4DR4I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4I00
4DXLA 1Z0BA 1HR0E 4DV1I 2E5LI 1DARA 4JV5I 2R3VA 4LF9E 1Z5AA 2V2QA 2HFUA 1PVGA 4DR3I 1XMQE 3J7AM 4DV1E 2ZM6E 2UXCI 2LJPA 1XMOI 4DV6I 1FI4A 1N33E 1MG7A 4DR7E 4JI5E 4DU7A 4PRXA 4NXNI 4LF6I 1ZXNA 2UUBI 2UXBE 2X36A 2HKEA 1IBKE 2HFSA 4NXME 3F0NA 1KKHA 4DR4E 1N32I 4URLA 3K17A 3JAMC 1J5EE 1S16A 3QT7A 3ZM7A 2V2VA 4JV5E 4DV0E 1XNRE 1Z59A 4UTGA 4JI8I 3WU6A 4LF9I 1HNZE 1FWLA 4FW9A 3LNUA 3Q1QA 2HKJA 2E1RA 1H74A 4DPXA 4NXMI 4GKKI 2OI2A 4R1FA 4DV5I 3J80Q 4HYMA 2XEXA 4B3TE 4DPTA 2HK3A 4LF8E 3QT5A 4B3MI 4B3RI 4EMDA 2ZITA 2GS8A 5LMNI 2UUCE 2WW4A 3T1YI 1I94E 4ZVIA 1ZM3A 4MYUA 1S4EA 1MU5A 4K0KI 3T1HE 2UUAE 4LF8I 4DUZE 4JI0E 5BR8E 4M1KA 3PYDA 4Z7CA 4B3SI 1Z0GA 4X66E 2BV3A 4DV6E 4JI6E 4K0KE 4X64I 4PRVA 1NHHA 1XNRI 4DR2E 2UXDI 4LF6E 4B3TI 5LL6R 4B3SE 4DR7I 3PYGA 4YY3E 1IBMI 1XNQE 1J5EI 1H7SA 1B63A 1HNWE 4GKJI 4LFCE 4I3HA 1NZ0A 1FJGE 3WU5A 1XMQI 4X65I 3M6AA 1KIJA 4DPUA 3ZKBA 3H4LA 4FWGA 1N0VC 2BM1A 2UXCE 2VQFI 5A2QQ 4JI1E 2J7KA 3B82A 4DV5E 4MYTA 4LF5I 4LF7E 3ZZUA 1Z0WA 2HHHI 2V34A 4JI7E 4LF4I 4Z7YA 4DPYA 5GMDA 4DUZI 1EA6A 2ZM6I 1U2RA 1RREA 4YY3I 1XNQI 3QT8A 2AJ4A 1D6TA 3OTOI 5LMUE 4X66I 1B62A 1HNXI 4DR6E 4DPWA 3LTOA 1FKAE 1H72C 2UUCI 4KHPE 2VF3A 4JI4I 4RPFA 4YHHE 1Z0CA 4DV4I 1Z0VA 4DV0I 1FNMA 4LFAE 1KVKA 2UUAI 4GKJE 1ZM4A 1MX0A 4KHPI 4UT4A 1ZXMA 1RR9A 4DV2E 2Q2EB 2NPFA 2E5LE 2UUBE 4X64E 4JG4A 4DUYI 4OX9I 2UU9I 4B3ME 4AQYI 1OJ4A 1EI1A 1ZM9A 4X65E 4LF7I 1Z0EA 4FN5A 3D4JA 3WU3A 4JI1I 4X62E 1FWKA 1N34E 4ED4A 1Z5BA 5BR8I 3B78A 4LF4E 2HHHE 4JI5I 4LFCI 4JI3I 5A2QC 4DV3I 1A6FA 4DR2I 2X7IA 2EFGA 2UXBI 2HK2A 4FWHA 5LMUI 3PYFA 1IBME 4OX9E 3J80C 1N33I 4AQYE 4DR1E 1IBLE 4DR5E 1Z0TA 3T1HI 4YHHI 4KQVA 1H73A 1NHIA 3ZZTA 4WUDA 5L3JA 4DV4E 3HULA 4PU9A 4FWDA 4DUYE 1IBKI 4DV2I 4LFBI 4HACB 3PYEA 1K47A 3V5RA 1PIEA 4DV7E 2VQEE 5IT9C 2BM0A 3ZKDA 4USKA 2DEJA 5FLXC 4GKKE 1ZM2A 4JI4E 3GONA 1HNWI 2VQEI 5IWAI 1QZRA 1KTVA 4JYAI 3CWVA 3QT6A 2DEIA 4JI3E 1N36E 2R42A 5FLXQ 2F4VE 3ZZ0A 4JYAE 4JI7I 4DV3E 4P52A 4DV7I 1IBLI 3J81Q 4LFAI 4DU8A 4DR3E 4NXNE 1FJGI 1UEKA 1N36I 3WU4A 4JI2E 1N34I 1N32E 5IT9Q 4LF5E 2UXDE 1ELOA 5IWAE 3T1YE 1I94I 1XMOE 3J81C 4HY1A 3JAMQ 4JI2I 4JI0I 4USMA 1PKPA 1XHKA 2ZBKB 2A2DA 4X62I 2F4VI 1BKNA 2A2CA 3V2UC 5LMNE 3OTOE 2VQFE 3J7AG 1WUUA 4WUBA 2V8PA 2UU9E 3LPSA 4HXZA 4DR4I 1NHJA 1VISA 4HACA 4P7AA 1HR0I 1HNXE 4DR6I 1H7UA 1N0UA 1HNZI 1Z5CA 5GMEA 4JI8E 4B3RE 4WUCA 4JI6I 2CZ9A 4DR1I 4DR5I 4LFBE 3B8HA 3K1JA 4XTJA 2V2ZA
chains in the Genus database with same CATH superfamily
