4DR4I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4I00
2UUBI 2UXDE 4JI5E 2A2CA 4DV0I 4FW9A 2UXBE 1PIEA 4DU8A 2NPFA 4JI2I 2UXCI 3ZM7A 4LFBE 4KQVA 1I94I 1ZXNA 2V2QA 4DV2I 4DXLA 4X64E 1VISA 4DPWA 2X7IA 4DUZI 5IWAI 4UTGA 4LF5E 4DPYA 4LF7E 4K0KE 1Z59A 3B78A 1HNWE 1HNXI 1FWLA 3F0NA 3GONA 3PYGA 4DR5I 1H7UA 5LMNI 2BM0A 4MYUA 4DV6I 2ZBKB 3OTOI 5LL6R 4B3ME 4DR1I 4B3RI 1ZM3A 4WUCA 1ZXMA 2UXDI 4JI3I 4JYAE 4LFAE 1XNRE 5IT9Q 3CWVA 4LFBI 3QT7A 3PYEA 4X64I 5FLXC 1FWKA 2DEIA 3PYDA 1MG7A 4Z7YA 4P7AA 1NHIA 2AJ4A 3B82A 1HNZE 2BV3A 1Z0VA 2VQFI 4KHPE 4JI0E 4NXMI 4DR4E 2ZITA 3JAMQ 1XNQE 1N36E 4PRXA 1B62A 4AQYE 3M6AA 4B3TE 4PU9A 4YY3I 4DV3E 1PKPA 1Z0CA 1N0UA 4MYTA 4DR7E 1N34E 1Z0BA 2UUAE 2HK3A 4DR3I 1H72C 4LF6E 4LFAI 1XNRI 4FN5A 4DUYI 2ZM6E 4GKKE 1D6TA 1ELOA 2HKEA 1HR0E 4USKA 2HHHE 1IBMI 1KIJA 4ZVIA 2HKJA 1FNMA 1MX0A 2UU9E 1IBLI 1HNZI 3J81Q 4GKJE 4DV1E 1RREA 4X65E 5BR8E 2VQEE 1N33E 5LMUI 2OI2A 1FJGE 4X62I 1NZ0A 3T1HE 1XNQI 1N36I 1EI1A 4I3HA 4URLA 1J5EE 4AQYI 3LNUA 4JG4A 3LTOA 4DPTA 4DV3I 4WUBA 4JI7E 4DR6I 4EMDA 4DR7I 4LF8E 1N34I 3QT6A 1N32I 2UUAI 4X66E 4PRVA 4JI4I 2F4VE 1FKAE 1XMOE 5IT9C 4DR2I 4M1KA 4GKKI 3ZZUA 4LF4E 1HR0I 2HFSA 4JI5I 3ZKDA 2V2ZA 1RR9A 2UXBI 4GKJI 4DV1I 3K17A 4DV5E 4X65I 1N33I 4FWGA 2E5LE 1BKNA 4JI8E 1Z0EA 3JAMC 2R42A 4LF5I 1KTVA 4LF7I 4K0KI 4WUDA 1HNWI 3PYFA 3T1YE 2X36A 4JI7I 5GMEA 2UUBE 1Z0GA 1Z0WA 4LF8I 5A2QQ 1B63A 2LJPA 2Q2EB 4X66I 3ZZTA 4B3MI 4P52A 2UXCE 1I94E 1K47A 1S16A 4DV2E 1XMOI 1ZM4A 1A6FA 1Z5BA 4DPXA 3J80Q 4LF4I 1KKHA 4JYAI 2GS8A 4LFCE 1HNXE 4DV5I 1U2RA 3J81C 5L3JA 4DR5E 1IBKE 2E5LI 4JI8I 3ZKBA 4HXZA 3OTOE 3H4LA 3QT8A 1S4EA 3ZZ0A 4JV5E 4KHPI 4JI0I 1WUUA 4DR4I 4B3RE 4LF9E 2EFGA 4JI3E 4JI6E 3LPSA 1ZM2A 4B3TI 3D4JA 4HY1A 1Z5AA 4FWHA 1MU5A 4DV7E 1QZRA 4DV4E 1DARA 4RPFA 4LFCI 5GMDA 4LF6I 1UEKA 4DU7A 1NHJA 4JI1E 4OX9E 1H74A 3V2UC 2ZM6I 2VQFE 1IBKI 4NXME 3QT5A 4B3SE 2XEXA 4DPUA 3B8HA 2HHHI 1H7SA 4ED4A 1EA6A 2VF3A 2UU9I 2CZ9A 3WU6A 4YY3E 4XTJA 2HK2A 5BR8I 2VQEI 4Z7CA 1XMQE 2UUCE 2J7KA 1FI4A 4JV5I 1FJGI 4FWDA 3WU3A 3T1HI 4LF9I 4JI6I 1J5EI 4DR3E 5A2QC 4USMA 2R3VA 1NHHA 4YHHE 4DUYE 4NXNE 3HULA 2DEJA 1H73A 4R1FA 4DV7I 2V34A 1IBME 2A2DA 4DV0E 4DV4I 3J80C 1Z5CA 1IBLE 4JI2E 5FLXQ 4JI1I 2F4VI 4OX9I 1KVKA 5LMUE 2BM1A 3WU5A 4X62E 4B3SI 2V2VA 4DUZE 5IWAE 3V5RA 1XHKA 5LMNE 1XMQI 1ZM9A 4HACB 2UUCI 4DV6E 1Z0TA 2E1RA 4DR6E 3K1JA 1N0VC 4HACA 3Q1QA 1N32E 1PVGA 1OJ4A 3J7AM 2V8PA 3J7AG 3WU4A 2HFUA 4JI4E 4DR1E 4YHHI 4UT4A 2WW4A 4DR2E 4NXNI 3T1YI 4HYMA
chains in the Genus database with same CATH superfamily
