4DR4K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr4K00
1HNWK 4YY3K 4LF8K 4CW7B 3T1YK 2ZM6K 1J5EK 2UUCK 5BR8K 5IWAK 4DV3K 5FLXO 4DUYK 1XMQK 1IBLK 4B3RK 4B3MK 4GKKK 4X66K 2VQFK 4LFBK 4B3TK 4DV4K 4LF7K 3OTOK 2E5LK 4X65K 1HR0K 4DV6K 4DUZK 2F4VK 3J7AP 4LF4K 1N36K 3T1HK 4X62K 4DR6K 5LL6Z 4KHPK 5A2QO 4LFCK 2UXDK 1N34K 1I94K 5LMNK 4OX9K 2UXBK 4JI4K 1IBMK 1N33K 4V19S 3J80O 4LFAK 3J7YP 4DR1K 4DV5K 1XNRK 3JAMO 1HNZK 4DV2K 4B3SK 4X64K 4JV5K 4JI0K 4DV7K 4DR4K 4JI8K 4NXMK 4NXNK 4YHHK 4DR3K 1XMOK 4DV1K 4CVNE 1FJGK 4JI6K 4DR7K 4JI5K 4LF9K 1HNXK 1N32K 2HHHK 2UUBK 4DV0K 4JI7K 2UXCK 4LF5K 4JI3K 1IBKK 4K0KK 4DR2K 5AJ3K 4GKJK 4JI1K 3J81O 1XNQK 2UUAK 2VQEK 2UU9K 4LF6K 4JI2K 4JYAK 4DR5K 5LMUK 5IT9O 4AQYK
chains in the Genus database with same CATH superfamily
3ZSYA 3OYIA 3C6UA 4E7KA 4OKKA 4IG0A 2F8SA 4B1VA 1CZ9A 3K2PA 3E01A 4PA1A 1ATSA 4IEEA 4Z4HA 2HF4A 2HHSA 4FWOA 2IGIA 5AQJA 3PV8A 2YNGA 3UKRA 3C7NA 3PX4A 1HJRA 3MEDA 2YHAA 4JN4A 3FR0A 4BVPA 2KKZA 5HLFA 4M42A 4G9ZA 2WONA 1VQ6N 3IDHA 2NLXA 2D0AA 2P9SA 3QLHA 1D9DA 3EE9A 3WXKA 1NGEA 4LFCK 3CM6A 4EAHD 1YJ9N 2QKKA 1CZAN 2GX9A 3TSUA 4KV8A 4A2BA 3F73A 3O6WA 1TKTA 1P8ZA 3AV9A 3J80O 2XO7A 5E26A 4HHTA 4GMJB 3JAMO 4MO5A 3VF6A 3CHWA 1BA0A 5DMRA 3OVNA 1BCMA 4A61A 3ZSWA 4CHPA 1C0TA 4CVNE 1BIZA 3UKUB 4LF9K 4NYNA 4F4KA 3VEYA 3NH0A 2HHHK 1RBVA 1HX1A 2QTDA 1KAZA 4H4OA 2QWRA 2YHWA 3QNNA 3UB5A 4CIEA 3SUPA 2A41A 4FWRA 3THYA 1U45A 4KHSA 3M6GA 5LY3A 4WYBA 1WSFA 1RDUA 3DM2A 2B6AA 2ETJA 4CJUA 1NJIO 4EFHA 2YNIA 4AQYK 5C25A 2E2NA 2FBTA 4C8KA 1U49A 3TWHA 1GLFO 2YNFA 4LF8K 5HBMA 1KFSA 1XUPO 1KC8O 1C0FA 3DXMB 4CHYA 4FOEA 1EWQA 2P5OA 4GW6A 4FJNA 3FFKB 4BRLA 1TYQB 4A5BA 1LV5A 1NG9A 3MK6A 4AM7A 3DLBA 3PIOL 3SZ2A 3CC7N 3HZ6A 4F9OA 1KQSM 1BA1A 1KAYA 1DT9A 3IMXA 5BREA 1T03A 1ITGA 4H5WA 1MU2A 1RBSA 4M7XA 3QEIA 1KVBA 2KQ2A 2CH5A 2QWQA 1SQKA 5M1OA 3MXJA 3RMDA 4BE2A 1XWLA 2F96A 5H1SQ 5AQFA 4M3TA 2A3ZA 2G8VA 4CFBA 4FO0A 1J54A 4BRPA 2E4LA 4F8RA 4PY5A 5B8HA 1ATNA 3NF7A 1A5XA 4N56A 3DLKA 1YUWA 2QEXN 4B9VA 4KI6A 4JRQA 4DLEA 1LOTB 4IOCL 4E7HA 3F9KA 4CJKA 4CZEA 4FLTA 3H3OB 3L2WA 1XNRK 1JLFA 3ZT1A 3D45A 2BANA 1BCOA 3CF5L 4UQGA 3KD5E 4JV5K 4PQUA 1NWKA 1VK0A 4JK7A 1QSSA 4DR3K 3AO3A 4CHZA 3OA9A 5C12A 4DTMA 4DR7K 1IKWA 1C1BA 3CCRN 4KFBA 4RW4A 3SK3A 4HUFA 4FWSA 3UIQA 4DU3A 2ZJRL 1HKGA 3OYLA 3H45C 4FJXA 4Y1DA 1YVUA 5M1QA 1OVYA 3HYFA 1NGBA 3PIPL 2E20A 1WSHA 1VAZA 1XNQK 3OBYA 3QBXA 4PWDA 1BIUA 4IDKA 1VRUA 5AQWA 3ZT3A 5HRNA 2BGGA 4W5QA 1ZBUA 2E1ZA 4YFUA 4CW7B 3E66A 2XY7A 1NK5A 4O5BA 3O3GA 2KFNA 2OPRA 3OYMA 5F1XA 3TSPA 4RWTA 4ISFA 3M3ZA 5KRTA 1EWRA 1HLUA 3OYFA 3O8MA 1WN7A 3V1QA 4KTWA 3ISNC 1TV6A 3CPEA 1GLBG 1BOTO 3TSQA 1U2VB 3HOTA 2Z1IA 4CZGA 4DCHA 1K9MO 3AVBA 3V9ZA 4CJ3A 3M8RA 4GVMA 3OYDA 2PY5A 1TK8A 4JHDB 1F21A 5AQIA 1GLEG 4KHQA 3SI6A 4CFCA 3EEQA 1WOQA 3LM9A 1JL1A 4CJQA 4U7BA 3GE1A 1HMVA 4CHOA 5BRDA 4N76A 2O8CA 2P9PB 2FBXA 2F7TA 3ULEA 4GVEA 4B9LA 4CJ5A 4I9QA 3Q7CA 1NGHA 1SAZA 4CD3A 3AO1A 3RMCA 3CYMA 5ADXH 4H4MA 1YJNN 1U04A 3T69A 3VQ5A 4OPJA 4DV1K 4I2QA 2Y1JA 3THWA 3ZSVA 1ZBIA 3U4LA 4CK2A 1N32K 1QS4A 3IUCA 1VQ8N 1W7AA 3OYCA 4O8KA 3GDQA 3P83D 4WQ4A 5C24A 1WSGA 4K8XA 4JNEA 1RNHA 4O44A 4QS9A 1MA9B 2HMPA 5AQKA 1BWFO 4CF2A 4IBNA 4EHUA 2VWJA 4JEPA 4K41A 3LP1A 2QI2A 1UWBA 3FLCO 2P51A 3CC4N 1RBRA 2AJQA 1EP4A 2R7YA 5GIOA 2QWPA 4DUYK 1VSHA 1LWEA 4GV9A 1X3NA 4BR9A 4KTQA 4GKKK 4L8RB 1RDAA 1VSJA 1NK0A 1HQUA 3ZSQA 4CEAA 4X65K 5GAGP 2Q3SA 2IVPA 2X6NA 3JS6A 3KLHA 4R79A 3OYAA 1OKJA 1IKXA 1W97L 2E2OA 1DLOA 3HVTA 1TK5A 2OZMA 4KHUA 3H6EA 2GUIA 1YAGA 4DR6K 1XHZA 4I7FA 4W5TA 4C1NI 4BRGA 5KGXA 1I94K 4IFEA 4I9LA 1I39A 5M1KA 4JKGA 4F2RA 3CQYA 3THVA 1W2BM 1IBMK 1KFDA 3H3NO 4B08A 5T7BA 1BDGA 2Q1NA 4JKCA 4XIUA 3T7ZA 4CJFA 4CEFA 3HT3A 4DV2K 4H0TB 1BL3A 1SS6A 5DK5A 3CMAN 1Z05A 3C65A 2V51B 4BE1A 1NKCA 4IFVA 5ADXA 2EHGA 3AGKA 4MO4A 2HHVA 4ELUA 4B9TA 3GOIA 2YHBA 2O8BB 3MAQA 2OANA 2GELA 1IBKK 3SQ1A 4YOTA 3O9QA 4DR2K 3PUFA 3DLLL 5M1PA 4DQQA 2O8FB 3WUHA 3FZFA 2YJEA 1HYZA 3IKMA 4ELTA 4FJ7A 2BDPA 2KZMA 2D0BA 2W40A 1QQMA 3H46O 3MX2A 2OCEA 2QK9A 4BRMA 1IKYA 3TAPA 3OJUA 3CCLN 1IKVA 4BDYA 3C6HA 3OYKA 2G8UA 4F3TA 5KPZA 1WSIA 1B9FA 1NGFA 3P31A 1B9DA 1QZ5A 3OHRA 3E9OA 1XC3A 4BC4A 3V9UA 3NE6A 4LF7K 3NH2A 4J2DA 4WFAL 4E3SA 1BU6O 5TKWA 3V6DA 3VEZA 4E1NA 3QFPA 1R0AA 1NJWA 4J2BA 4ID1A 2BTFA 2P9IB 1ILYA 4BRAA 4ZHRA 3D2FA 3VGLA 3JYTA 2RF2A 4ZTJA 2HBKA 1NGJA 4IDHA 1QVGM 2OPQA 3WNHA 2E88A 4B3OA 3O08A 3UKUA 2PYLA 2YV0X 1VQ5N 1YVNA 4B9SA 4YORA 4B1ZA 3PO4A 3J8AA 1G15A 4FJJA 3K5NA 1TGOA 4BREA 2HF3A 3C6TA 3QIOA 3LDLA 3RWUA 5FROA 2YX6A 1NGGA 3O9RA 4AHCA 2ZD1A 4CZHA 4H0OA 3D2EB 3OS0A 4OPAA 3PSIA 3FZKA 1S72N 1VSIA 4CJVA 3VA0A 