4DXLA 1Z0BA 2CGEA 1HR0E 4DV1I 2E5LI 1DARA 4U3BA 4JV5I 2BA1D 2NN6E 2R3VA 3M7NG 4LF9E 1Z5AA 2BR2A 2V2QA 2WP8B 3B4TA 2HFUA 3L7ZB 1PVGA 2C39B 5JEAD 4DR3I 1XMQE 3J7AM 4DV1E 2ZM6E 4OZEA 2UXCI 2LJPA 1XMOI 4DV6I 1FI4A 1N33E 4U3DA 1MG7A 2PO2B 4AIDA 4DR7E 2NN6F 4MU1A 4JI5E 4MU0A 4NBQA 4DU7A 4PRXA 1YHCA 3M7ND 4NXNI 4LF6I 1ZXNA 2UUBI 2UXBE 2X36A 2HKEA 1IBKE 2HFSA 1Y5YA 4NXME 3F0NA 1KKHA 4DR4E 1N32I 4URLA 3CDJA 3K17A 3PS1A 3JAMC 2O1VA 1J5EE 1S16A 2Z5EA 2Z5BA 3QT7A 4FW7A 3ZM7A 2CG9A 2V2VA 4JV5E 4DV0E 1XNRE 1Z59A 4UTGA 4JI8I 2WP8A 5ELWA 3WU6A 4LF9I 3HKMA 1HNZE 1FWLA 4FW9A 2IOQA 3LNUA 1OYPA 5JEAC 2E1RA 1H74A 2HKJA 3Q1QA 4DPXA 1R6LA 2PNZB 4NXMI 4GKKI 2OI2A 4R1FA 4DV5I 4AM3A 4J3DA 3J80Q 4HYMA 2XEXA 4B3TE 4DPTA 2HK3A 1UDSA 4LF8E 3QT5A 4B3MI 5DRPA 4B3RI 4IFDF 4EMDA 2ZITA 4LOMA 4IFDB 2GS8A 5LMNI 3K85A 2WW4A 2UUCE 3T1YI 1I94E 4ZVIA 2GO3A 1ZM3A 5C0XC 4IS9A 4MYUA 1RHYA 1S4EA 1MU5A 4K0KI 3T1HE 2UUAE 4LF8I 4FW3A 4DUZE 4JI0E 2PO2A 5BR8E 4M1KA 3PYDA 5EKWA 4Z7CA 4B3SI 1Z0GA 4X66E 2BV3A 3P06A 4DV6E 2JEBB 4JI6E 2JEAA 4K0KE 4X64I 4PRVA 1NHHA 1XNRI 5C0XB 4DR2E 2UXDI 3L7ZA 4BA2A 4LF6E 4MQYA 5K36E 1E3PA 2O1UA 4LPFA 4B3TI 5LL6R 4B3SE 4DR7I 3PYGA 4YY3E 1IBMI 5K36C 1XNQE 1J5EI 1H7SA 2CVEA 5C0XE 1B63A 2GQ0A 1HNWE 4GKJI 2C38A 4LFCE 4IZJD 4I3HA 1P42A 1NZ0A 1FJGE 3WU5A 1XMQI 4X65I 3M6AA 1KIJA 4DPUA 3ZKBA 3H4LA 4FWGA 1N0VC 2BM1A 2UXCE 2VQFI 3H1CA 5A2QQ 4JI1E 5JEAF 2J7KA 3B82A 4DV5E 4OO1E 1USUA 4MYTA 2PNMA 4LF5I 4LF7E 2PO1A 4QNJA 3ZZUA 1Z0WA 2HHHI 2V34A 4JI7E 2PNLA 4LF4I 5K36D 4Z7YA 4DPYA 1UDNA 4QNKA 5GMDA 3NZKA 4DUZI 2JE6B 1EA6A 2ZM6I 2JE6A 4BA2B 3P3GA 1U2RA 1RREA 4YY3I 2VESA 1XNQI 3QT8A 5FWKA 2AJ4A 3KRNA 5C0XD 5DROA 1D6TA 3OTOI 5LMUE 4X66I 1B62A 5JEAE 1HNXI 4DR6E 2GO4A 4DPWA 2WNRB 3LTOA 1FKAE 1H72C 2UUCI 5DRQA 4KHPE 2VF3A 4JI4I 4RPFA 4YHHE 1Z0CA 3DD6A 4DV4I 1Z0VA 1Y4SA 4DV0I 5EL9A 4OO1F 1FNMA 4LFAE 2PNZA 2PO0B 4IFDA 1KVKA 2UUAI 5C0XF 4GKJE 1ZM4A 2JT2A 4IZJB 1MX0A 4KHPI 4UT4A 1ZXMA 2Z5CA 1RR9A 4DV2E 2Q2EB 2NPFA 2E5LE 2Z5CB 2UUBE 3U1KA 4X64E 2Z5BB 4JG4A 4DUYI 1Y4UA 4OX9I 2UU9I 4IZKB 4B3ME 4AQYI 1OJ4A 5C0XA 1EI1A 1ZM9A 4X65E 2IESA 4LF7I 1Z0EA 1E3HA 3D4JA 4FN5A 1UDOA 3UHMA 3WU3A 2AE8A 4JI1I 5DNLA 4X62E 5K36F 1FWKA 1N34E 2O1WA 5K36B 4OO1B 4LCFA 4ED4A 2C37A 4MDTA 1Z5BA 5BR8I 2NN6C 3B78A 4MU3A 4OKGA 4LF4E 4OO1A 3HJCA 2HHHE 4JI5I 4LFCI 4JI3I 2IERA 5A2QC 4DV3I 1A6FA 4DR2I 2X7IA 2EFGA 2UXBI 2HK2A 4FWHA 2O1TA 5LMUI 3PYFA 1IBME 4OX9E 4OO1D 1XXEA 3J80C 1N33I 4AQYE 4DR1E 4DR5E 1IBLE 1Z0TA 2BR2B 2O3ZA 3T1HI 3Q6MA 4YHHI 4IZJA 4KQVA 3M85G 1H73A 2PO1B 1NHIA 3ZZTA 4WUDA 5L3JA 4DV4E 3HULA 4PU9A 4FWDA 3PS2A 4DUYE 1IBKI 4DV2I 4LFBI 4HACB 3PYEA 4BA1A 1K47A 5JEAB 3V5RA 1PIEA 2F1DA 4DV7E 2VQEE 5IT9C 2BM0A 3P76A 5DNXA 3ZKDA 2WNRA 4USKA 4GQUA 2C37B 2DEJA 5FLXC 4GKKE 1HK7A 4LCHA 2BA0D 1ZM2A 4JI4E 3GONA 4OO1C 1HNWI 2VQEI 1YH8A 1Y6ZA 4ISAA 5IWAI 1QZRA 1KTVA 4JYAI 3CWVA 2C39A 3Q6NA 3QT6A 2DEIA 4FW6A 4IZKA 4JI3E 3M85D 1N36E 2JEBA 2R42A 5FLXQ 1USVA 2F4VE 3ZZ0A 4JYAE 4FW4A 3CDIA 4JI7I 4IFDE 4AIMA 4DV3E 4P52A 