2UUBI 2UXDE 4JI5E 4OO1F 2A2CA 4DV0I 4FW9A 4LOMA 2UXBE 1PIEA 4DU8A 2NPFA 4IFDB 4JI2I 2UXCI 3ZM7A 4LFBE 4KQVA 1I94I 5K36E 1ZXNA 2V2QA 4IZJD 3CDJA 4DV2I 4DXLA 4X64E 2O1VA 1YH8A 2O3ZA 1VISA 3HKMA 5JEAB 4OO1D 4QNKA 4DPWA 2X7IA 4DUZI 5IWAI 3K85A 4UTGA 4LCGA 2JE6A 4LF5E 4DPYA 4LF7E 4K0KE 4OKGA 1Z59A 3B78A 4QNJA 1HNWE 2GQ0A 1HNXI 1R6MA 1FWLA 3F0NA 1OYRA 4NBQA 3GONA 3PYGA 2CG9A 1H7UA 4DR5I 5LMNI 2BM0A 3P06A 2CVEA 4MYUA 2ZBKB 4FW5A 4DV6I 5K36C 3B4TA 3OTOI 5LL6R 4IZJA 4B3ME 2Z5CB 1YHCA 4IFDE 4DR1I 2VESA 4OO1A 2C37A 5DROA 4B3RI 1ZM3A 4WUCA 1ZXMA 2UXDI 2GO4A 4JI3I 4JYAE 5JEAE 4LFAE 1XNRE 5IT9Q 3CWVA 4LFBI 2C38B 3QT7A 4AIMA 4LPFA 2O1UA 3PYEA 5DNLA 4X64I 5FLXC 2C38A 1FWKA 2DEIA 3PYDA 1MG7A 4Z7YA 1USUA 4P7AA 1NHIA 5EKWA 4IFDC 2AJ4A 3B82A 1HNZE 3Q6NA 3P3EA 2BV3A 1Z0VA 3L7ZB 2C39B 2VQFI 4KHPE 4JI0E 5JEAC 4NXMI 4IFDF 4DR4E 2C39A 2ZITA 3JAMQ 1XNQE 1N36E 4PRXA 1E3PA 1B62A 4AQYE 4IZKB 3M6AA 4B3TE 2JEAA 1HK7A 4PU9A 4LCFA 4YY3I 4IZKA 4DV3E 1PKPA 4AM3A 1Z0CA 4IFDD 1N0UA 3U1YA 2PO1B 2O1TA 4MYTA 4DR7E 5DRQA 2PO1A 1N34E 1Z0BA 2IERA 1USVA 4IS9A 2UUAE 2HK3A 5JEAD 3M7NG 4DR3I 1H72C 4LF6E 4LFAI 1XNRI 4FN5A 4OO1C 5DNXA 4DUYI 2ZM6E 4GKKE 1D6TA 1ELOA 2HKEA 1HR0E 2IESA 4USKA 2HHHE 1IBMI 1KIJA 4ZVIA 2HKJA 1FNMA 1MX0A 4FW6A 2UU9E 2PNLA 1IBLI 1HNZI 4OZEA 4MU0A 3J81Q 4GKJE 4DV1E 1RREA 4X65E 5BR8E 4IFDA 2VQEE 2IOQA 1N33E 5LMUI 2OI2A 1FJGE 4X62I 1OYSA 1NZ0A 3T1HE 4FW7A 1XNQI 1N36I 1EI1A 2Z5EA 5JEAA 4I3HA 4URLA 1J5EE 4AQYI 3LNUA 2JT2A 2BA1D 4JG4A 3LTOA 1Y4UA 1E3HA 3NZKA 4DPTA 4DV3I 4WUBA 5C0XF 4JI7E 2BA1G 4DR6I 4EMDA 4DR7I 5DRPA 4LF8E 1N34I 3QT6A 1N32I 1Y4SA 2UUAI 4X66E 4PRVA 3DD6A 1Y6ZA 4JI4I 2F4VE 5FWKA 1FKAE 1XMOE 5IT9C 2Z5CA 4DR2I 4M1KA 2NN6F 4GKKI 4BA2B 3ZZUA 2WNRB 4LF4E 4ISAA 3KRNA 1HR0I 2HFSA 4JI5I 2WNRA 3ZKDA 2V2ZA 1RR9A 2UXBI 2O1WA 3CDIA 4J3DA 3PS2A 1UDQA 1P42A 4GKJI 4DV1I 3K17A 4DV5E 4X65I 1R6LA 2NN6D 1N33I 5DRRA 4FWGA 4N3OA 2E5LE 1BKNA 4FW3A 4JI8E 4MU3A 2JEBB 1Z0EA 3M85D 3JAMC 2R42A 5C0XB 4LF5I 1KTVA 1VI7A 4BA1B 4LF7I 4K0KI 4WUDA 1HNWI 5C0XA 2Z5BB 3M85G 3PYFA 2AE8A 3L7ZA 1OYPA 3T1YE 2X36A 4JI7I 5GMEA 2UUBE 1Z0GA 1Z0WA 3GLLA 4LF8I 5A2QQ 1B63A 2LJPA 2Q2EB 4X66I 2NN6B 3ZZTA 4P52A 4B3MI 2UXCE 4MQYA 1I94E 1K47A 2NN6A 1S16A 2F1DA 4DV2E 2BA0D 1XMOI 2J65A 1ZM4A 1A6FA 1Z5BA 4DPXA 3J80Q 4LF4I 2WP8B 2BA0G 1KKHA 5EL9A 4JYAI 2GS8A 2WP8A 4LFCE 4GQUA 1HNXE 5C0XE 3PRYA 2PO0B 4DV5I 1U2RA 3J81C 5L3JA 4DR5E 1IBKE 2PO0A 2E5LI 4JI8I 3ZKBA 4HXZA 3OTOE 1UDOA 3H4LA 3QT8A 3U1KA 2NN6E 1S4EA 3ZZ0A 3P3CA 4JV5E 4KHPI 4JI0I 1WUUA 4DR4I 4B3RE 4LF9E 5C0XC 2EFGA 4JI3E 4JI6E 3LPSA 3GMEA 1ZM2A 4B3TI 4MDTA 3D4JA 4HY1A 1Z5AA 4FWHA 1MU5A 4DV7E 1QZRA 2JE6B 4DV4E 1DARA 4RPFA 2NN6C 4LFCI 1Y5YA 5GMDA 4LF6I 1UEKA 4DU7A 1NHJA 2PNZB 4JI1E 5C0XD 4OX9E 1H74A 2PNZA 3V2UC 2ZM6I 3GCMA 2VQFE 1IBKI 4NXME 4MU1A 3QT5A 4B3SE 2XEXA 4DPUA 3B8HA 4BA2A 2HHHI 1XXEA 1H7SA 3H1CA 4ED4A 1EA6A 2VF3A 2UU9I 4IZJB 2CZ9A 3WU6A 4YY3E 4XTJA 4U3BA 3PS1A 2HK2A 5BR8I 2VQEI 4Z7CA 1XMQE 5K36F 2UUCE 2J7KA 4FW4A 2C37B 4OO1B 1FI4A 4JV5I 1FJGI 