1FW6A 1FKPA 1TVRA 4W5NA 2P9NB 3GG4A 4DQPA 4CJEA 3RRGA 2ZGZA 1U48A 5KQ8A 4JLHA 4CESA 1YIJN 2D0CA 3ZSZA 3ZX3A 4Z4FA 5M1NA 3BEXA 1U6ZA 2OA8A 4FCYA 4DV0K 3NGZA 3G6EN 3CCQN 5J2QA 4CZLA 2XY5A 1D5AA 4K0KK 4XH1A 1TYQA 2O8EA 3VEOA 4DSLA 2DY4A 1JXBA 3WEEB 4FZXC 2PYJA 2NRTA 1DTTA 3F9MA 4FVMA 2ZWHA 4CJRA 1M1KO 2PZSA 3TAQA 2H3GX 5C42A 1KLNA 4M3WA 2E8AA 3AVHA 1DGKN 3WXJA 5C2FA 3T1YK 1GLCG 1BGXT 4AHUA 2UUCK 2Z1HA 1XHXA 5SZTA 2VG6A 3LM2A 3KLIA 4ZTFA 4AHSA 3NVKA 5AFUH 1XMQK 4H5VA 1QQNA 2FF6A 4I6MB 4QAGA 4AF1A 5BN8A 3CCUN 2X74A 3AVLA 3AGRA 4FJHA 4DV4K 4IO8A 3OTOK 4ILHA 1YTUA 2ITGA 1EQYA 3ZETB 3A2FA 3A5MC 3L3UA 1B92A 1JKHA 3WXIA 4WQ5A 1GOBA 3P38A 2VGNA 2ITMA 1N36K 1HPMA 3HTVA 4AHVA 1WSEA 4KHPK 3KLGA 3E9LA 5HRRA 4L3QA 1N34K 4KHNA 5D3GA 4YOXA 3IAYA 2QWOA 1D9FA 3CETA 3ASMA 3SLCA 4OX9K 2UXBK 3A0IX 3K5MA 4O8UA 3ITHA 3SUNA 1RDDA 2W42A 4J8FA 1RT3A 3AVIA 4DTPA 2NRRA 4LH4A 4JAXA 4KAZA 1A5VA 4BG9A 1HNZK 3L3VA 3RRHA 4BRKA 1C0MA 3KLFA 2E6LA 1JCGA 3G25A 3DRPA 2VWKA 4BR5A 1XC9A 3OBWA 4NCAA 3CQXA 1P90A 1SUQA 1Z6RA 5JVHL 4DFPA 1X9JA 5KRSA 4IO9L 4KPYA 2I7NA 4XEIA 3F2KA 4BDZA 2WUSA 2OPSA 2VGMA 4FSVA 2YHXA 4Y1CA 2P9UB 4CEOA 2FBVA 2EWSA 3ZSXA 4BWMA 2DFFA 2YI1A 4CIGA 1U2VA 4F2SA 5AQYA 1QQCA 1KRPA 1SKWA 4FZYA 3I8DA 1SL1A 3QICA 5IT9O 4E7IA 3IG1A 2Q0UA 1WLJA 2Q97A 1LW2A 2KHOA 2IC3A 2F8TA 1A5WA 3VQ8A 5AQXA 2FSKA 3I33A 2VWBA 4CEQA 4KB0A 1DEJA 1IBLK 3OYNA 1SKRA 3AA2A 4FJ5A 4B3TK 1L3UA 5AFUA 3AAPA 1BO5O 4E7JA 1JCEA 1NM1A 3TAFA 1HR0K 1N6QA 1Q9XA 3MN7A 3VQ6A 4DSFA 5BRHA 4RW8A 1SL0A 2HBLA 1Q81O 3K58A 4G1QA 3CERA 3G0ZA 3N4QA 3HBTA 1VQKN 1IO2A 4YNQA 1QZ6A 2G8KA 1Q7YO 4CBXA 3MXIA 4C8OA 1NGIA 1X1PA 2GEMA 1YJWN 1QE1A 3ID6A 1W0HA 4JK9A 3WXMB 1NMDA 3M8QA 4FWKA 3ZEUA 1TL3A 4BQZA 1NK7A 1S22A 3VQDA 2DTUA 1NK4A 2QKBA 1Q82O 1V4TA 1RTDA 4Q0BA 4GV6A 5GAHP 2QXLA 3LDOA 3V9XA 4IWVA 4AM6A 3K59A 2GWKA 1REVA 3MN5A 3QERA 3O5BA 3QNOA 5HP1A 4Z0UA 1KTQA 3CJCA 3I0RA 3OY9A 3KKRA 3DRRA 1CXUA 2GV9A 1NOZA 3RSEA 4FXDA 3NHGA 5EX5A 3TTCA 2FXUA 1WBDA 4EHTA 3SQ0A 2NRXA 4CF0A 3H08A 4CIFA 5J2MA 4LF5K 3ATUA 4B1YB 5JS2A 2JWKA 4KH4A 4C8LA 4IJAA 1QSLA 3SV4A 1MWMA 4GKJK 4JD2A 5AQQA 4O55A 3AVFA 4H5NA 3V9WA 2RPIA 3EZ5A 3OYEA 2Y1IA 4ID5A 2OTJN 3EKSA 4DSJA 4DFJA 4CGGA 3B6PA 1HNWK 4DS5A 4DF8A 5IWAK 5FLXO 1XQSC 4IOAL 3C95A 4AILC 4O5FA 1IG8A 3SAFA 4WE1A 5JLFA 4LFBK 3MMVA 2ATQA 1X3MA 1NLVA 4J2EA 3CCSN 3R1XA 5CY4A 3SMSA 3VETA 4BC3A 3U8XA 3S3NA 1SL2A 1YTAA 1NBWA 3NGIA 3QEXA 3KK7A 1E4GT 3DWLA 4CGDA 4M45A 4UY8O 5AQMA 2D5RA 3OYHA 1C1CA 1WSJA 4LC9B 4CJLA 3DI6A 4B9NA 1J9AA 4KO0A 3KJVA 1LAWA 5BPLA 3RMBA 4BRDA 3LAMA 4FLUA 2B4JA 1TKXA 4DSKA 1IV0A 1NMNA 2O8FA 1QHAA 3DXKA 3MECA 4JKBA 4DSEA 3KD1E 4LFAK 4CGHA 3KIOA 3VEXA 2Z1GA 2O4IA 3SQ2A 4CJWA 1JLEA 4A57A 2HMIA 4PKIA 1E3MA 3EY1A 5ELZA 3VTHA 4JI5K 2D0OA 1NGCA 3AA3A 5AR0A 1VQ4N 1O13A 3OYGA 4CBUA 3AVMA 4CJ7A 2QXFA 4A62A 5AZJA 3AVCA 1O1WA 4RW9A 2BUPA 3RR8A 3VQCA 4BROA 1QSYA 3ATVA 4BGBA 3CIPA 3I8BA 3C6AA 2P9IA 2P9LA 1N5YA 4O4GA 4HVJA 4JYAK 2WFBA 4HCBA 3C94A 1YHQN 1Q9YA 1EETA 4IXCA 2PBDA 3SPYA 3S9HA 1D8YA 3VQ7A 4IZ9A 4B3MK 4AH9A 3CCEN 3THXA 2CH6A 2G8HA 3N4PA 3V1RA 2UYTA 4DHYA 3NVMA 5GAEP 2P9KA 3ZSRA 4ELVA 1BHLA 1KVCA 2NRVA 3LP3A 3VTIA 3ENBA 1LAVA 2GWJA 2NRWA 2VG7A 2XHBA 5C0YA 3AY9A 4DG1A 2F4VK 5AQUA 5I3UA 4XH5A 1GLJO 4NLBA 1YITN 2IVOA 2RN2A 4BRNA 3PO5A 5BN9A 3AVAA 1T8EA 3VQ4A 1ASVA 2D4WA 3L6QA 3KK3A 1U47A 5A2QO 5AQNA 2OPPA 5K14A 5LMNK 5CHIA 1RFQA 4AHRA 3HP9A 3NF9A 5EY4A 1ASWA 1I3AA 2RE2A 3R9PA 1VQ7N 1Z25A 1MWKA 4F3OA 4EIAA 1QTMA 1S1UA 4DV5K 3L4QA 2HNDA 5JLHA 5EU7A 3AVGA 3SAGA 3KTQA 3AA5X 1K6YA 4B9UA 2HW3A 3WNFA 2E2PA 2ZQBA 3VGMA 4MFBA 3PX6A 3DYAA 2OYQA 1W9HA 4DTRA 1XMOK 1NJXA 1VSFA 4EP4A 3TU5A 4MDAA 4H5RA 3ZYYX 3CFPA 4CEZA 3BP8A 4IFYA 4M41A 4I6MA 1GLAG 3O1BA 3LP2A 4B1WB 1NJYA 3MDQA 4JS4A 1JCFA 3EYZA 3ZETA 4LH5A 3O3HA 5AQRA 1HKCA 1DKGD 4JI1K 5EOYA 5AQGA 1KSPA 3CCMN 1Q8IA 3PY8A 3TTFA 3ZCMA 1NK8A 5E84A 3OS2A 4YDUC 3CJ1A 2E1YA 3V9SA 1JLAA 3QDKA 1IJJA 4U67L 4A5AA 1EX4A 2WOMA 4FJKA 4KHYA 1C1AA 5HL7L 3DRSA 1L3SA 2DFHA 3CQ8A 1OH6A 5KQDA 3EE8A 1NJZA 4CHNA 1ZBHA 3W0LA 5JVGL 1QQOA 1ZXOA 4BR0A 4FJIA 3OYJA 4BRCA 1LCUA 3WQUA 2E5LK 3A8YA 4FM2A 1RT1A 4N41A 4YOVA 4FZZA 1L3TA 3VMFB 4CFAA 2ASPA 4CJPA 2ZF5O 1HKBA 3KKSA 4O0IA 4B1XB 4B9MA 3AVKA 1VQNN 4B8CA 2BH1A 3R6MA 2P1JA 4DTOA 4OO1J 3T1AA 3FZLA 4BE0A 3LWLA 4ISGA 3ZT4A 2O8DB 5LL6Z 1YXQA 5EXWA 4MLHA 3HVRA 4DF4A 2BE2A 2P5GA 2VG5A 4BGAA 3QINA 5AZIB 4CFDA 2HHXA 1UA1A 4PL8A 4NYFA 1L3VA 3J7YP 2GTDA 1HPZA 4NCGA 4DQSA 5CR4A 4CI6A 1K73O 4FK2A 2D0PA 3ULEB 4BR7A 4B3SK 1YT3A 4JI0K 1ZBLA 3MXMA 4DU4A 4W5RA 4DFKA 3ZSOA 4DQIA 4FM1A 4DLGA 3VGKA 5KPRA 4CF9A 4BR4A 4DSIA 3BF1A 3U3YA 3SMPA 4FWNA 3L4IA 3CJBA 