2PO0A 4DV7I 1IBLI 3J81Q 4LFAI 2NN6D 4IFDC 4DU8A 4DR3E 4NXNE 1FJGI 1UEKA 1UDQA 1N36I 3WU4A 4JI2E 3PRYA 3PS3A 1N34I 1N32E 5IT9Q 4IFDD 4LF5E 4N3OA 2UXDE 1ELOA 5IWAE 3T1YE 2BA0G 1XMOE 1I94I 4FW5A 2C38B 3J81C 4HY1A 3JAMQ 3GMEA 1R6MA 4JI2I 4JI0I 2NN6B 4USMA 4MU4A 1PKPA 3GCMA 1XHKA 2ZBKB 1OYSA 5DRRA 3P3CA 2A2DA 4X62I 3GLLA 2NN6A 2F4VI 1BKNA 3P3EA 4LCGA 2A2CA 1Y60A 3V2UC 5LMNE 3U1YA 3OTOE 2VQFE 3J7AG 2JEAB 1WUUA 2J65A 1OYRA 4WUBA 2V8PA 2UU9E 3LPSA 4HXZA 4DR4I 1NHJA 5JEAA 1VISA 4HACA 4P7AA 1HR0I 1HNXE 4DR6I 2BA1G 1H7UA 5K36A 1N0UA 1HNZI 1Z5CA 5GMEA 4JI8E 4B3RE 4WUCA 4JI6I 2CZ9A 4BA1B 4DR1I 4DR5I 4LFBE 3B8HA 1VI7A 3K1JA 4XTJA 2V2ZA 2IOPA
chains in the Genus database with same CATH topology
4DXLA 1Z0BA 2CGEA 1HR0E 4DV1I 2E5LI 1DARA 4JV5I 2R3VA 4LF9E 1Z5AA 2V2QA 2HFUA 1PVGA 4DR3I 1XMQE 3J7AM 4DV1E 2ZM6E 2UXCI 2LJPA 1XMOI 4DV6I 1FI4A 1N33E 1MG7A 4DR7E 4JI5E 4DU7A 4PRXA 4NXNI 4LF6I 1ZXNA 2UUBI 2UXBE 2X36A 2HKEA 1IBKE 2HFSA 4NXME 3F0NA 1KKHA 4DR4E 1N32I 4URLA 3K17A 3JAMC 2O1VA 1J5EE 1S16A 2Z5EA 2Z5BA 3QT7A 3ZM7A 2CG9A 2V2VA 4JV5E 4DV0E 1XNRE 1Z59A 4UTGA 4JI8I 3WU6A 4LF9I 1HNZE 1FWLA 4FW9A 2IOQA 3LNUA 3Q1QA 2E1RA 1H74A 2HKJA 4DPXA 4NXMI 4GKKI 2OI2A 4R1FA 4DV5I 3J80Q 4HYMA 2XEXA 4B3TE 4DPTA 2HK3A 4LF8E 3QT5A 4B3MI 4B3RI 4EMDA 2ZITA 2UUCE 2GS8A 3K85A 2WW4A 5LMNI 3T1YI 1I94E 4ZVIA 1ZM3A 4MYUA 1S4EA 1MU5A 4K0KI 3T1HE 2UUAE 4LF8I 4DUZE 4JI0E 5BR8E 4M1KA 3PYDA 4Z7CA 4B3SI 1Z0GA 4X66E 2BV3A 3P06A 4DV6E 4JI6E 4K0KE 4X64I 4PRVA 1NHHA 1XNRI 4DR2E 2UXDI 4LF6E 2O1UA 4B3TI 5LL6R 4B3SE 4DR7I 3PYGA 4YY3E 1IBMI 1XNQE 1J5EI 1H7SA 2GQ0A 1B63A 1HNWE 4GKJI 4LFCE 4IZJD 4I3HA 1NZ0A 1FJGE 3WU5A 1XMQI 4X65I 3M6AA 1KIJA 4DPUA 3ZKBA 3H4LA 4FWGA 1N0VC 2BM1A 2UXCE 2VQFI 5A2QQ 4JI1E 2J7KA 3B82A 4DV5E 1USUA 4MYTA 2PNMA 4LF5I 4LF7E 3ZZUA 1Z0WA 2HHHI 2V34A 4JI7E 2PNLA 4LF4I 4Z7YA 4DPYA 5GMDA 4DUZI 1EA6A 2ZM6I 1U2RA 1RREA 4YY3I 1XNQI 3QT8A 5FWKA 2AJ4A 1D6TA 3OTOI 5LMUE 4X66I 1B62A 1HNXI 4DR6E 4DPWA 3LTOA 1FKAE 1H72C 2UUCI 4KHPE 2VF3A 4JI4I 4RPFA 4YHHE 1Z0CA 4DV4I 1Z0VA 1Y4SA 4DV0I 1FNMA 4LFAE 1KVKA 2UUAI 4GKJE 1ZM4A 4IZJB 1MX0A 4KHPI 4UT4A 1ZXMA 2Z5CA 1RR9A 4DV2E 2Q2EB 2NPFA 2E5LE 2Z5CB 2UUBE 4X64E 2Z5BB 4JG4A 4DUYI 1Y4UA 4OX9I 2UU9I 4IZKB 4B3ME 4AQYI 1OJ4A 1EI1A 1ZM9A 4X65E 4LF7I 1Z0EA 4FN5A 3D4JA 3WU3A 4JI1I 4X62E 1FWKA 1N34E 2O1WA 4ED4A 1Z5BA 5BR8I 3B78A 4LF4E 3HJCA 2HHHE 4JI5I 4LFCI 4JI3I 5A2QC 4DV3I 1A6FA 4DR2I 2X7IA 2EFGA 2UXBI 2HK2A 4FWHA 2O1TA 5LMUI 3PYFA 1IBME 4OX9E 3J80C 1N33I 4AQYE 4DR1E 1IBLE 4DR5E 1Z0TA 3T1HI 3Q6MA 4YHHI 4IZJA 4KQVA 1H73A 1NHIA 3ZZTA 4WUDA 5L3JA 4DV4E 3HULA 4PU9A 4FWDA 4DUYE 1IBKI 4DV2I 4LFBI 4HACB 3PYEA 1K47A 3V5RA 1PIEA 4DV7E 2VQEE 5IT9C 2BM0A 3ZKDA 4USKA 2DEJA 5FLXC 4GKKE 1HK7A 1ZM2A 4JI4E 3GONA 1HNWI 2VQEI 1Y6ZA 5IWAI 1QZRA 1KTVA 