4FWDA 3WU3A 3T1HI 4MU4A 4LF9I 4JI6I 1J5EI 2JEBA 3Q6MA 4DR3E 5A2QC 4USMA 2R3VA 1NHHA 4BA1A 5K36D 4YHHE 4DUYE 2Z5BA 4NXNE 3HULA 3PS3A 4U3DA 2DEJA 1H73A 4R1FA 4DV7I 2V34A 1IBME 2A2DA 4DV0E 4DV4I 3J80C 1Z5CA 1IBLE 4JI2E 4LCHA 5FLXQ 4JI1I 2F4VI 4OX9I 1KVKA 5LMUE 2BM1A 3WU5A 4X62E 4B3SI 2PO2B 4OO1E 2V2VA 4DUZE 5IWAE 2PO2A 2JEAB 5K36B 2CGEA 1UDNA 3V5RA 2GO3A 4AIDA 5K36A 5JEAF 2IOPA 1XHKA 5LMNE 1XMQI 1ZM9A 5ELWA 4HACB 2UUCI 4DV6E 1Z0TA 2E1RA 2BR2B 4DR6E 3K1JA 3M7ND 3P76A 1N0VC 4HACA 2PNMA 3Q1QA 1N32E 1PVGA 1OJ4A 1Y60A 2BR2A 3J7AM 2V8PA 3UHMA 3J7AG 3WU4A 1UDSA 2HFUA 3P3GA 1RHYA 4JI4E 3HJCA 4DR1E 4YHHI 4UT4A 2WW4A 4DR2E 4NXNI 3T1YI 4HYMA
chains in the Genus database with same CATH topology
2UUBI 2UXDE 4JI5E 2A2CA 4DV0I 4FW9A 2UXBE 1PIEA 4DU8A 2NPFA 4JI2I 2UXCI 3ZM7A 4LFBE 4KQVA 1I94I 1ZXNA 2V2QA 4IZJD 4DV2I 4DXLA 4X64E 2O1VA 1VISA 4DPWA 2X7IA 4DUZI 5IWAI 3K85A 4UTGA 4LF5E 4DPYA 4LF7E 4K0KE 1Z59A 3B78A 1HNWE 2GQ0A 1HNXI 1FWLA 3F0NA 3GONA 3PYGA 2CG9A 1H7UA 4DR5I 5LMNI 2BM0A 3P06A 4MYUA 4DV6I 2ZBKB 3OTOI 5LL6R 4IZJA 4B3ME 2Z5CB 4DR1I 4B3RI 1ZM3A 4WUCA 1ZXMA 2UXDI 4JI3I 4JYAE 4LFAE 1XNRE 5IT9Q 3CWVA 4LFBI 3QT7A 2O1UA 3PYEA 4X64I 5FLXC 1FWKA 2DEIA 3PYDA 1MG7A 4Z7YA 1USUA 4P7AA 1NHIA 2AJ4A 3B82A 1HNZE 3Q6NA 2BV3A 1Z0VA 2VQFI 4KHPE 4JI0E 4NXMI 4DR4E 2ZITA 3JAMQ 1XNQE 1N36E 4PRXA 1B62A 4AQYE 4IZKB 3M6AA 4B3TE 1HK7A 4PU9A 4YY3I 4IZKA 4DV3E 1PKPA 1Z0CA 1N0UA 2O1TA 4MYTA 4DR7E 1N34E 1Z0BA 1USVA 2UUAE 2HK3A 4DR3I 1H72C 4LF6E 4LFAI 1XNRI 4FN5A 4DUYI 2ZM6E 4GKKE 1D6TA 1ELOA 2HKEA 1HR0E 4USKA 2HHHE 1IBMI 1KIJA 4ZVIA 2HKJA 1FNMA 1MX0A 2UU9E 2PNLA 1IBLI 1HNZI 3J81Q 4GKJE 4DV1E 1RREA 4X65E 5BR8E 2VQEE 2IOQA 1N33E 5LMUI 2OI2A 1FJGE 4X62I 1NZ0A 3T1HE 1XNQI 1N36I 1EI1A 2Z5EA 4I3HA 4URLA 1J5EE 4AQYI 3LNUA 4JG4A 3LTOA 1Y4UA 4DPTA 4DV3I 4WUBA 4JI7E 4DR6I 4EMDA 4DR7I 4LF8E 1N34I 3QT6A 1N32I 1Y4SA 2UUAI 4X66E 4PRVA 1Y6ZA 4JI4I 2F4VE 5FWKA 1FKAE 1XMOE 5IT9C 2Z5CA 4DR2I 4M1KA 4GKKI 3ZZUA 4LF4E 1HR0I 2HFSA 4JI5I 3ZKDA 2V2ZA 1RR9A 2UXBI 2O1WA 4GKJI 4DV1I 3K17A 4DV5E 4X65I 1N33I 4FWGA 4N3OA 2E5LE 1BKNA 4JI8E 1Z0EA 3JAMC 2R42A 4LF5I 1KTVA 4LF7I 4K0KI 4WUDA 1HNWI 2Z5BB 3PYFA 3T1YE 2X36A 4JI7I 5GMEA 2UUBE 1Z0GA 1Z0WA 4LF8I 5A2QQ 1B63A 2LJPA 2Q2EB 4X66I 3ZZTA 4P52A 4B3MI 2UXCE 1I94E 1K47A 1S16A 4DV2E 1XMOI 1ZM4A 1A6FA 1Z5BA 4DPXA 3J80Q 4LF4I 1KKHA 4JYAI 2GS8A 4LFCE 1HNXE 3PRYA 4DV5I 1U2RA 3J81C 5L3JA 4DR5E 1IBKE 2E5LI 4JI8I 3ZKBA 4HXZA 3OTOE 3H4LA 3QT8A 1S4EA 3ZZ0A 4JV5E 4KHPI 4JI0I 1WUUA 4DR4I 4B3RE 4LF9E 2EFGA 4JI3E 4JI6E 3LPSA 1ZM2A 4B3TI 3D4JA 4HY1A 1Z5AA 4FWHA 1MU5A 4DV7E 1QZRA 4DV4E 1DARA 4RPFA 4LFCI 5GMDA 4LF6I 1UEKA 4DU7A 1NHJA 4JI1E 4OX9E 1H74A 3V2UC 2ZM6I 2VQFE 1IBKI 4NXME 3QT5A 4B3SE 2XEXA 4DPUA 3B8HA 2HHHI 1H7SA 4ED4A 1EA6A 2VF3A 2UU9I 4IZJB 2CZ9A 