3NMUA 2UXCK 2W41A 1SV5A 1X9WA 5F2RA 4M3RA 1GOCA 1M90O 2EX3A 3TAGA 2PFUA 3MN6A 4MQ3A 3WXLA 4FJLA 3SUQA 3O4WA 3SQ4A 5GIPA 4BR2A 4GV3A 2UU9K 1VRTA 1CZBA 3DXMA 3IFRA 3M8PA 3D6RA 4OLAA 3O4NA 5JICA 2X6SA 3KZBA 5KI6A 4WCEL 2ZM6K 3S3MA 1TKZA 5DM7L 5BR8K 4IG3A 4KH6A 2E6MA 5AQZA 4JKHA 3ZT2A 4BG8A 4EZ6A 2NRHA 3HPOA 4K25A 3MCAB 3HP6A 1TKDA 3L2VA 4CGFA 4FJGA 3W3DA 2KW4A 3QMLA 2ZE2A 3VQEA 4FJMA 4FOIA 4N47A 2IDOA 3KK2A 1VQLN 1U4BA 3AO5A 3D7EO 1Y64A 4DV6K 3NAEA 3V81A 4H0VB 3VEWA 3NCIA 4CBWA 3LPUA 1VSEA 3G10A 3J7AP 3QB0A 3AARA 1RDCA 2NNWA 3QO9A 4CK3A 2JGUA 4JKAA 4CK1A 3T19A 4WFNL 1BG3A 4CZMA 3B6OA 3HPHA 5HOOA 2I5JA 1BI4B 2HHQA 2F9TA 2RKIA 4Z4CA 4M3YA 3HJFA 1J53A 1HRHA 1T44A 2PAVA 3CPWM 3QFUA 3NBPA 3GL1A 4DU1A 4V19S 4IJNA 4DR1K 1JLQA 1TAUA 5LJVA 3DLEA 4JRPA 3SNNA 3BUZB 3WNEA 4WFBL 3HO1A 4LY7A 3BZKA 1WUAA 3NDKA 2V7YA 3K9KA 4JI8K 3LANA 4CZJA 5FRNA 3CC2N 3VEVA 4M7YA 3HXMA 2QWMA 4GY2B 3AVJA 2W6LA 3QIPA 4BWJA 1HNXK 5KPTA 5FPMA 4HCCA 4DTNA 3PLAA 1VQPN 1JLGA 4Z4GA 4E1JA 2IS3A 4CF8A 4OVLA 4HUEA 4E7LA 2JWLA 4DTJA 3DLHA 1BQMA 2KLAA 3O9UA 1KCFA 3LL3A 1HJOA 4KKOA 3S41A 4DTSA 1JL2A 2XRIA 2A5XA 5C15A 4CF1A 4JI2K 1LWCA 3F5TA 2ZGYA 1GLLO 4DR5K 5FPDA 1Q18A 5LJWA 3I0SA 3A5OC 2IOCA 4R5PA 2WTUA 1EKEA 1UAXA 1K8KB 3MEGA 2G8WA 2Q0RA 1V4SA 4BACA 3AVNA 5M1FA 2VQFK 5JS1A 4JS5A 5FDLA 3K5OA 1T05A 1YF5L 4CEDA 4H5TA 3SJHA 1RT2A 3NH1A 3VA3A 4FYDA 4QS8A 2Q31A 4B9QA 3ULDA 4E0DA 4DKWA 4JHDA 1J6ZA 2NRZA 5C2DA 1EXQA 3T1HK 5JMVA 4AHTA 3QEWA 4NCBA 3D2FB 3NGYA 4X62K 3E1YA 3FFIA 4KRFA 1T6DA 4DB3A 3FE1A 1NGDA 2P9PA 2UXDK 4PL7A 5J2PA 2KTQA 3K57A 3HPGA 4K8ZA 4FK0A 1QVFM 5HRSA 4OPHA 1S1XA 3QETA 4CJTA 3ID8A 3Q7BA 5I9EB 4FLVA 3A5NC 1JXEA 4ILGB 4KHWA 1RBUA 1JJ2M 4DR4K 4Z4EA 4MDBA 4NXMK 2YKNA 3VQQA 2FC0A 4K43A 3P4IA 5HRPA 3SYZA 3TI0A 4NXNK 3MX5A 1FJGK 1H1VA 4FL9A 1UOCA 4JI6K 3VQ9A 2QWLA 4KI4A 3L2RA 4C1NK 4W5OA 4YOUA 3L8BA 1IH7A 2V52B 1RT5A 2HHWA 2UUBK 3LDPA 4BY9C 2FBYA 1WAJA 1T6CA 3P39A 1ZBFA 3AAQA 3SUOA 3K9JA 3QEPA 2W6KA 3ZLJA 2KZZA 3VF4A 1NK9A 5I42A 5AQLA 3CCJN 3SAHA 3J81O 3KHYA 2O8EB 4OKJA 1S6QA 3QBWA 4FJ8A 2DFEA 4QOZB 4OJRA 3QESA 1S3XA 5CZ2A 5LMUK 3P5JA 2GUPA 2A40A 1MDUB 1BISA 3U9DA 2CGKA 4KH5A 4OGCA 1S1VA 3M1FA 1LW0A 4CD1A 2HNYA 4CZKA 1WNSA 1S5JA 3TTDA 1RT6A 3MEEA 1VQON 2D1KA 3KWGA 3D0PA 3KK1A 2OZSA 3LPTA 3CD6N 1Z26A 4PKGA 2FSJA 4QS7A 3ALYA 3CI5A 4FPAA 3UE5A 2X78A 4BRIA 4CJSA 4I2PA 4FLZA 3SCXA 3DOKA 3HM9A 1C0UA 4WQ5C 3TPQA 3VOVA 4Y0WA 3E9PA 3LZIA 2ZJPL 3BF3A 1RBTA 5HROA 1OH8A 4DTUA 2HB5A 2A1RA 4H0XB 4HTLA 2XY8A 1WB9A 4QCLA 5MLCQ 3SJJA 1RTJA 1RT7A 1VSKA 3IRXA 2G8FA 1D4XA 3UKRB 1RCHA 4CECA 3A5LC 3C7NB 3JSMA 1N33K 2QW9A 2HHUA 4HTUA 1HNIA 3FZMA 2ZJQL 3O4QA 3DLGA 3BY5A 1RTIA 2FLOA 3CFRA 5CZ1A 3NF6A 4KTZA 5J2NA 4N5SA 4YDUA 1NKBA 4JKEA 3ZT0A 4PUOA 1HYVA 1ESVA 2P9SB 3CJAA 3LP0A 3V4IA 1HYSA 2QM1A 2O8BA 4H8KA 3M8SA 1CLQA 3M5RA 3BZCA 1NKEA 3MWTA 2WBNA 2XY6A 3KWIA 1WBBA 4JI7K 3CFOA 4JI3K 3HI0A 4M63C 1ZBSA 3K5LA 4H0YB 3HM8A 3CJ7A 4B8AB 2CGLA 4DQ8A 1EO1A 2F9WA 4DS4A 2YJFA 3G71N 1TL1A 1FK9A 2FF3B 3H1VX 3KLEA 3VF2A 2JLEA 1C0GA 3H1QA 2O8DA 5E41A 4M3UA 4NO7A 3LDSA 3PSFA 4PHTX 3EO3A 4X66K 4DFMA 3WQTA 1VQMN 4EZ9A 3J7ZO 5AZIA 4BRQA 4FWPA 4HWIA 4KBOA 2O4GA 3THYB 4JKDA 4Q5VA 3MWPA 5CYQA 2VYPA 3LALA 2IVNA 3VENA 4CEEA 1QHTA 4J2AA 3DAWA 5C10A 1X9SA 4FLWA 4CEBA 4CHQA 2YKMA 3DJCA 4DTXA 1KD1O 3RMAA 4FWLA 1TUYA 5FRMA 1VQ9N 5AQPA 1FXXA 3ENHA 3SV3A 1UA0A 4M3ZA 3D2EA 2A42A 3OW2M 3L2QA 3AO4A 1NK6A 3ZEUB 1XI1A 2OTLN 4E19A 4C23A 1ZYQA 4ISEA 2G8IA 2P9NA 5AQVA 3TR8A 1OH5A 3TAEA 4BRFA 3TANA 2A6AA 4LSNA 3VQBA 4CERA 3LWMA 4RTFD 1SKSA 3TAMA 4H0PA 1OH7A 2HSTA 3R3LA 3VQAA 4RCHA 4MLEA 3IS9A 4OPKA 5GADP 3EL2A 4ICLA 4FVUA 3TABA 4TSXA 1JLCA 1Q86O 1E4FT 1FKOA 3AO2A 4ILJA 1BQNA 3WEEA 3RSEB 4XH4A 4LD0A 2NUBA 3OJSA 4A59A 1JLBA 2Q2RA 2ASOA 1HQEA 3CG7A 1RILA 4LSLA 3QEVA 4A2AA 2VQEK 1CXQA 4CJ4A 5AQHA 4JD2B 4BC2A 3U9ZA 3LZJA 2QA4N 5AQSA 3RVCA 4OGEA 4YY3K 2J4RA 1C6VA 3HSCA 1J5EK 4FJ9A 3TARA 3V1OA 3CCVN 4DMNA 4CGIA 3EKUA 1NU0A 3HOSA 4B3RK 1BI4A 1OVQA 1IG9A 2HVIA 1YI2N 3O1WA 4RW6A 3FZHA 3OYBA 4CCHA 4NLCA 1TUUA 1L5UA 2B5JA 4C8NA 1HUXA 4DUZK 1J5OA 3KVGA 4JK8A 1VSLA 1NNEA 5F0XA 1NGAA 3HRGA 3G4SN 1G99A 4IEIA 3PX0A 3VN5A 5DM6L 2HNZA 2AA4A 2QWNA 5GINA 1SZ2A 5BPNA 1ATRA 1ZC6A 4EP5A 3B8AX 2E2QA 3SBGA 1S1TA 4JI4K 4FPBA 3RTVA 4WF9L 3MCPA 3L2UA 4BC5A 5BPMA 2HBMA 4E89A 3I56N 3HL8A 3NFAA 3DXKB 4FWQA 2V7ZA 5J1EA 4X64K 4Z4IA 4BQLA 3LDNA 4KB1A 1ASUA 3ZX2A 3WT0A 3EZWA 1S1WA 2AP1A 2HHTA 4CGJA 1K8KA 4BDPA 3CJ9A 1TAQA 1VSDA 3VQPA 4OKEA 2P9UA 4CZIA 3DOLA 5AQTA 2O8CB 3K0SA 3T3FA 3JXUA 4OLBA 5AZJB 4FW1A 2IAJA 3O80A 4FK4A 5EVZA 1S6PA 3GBTA 3HSTB 2HVHA 1RDWX 2Q36A 3SPZA 4HUGA 1BUPA 4DQRA 