4JYAI 3CWVA 3Q6NA 3QT6A 2DEIA 4IZKA 4JI3E 1N36E 2R42A 5FLXQ 1USVA 2F4VE 3ZZ0A 4JYAE 4JI7I 4DV3E 4P52A 4DV7I 1IBLI 3J81Q 4LFAI 4DU8A 4DR3E 4NXNE 1FJGI 1UEKA 1N36I 3WU4A 4JI2E 3PRYA 1N34I 1N32E 5IT9Q 4LF5E 4N3OA 2UXDE 1ELOA 5IWAE 3T1YE 1I94I 1XMOE 3J81C 4HY1A 3JAMQ 4JI2I 4JI0I 4USMA 1PKPA 1XHKA 2ZBKB 2A2DA 4X62I 2F4VI 1BKNA 2A2CA 3V2UC 5LMNE 3OTOE 2VQFE 3J7AG 1WUUA 4WUBA 2V8PA 2UU9E 3LPSA 4HXZA 4DR4I 1NHJA 1VISA 4HACA 4P7AA 1HR0I 1HNXE 4DR6I 1H7UA 1N0UA 1HNZI 1Z5CA 5GMEA 4JI8E 4B3RE 4WUCA 4JI6I 2CZ9A 4DR1I 4DR5I 4LFBE 3B8HA 3K1JA 4XTJA 2V2ZA 2IOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXL A;  1Z0B A;  1HR0 E;  4DV1 I;  2E5L I;  1DAR A;  4JV5 I;  2R3V A;  4LF9 E;  1Z5A A;  2V2Q A;  2HFU A;  1PVG A;  4DR3 I;  1XMQ E;  3J7A M;  4DV1 E;  2ZM6 E;  2UXC I;  2LJP A;  1XMO I;  4DV6 I;  1FI4 A;  1N33 E;  1MG7 A;  4DR7 E;  4JI5 E;  4DU7 A;  4PRX A;  4NXN I;  4LF6 I;  1ZXN A;  2UUB I;  2UXB E;  2X36 A;  2HKE A;  1IBK E;  2HFS A;  4NXM E;  3F0N A;  1KKH A;  4DR4 E;  1N32 I;  4URL A;  3K17 A;  3JAM C;  1J5E E;  1S16 A;  3QT7 A;  3ZM7 A;  2V2V A;  4JV5 E;  4DV0 E;  1XNR E;  1Z59 A;  4UTG A;  4JI8 I;  3WU6 A;  4LF9 I;  1HNZ E;  1FWL A;  4FW9 A;  3LNU A;  3Q1Q A;  2HKJ A;  2E1R A;  1H74 A;  4DPX A;  4NXM I;  4GKK I;  2OI2 A;  4R1F A;  4DV5 I;  3J80 Q;  4HYM A;  2XEX A;  4B3T E;  4DPT A;  2HK3 A;  4LF8 E;  3QT5 A;  4B3M I;  4B3R I;  4EMD A;  2ZIT A;  2GS8 A;  5LMN I;  2UUC E;  2WW4 A;  3T1Y I;  1I94 E;  4ZVI A;  1ZM3 A;  4MYU A;  1S4E A;  1MU5 A;  4K0K I;  3T1H E;  2UUA E;  4LF8 I;  4DUZ E;  4JI0 E;  5BR8 E;  4M1K A;  3PYD A;  4Z7C A;  4B3S I;  1Z0G A;  4X66 E;  2BV3 A;  4DV6 E;  4JI6 E;  4K0K E;  4X64 I;  4PRV A;  1NHH A;  1XNR I;  4DR2 E;  2UXD I;  4LF6 E;  4B3T I;  5LL6 R;  4B3S E;  4DR7 I;  3PYG A;  4YY3 E;  1IBM I;  1XNQ E;  1J5E I;  1H7S A;  1B63 A;  1HNW E;  4GKJ I;  4LFC E;  4I3H A;  1NZ0 A;  1FJG E;  3WU5 A;  1XMQ I;  4X65 I;  3M6A A;  1KIJ A;  4DPU A;  3ZKB A;  3H4L A;  4FWG A;  1N0V C;  2BM1 A;  2UXC E;  2VQF I;  5A2Q Q;  4JI1 E;  2J7K A;  3B82 A;  4DV5 E;  4MYT A;  4LF5 I;  4LF7 E;  3ZZU A;  1Z0W A;  2HHH I;  2V34 A;  4JI7 E;  4LF4 I;  4Z7Y A;  4DPY A;  5GMD A;  4DUZ I;  1EA6 A;  2ZM6 I;  1U2R A;  1RRE A;  4YY3 I;  1XNQ I;  3QT8 A;  2AJ4 A;  1D6T A;  3OTO I;  5LMU E;  4X66 I;  1B62 A;  1HNX I;  4DR6 E;  4DPW A;  3LTO A;  1FKA E;  1H72 C;  2UUC I;  4KHP E;  2VF3 A;  4JI4 I;  4RPF A;  4YHH E;  1Z0C A;  4DV4 I;  1Z0V A;  4DV0 I;  1FNM A;  4LFA E;  1KVK A;  2UUA I;  4GKJ E;  1ZM4 A;  1MX0 A;  4KHP I;  4UT4 A;  1ZXM A;  1RR9 A;  4DV2 E;  2Q2E B;  2NPF A;  2E5L E;  2UUB E;  4X64 E;  4JG4 A;  4DUY I;  4OX9 I;  2UU9 I;  4B3M E;  4AQY I;  1OJ4 A;  1EI1 A;  1ZM9 A;  4X65 E;  4LF7 I;  1Z0E A;  4FN5 A;  3D4J A;  3WU3 A;  