3 E;  3K85 A;  4PU9 A;  1NHJ A;  4LFB I;  3J80 Q;  4JI6 E;  4B3R I;  4EMD A;  2UUA I;  3WU6 A;  4JI0 E;  4DR6 E;  2V2Q A;  5BR8 E;  1XMQ I;  1XMO E;  2BM0 A;  4RPF A;  4YY3 E;  3F0N A;  1NHH A;  3V2U C;  4WUC A;  5A2Q C;  1FNM A;  3ZZU A;  2EFG A;  4NXN I;  1Z0T A;  1H7S A;  1Z0E A;  3H4L A;  4DV3 E;  4DV4 E;  4KHP E;  3GON A;  1K47 A;  4LFC E;  4X65 E;  3J7A G;  1J5E E;  2NPF A;  4DR7 E;  4DU8 A;  2Q2E B;  4LF7 E;  4HY1 A;  2Z5E A;  4DUY E;  4B3S E;  1KVK A;  2HK2 A;  1PKP A;  5A2Q Q;  2VQF I;  1ZM3 A;  4B3T E;  1XNQ E;  3WU5 A;  4NXM E;  2XEX A;  2VQE E;  1QZR A;  3J7A M;  2V2V A;  4ZVI A;  4GKJ I;  2F4V E;  3B78 A;  4UTG A;  2J7K A;  1IBM I;  1ZXM A;  1N36 I;  2UXD I;  1IBL E;  4DR3 E;  1Z0W A;  4FWD A;  3QT8 A;  4DV1 I;  3ZKD A;  1N32 I;  1N33 I;  4MYT A;  1U2R A;  4OX9 I;  1N0V C;  4Z7Y A;  3ZM7 A;  3B82 A;  5L3J A;  2OI2 A;  1Z0C A;  2CGE A;  1N0U A;  4AQY I;  3Q1Q A;  4JI8 I;  3K1J A;  4WUD A;  3OTO I;  4MYU A;  4LF9 I;  4JV5 E;  1N34 E;  4IZK B;  4DPU A;  2UXB E;  4DV0 E;  2CZ9 A;  1IBK E;  4LFA I;  4JI2 E;  4JI7 I;  3Q6N A;  1BKN A;  4DR6 I;  4JI1 E;  5BR8 I;  4YHH E;  1ZM4 A;  1WUU A;  1MG7 A;  1HNZ E;  4LF5 E;  3HJC A;  1HR0 E;  1XNR E;  2UUB E;  1FJG I;  1KTV A;  2HK3 A;  2V34 A;  2X36 A;  4FWH A;  1HK7 A;  1I94 I;  1ZM9 A;  4JYA I;  1Y6Z A;  2PNM A;  4LF6 E;  4K0K E;  3PYE A;  4DV4 I;  4DV5 I;  4LF4 I;  2Z5C B;  4X62 I;  2UUC I;  4HAC B;  4X64 E;  4DXL A;  2E5L I;  4B3M I;  1HNX I;  3T1H I;  4DR7 I;  2V2Z A;  1UEK A;  1RRE A;  4M1K A;  4DV6 E;  1OJ4 A;  4DR4 E;  3T1Y I;  2O1T A;  4NXM I;  1XNQ I;  4DPW A;  2A2D A;  3HUL A;  4DUZ I;  4DR5 I;  4LFB E;  1USU A;  4JI4 I;  4B3R E;  3JAM C;  1FWL A;  4IZJ B;  5FLX C;  4PRV A;  1XMQ E;  2HHH I;  4DPY A;  1Z5B A;  3LTO A;  4DV2 I;  4GKK I;  2HKE A;  4X66 E;  3B8H A;  5LMN E;  3J81 C;  2X7I A;  5IWA E;  4P7A A;  4DR2 E;  3P06 A;  2Z5B B;  4DU7 A;  4DV7 I;  3JAM Q;  1Z0B A;  3QT7 A;  2PNL A;  2GS8 A;  4LF8 I;  1USV A;  4USM A;  1PIE A;  4DR1 E;  2R42 A;  3ZZT A;  1ZM2 A;  1MU5 A;  4DPX A;  3ZKB A;  2HFU A;  5LMU I;  2O1V A;  5GME A;  4JI2 I;  4USK A;  1EI1 A;  3V5R A;  3PYF A;  1HNW I;  2ZM6 I;  3M6A A;  2UU9 E;  2UXC I;  4IZK A;  4JI3 I;  4FW9 A;  1VIS A;  1IBM E;  1EA6 A;  4N3O A;  2UXD E;  4JI6 I;  1FKA E;  2A2C A;  1Z0V A;  4DV1 E;  3ZZ0 A;  1FI4 A;  4JI0 I;  1XHK A;  1N32 E;  1S16 A;  1XMO I;  1N33 E;  2V8P A;  4YY3 I;  4OX9 E;  4XTJ A;  2IOQ A;  4WUB A;  2DEI A;  4JI8 E;  3OTO E;  4DV3 I;  3QT5 A;  4JI5 E;  2Z5C A;  1A6F A;  4KHP I;  4LF9 E;  4HAC A;  4LFC I;  4HYM A;  2BM1 A;  3WU3 A;  4X65 I;  3LNU A;  1D6T A;  1J5E I;  5LL6 R;  2E1R A;  4LFA E;  4LF7 I;  4DUY I;  4B3S I;  4JI7 E;  2O1U A;  1ELO A;  4B3T I;  2ZIT A;  1FJG E;  2VQE I;  1B63 A;  2DEJ A;  4X66 I;  2IOP A;  5LMN I;  2F4V I;  5IWA I;  1Z5A A;  1H72 C;  1I94 E;  4JYA E;  4DR2 I;  2AJ4 A;  2UUA E;  4IZJ A;  1IBL I;  4DR3 I;  4PRX A;  3K17 A;  2ZBK B;  4DV5 E;  4LF4 E;  4X62 E;  2UUC E;  1NHI A;  2E5L E;  1Z5C A;  3CWV A;  4B3M E;  1HNX E;  3QT6 A;  4DR1 I;  3T1H E;  1Z0G A;  4HXZ A;  2O1W A;  1PVG A;  1S4E A;  1Y4S A;  2Z5B A;  4NXN E;  1H73 A;  4JG4 A;  5FLX Q;  1Z59 A;  3T1Y E;  1NZ0 A;  4JV5 I;  1DAR A;  1N34 I;  2UU9 I;  4R1F A;  4DUZ E;  4DR5 E;  4FWG A;  1B62 A;  3Q6M A;  2UXB I;  4DV0 I;  4JI4 E;  3PYG A;  1Y4U A;  1H74 A;  3J81 Q;  1IBK I;  2WW4 A;  2VQF E;  2HHH E;  2GQ0 A;  4URL A;  1KKH A;  2HKJ A;  4JI1 I;  4YHH I;  4Z7C A;  1RR9 A;  4DV2 E;  1HNZ I;  4GKK E;  5FWK A;  4LF5 I;  1HR0 I;  1XNR I;  2UUB I;  4GKJ E;  4IZJ D;  4I3H A;  1N36 E;  4DPT A;  1H7U A;  5IT9 C;  4LF6 I;  3PYD A;  4DV7 E;  4K0K I;  1MX0 A;  4JI5 I;  5GMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...