5KGWA 2P9LB 5BRFA 3OS1A 1X9MA 1R59O 2GBZA 3DLRA 5KTQA 4DV3K 3THWB 3EN9A 4C8MA 3O9TA 3L0QA 2CGJA 1WAFA 2IIRA 4B1UB 4M3XA 3BGRA 3I55N 4Z94A 4NB4A 4WQ4C 4FLXA 3THXB 3RR7A 1NOYA 3O9SA 4RW7A 3CMEN 4PKHA 4H03B 3VERA 1N8RO 2P9KB 1DTQA 1VSMA 4RG8A 2KFZA 5CE3A 3DMJA 5AQOA 4LF4K 1TK0A 2NZTA 3VESA 2HOEA 3LDQA 1KAXA 3O3FA 4DWIA 3ZX0A 4IOXA 1KVAA 3LAKA 5SWMA 2FSNA 4GNIA 4KREA 3BDPA 3S3OA 5CYMA 2YHYA 5TKYA 3SBTA 1GLDG 4BRHA 3FGUA 5BR9A 3AA4A 1RT4A 3C0BA 2I7PA 3U6FA 1VHXA 1LWFA 3R8EA 3CXCM 3P1GA 2WC9A 4K42A 4BVOA 4O0JA 3WNGA 2ASMA 4DV7K 4FW2A 4FM0A 1RDBA 4YOWA 1K8AO 4YHHK 2A1SA 3CM5A 5FPEA 1S9EA 4IKFA 1RGIA 1KLMA 4CE9A 1KXPA 3NF8A 3VPZA 4CZFA 4JKGB 2DPNA 3ENOA 3HK2A 4FWMA 2YCHA 5AJ3K 2LSNA 4E1MA 1T7PA 1S9GA 2RHKA 4JKFA 2Z1JA 1RTHA 3U3GA 2UUAK 2YNHA 4FLYA 5FPNA 4LF6K 1HNVA 1T3VA 1GOAA 1Y97A 2VCPA 3MN9A 4YOYA 2HBJA
chains in the Genus database with same CATH topology
1HNWK 4YY3K 4LF8K 4CW7B 3T1YK 2ZM6K 1J5EK 2UUCK 5BR8K 5IWAK 4DV3K 5FLXO 4DUYK 1XMQK 1IBLK 4B3RK 4B3MK 4GKKK 4X66K 2VQFK 4LFBK 4B3TK 4DV4K 4LF7K 3OTOK 2E5LK 4X65K 1HR0K 4DV6K 4DUZK 2F4VK 3J7AP 4LF4K 1N36K 3T1HK 4X62K 4DR6K 5LL6Z 4KHPK 5A2QO 4LFCK 2UXDK 1N34K 1I94K 5LMNK 4OX9K 2UXBK 4JI4K 1IBMK 1N33K 4V19S 3J80O 4LFAK 3J7YP 4DR1K 4DV5K 1XNRK 3JAMO 1HNZK 4DV2K 4B3SK 4X64K 4JV5K 4JI0K 4DV7K 4DR4K 4JI8K 4NXMK 4NXNK 4YHHK 4DR3K 1XMOK 4DV1K 4CVNE 1FJGK 4JI6K 4DR7K 4JI5K 4LF9K 1HNXK 1N32K 2HHHK 2UUBK 4DV0K 4JI7K 2UXCK 4LF5K 4JI3K 1IBKK 4K0KK 4DR2K 5AJ3K 4GKJK 4JI1K 3J81O 1XNQK 2UUAK 2VQEK 2UU9K 4LF6K 4JI2K 4JYAK 4DR5K 5LMUK 5IT9O 4AQYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW K;  4YY3 K;  4LF8 K;  4CW7 B;  3T1Y K;  2ZM6 K;  1J5E K;  2UUC K;  5BR8 K;  5IWA K;  4DV3 K;  5FLX O;  4DUY K;  1XMQ K;  1IBL K;  4B3R K;  4B3M K;  4GKK K;  4X66 K;  2VQF K;  4LFB K;  4B3T K;  4DV4 K;  4LF7 K;  3OTO K;  2E5L K;  4X65 K;  1HR0 K;  4DV6 K;  4DUZ K;  2F4V K;  3J7A P;  4LF4 K;  1N36 K;  3T1H K;  4X62 K;  4DR6 K;  5LL6 Z;  4KHP K;  5A2Q O;  4LFC K;  2UXD K;  1N34 K;  1I94 K;  5LMN K;  4OX9 K;  2UXB K;  4JI4 K;  1IBM K;  1N33 K;  4V19 S;  3J80 O;  4LFA K;  3J7Y P;  4DR1 K;  4DV5 K;  1XNR K;  3JAM O;  1HNZ K;  4DV2 K;  4B3S K;  4X64 K;  4JV5 K;  4JI0 K;  4DV7 K;  4DR4 K;  4JI8 K;  4NXM K;  4NXN K;  4YHH K;  4DR3 K;  1XMO K;  4DV1 K;  4CVN E;  1FJG K;  4JI6 K;  4DR7 K;  4JI5 K;  4LF9 K;  1HNX K;  1N32 K;  2HHH K;  2UUB K;  4DV0 K;  4JI7 K;  2UXC K;  4LF5 K;  4JI3 K;  1IBK K;  4K0K K;  4DR2 K;  5AJ3 K;  4GKJ K;  4JI1 K;  3J81 O;  1XNQ K;  2UUA K;  2VQE K;  2UU9 K;  4LF6 K;  4JI2 K;  4JYA K;  4DR5 K;  5LMU K;  5IT9 O;  4AQY K; 
#chains in the Genus database with same CATH topology
 3ZSY A;  3OYI A;  3C6U A;  4E7K A;  4OKK A;  4IG0 A;  2F8S A;  4B1V A;  1CZ9 A;  3K2P A;  3E01 A;  4PA1 A;  1ATS A;  4IEE A;  4Z4H A;  2HF4 A;  2HHS A;  4FWO A;  2IGI A;  5AQJ A;  3PV8 A;  2YNG A;  3UKR A;  3C7N A;  3PX4 A;  1HJR A;  3MED A;  2YHA A;  4JN4 A;  3FR0 A;  4BVP A;  2KKZ A;  5HLF A;  4M42 A;  4G9Z A;  2WON A;  1VQ6 N;  3IDH A;  2NLX A;  2D0A A;  2P9S A;  3QLH A;  1D9D A;  3EE9 A;  3WXK A;  1NGE A;  4LFC K;  3CM6 A;  4EAH D;  1YJ9 N;  2QKK A;  1CZA N;  2GX9 A;  3TSU A;  4KV8 A;  4A2B A;  3F73 A;  3O6W A;  1TKT A;  1P8Z A;  3AV9 A;  3J80 O;  2XO7 A;  5E26 A;  4HHT A;  4GMJ B;  3JAM O;  4MO5 A;  3VF6 A;  3CHW A;  1BA0 A;  5DMR A;  3OVN A;  1BCM A;  4A61 A;  3ZSW A;  4CHP A;  1C0T A;  4CVN E;  1BIZ A;  3UKU B;  4LF9 K;  4NYN A;  4F4K A;  3VEY A;  3NH0 A;  2HHH K;  1RBV A;  1HX1 A;  2QTD A;  1KAZ A;  4H4O A;  2QWR A;  2YHW A;  3QNN A;  3UB5 A;  4CIE A;  3SUP A;  2A41 A;  4FWR A;  3THY A;  1U45 A;  4KHS A;  3M6G A;  5LY3 A;  4WYB A;  1WSF A;  1RDU A;  3DM2 A;  2B6A A;  2ETJ A;  4CJU A;  1NJI O;  4EFH A;  2YNI A;  4AQY K;  5C25 A;  2E2N A;  2FBT A;  4C8K A;  1U49 A;  3TWH A;  1GLF O;  2YNF A;  4LF8 K;  5HBM A;  1KFS A;  1XUP O;  1KC8 O;  1C0F A;  3DXM B;  4CHY A;  4FOE A;  1EWQ A;  2P5O A;  4GW6 A;  4FJN A;  3FFK B;  4BRL A;  1TYQ B;  4A5B A;  1LV5 A;  1NG9 A;  3MK6 A;  4AM7 A;  3DLB A;  3PIO L;  3SZ2 A;  3CC7 N;  3HZ6 A;  4F9O A;  1KQS M;  1BA1 A;  1KAY A;  1DT9 A;  3IMX A;  5BRE A;  1T03 A;  1ITG A;  4H5W A;  1MU2 A;  1RBS A;  4M7X A;  3QEI A;  1KVB A;  2KQ2 A;  2CH5 A;  2QWQ A;  1SQK A;  5M1O A;  3MXJ A;  3RMD A;  4BE2 A;  1XWL A;  2F96 A;  5H1S Q;  5AQF A;  4M3T A;  2A3Z A;  2G8V A;  4CFB A;  4FO0 A;  1J54 A;  4BRP A;  2E4L A;  4F8R A;  4PY5 A;  5B8H A;  1ATN A;  3NF7 A;  1A5X A;  4N56 A;  3DLK A;  1YUW A;  2QEX N;  4B9V A;  4KI6 A;  4JRQ A;  4DLE A;  1LOT B;  4IOC L;  4E7H A;  3F9K A;  4CJK A;  4CZE A;  4FLT A;  3H3O B;  3L2W A;  