3WU6A 4YY3E 4XTJA 2HK2A 5BR8I 2VQEI 4Z7CA 1XMQE 2UUCE 2J7KA 1FI4A 4JV5I 1FJGI 4FWDA 3WU3A 3T1HI 4LF9I 4JI6I 1J5EI 3Q6MA 4DR3E 5A2QC 4USMA 2R3VA 1NHHA 4YHHE 4DUYE 2Z5BA 4NXNE 3HULA 2DEJA 1H73A 4R1FA 4DV7I 2V34A 1IBME 2A2DA 4DV0E 4DV4I 3J80C 1Z5CA 1IBLE 4JI2E 5FLXQ 4JI1I 2F4VI 4OX9I 1KVKA 5LMUE 2BM1A 3WU5A 4X62E 4B3SI 2V2VA 4DUZE 5IWAE 2CGEA 3V5RA 2IOPA 1XHKA 5LMNE 1XMQI 1ZM9A 4HACB 2UUCI 4DV6E 1Z0TA 2E1RA 4DR6E 3K1JA 1N0VC 4HACA 2PNMA 3Q1QA 1N32E 1PVGA 1OJ4A 3J7AM 2V8PA 3J7AG 3WU4A 2HFUA 4JI4E 3HJCA 4DR1E 4YHHI 4UT4A 2WW4A 4DR2E 4NXNI 3T1YI 4HYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB I;  2UXD E;  4JI5 E;  2A2C A;  4DV0 I;  4FW9 A;  2UXB E;  1PIE A;  4DU8 A;  2NPF A;  4JI2 I;  2UXC I;  3ZM7 A;  4LFB E;  4KQV A;  1I94 I;  1ZXN A;  2V2Q A;  4DV2 I;  4DXL A;  4X64 E;  1VIS A;  4DPW A;  2X7I A;  4DUZ I;  5IWA I;  4UTG A;  4LF5 E;  4DPY A;  4LF7 E;  4K0K E;  1Z59 A;  3B78 A;  1HNW E;  1HNX I;  1FWL A;  3F0N A;  3GON A;  3PYG A;  4DR5 I;  1H7U A;  5LMN I;  2BM0 A;  4MYU A;  4DV6 I;  2ZBK B;  3OTO I;  5LL6 R;  4B3M E;  4DR1 I;  4B3R I;  1ZM3 A;  4WUC A;  1ZXM A;  2UXD I;  4JI3 I;  4JYA E;  4LFA E;  1XNR E;  5IT9 Q;  3CWV A;  4LFB I;  3QT7 A;  3PYE A;  4X64 I;  5FLX C;  1FWK A;  2DEI A;  3PYD A;  1MG7 A;  4Z7Y A;  4P7A A;  1NHI A;  2AJ4 A;  3B82 A;  1HNZ E;  2BV3 A;  1Z0V A;  2VQF I;  4KHP E;  4JI0 E;  4NXM I;  4DR4 E;  2ZIT A;  3JAM Q;  1XNQ E;  1N36 E;  4PRX A;  1B62 A;  4AQY E;  3M6A A;  4B3T E;  4PU9 A;  4YY3 I;  4DV3 E;  1PKP A;  1Z0C A;  1N0U A;  4MYT A;  4DR7 E;  1N34 E;  1Z0B A;  2UUA E;  2HK3 A;  4DR3 I;  1H72 C;  4LF6 E;  4LFA I;  1XNR I;  4FN5 A;  4DUY I;  2ZM6 E;  4GKK E;  1D6T A;  1ELO A;  2HKE A;  1HR0 E;  4USK A;  2HHH E;  1IBM I;  1KIJ A;  4ZVI A;  2HKJ A;  1FNM A;  1MX0 A;  2UU9 E;  1IBL I;  1HNZ I;  3J81 Q;  4GKJ E;  4DV1 E;  1RRE A;  4X65 E;  5BR8 E;  2VQE E;  1N33 E;  5LMU I;  2OI2 A;  1FJG E;  4X62 I;  1NZ0 A;  3T1H E;  1XNQ I;  1N36 I;  1EI1 A;  4I3H A;  4URL A;  1J5E E;  4AQY I;  3LNU A;  4JG4 A;  3LTO A;  4DPT A;  4DV3 I;  4WUB A;  4JI7 E;  4DR6 I;  4EMD A;  4DR7 I;  4LF8 E;  1N34 I;  3QT6 A;  1N32 I;  2UUA I;  4X66 E;  4PRV A;  4JI4 I;  2F4V E;  1FKA E;  1XMO E;  5IT9 C;  4DR2 I;  4M1K A;  4GKK I;  3ZZU A;  4LF4 E;  1HR0 I;  2HFS A;  4JI5 I;  3ZKD A;  2V2Z A;  1RR9 A;  2UXB I;  4GKJ I;  4DV1 I;  3K17 A;  4DV5 E;  4X65 I;  1N33 I;  4FWG A;  2E5L E;  1BKN A;  4JI8 E;  1Z0E A;  3JAM C;  2R42 A;  4LF5 I;  1KTV A;  4LF7 I;  4K0K I;  4WUD A;  1HNW I;  3PYF A;  3T1Y E;  2X36 A;  4JI7 I;  5GME A;  2UUB E;  1Z0G A;  1Z0W A;  4LF8 I;  5A2Q Q;  1B63 A;  2LJP A;  2Q2E B;  4X66 I;  3ZZT A;  4B3M I;  4P52 A;  2UXC E;  1I94 E;  1K47 A;  1S16 A;  4DV2 E;  1XMO I;  1ZM4 A;  1A6F A;  1Z5B A;  4DPX A;  