4JI1 I;  4X62 E;  1FWK A;  1N34 E;  4ED4 A;  1Z5B A;  5BR8 I;  3B78 A;  4LF4 E;  2HHH E;  4JI5 I;  4LFC I;  4JI3 I;  5A2Q C;  4DV3 I;  1A6F A;  4DR2 I;  2X7I A;  2EFG A;  2UXB I;  2HK2 A;  4FWH A;  5LMU I;  3PYF A;  1IBM E;  4OX9 E;  3J80 C;  1N33 I;  4AQY E;  4DR1 E;  1IBL E;  4DR5 E;  1Z0T A;  3T1H I;  4YHH I;  4KQV A;  1H73 A;  1NHI A;  3ZZT A;  4WUD A;  5L3J A;  4DV4 E;  3HUL A;  4PU9 A;  4FWD A;  4DUY E;  1IBK I;  4DV2 I;  4LFB I;  4HAC B;  3PYE A;  1K47 A;  3V5R A;  1PIE A;  4DV7 E;  2VQE E;  5IT9 C;  2BM0 A;  3ZKD A;  4USK A;  2DEJ A;  5FLX C;  4GKK E;  1ZM2 A;  4JI4 E;  3GON A;  1HNW I;  2VQE I;  5IWA I;  1QZR A;  1KTV A;  4JYA I;  3CWV A;  3QT6 A;  2DEI A;  4JI3 E;  1N36 E;  2R42 A;  5FLX Q;  2F4V E;  3ZZ0 A;  4JYA E;  4JI7 I;  4DV3 E;  4P52 A;  4DV7 I;  1IBL I;  3J81 Q;  4LFA I;  4DU8 A;  4DR3 E;  4NXN E;  1FJG I;  1UEK A;  1N36 I;  3WU4 A;  4JI2 E;  1N34 I;  1N32 E;  5IT9 Q;  4LF5 E;  2UXD E;  1ELO A;  5IWA E;  3T1Y E;  1I94 I;  1XMO E;  3J81 C;  4HY1 A;  3JAM Q;  4JI2 I;  4JI0 I;  4USM A;  1PKP A;  1XHK A;  2ZBK B;  2A2D A;  4X62 I;  2F4V I;  1BKN A;  2A2C A;  3V2U C;  5LMN E;  3OTO E;  2VQF E;  3J7A G;  1WUU A;  4WUB A;  2V8P A;  2UU9 E;  3LPS A;  4HXZ A;  4DR4 I;  1NHJ A;  1VIS A;  4HAC A;  4P7A A;  1HR0 I;  1HNX E;  4DR6 I;  1H7U A;  1N0U A;  1HNZ I;  1Z5C A;  5GME A;  4JI8 E;  4B3R E;  4WUC A;  4JI6 I;  2CZ9 A;  4DR1 I;  4DR5 I;  4LFB E;  3B8H A;  3K1J A;  4XTJ A;  2V2Z A; 
#chains in the Genus database with same CATH topology
 4DXL A;  1Z0B A;  2CGE A;  1HR0 E;  4DV1 I;  2E5L I;  1DAR A;  4U3B A;  4JV5 I;  2BA1 D;  2NN6 E;  2R3V A;  3M7N G;  4LF9 E;  1Z5A A;  2BR2 A;  2V2Q A;  2WP8 B;  3B4T A;  2HFU A;  3L7Z B;  1PVG A;  2C39 B;  5JEA D;  4DR3 I;  1XMQ E;  3J7A M;  4DV1 E;  2ZM6 E;  4OZE A;  2UXC I;  2LJP A;  1XMO I;  4DV6 I;  1FI4 A;  1N33 E;  4U3D A;  1MG7 A;  2PO2 B;  4AID A;  4DR7 E;  2NN6 F;  4MU1 A;  4JI5 E;  4MU0 A;  4NBQ A;  4DU7 A;  4PRX A;  1YHC A;  3M7N D;  4NXN I;  4LF6 I;  1ZXN A;  2UUB I;  2UXB E;  2X36 A;  2HKE A;  1IBK E;  2HFS A;  1Y5Y A;  4NXM E;  3F0N A;  1KKH A;  4DR4 E;  1N32 I;  4URL A;  3CDJ A;  3K17 A;  3PS1 A;  3JAM C;  2O1V A;  1J5E E;  1S16 A;  2Z5E A;  2Z5B A;  3QT7 A;  4FW7 A;  3ZM7 A;  2CG9 A;  2V2V A;  4JV5 E;  4DV0 E;  1XNR E;  1Z59 A;  4UTG A;  4JI8 I;  2WP8 A;  5ELW A;  3WU6 A;  4LF9 I;  3HKM A;  1HNZ E;  1FWL A;  4FW9 A;  2IOQ A;  3LNU A;  1OYP A;  5JEA C;  2E1R A;  1H74 A;  2HKJ A;  3Q1Q A;  4DPX A;  1R6L A;  2PNZ B;  4NXM I;  4GKK I;  2OI2 A;  4R1F A;  4DV5 I;  4AM3 A;  4J3D A;  3J80 Q;  4HYM A;  2XEX A;  4B3T E;  4DPT A;  2HK3 A;  1UDS A;  4LF8 E;  3QT5 A;  4B3M I;  5DRP A;  4B3R I;  4IFD F;  4EMD A;  2ZIT A;  4LOM A;  4IFD B;  2GS8 A;  5LMN I;  3K85 A;  2WW4 