1XNR K;  1JLF A;  3ZT1 A;  3D45 A;  2BAN A;  1BCO A;  3CF5 L;  4UQG A;  3KD5 E;  4JV5 K;  4PQU A;  1NWK A;  1VK0 A;  4JK7 A;  1QSS A;  4DR3 K;  3AO3 A;  4CHZ A;  3OA9 A;  5C12 A;  4DTM A;  4DR7 K;  1IKW A;  1C1B A;  3CCR N;  4KFB A;  4RW4 A;  3SK3 A;  4HUF A;  4FWS A;  3UIQ A;  4DU3 A;  2ZJR L;  1HKG A;  3OYL A;  3H45 C;  4FJX A;  4Y1D A;  1YVU A;  5M1Q A;  1OVY A;  3HYF A;  1NGB A;  3PIP L;  2E20 A;  1WSH A;  1VAZ A;  1XNQ K;  3OBY A;  3QBX A;  4PWD A;  1BIU A;  4IDK A;  1VRU A;  5AQW A;  3ZT3 A;  5HRN A;  2BGG A;  4W5Q A;  1ZBU A;  2E1Z A;  4YFU A;  4CW7 B;  3E66 A;  2XY7 A;  1NK5 A;  4O5B A;  3O3G A;  2KFN A;  2OPR A;  3OYM A;  5F1X A;  3TSP A;  4RWT A;  4ISF A;  3M3Z A;  5KRT A;  1EWR A;  1HLU A;  3OYF A;  3O8M A;  1WN7 A;  3V1Q A;  4KTW A;  3ISN C;  1TV6 A;  3CPE A;  1GLB G;  1BOT O;  3TSQ A;  1U2V B;  3HOT A;  2Z1I A;  4CZG A;  4DCH A;  1K9M O;  3AVB A;  3V9Z A;  4CJ3 A;  3M8R A;  4GVM A;  3OYD A;  2PY5 A;  1TK8 A;  4JHD B;  1F21 A;  5AQI A;  1GLE G;  4KHQ A;  3SI6 A;  4CFC A;  3EEQ A;  1WOQ A;  3LM9 A;  1JL1 A;  4CJQ A;  4U7B A;  3GE1 A;  1HMV A;  4CHO A;  5BRD A;  4N76 A;  2O8C A;  2P9P B;  2FBX A;  2F7T A;  3ULE A;  4GVE A;  4B9L A;  4CJ5 A;  4I9Q A;  3Q7C A;  1NGH A;  1SAZ A;  4CD3 A;  3AO1 A;  3RMC A;  3CYM A;  5ADX H;  4H4M A;  1YJN N;  1U04 A;  3T69 A;  3VQ5 A;  4OPJ A;  4DV1 K;  4I2Q A;  2Y1J A;  3THW A;  3ZSV A;  1ZBI A;  3U4L A;  4CK2 A;  1N32 K;  1QS4 A;  3IUC A;  1VQ8 N;  1W7A A;  3OYC A;  4O8K A;  3GDQ A;  3P83 D;  4WQ4 A;  5C24 A;  1WSG A;  4K8X A;  4JNE A;  1RNH A;  4O44 A;  4QS9 A;  1MA9 B;  2HMP A;  5AQK A;  1BWF O;  4CF2 A;  4IBN A;  4EHU A;  2VWJ A;  4JEP A;  4K41 A;  3LP1 A;  2QI2 A;  1UWB A;  3FLC O;  2P51 A;  3CC4 N;  1RBR A;  2AJQ A;  1EP4 A;  2R7Y A;  5GIO A;  2QWP A;  4DUY K;  1VSH A;  1LWE A;  4GV9 A;  1X3N A;  4BR9 A;  4KTQ A;  4GKK K;  4L8R B;  1RDA A;  1VSJ A;  1NK0 A;  1HQU A;  3ZSQ A;  4CEA A;  4X65 K;  5GAG P;  2Q3S A;  2IVP A;  2X6N A;  3JS6 A;  3KLH A;  4R79 A;  3OYA A;  1OKJ A;  1IKX A;  1W97 L;  2E2O A;  1DLO A;  3HVT A;  1TK5 A;  2OZM A;  4KHU A;  3H6E A;  2GUI A;  1YAG A;  4DR6 K;  1XHZ A;  4I7F A;  4W5T A;  4C1N I;  4BRG A;  5KGX A;  1I94 K;  4IFE A;  4I9L A;  1I39 A;  5M1K A;  4JKG A;  4F2R A;  3CQY A;  3THV A;  1W2B M;  1IBM K;  1KFD A;  3H3N O;  4B08 A;  5T7B A;  1BDG A;  2Q1N A;  4JKC A;  4XIU A;  3T7Z A;  4CJF A;  4CEF A;  3HT3 A;  4DV2 K;  4H0T B;  1BL3 A;  1SS6 A;  5DK5 A;  3CMA N;  1Z05 A;  3C65 A;  2V51 B;  4BE1 A;  1NKC A;  4IFV A;  5ADX A;  2EHG A;  3AGK A;  4MO4 A;  2HHV A;  4ELU A;  4B9T A;  3GOI A;  2YHB A;  2O8B B;  3MAQ A;  2OAN A;  2GEL A;  1IBK K;  3SQ1 A;  4YOT A;  3O9Q A;  4DR2 K;  3PUF A;  3DLL L;  5M1P A;  4DQQ A;  2O8F B;  3WUH A;  3FZF A;  2YJE A;  1HYZ A;  3IKM A;  4ELT A;  4FJ7 A;  2BDP A;  2KZM A;  2D0B A;  2W40 A;  1QQM A;  3H46 O;  3MX2 A;  2OCE A;  2QK9 A;  4BRM A;  1IKY A;  3TAP A;  3OJU A;  3CCL N;  1IKV A;  4BDY A;  3C6H A;  3OYK A;  2G8U A;  4F3T A;  5KPZ A;  1WSI A;  1B9F A;  1NGF A;  3P31 A;  1B9D A;  1QZ5 A;  3OHR A;  3E9O A;  1XC3 A;  4BC4 A;  3V9U A;  3NE6 A;  4LF7 K;  3NH2 A;  4J2D A;  4WFA L;  4E3S A;  1BU6 O;  5TKW A;  3V6D A;  3VEZ A;  4E1N A;  3QFP A;  1R0A A;  1NJW A;  4J2B A;  4ID1 A;  2BTF A;  2P9I B;  1ILY A;  4BRA A;  4ZHR A;  3D2F A;  3VGL A;  3JYT A;  2RF2 A;  4ZTJ A;  2HBK A;  1NGJ A;  4IDH A;  1QVG M;  2OPQ A;  3WNH A;  2E88 A;  4B3O A;  3O08 A;  3UKU A;  2PYL A;  2YV0 X;  1VQ5 N;  1YVN A;  4B9S A;  4YOR A;  4B1Z A;  3PO4 A;  3J8A A;  1G15 A;  4FJJ A;  3K5N A;  1TGO A;  4BRE A;  2HF3 A;  3C6T A;  3QIO A;  3LDL A;  3RWU A;  5FRO A;  2YX6 A;  1NGG A;  3O9R A;  4AHC A;  2ZD1 A;  4CZH A;  4H0O A;  3D2E B;  3OS0 A;  4OPA A;  3PSI A;  3FZK A;  1S72 N;  1VSI A;  4CJV A;  3VA0 A;  1FW6 A;  1FKP A;  1TVR A;  4W5N A;  2P9N B;  3GG4 A;  4DQP A;  4CJE A;  3RRG A;  2ZGZ A;  1U48 A;  5KQ8 A;  4JLH A;  4CES A;  1YIJ N;  2D0C A;  3ZSZ A;  3ZX3 A;  4Z4F A;  5M1N A;  3BEX A;  1U6Z A;  2OA8 A;  4FCY A;  4DV0 K;  3NGZ A;  3G6E N;  3CCQ N;  5J2Q A;  4CZL A;  2XY5 A;  1D5A A;  4K0K K;  4XH1 A;  1TYQ A;  2O8E A;  3VEO A;  4DSL A;  2DY4 A;  1JXB A;  3WEE B;  4FZX C;  2PYJ A;  2NRT A;  1DTT A;  3F9M A;  4FVM A;  2ZWH A;  4CJR A;  1M1K O;  2PZS A;  3TAQ A;  2H3G X;  5C42 A;  1KLN A;  4M3W A;  2E8A A;  3AVH A;  1DGK N;  3WXJ A;  5C2F A;  3T1Y K;  1GLC G;  1BGX T;  4AHU A;  2UUC K;  2Z1H A;  1XHX A;  5SZT A;  2VG6 A;  3LM2 A;  3KLI A;  4ZTF A;  4AHS A;  3NVK A;  5AFU H;  1XMQ K;  4H5V A;  1QQN A;  2FF6 A;  4I6M B;  4QAG A;  4AF1 A;  5BN8 A;  3CCU N;  2X74 A;  3AVL A;  3AGR A;  