3J80 Q;  4LF4 I;  1KKH A;  4JYA I;  2GS8 A;  4LFC E;  1HNX E;  4DV5 I;  1U2R A;  3J81 C;  5L3J A;  4DR5 E;  1IBK E;  2E5L I;  4JI8 I;  3ZKB A;  4HXZ A;  3OTO E;  3H4L A;  3QT8 A;  1S4E A;  3ZZ0 A;  4JV5 E;  4KHP I;  4JI0 I;  1WUU A;  4DR4 I;  4B3R E;  4LF9 E;  2EFG A;  4JI3 E;  4JI6 E;  3LPS A;  1ZM2 A;  4B3T I;  3D4J A;  4HY1 A;  1Z5A A;  4FWH A;  1MU5 A;  4DV7 E;  1QZR A;  4DV4 E;  1DAR A;  4RPF A;  4LFC I;  5GMD A;  4LF6 I;  1UEK A;  4DU7 A;  1NHJ A;  4JI1 E;  4OX9 E;  1H74 A;  3V2U C;  2ZM6 I;  2VQF E;  1IBK I;  4NXM E;  3QT5 A;  4B3S E;  2XEX A;  4DPU A;  3B8H A;  2HHH I;  1H7S A;  4ED4 A;  1EA6 A;  2VF3 A;  2UU9 I;  2CZ9 A;  3WU6 A;  4YY3 E;  4XTJ A;  2HK2 A;  5BR8 I;  2VQE I;  4Z7C A;  1XMQ E;  2UUC E;  2J7K A;  1FI4 A;  4JV5 I;  1FJG I;  4FWD A;  3WU3 A;  3T1H I;  4LF9 I;  4JI6 I;  1J5E I;  4DR3 E;  5A2Q C;  4USM A;  2R3V A;  1NHH A;  4YHH E;  4DUY E;  4NXN E;  3HUL A;  2DEJ A;  1H73 A;  4R1F A;  4DV7 I;  2V34 A;  1IBM E;  2A2D A;  4DV0 E;  4DV4 I;  3J80 C;  1Z5C A;  1IBL E;  4JI2 E;  5FLX Q;  4JI1 I;  2F4V I;  4OX9 I;  1KVK A;  5LMU E;  2BM1 A;  3WU5 A;  4X62 E;  4B3S I;  2V2V A;  4DUZ E;  5IWA E;  3V5R A;  1XHK A;  5LMN E;  1XMQ I;  1ZM9 A;  4HAC B;  2UUC I;  4DV6 E;  1Z0T A;  2E1R A;  4DR6 E;  3K1J A;  1N0V C;  4HAC A;  3Q1Q A;  1N32 E;  1PVG A;  1OJ4 A;  3J7A M;  2V8P A;  3J7A G;  3WU4 A;  2HFU A;  4JI4 E;  4DR1 E;  4YHH I;  4UT4 A;  2WW4 A;  4DR2 E;  4NXN I;  3T1Y I;  4HYM A; 
#chains in the Genus database with same CATH topology
 2UUB I;  2UXD E;  4JI5 E;  4OO1 F;  2A2C A;  4DV0 I;  4FW9 A;  4LOM A;  2UXB E;  1PIE A;  4DU8 A;  2NPF A;  4IFD B;  4JI2 I;  2UXC I;  3ZM7 A;  4LFB E;  4KQV A;  1I94 I;  5K36 E;  1ZXN A;  2V2Q A;  4IZJ D;  3CDJ A;  4DV2 I;  4DXL A;  4X64 E;  2O1V A;  1YH8 A;  2O3Z A;  1VIS A;  3HKM A;  5JEA B;  4OO1 D;  4QNK A;  4DPW A;  2X7I A;  4DUZ I;  5IWA I;  3K85 A;  4UTG A;  4LCG A;  2JE6 A;  4LF5 E;  4DPY A;  4LF7 E;  4K0K E;  4OKG A;  1Z59 A;  3B78 A;  4QNJ A;  1HNW E;  2GQ0 A;  1HNX I;  1R6M A;  1FWL A;  3F0N A;  1OYR A;  4NBQ A;  3GON A;  3PYG A;  2CG9 A;  1H7U A;  4DR5 I;  5LMN I;  2BM0 A;  3P06 A;  2CVE A;  4MYU A;  2ZBK B;  4FW5 A;  4DV6 I;  5K36 C;  3B4T A;  3OTO I;  5LL6 R;  4IZJ A;  4B3M E;  2Z5C B;  1YHC A;  4IFD E;  4DR1 I;  2VES A;  4OO1 A;  2C37 A;  5DRO A;  4B3R I;  1ZM3 A;  4WUC A;  1ZXM A;  2UXD I;  2GO4 A;  4JI3 I;  4JYA E;  5JEA E;  4LFA E;  1XNR E;  5IT9 Q;  3CWV A;  4LFB I;  2C38 B;  3QT7 A;  4AIM A;  4LPF A;  2O1U A;  3PYE A;  5DNL A;  4X64 I;  5FLX C;  2C38 A;  1FWK A;  2DEI A;  3PYD A;  1MG7 A;  4Z7Y A;  1USU A;  4P7A A;  1NHI A;  5EKW A;  4IFD C;  2AJ4 A;  3B82 A;  1HNZ E;  3Q6N A;  3P3E A;  2BV3 A;  1Z0V A;  3L7Z B;  2C39 B;  2VQF I;  4KHP E;  4JI0 E;  5JEA