A;  2UUC E;  3T1Y I;  1I94 E;  4ZVI A;  2GO3 A;  1ZM3 A;  5C0X C;  4IS9 A;  4MYU A;  1RHY A;  1S4E A;  1MU5 A;  4K0K I;  3T1H E;  2UUA E;  4LF8 I;  4FW3 A;  4DUZ E;  4JI0 E;  2PO2 A;  5BR8 E;  4M1K A;  3PYD A;  5EKW A;  4Z7C A;  4B3S I;  1Z0G A;  4X66 E;  2BV3 A;  3P06 A;  4DV6 E;  2JEB B;  4JI6 E;  2JEA A;  4K0K E;  4X64 I;  4PRV A;  1NHH A;  1XNR I;  5C0X B;  4DR2 E;  2UXD I;  3L7Z A;  4BA2 A;  4LF6 E;  4MQY A;  5K36 E;  1E3P A;  2O1U A;  4LPF A;  4B3T I;  5LL6 R;  4B3S E;  4DR7 I;  3PYG A;  4YY3 E;  1IBM I;  5K36 C;  1XNQ E;  1J5E I;  1H7S A;  2CVE A;  5C0X E;  1B63 A;  2GQ0 A;  1HNW E;  4GKJ I;  2C38 A;  4LFC E;  4IZJ D;  4I3H A;  1P42 A;  1NZ0 A;  1FJG E;  3WU5 A;  1XMQ I;  4X65 I;  3M6A A;  1KIJ A;  4DPU A;  3ZKB A;  3H4L A;  4FWG A;  1N0V C;  2BM1 A;  2UXC E;  2VQF I;  3H1C A;  5A2Q Q;  4JI1 E;  5JEA F;  2J7K A;  3B82 A;  4DV5 E;  4OO1 E;  1USU A;  4MYT A;  2PNM A;  4LF5 I;  4LF7 E;  2PO1 A;  4QNJ A;  3ZZU A;  1Z0W A;  2HHH I;  2V34 A;  4JI7 E;  2PNL A;  4LF4 I;  5K36 D;  4Z7Y A;  4DPY A;  1UDN A;  4QNK A;  5GMD A;  3NZK A;  4DUZ I;  2JE6 B;  1EA6 A;  2ZM6 I;  2JE6 A;  4BA2 B;  3P3G A;  1U2R A;  1RRE A;  4YY3 I;  2VES A;  1XNQ I;  3QT8 A;  5FWK A;  2AJ4 A;  3KRN A;  5C0X D;  5DRO A;  1D6T A;  3OTO I;  5LMU E;  4X66 I;  1B62 A;  5JEA E;  1HNX I;  4DR6 E;  2GO4 A;  4DPW A;  2WNR B;  3LTO A;  1FKA E;  1H72 C;  2UUC I;  5DRQ A;  4KHP E;  2VF3 A;  4JI4 I;  4RPF A;  4YHH E;  1Z0C A;  3DD6 A;  4DV4 I;  1Z0V A;  1Y4S A;  4DV0 I;  5EL9 A;  4OO1 F;  1FNM A;  4LFA E;  2PNZ A;  2PO0 B;  4IFD A;  1KVK A;  2UUA I;  5C0X F;  4GKJ E;  1ZM4 A;  2JT2 A;  4IZJ B;  1MX0 A;  4KHP I;  4UT4 A;  1ZXM A;  2Z5C A;  1RR9 A;  4DV2 E;  2Q2E B;  2NPF A;  2E5L E;  2Z5C B;  2UUB E;  3U1K A;  4X64 E;  2Z5B B;  4JG4 A;  4DUY I;  1Y4U A;  4OX9 I;  2UU9 I;  4IZK B;  4B3M E;  4AQY I;  1OJ4 A;  5C0X A;  1EI1 A;  1ZM9 A;  4X65 E;  2IES A;  4LF7 I;  1Z0E A;  1E3H A;  3D4J A;  4FN5 A;  1UDO A;  3UHM A;  3WU3 A;  2AE8 A;  4JI1 I;  5DNL A;  4X62 E;  5K36 F;  1FWK A;  1N34 E;  2O1W A;  5K36 B;  4OO1 B;  4LCF A;  4ED4 A;  2C37 A;  4MDT A;  1Z5B A;  5BR8 I;  2NN6 C;  3B78 A;  4MU3 A;  4OKG A;  4LF4 E;  4OO1 A;  3HJC A;  2HHH E;  4JI5 I;  4LFC I;  4JI3 I;  2IER A;  5A2Q C;  4DV3 I;  1A6F A;  4DR2 I;  2X7I A;  2EFG A;  2UXB I;  2HK2 A;  4FWH A;  2O1T A;  5LMU I;  3PYF A;  1IBM E;  4OX9 E;  4OO1 D;  1XXE A;  3J80 C;  1N33 I;  4AQY E;  4DR1 E;  4DR5 E;  1IBL E;  1Z0T A;  2BR2 B;  2O3Z A;  3T1H I;  3Q6M A;  4YHH I;  4IZJ A;  4KQV A;  3M85 G;  1H73 A;  2PO1 B;  1NHI A;  3ZZT A;  4WUD A;  5L3J A;  4DV4 E;  3HUL A;  4PU9 A;  4FWD A;  3PS2 A;  4DUY E;  1IBK I;  4DV2 I;  4LFB I;  4HAC B;  3PYE A;  4BA1 A;  1K47 A;  5JEA B;  3V5R A;  1PIE A;  2F1D A;  4DV7 E;  