4FJH A;  4DV4 K;  4IO8 A;  3OTO K;  4ILH A;  1YTU A;  2ITG A;  1EQY A;  3ZET B;  3A2F A;  3A5M C;  3L3U A;  1B92 A;  1JKH A;  3WXI A;  4WQ5 A;  1GOB A;  3P38 A;  2VGN A;  2ITM A;  1N36 K;  1HPM A;  3HTV A;  4AHV A;  1WSE A;  4KHP K;  3KLG A;  3E9L A;  5HRR A;  4L3Q A;  1N34 K;  4KHN A;  5D3G A;  4YOX A;  3IAY A;  2QWO A;  1D9F A;  3CET A;  3ASM A;  3SLC A;  4OX9 K;  2UXB K;  3A0I X;  3K5M A;  4O8U A;  3ITH A;  3SUN A;  1RDD A;  2W42 A;  4J8F A;  1RT3 A;  3AVI A;  4DTP A;  2NRR A;  4LH4 A;  4JAX A;  4KAZ A;  1A5V A;  4BG9 A;  1HNZ K;  3L3V A;  3RRH A;  4BRK A;  1C0M A;  3KLF A;  2E6L A;  1JCG A;  3G25 A;  3DRP A;  2VWK A;  4BR5 A;  1XC9 A;  3OBW A;  4NCA A;  3CQX A;  1P90 A;  1SUQ A;  1Z6R A;  5JVH L;  4DFP A;  1X9J A;  5KRS A;  4IO9 L;  4KPY A;  2I7N A;  4XEI A;  3F2K A;  4BDZ A;  2WUS A;  2OPS A;  2VGM A;  4FSV A;  2YHX A;  4Y1C A;  2P9U B;  4CEO A;  2FBV A;  2EWS A;  3ZSX A;  4BWM A;  2DFF A;  2YI1 A;  4CIG A;  1U2V A;  4F2S A;  5AQY A;  1QQC A;  1KRP A;  1SKW A;  4FZY A;  3I8D A;  1SL1 A;  3QIC A;  5IT9 O;  4E7I A;  3IG1 A;  2Q0U A;  1WLJ A;  2Q97 A;  1LW2 A;  2KHO A;  2IC3 A;  2F8T A;  1A5W A;  3VQ8 A;  5AQX A;  2FSK A;  3I33 A;  2VWB A;  4CEQ A;  4KB0 A;  1DEJ A;  1IBL K;  3OYN A;  1SKR A;  3AA2 A;  4FJ5 A;  4B3T K;  1L3U A;  5AFU A;  3AAP A;  1BO5 O;  4E7J A;  1JCE A;  1NM1 A;  3TAF A;  1HR0 K;  1N6Q A;  1Q9X A;  3MN7 A;  3VQ6 A;  4DSF A;  5BRH A;  4RW8 A;  1SL0 A;  2HBL A;  1Q81 O;  3K58 A;  4G1Q A;  3CER A;  3G0Z A;  3N4Q A;  3HBT A;  1VQK N;  1IO2 A;  4YNQ A;  1QZ6 A;  2G8K A;  1Q7Y O;  4CBX A;  3MXI A;  4C8O A;  1NGI A;  1X1P A;  2GEM A;  1YJW N;  1QE1 A;  3ID6 A;  1W0H A;  4JK9 A;  3WXM B;  1NMD A;  3M8Q A;  4FWK A;  3ZEU A;  1TL3 A;  4BQZ A;  1NK7 A;  1S22 A;  3VQD A;  2DTU A;  1NK4 A;  2QKB A;  1Q82 O;  1V4T A;  1RTD A;  4Q0B A;  4GV6 A;  5GAH P;  2QXL A;  3LDO A;  3V9X A;  4IWV A;  4AM6 A;  3K59 A;  2GWK A;  1REV A;  3MN5 A;  3QER A;  3O5B A;  3QNO A;  5HP1 A;  4Z0U A;  1KTQ A;  3CJC A;  3I0R A;  3OY9 A;  3KKR A;  3DRR A;  1CXU A;  2GV9 A;  1NOZ A;  3RSE A;  4FXD A;  3NHG A;  5EX5 A;  3TTC A;  2FXU A;  1WBD A;  4EHT A;  3SQ0 A;  2NRX A;  4CF0 A;  3H08 A;  4CIF A;  5J2M A;  4LF5 K;  3ATU A;  4B1Y B;  5JS2 A;  2JWK A;  4KH4 A;  4C8L A;  4IJA A;  1QSL A;  3SV4 A;  1MWM A;  4GKJ K;  4JD2 A;  5AQQ A;  4O55 A;  3AVF A;  4H5N A;  3V9W A;  2RPI A;  3EZ5 A;  3OYE A;  2Y1I A;  4ID5 A;  2OTJ N;  3EKS A;  4DSJ A;  4DFJ A;  4CGG A;  3B6P A;  1HNW K;  4DS5 A;  4DF8 A;  5IWA K;  5FLX O;  1XQS C;  4IOA L;  3C95 A;  4AIL C;  4O5F A;  1IG8 A;  3SAF A;  4WE1 A;  5JLF A;  4LFB K;  3MMV A;  2ATQ A;  1X3M A;  1NLV A;  4J2E A;  3CCS N;  3R1X A;  5CY4 A;  3SMS A;  3VET A;  4BC3 A;  3U8X A;  3S3N A;  1SL2 A;  1YTA A;  1NBW A;  3NGI A;  3QEX A;  3KK7 A;  1E4G T;  3DWL A;  4CGD A;  4M45 A;  4UY8 O;  5AQM A;  2D5R A;  3OYH A;  1C1C A;  1WSJ A;  4LC9 B;  4CJL A;  3DI6 A;  4B9N A;  1J9A A;  4KO0 A;  3KJV A;  1LAW A;  5BPL A;  3RMB A;  4BRD A;  3LAM A;  4FLU A;  2B4J A;  1TKX A;  4DSK A;  1IV0 A;  1NMN A;  2O8F A;  1QHA A;  3DXK A;  3MEC A;  4JKB A;  4DSE A;  3KD1 E;  4LFA K;  4CGH A;  3KIO A;  3VEX A;  2Z1G A;  2O4I A;  3SQ2 A;  4CJW A;  1JLE A;  4A57 A;  2HMI A;  4PKI A;  1E3M A;  3EY1 A;  5ELZ A;  3VTH A;  4JI5 K;  2D0O A;  1NGC A;  3AA3 A;  5AR0 A;  1VQ4 N;  1O13 A;  3OYG A;  4CBU A;  3AVM A;  4CJ7 A;  2QXF A;  4A62 A;  5AZJ A;  3AVC A;  1O1W A;  4RW9 A;  2BUP A;  3RR8 A;  3VQC A;  4BRO A;  1QSY A;  3ATV A;  4BGB A;  3CIP A;  3I8B A;  3C6A A;  2P9I A;  2P9L A;  1N5Y A;  4O4G A;  4HVJ A;  4JYA K;  2WFB A;  4HCB A;  3C94 A;  1YHQ N;  1Q9Y A;  1EET A;  4IXC A;  2PBD A;  3SPY A;  3S9H A;  1D8Y A;  3VQ7 A;  4IZ9 A;  4B3M K;  4AH9 A;  3CCE N;  3THX A;  2CH6 A;  2G8H A;  3N4P A;  3V1R A;  2UYT A;  4DHY A;  3NVM A;  5GAE P;  2P9K A;  3ZSR A;  4ELV A;  1BHL A;  1KVC A;  2NRV A;  3LP3 A;  3VTI A;  3ENB A;  1LAV A;  2GWJ A;  2NRW A;  2VG7 A;  2XHB A;  5C0Y A;  3AY9 A;  4DG1 A;  2F4V K;  5AQU A;  5I3U A;  4XH5 A;  1GLJ O;  4NLB A;  1YIT N;  2IVO A;  2RN2 A;  4BRN A;  3PO5 A;  5BN9 A;  3AVA A;  1T8E A;  3VQ4 A;  1ASV A;  2D4W A;  3L6Q A;  3KK3 A;  1U47 A;  5A2Q O;  5AQN A;  2OPP A;  5K14 A;  5LMN K;  5CHI A;  1RFQ A;  4AHR A;  3HP9 A;  3NF9 A;  5EY4 A;  1ASW A;  1I3A A;  2RE2 A;  3R9P A;  1VQ7 N;  1Z25 A;  1MWK A;  4F3O A;  4EIA A;  1QTM A;  1S1U A;  4DV5 K;  3L4Q A;  2HND A;  5JLH A;  5EU7 A;  3AVG A;  3SAG A;  3KTQ A;  3AA5 X;  1K6Y A;  4B9U A;  2HW3 A;  3WNF A;  2E2P A;  2ZQB A;  3VGM A;  4MFB A;  3PX6 A;  3DYA A;  2OYQ A;  1W9H A;  4DTR A;  1XMO K;  1NJX A;  1VSF A;  4EP4 