C;  4NXM I;  4IFD F;  4DR4 E;  2C39 A;  2ZIT A;  3JAM Q;  1XNQ E;  1N36 E;  4PRX A;  1E3P A;  1B62 A;  4AQY E;  4IZK B;  3M6A A;  4B3T E;  2JEA A;  1HK7 A;  4PU9 A;  4LCF A;  4YY3 I;  4IZK A;  4DV3 E;  1PKP A;  4AM3 A;  1Z0C A;  4IFD D;  1N0U A;  3U1Y A;  2PO1 B;  2O1T A;  4MYT A;  4DR7 E;  5DRQ A;  2PO1 A;  1N34 E;  1Z0B A;  2IER A;  1USV A;  4IS9 A;  2UUA E;  2HK3 A;  5JEA D;  3M7N G;  4DR3 I;  1H72 C;  4LF6 E;  4LFA I;  1XNR I;  4FN5 A;  4OO1 C;  5DNX A;  4DUY I;  2ZM6 E;  4GKK E;  1D6T A;  1ELO A;  2HKE A;  1HR0 E;  2IES A;  4USK A;  2HHH E;  1IBM I;  1KIJ A;  4ZVI A;  2HKJ A;  1FNM A;  1MX0 A;  4FW6 A;  2UU9 E;  2PNL A;  1IBL I;  1HNZ I;  4OZE A;  4MU0 A;  3J81 Q;  4GKJ E;  4DV1 E;  1RRE A;  4X65 E;  5BR8 E;  4IFD A;  2VQE E;  2IOQ A;  1N33 E;  5LMU I;  2OI2 A;  1FJG E;  4X62 I;  1OYS A;  1NZ0 A;  3T1H E;  4FW7 A;  1XNQ I;  1N36 I;  1EI1 A;  2Z5E A;  5JEA A;  4I3H A;  4URL A;  1J5E E;  4AQY I;  3LNU A;  2JT2 A;  2BA1 D;  4JG4 A;  3LTO A;  1Y4U A;  1E3H A;  3NZK A;  4DPT A;  4DV3 I;  4WUB A;  5C0X F;  4JI7 E;  2BA1 G;  4DR6 I;  4EMD A;  4DR7 I;  5DRP A;  4LF8 E;  1N34 I;  3QT6 A;  1N32 I;  1Y4S A;  2UUA I;  4X66 E;  4PRV A;  3DD6 A;  1Y6Z A;  4JI4 I;  2F4V E;  5FWK A;  1FKA E;  1XMO E;  5IT9 C;  2Z5C A;  4DR2 I;  4M1K A;  2NN6 F;  4GKK I;  4BA2 B;  3ZZU A;  2WNR B;  4LF4 E;  4ISA A;  3KRN A;  1HR0 I;  2HFS A;  4JI5 I;  2WNR A;  3ZKD A;  2V2Z A;  1RR9 A;  2UXB I;  2O1W A;  3CDI A;  4J3D A;  3PS2 A;  1UDQ A;  1P42 A;  4GKJ I;  4DV1 I;  3K17 A;  4DV5 E;  4X65 I;  1R6L A;  2NN6 D;  1N33 I;  5DRR A;  4FWG A;  4N3O A;  2E5L E;  1BKN A;  4FW3 A;  4JI8 E;  4MU3 A;  2JEB B;  1Z0E A;  3M85 D;  3JAM C;  2R42 A;  5C0X B;  4LF5 I;  1KTV A;  1VI7 A;  4BA1 B;  4LF7 I;  4K0K I;  4WUD A;  1HNW I;  5C0X A;  2Z5B B;  3M85 G;  3PYF A;  2AE8 A;  3L7Z A;  1OYP A;  3T1Y E;  2X36 A;  4JI7 I;  5GME A;  2UUB E;  1Z0G A;  1Z0W A;  3GLL A;  4LF8 I;  5A2Q Q;  1B63 A;  2LJP A;  2Q2E B;  4X66 I;  2NN6 B;  3ZZT A;  4P52 A;  4B3M I;  2UXC E;  4MQY A;  1I94 E;  1K47 A;  2NN6 A;  1S16 A;  2F1D A;  4DV2 E;  2BA0 D;  1XMO I;  2J65 A;  1ZM4 A;  1A6F A;  1Z5B A;  4DPX A;  3J80 Q;  4LF4 I;  2WP8 B;  2BA0 G;  1KKH A;  5EL9 A;  4JYA I;  2GS8 A;  2WP8 A;  4LFC E;  4GQU A;  1HNX E;  5C0X E;  3PRY A;  2PO0 B;  4DV5 I;  1U2R A;  3J81 C;  5L3J A;  4DR5 E;  1IBK E;  2PO0 A;  2E5L I;  4JI8 I;  3ZKB A;  4HXZ A;  3OTO E;  1UDO A;  3H4L A;  3QT8 A;  3U1K A;  2NN6 E;  1S4E A;  3ZZ0 A;  3P3C A;  4JV5 E;  4KHP I;  4JI0 I;  1WUU A;  4DR4 I;  4B3R E;  4LF9 E;  5C0X C;  2EFG A;  4JI3 E;  4JI6 E;  3LPS A;  3GME A;  1ZM2 A;  4B3T I;  4MDT A;  3D4J A;  4HY1 A;  1Z5A A;  4FWH A;  1MU5 A;  4DV7 E;  1QZR A;  2JE6 B;  4DV4 E;  1DAR A;  4RPF A;  2NN6 C;  4LFC I;  1Y5Y A;  5GMD