2VQE E;  5IT9 C;  2BM0 A;  3P76 A;  5DNX A;  3ZKD A;  2WNR A;  4USK A;  4GQU A;  2C37 B;  2DEJ A;  5FLX C;  4GKK E;  1HK7 A;  4LCH A;  2BA0 D;  1ZM2 A;  4JI4 E;  3GON A;  4OO1 C;  1HNW I;  2VQE I;  1YH8 A;  1Y6Z A;  4ISA A;  5IWA I;  1QZR A;  1KTV A;  4JYA I;  3CWV A;  2C39 A;  3Q6N A;  3QT6 A;  2DEI A;  4FW6 A;  4IZK A;  4JI3 E;  3M85 D;  1N36 E;  2JEB A;  2R42 A;  5FLX Q;  1USV A;  2F4V E;  3ZZ0 A;  4JYA E;  4FW4 A;  3CDI A;  4JI7 I;  4IFD E;  4AIM A;  4DV3 E;  4P52 A;  2PO0 A;  4DV7 I;  1IBL I;  3J81 Q;  4LFA I;  2NN6 D;  4IFD C;  4DU8 A;  4DR3 E;  4NXN E;  1FJG I;  1UEK A;  1UDQ A;  1N36 I;  3WU4 A;  4JI2 E;  3PRY A;  3PS3 A;  1N34 I;  1N32 E;  5IT9 Q;  4IFD D;  4LF5 E;  4N3O A;  2UXD E;  1ELO A;  5IWA E;  3T1Y E;  2BA0 G;  1XMO E;  1I94 I;  4FW5 A;  2C38 B;  3J81 C;  4HY1 A;  3JAM Q;  3GME A;  1R6M A;  4JI2 I;  4JI0 I;  2NN6 B;  4USM A;  4MU4 A;  1PKP A;  3GCM A;  1XHK A;  2ZBK B;  1OYS A;  5DRR A;  3P3C A;  2A2D A;  4X62 I;  3GLL A;  2NN6 A;  2F4V I;  1BKN A;  3P3E A;  4LCG A;  2A2C A;  1Y60 A;  3V2U C;  5LMN E;  3U1Y A;  3OTO E;  2VQF E;  3J7A G;  2JEA B;  1WUU A;  2J65 A;  1OYR A;  4WUB A;  2V8P A;  2UU9 E;  3LPS A;  4HXZ A;  4DR4 I;  1NHJ A;  5JEA A;  1VIS A;  4HAC A;  4P7A A;  1HR0 I;  1HNX E;  4DR6 I;  2BA1 G;  1H7U A;  5K36 A;  1N0U A;  1HNZ I;  1Z5C A;  5GME A;  4JI8 E;  4B3R E;  4WUC A;  4JI6 I;  2CZ9 A;  4BA1 B;  4DR1 I;  4DR5 I;  4LFB E;  3B8H A;  1VI7 A;  3K1J A;  4XTJ A;  2V2Z A;  2IOP A; 
#chains in the Genus database with same CATH homology
 4DXL A;  1Z0B A;  2CGE A;  1HR0 E;  4DV1 I;  2E5L I;  1DAR A;  4JV5 I;  2R3V A;  4LF9 E;  1Z5A A;  2V2Q A;  2HFU A;  1PVG A;  4DR3 I;  1XMQ E;  3J7A M;  4DV1 E;  2ZM6 E;  2UXC I;  2LJP A;  1XMO I;  4DV6 I;  1FI4 A;  1N33 E;  1MG7 A;  4DR7 E;  4JI5 E;  4DU7 A;  4PRX A;  4NXN I;  4LF6 I;  1ZXN A;  2UUB I;  2UXB E;  2X36 A;  2HKE A;  1IBK E;  2HFS A;  4NXM E;  3F0N A;  1KKH A;  4DR4 E;  1N32 I;  4URL A;  3K17 A;  3JAM C;  2O1V A;  1J5E E;  1S16 A;  2Z5E A;  2Z5B A;  3QT7 A;  3ZM7 A;  2CG9 A;  2V2V A;  4JV5 E;  4DV0 E;  1XNR E;  1Z59 A;  4UTG A;  4JI8 I;  3WU6 A;  4LF9 I;  1HNZ E;  1FWL A;  4FW9 A;  2IOQ A;  3LNU A;  3Q1Q A;  2E1R A;  1H74 A;  2HKJ A;  4DPX A;  4NXM I;  4GKK I;  2OI2 A;  4R1F A;  4DV5 I;  3J80 Q;  4HYM A;  2XEX A;  4B3T E;  4DPT A;  2HK3 A;  4LF8 E;  3QT5 A;  4B3M I;  4B3R I;  4EMD A;  2ZIT A;  2UUC E;  2GS8 A;  3K85 A;  2WW4 A;  5LMN I;  3T1Y I;  1I94 E;  4ZVI A;  1ZM3 A;  4MYU A;  1S4E A;  1MU5 A;  4K0K I;  3T1H E;  2UUA E;  4LF8 I;  4DUZ E;  4JI0 E;  5BR8 E;  4M1K A;  3PYD A;  4Z7C A;  4B3S I;  1Z0G A;  4X66 E;  2BV3 A;  3P06 A;  4DV6 E;  4JI6 E;  4K0K E;  4X64 I;  4PRV A;  1NHH A;  1XNR I;  4DR2 E;  2UXD I;  4LF6 E;  2O1U A;  4B3T I;  5LL6 R;  