A;  3TU5 A;  4MDA A;  4H5R A;  3ZYY X;  3CFP A;  4CEZ A;  3BP8 A;  4IFY A;  4M41 A;  4I6M A;  1GLA G;  3O1B A;  3LP2 A;  4B1W B;  1NJY A;  3MDQ A;  4JS4 A;  1JCF A;  3EYZ A;  3ZET A;  4LH5 A;  3O3H A;  5AQR A;  1HKC A;  1DKG D;  4JI1 K;  5EOY A;  5AQG A;  1KSP A;  3CCM N;  1Q8I A;  3PY8 A;  3TTF A;  3ZCM A;  1NK8 A;  5E84 A;  3OS2 A;  4YDU C;  3CJ1 A;  2E1Y A;  3V9S A;  1JLA A;  3QDK A;  1IJJ A;  4U67 L;  4A5A A;  1EX4 A;  2WOM A;  4FJK A;  4KHY A;  1C1A A;  5HL7 L;  3DRS A;  1L3S A;  2DFH A;  3CQ8 A;  1OH6 A;  5KQD A;  3EE8 A;  1NJZ A;  4CHN A;  1ZBH A;  3W0L A;  5JVG L;  1QQO A;  1ZXO A;  4BR0 A;  4FJI A;  3OYJ A;  4BRC A;  1LCU A;  3WQU A;  2E5L K;  3A8Y A;  4FM2 A;  1RT1 A;  4N41 A;  4YOV A;  4FZZ A;  1L3T A;  3VMF B;  4CFA A;  2ASP A;  4CJP A;  2ZF5 O;  1HKB A;  3KKS A;  4O0I A;  4B1X B;  4B9M A;  3AVK A;  1VQN N;  4B8C A;  2BH1 A;  3R6M A;  2P1J A;  4DTO A;  4OO1 J;  3T1A A;  3FZL A;  4BE0 A;  3LWL A;  4ISG A;  3ZT4 A;  2O8D B;  5LL6 Z;  1YXQ A;  5EXW A;  4MLH A;  3HVR A;  4DF4 A;  2BE2 A;  2P5G A;  2VG5 A;  4BGA A;  3QIN A;  5AZI B;  4CFD A;  2HHX A;  1UA1 A;  4PL8 A;  4NYF A;  1L3V A;  3J7Y P;  2GTD A;  1HPZ A;  4NCG A;  4DQS A;  5CR4 A;  4CI6 A;  1K73 O;  4FK2 A;  2D0P A;  3ULE B;  4BR7 A;  4B3S K;  1YT3 A;  4JI0 K;  1ZBL A;  3MXM A;  4DU4 A;  4W5R A;  4DFK A;  3ZSO A;  4DQI A;  4FM1 A;  4DLG A;  3VGK A;  5KPR A;  4CF9 A;  4BR4 A;  4DSI A;  3BF1 A;  3U3Y A;  3SMP A;  4FWN A;  3L4I A;  3CJB A;  3NMU A;  2UXC K;  2W41 A;  1SV5 A;  1X9W A;  5F2R A;  4M3R A;  1GOC A;  1M90 O;  2EX3 A;  3TAG A;  2PFU A;  3MN6 A;  4MQ3 A;  3WXL A;  4FJL A;  3SUQ A;  3O4W A;  3SQ4 A;  5GIP A;  4BR2 A;  4GV3 A;  2UU9 K;  1VRT A;  1CZB A;  3DXM A;  3IFR A;  3M8P A;  3D6R A;  4OLA A;  3O4N A;  5JIC A;  2X6S A;  3KZB A;  5KI6 A;  4WCE L;  2ZM6 K;  3S3M A;  1TKZ A;  5DM7 L;  5BR8 K;  4IG3 A;  4KH6 A;  2E6M A;  5AQZ A;  4JKH A;  3ZT2 A;  4BG8 A;  4EZ6 A;  2NRH A;  3HPO A;  4K25 A;  3MCA B;  3HP6 A;  1TKD A;  3L2V A;  4CGF A;  4FJG A;  3W3D A;  2KW4 A;  3QML A;  2ZE2 A;  3VQE A;  4FJM A;  4FOI A;  4N47 A;  2IDO A;  3KK2 A;  1VQL N;  1U4B A;  3AO5 A;  3D7E O;  1Y64 A;  4DV6 K;  3NAE A;  3V81 A;  4H0V B;  3VEW A;  3NCI A;  4CBW A;  3LPU A;  1VSE A;  3G10 A;  3J7A P;  3QB0 A;  3AAR A;  1RDC A;  2NNW A;  3QO9 A;  4CK3 A;  2JGU A;  4JKA A;  4CK1 A;  3T19 A;  4WFN L;  1BG3 A;  4CZM A;  3B6O A;  3HPH A;  5HOO A;  2I5J A;  1BI4 B;  2HHQ A;  2F9T A;  2RKI A;  4Z4C A;  4M3Y A;  3HJF A;  1J53 A;  1HRH A;  1T44 A;  2PAV A;  3CPW M;  3QFU A;  3NBP A;  3GL1 A;  4DU1 A;  4V19 S;  4IJN A;  4DR1 K;  1JLQ A;  1TAU A;  5LJV A;  3DLE A;  4JRP A;  3SNN A;  3BUZ B;  3WNE A;  4WFB L;  3HO1 A;  4LY7 A;  3BZK A;  1WUA A;  3NDK A;  2V7Y A;  3K9K A;  4JI8 K;  3LAN A;  4CZJ A;  5FRN A;  3CC2 N;  3VEV A;  4M7Y A;  3HXM A;  2QWM A;  4GY2 B;  3AVJ A;  2W6L A;  3QIP A;  4BWJ A;  1HNX K;  5KPT A;  5FPM A;  4HCC A;  4DTN A;  3PLA A;  1VQP N;  1JLG A;  4Z4G A;  4E1J A;  2IS3 A;  4CF8 A;  4OVL A;  4HUE A;  4E7L A;  2JWL A;  4DTJ A;  3DLH A;  1BQM A;  2KLA A;  3O9U A;  1KCF A;  3LL3 A;  1HJO A;  4KKO A;  3S41 A;  4DTS A;  1JL2 A;  2XRI A;  2A5X A;  5C15 A;  4CF1 A;  4JI2 K;  1LWC A;  3F5T A;  2ZGY A;  1GLL O;  4DR5 K;  5FPD A;  1Q18 A;  5LJW A;  3I0S A;  3A5O C;  2IOC A;  4R5P A;  2WTU A;  1EKE A;  1UAX A;  1K8K B;  3MEG A;  2G8W A;  2Q0R A;  1V4S A;  4BAC A;  3AVN A;  5M1F A;  2VQF K;  5JS1 A;  4JS5 A;  5FDL A;  3K5O A;  1T05 A;  1YF5 L;  4CED A;  4H5T A;  3SJH A;  1RT2 A;  3NH1 A;  3VA3 A;  4FYD A;  4QS8 A;  2Q31 A;  4B9Q A;  3ULD A;  4E0D A;  4DKW A;  4JHD A;  1J6Z A;  2NRZ A;  5C2D A;  1EXQ A;  3T1H K;  5JMV A;  4AHT A;  3QEW A;  4NCB A;  3D2F B;  3NGY A;  4X62 K;  3E1Y A;  3FFI A;  4KRF A;  1T6D A;  4DB3 A;  3FE1 A;  1NGD A;  2P9P A;  2UXD K;  4PL7 A;  5J2P A;  2KTQ A;  3K57 A;  3HPG A;  4K8Z A;  4FK0 A;  1QVF M;  5HRS A;  4OPH A;  1S1X A;  3QET A;  4CJT A;  3ID8 A;  3Q7B A;  5I9E B;  4FLV A;  3A5N C;  1JXE A;  4ILG B;  4KHW A;  1RBU A;  1JJ2 M;  4DR4 K;  4Z4E A;  4MDB A;  4NXM K;  2YKN A;  3VQQ A;  2FC0 A;  4K43 A;  3P4I A;  5HRP A;  3SYZ A;  3TI0 A;  4NXN K;  3MX5 A;  1FJG K;  1H1V A;  4FL9 A;  1UOC A;  4JI6 K;  3VQ9 A;  2QWL A;  4KI4 A;  3L2R A;  4C1N K;  4W5O A;  4YOU A;  3L8B A;  1IH7 A;  2V52 B;  1RT5 A;  2HHW A;  2UUB K;  3LDP A;  4BY9 C;  2FBY A;  1WAJ A;  1T6C A;  3P39 A;  1ZBF A;  3AAQ A;  3SUO A;  3K9J A;  3QEP A;  2W6K A;  3ZLJ A;  2KZZ A;  3VF4 A;  1NK9 A;  5I42 A;  5AQL A;  3CCJ N;  3SAH A;  3J81 O;  3KHY A;  2O8E B;  4OKJ A;  1S6Q A;  3QBW A;  4FJ8 A;  2DFE A;  4QOZ B;  4OJR A;  3QES