A;  4LF6 I;  1UEK A;  4DU7 A;  1NHJ A;  2PNZ B;  4JI1 E;  5C0X D;  4OX9 E;  1H74 A;  2PNZ A;  3V2U C;  2ZM6 I;  3GCM A;  2VQF E;  1IBK I;  4NXM E;  4MU1 A;  3QT5 A;  4B3S E;  2XEX A;  4DPU A;  3B8H A;  4BA2 A;  2HHH I;  1XXE A;  1H7S A;  3H1C A;  4ED4 A;  1EA6 A;  2VF3 A;  2UU9 I;  4IZJ B;  2CZ9 A;  3WU6 A;  4YY3 E;  4XTJ A;  4U3B A;  3PS1 A;  2HK2 A;  5BR8 I;  2VQE I;  4Z7C A;  1XMQ E;  5K36 F;  2UUC E;  2J7K A;  4FW4 A;  2C37 B;  4OO1 B;  1FI4 A;  4JV5 I;  1FJG I;  4FWD A;  3WU3 A;  3T1H I;  4MU4 A;  4LF9 I;  4JI6 I;  1J5E I;  2JEB A;  3Q6M A;  4DR3 E;  5A2Q C;  4USM A;  2R3V A;  1NHH A;  4BA1 A;  5K36 D;  4YHH E;  4DUY E;  2Z5B A;  4NXN E;  3HUL A;  3PS3 A;  4U3D A;  2DEJ A;  1H73 A;  4R1F A;  4DV7 I;  2V34 A;  1IBM E;  2A2D A;  4DV0 E;  4DV4 I;  3J80 C;  1Z5C A;  1IBL E;  4JI2 E;  4LCH A;  5FLX Q;  4JI1 I;  2F4V I;  4OX9 I;  1KVK A;  5LMU E;  2BM1 A;  3WU5 A;  4X62 E;  4B3S I;  2PO2 B;  4OO1 E;  2V2V A;  4DUZ E;  5IWA E;  2PO2 A;  2JEA B;  5K36 B;  2CGE A;  1UDN A;  3V5R A;  2GO3 A;  4AID A;  5K36 A;  5JEA F;  2IOP A;  1XHK A;  5LMN E;  1XMQ I;  1ZM9 A;  5ELW A;  4HAC B;  2UUC I;  4DV6 E;  1Z0T A;  2E1R A;  2BR2 B;  4DR6 E;  3K1J A;  3M7N D;  3P76 A;  1N0V C;  4HAC A;  2PNM A;  3Q1Q A;  1N32 E;  1PVG A;  1OJ4 A;  1Y60 A;  2BR2 A;  3J7A M;  2V8P A;  3UHM A;  3J7A G;  3WU4 A;  1UDS A;  2HFU A;  3P3G A;  1RHY A;  4JI4 E;  3HJC A;  4DR1 E;  4YHH I;  4UT4 A;  2WW4 A;  4DR2 E;  4NXN I;  3T1Y I;  4HYM A; 
#chains in the Genus database with same CATH homology
 2UUB I;  2UXD E;  4JI5 E;  2A2C A;  4DV0 I;  4FW9 A;  2UXB E;  1PIE A;  4DU8 A;  2NPF A;  4JI2 I;  2UXC I;  3ZM7 A;  4LFB E;  4KQV A;  1I94 I;  1ZXN A;  2V2Q A;  4IZJ D;  4DV2 I;  4DXL A;  4X64 E;  2O1V A;  1VIS A;  4DPW A;  2X7I A;  4DUZ I;  5IWA I;  3K85 A;  4UTG A;  4LF5 E;  4DPY A;  4LF7 E;  4K0K E;  1Z59 A;  3B78 A;  1HNW E;  2GQ0 A;  1HNX I;  1FWL A;  3F0N A;  3GON A;  3PYG A;  2CG9 A;  1H7U A;  4DR5 I;  5LMN I;  2BM0 A;  3P06 A;  4MYU A;  4DV6 I;  2ZBK B;  3OTO I;  5LL6 R;  4IZJ A;  4B3M E;  2Z5C B;  4DR1 I;  4B3R I;  1ZM3 A;  4WUC A;  1ZXM A;  2UXD I;  4JI3 I;  4JYA E;  4LFA E;  1XNR E;  5IT9 Q;  3CWV A;  4LFB I;  3QT7 A;  2O1U A;  3PYE A;  4X64 I;  5FLX C;  1FWK A;  2DEI A;  3PYD A;  1MG7 A;  4Z7Y A;  1USU A;  4P7A A;  1NHI A;  2AJ4 A;  3B82 A;  1HNZ E;  3Q6N A;  2BV3 A;  1Z0V A;  2VQF I;  4KHP E;  4JI0 E;  4NXM I;  4DR4 E;  2ZIT A;  3JAM Q;  1XNQ E;  1N36 E;  4PRX A;  1B62 A;  4AQY E;  4IZK B;  3M6A A;  4B3T E;  1HK7 A;  4PU9 A;  4YY3 I;  4IZK A;  4DV3 E;  1PKP A;  1Z0C A;  1N0U A;  2O1T A;  4MYT A;  4DR7 E;  1N34 E;  1Z0B A;  1USV A;  2UUA E;  2HK3 A;  4DR3 I;  1H72 C;  4LF6 E;  4LFA I;  1XNR I;  4FN5 A;  4DUY I;  2ZM6 E;  4GKK E;  1D6T A;  1ELO A;  