4B3S E;  4DR7 I;  3PYG A;  4YY3 E;  1IBM I;  1XNQ E;  1J5E I;  1H7S A;  2GQ0 A;  1B63 A;  1HNW E;  4GKJ I;  4LFC E;  4IZJ D;  4I3H A;  1NZ0 A;  1FJG E;  3WU5 A;  1XMQ I;  4X65 I;  3M6A A;  1KIJ A;  4DPU A;  3ZKB A;  3H4L A;  4FWG A;  1N0V C;  2BM1 A;  2UXC E;  2VQF I;  5A2Q Q;  4JI1 E;  2J7K A;  3B82 A;  4DV5 E;  1USU A;  4MYT A;  2PNM A;  4LF5 I;  4LF7 E;  3ZZU A;  1Z0W A;  2HHH I;  2V34 A;  4JI7 E;  2PNL A;  4LF4 I;  4Z7Y A;  4DPY A;  5GMD A;  4DUZ I;  1EA6 A;  2ZM6 I;  1U2R A;  1RRE A;  4YY3 I;  1XNQ I;  3QT8 A;  5FWK A;  2AJ4 A;  1D6T A;  3OTO I;  5LMU E;  4X66 I;  1B62 A;  1HNX I;  4DR6 E;  4DPW A;  3LTO A;  1FKA E;  1H72 C;  2UUC I;  4KHP E;  2VF3 A;  4JI4 I;  4RPF A;  4YHH E;  1Z0C A;  4DV4 I;  1Z0V A;  1Y4S A;  4DV0 I;  1FNM A;  4LFA E;  1KVK A;  2UUA I;  4GKJ E;  1ZM4 A;  4IZJ B;  1MX0 A;  4KHP I;  4UT4 A;  1ZXM A;  2Z5C A;  1RR9 A;  4DV2 E;  2Q2E B;  2NPF A;  2E5L E;  2Z5C B;  2UUB E;  4X64 E;  2Z5B B;  4JG4 A;  4DUY I;  1Y4U A;  4OX9 I;  2UU9 I;  4IZK B;  4B3M E;  4AQY I;  1OJ4 A;  1EI1 A;  1ZM9 A;  4X65 E;  4LF7 I;  1Z0E A;  4FN5 A;  3D4J A;  3WU3 A;  4JI1 I;  4X62 E;  1FWK A;  1N34 E;  2O1W A;  4ED4 A;  1Z5B A;  5BR8 I;  3B78 A;  4LF4 E;  3HJC A;  2HHH E;  4JI5 I;  4LFC I;  4JI3 I;  5A2Q C;  4DV3 I;  1A6F A;  4DR2 I;  2X7I A;  2EFG A;  2UXB I;  2HK2 A;  4FWH A;  2O1T A;  5LMU I;  3PYF A;  1IBM E;  4OX9 E;  3J80 C;  1N33 I;  4AQY E;  4DR1 E;  1IBL E;  4DR5 E;  1Z0T A;  3T1H I;  3Q6M A;  4YHH I;  4IZJ A;  4KQV A;  1H73 A;  1NHI A;  3ZZT A;  4WUD A;  5L3J A;  4DV4 E;  3HUL A;  4PU9 A;  4FWD A;  4DUY E;  1IBK I;  4DV2 I;  4LFB I;  4HAC B;  3PYE A;  1K47 A;  3V5R A;  1PIE A;  4DV7 E;  2VQE E;  5IT9 C;  2BM0 A;  3ZKD A;  4USK A;  2DEJ A;  5FLX C;  4GKK E;  1HK7 A;  1ZM2 A;  4JI4 E;  3GON A;  1HNW I;  2VQE I;  1Y6Z A;  5IWA I;  1QZR A;  1KTV A;  4JYA I;  3CWV A;  3Q6N A;  3QT6 A;  2DEI A;  4IZK A;  4JI3 E;  1N36 E;  2R42 A;  5FLX Q;  1USV A;  2F4V E;  3ZZ0 A;  4JYA E;  4JI7 I;  4DV3 E;  4P52 A;  4DV7 I;  1IBL I;  3J81 Q;  4LFA I;  4DU8 A;  4DR3 E;  4NXN E;  1FJG I;  1UEK A;  1N36 I;  3WU4 A;  4JI2 E;  3PRY A;  1N34 I;  1N32 E;  5IT9 Q;  4LF5 E;  4N3O A;  2UXD E;  1ELO A;  5IWA E;  3T1Y E;  1I94 I;  1XMO E;  3J81 C;  4HY1 A;  3JAM Q;  4JI2 I;  4JI0 I;  4USM A;  1PKP A;  1XHK A;  2ZBK B;  2A2D A;  4X62 I;  2F4V I;  1BKN A;  2A2C A;  3V2U C;  5LMN E;  3OTO E;  2VQF E;  3J7A G;  1WUU A;  4WUB A;  2V8P A;  2UU9 E;  3LPS A;  4HXZ A;  4DR4 I;  1NHJ A;  1VIS A;  4HAC A;  4P7A A;  1HR0 I;  1HNX E;  4DR6 I;  1H7U A;  1N0U A;  1HNZ I;  1Z5C A;  5GME A;  4JI8 E;  4B3R E;  4WUC A;  4JI6 I;  2CZ9 A;  4DR1 I;  4DR5 I;  4LFB E;  3B8H A;  3K1J A;  4XTJ A;  2V2Z A;  2IOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...