2HKE A;  1HR0 E;  4USK A;  2HHH E;  1IBM I;  1KIJ A;  4ZVI A;  2HKJ A;  1FNM A;  1MX0 A;  2UU9 E;  2PNL A;  1IBL I;  1HNZ I;  3J81 Q;  4GKJ E;  4DV1 E;  1RRE A;  4X65 E;  5BR8 E;  2VQE E;  2IOQ A;  1N33 E;  5LMU I;  2OI2 A;  1FJG E;  4X62 I;  1NZ0 A;  3T1H E;  1XNQ I;  1N36 I;  1EI1 A;  2Z5E A;  4I3H A;  4URL A;  1J5E E;  4AQY I;  3LNU A;  4JG4 A;  3LTO A;  1Y4U A;  4DPT A;  4DV3 I;  4WUB A;  4JI7 E;  4DR6 I;  4EMD A;  4DR7 I;  4LF8 E;  1N34 I;  3QT6 A;  1N32 I;  1Y4S A;  2UUA I;  4X66 E;  4PRV A;  1Y6Z A;  4JI4 I;  2F4V E;  5FWK A;  1FKA E;  1XMO E;  5IT9 C;  2Z5C A;  4DR2 I;  4M1K A;  4GKK I;  3ZZU A;  4LF4 E;  1HR0 I;  2HFS A;  4JI5 I;  3ZKD A;  2V2Z A;  1RR9 A;  2UXB I;  2O1W A;  4GKJ I;  4DV1 I;  3K17 A;  4DV5 E;  4X65 I;  1N33 I;  4FWG A;  4N3O A;  2E5L E;  1BKN A;  4JI8 E;  1Z0E A;  3JAM C;  2R42 A;  4LF5 I;  1KTV A;  4LF7 I;  4K0K I;  4WUD A;  1HNW I;  2Z5B B;  3PYF A;  3T1Y E;  2X36 A;  4JI7 I;  5GME A;  2UUB E;  1Z0G A;  1Z0W A;  4LF8 I;  5A2Q Q;  1B63 A;  2LJP A;  2Q2E B;  4X66 I;  3ZZT A;  4P52 A;  4B3M I;  2UXC E;  1I94 E;  1K47 A;  1S16 A;  4DV2 E;  1XMO I;  1ZM4 A;  1A6F A;  1Z5B A;  4DPX A;  3J80 Q;  4LF4 I;  1KKH A;  4JYA I;  2GS8 A;  4LFC E;  1HNX E;  3PRY A;  4DV5 I;  1U2R A;  3J81 C;  5L3J A;  4DR5 E;  1IBK E;  2E5L I;  4JI8 I;  3ZKB A;  4HXZ A;  3OTO E;  3H4L A;  3QT8 A;  1S4E A;  3ZZ0 A;  4JV5 E;  4KHP I;  4JI0 I;  1WUU A;  4DR4 I;  4B3R E;  4LF9 E;  2EFG A;  4JI3 E;  4JI6 E;  3LPS A;  1ZM2 A;  4B3T I;  3D4J A;  4HY1 A;  1Z5A A;  4FWH A;  1MU5 A;  4DV7 E;  1QZR A;  4DV4 E;  1DAR A;  4RPF A;  4LFC I;  5GMD A;  4LF6 I;  1UEK A;  4DU7 A;  1NHJ A;  4JI1 E;  4OX9 E;  1H74 A;  3V2U C;  2ZM6 I;  2VQF E;  1IBK I;  4NXM E;  3QT5 A;  4B3S E;  2XEX A;  4DPU A;  3B8H A;  2HHH I;  1H7S A;  4ED4 A;  1EA6 A;  2VF3 A;  2UU9 I;  4IZJ B;  2CZ9 A;  3WU6 A;  4YY3 E;  4XTJ A;  2HK2 A;  5BR8 I;  2VQE I;  4Z7C A;  1XMQ E;  2UUC E;  2J7K A;  1FI4 A;  4JV5 I;  1FJG I;  4FWD A;  3WU3 A;  3T1H I;  4LF9 I;  4JI6 I;  1J5E I;  3Q6M A;  4DR3 E;  5A2Q C;  4USM A;  2R3V A;  1NHH A;  4YHH E;  4DUY E;  2Z5B A;  4NXN E;  3HUL A;  2DEJ A;  1H73 A;  4R1F A;  4DV7 I;  2V34 A;  1IBM E;  2A2D A;  4DV0 E;  4DV4 I;  3J80 C;  1Z5C A;  1IBL E;  4JI2 E;  5FLX Q;  4JI1 I;  2F4V I;  4OX9 I;  1KVK A;  5LMU E;  2BM1 A;  3WU5 A;  4X62 E;  4B3S I;  2V2V A;  4DUZ E;  5IWA E;  2CGE A;  3V5R A;  2IOP A;  1XHK A;  5LMN E;  1XMQ I;  1ZM9 A;  4HAC B;  2UUC I;  4DV6 E;  1Z0T A;  2E1R A;  4DR6 E;  3K1J A;  1N0V C;  4HAC A;  2PNM A;  3Q1Q A;  1N32 E;  1PVG A;  1OJ4 A;  3J7A M;  2V8P A;  3J7A G;  3WU4 A;  2HFU A;  4JI4 E;  3HJC A;  4DR1 E;  4YHH I;  4UT4 A;  2WW4 A;  4DR2 E;  4NXN I;  3T1Y I;  4HYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...