A;  1S3X A;  5CZ2 A;  5LMU K;  3P5J A;  2GUP A;  2A40 A;  1MDU B;  1BIS A;  3U9D A;  2CGK A;  4KH5 A;  4OGC A;  1S1V A;  3M1F A;  1LW0 A;  4CD1 A;  2HNY A;  4CZK A;  1WNS A;  1S5J A;  3TTD A;  1RT6 A;  3MEE A;  1VQO N;  2D1K A;  3KWG A;  3D0P A;  3KK1 A;  2OZS A;  3LPT A;  3CD6 N;  1Z26 A;  4PKG A;  2FSJ A;  4QS7 A;  3ALY A;  3CI5 A;  4FPA A;  3UE5 A;  2X78 A;  4BRI A;  4CJS A;  4I2P A;  4FLZ A;  3SCX A;  3DOK A;  3HM9 A;  1C0U A;  4WQ5 C;  3TPQ A;  3VOV A;  4Y0W A;  3E9P A;  3LZI A;  2ZJP L;  3BF3 A;  1RBT A;  5HRO A;  1OH8 A;  4DTU A;  2HB5 A;  2A1R A;  4H0X B;  4HTL A;  2XY8 A;  1WB9 A;  4QCL A;  5MLC Q;  3SJJ A;  1RTJ A;  1RT7 A;  1VSK A;  3IRX A;  2G8F A;  1D4X A;  3UKR B;  1RCH A;  4CEC A;  3A5L C;  3C7N B;  3JSM A;  1N33 K;  2QW9 A;  2HHU A;  4HTU A;  1HNI A;  3FZM A;  2ZJQ L;  3O4Q A;  3DLG A;  3BY5 A;  1RTI A;  2FLO A;  3CFR A;  5CZ1 A;  3NF6 A;  4KTZ A;  5J2N A;  4N5S A;  4YDU A;  1NKB A;  4JKE A;  3ZT0 A;  4PUO A;  1HYV A;  1ESV A;  2P9S B;  3CJA A;  3LP0 A;  3V4I A;  1HYS A;  2QM1 A;  2O8B A;  4H8K A;  3M8S A;  1CLQ A;  3M5R A;  3BZC A;  1NKE A;  3MWT A;  2WBN A;  2XY6 A;  3KWI A;  1WBB A;  4JI7 K;  3CFO A;  4JI3 K;  3HI0 A;  4M63 C;  1ZBS A;  3K5L A;  4H0Y B;  3HM8 A;  3CJ7 A;  4B8A B;  2CGL A;  4DQ8 A;  1EO1 A;  2F9W A;  4DS4 A;  2YJF A;  3G71 N;  1TL1 A;  1FK9 A;  2FF3 B;  3H1V X;  3KLE A;  3VF2 A;  2JLE A;  1C0G A;  3H1Q A;  2O8D A;  5E41 A;  4M3U A;  4NO7 A;  3LDS A;  3PSF A;  4PHT X;  3EO3 A;  4X66 K;  4DFM A;  3WQT A;  1VQM N;  4EZ9 A;  3J7Z O;  5AZI A;  4BRQ A;  4FWP A;  4HWI A;  4KBO A;  2O4G A;  3THY B;  4JKD A;  4Q5V A;  3MWP A;  5CYQ A;  2VYP A;  3LAL A;  2IVN A;  3VEN A;  4CEE A;  1QHT A;  4J2A A;  3DAW A;  5C10 A;  1X9S A;  4FLW A;  4CEB A;  4CHQ A;  2YKM A;  3DJC A;  4DTX A;  1KD1 O;  3RMA A;  4FWL A;  1TUY A;  5FRM A;  1VQ9 N;  5AQP A;  1FXX A;  3ENH A;  3SV3 A;  1UA0 A;  4M3Z A;  3D2E A;  2A42 A;  3OW2 M;  3L2Q A;  3AO4 A;  1NK6 A;  3ZEU B;  1XI1 A;  2OTL N;  4E19 A;  4C23 A;  1ZYQ A;  4ISE A;  2G8I A;  2P9N A;  5AQV A;  3TR8 A;  1OH5 A;  3TAE A;  4BRF A;  3TAN A;  2A6A A;  4LSN A;  3VQB A;  4CER A;  3LWM A;  4RTF D;  1SKS A;  3TAM A;  4H0P A;  1OH7 A;  2HST A;  3R3L A;  3VQA A;  4RCH A;  4MLE A;  3IS9 A;  4OPK A;  5GAD P;  3EL2 A;  4ICL A;  4FVU A;  3TAB A;  4TSX A;  1JLC A;  1Q86 O;  1E4F T;  1FKO A;  3AO2 A;  4ILJ A;  1BQN A;  3WEE A;  3RSE B;  4XH4 A;  4LD0 A;  2NUB A;  3OJS A;  4A59 A;  1JLB A;  2Q2R A;  2ASO A;  1HQE A;  3CG7 A;  1RIL A;  4LSL A;  3QEV A;  4A2A A;  2VQE K;  1CXQ A;  4CJ4 A;  5AQH A;  4JD2 B;  4BC2 A;  3U9Z A;  3LZJ A;  2QA4 N;  5AQS A;  3RVC A;  4OGE A;  4YY3 K;  2J4R A;  1C6V A;  3HSC A;  1J5E K;  4FJ9 A;  3TAR A;  3V1O A;  3CCV N;  4DMN A;  4CGI A;  3EKU A;  1NU0 A;  3HOS A;  4B3R K;  1BI4 A;  1OVQ A;  1IG9 A;  2HVI A;  1YI2 N;  3O1W A;  4RW6 A;  3FZH A;  3OYB A;  4CCH A;  4NLC A;  1TUU A;  1L5U A;  2B5J A;  4C8N A;  1HUX A;  4DUZ K;  1J5O A;  3KVG A;  4JK8 A;  1VSL A;  1NNE A;  5F0X A;  1NGA A;  3HRG A;  3G4S N;  1G99 A;  4IEI A;  3PX0 A;  3VN5 A;  5DM6 L;  2HNZ A;  2AA4 A;  2QWN A;  5GIN A;  1SZ2 A;  5BPN A;  1ATR A;  1ZC6 A;  4EP5 A;  3B8A X;  2E2Q A;  3SBG A;  1S1T A;  4JI4 K;  4FPB A;  3RTV A;  4WF9 L;  3MCP A;  3L2U A;  4BC5 A;  5BPM A;  2HBM A;  4E89 A;  3I56 N;  3HL8 A;  3NFA A;  3DXK B;  4FWQ A;  2V7Z A;  5J1E A;  4X64 K;  4Z4I A;  4BQL A;  3LDN A;  4KB1 A;  1ASU A;  3ZX2 A;  3WT0 A;  3EZW A;  1S1W A;  2AP1 A;  2HHT A;  4CGJ A;  1K8K A;  4BDP A;  3CJ9 A;  1TAQ A;  1VSD A;  3VQP A;  4OKE A;  2P9U A;  4CZI A;  3DOL A;  5AQT A;  2O8C B;  3K0S A;  3T3F A;  3JXU A;  4OLB A;  5AZJ B;  4FW1 A;  2IAJ A;  3O80 A;  4FK4 A;  5EVZ A;  1S6P A;  3GBT A;  3HST B;  2HVH A;  1RDW X;  2Q36 A;  3SPZ A;  4HUG A;  1BUP A;  4DQR A;  5KGW A;  2P9L B;  5BRF A;  3OS1 A;  1X9M A;  1R59 O;  2GBZ A;  3DLR A;  5KTQ A;  4DV3 K;  3THW B;  3EN9 A;  4C8M A;  3O9T A;  3L0Q A;  2CGJ A;  1WAF A;  2IIR A;  4B1U B;  4M3X A;  3BGR A;  3I55 N;  4Z94 A;  4NB4 A;  4WQ4 C;  4FLX A;  3THX B;  3RR7 A;  1NOY A;  3O9S A;  4RW7 A;  3CME N;  4PKH A;  4H03 B;  3VER A;  1N8R O;  2P9K B;  1DTQ A;  1VSM A;  4RG8 A;  2KFZ A;  5CE3 A;  3DMJ A;  5AQO A;  4LF4 K;  1TK0 A;  2NZT A;  3VES A;  2HOE A;  3LDQ A;  1KAX A;  3O3F A;  4DWI A;  3ZX0 A;  4IOX A;  1KVA A;  3LAK A;  5SWM A;  2FSN A;  4GNI A;  4KRE A;  3BDP A;  3S3O A;  5CYM A;  2YHY A;  5TKY A;  3SBT A;  1GLD G;  4BRH A;  3FGU A;  5BR9 A;  3AA4 A;  1RT4 A;  3C0B A;  2I7P A;  3U6F A;  1VHX A;  1LWF A;  3R8E A;  3CXC M;  3P1G A;  2WC9 A;  4K42 A;  4BVO A;  4O0J A;  3WNG A;  2ASM A;  4DV7 K;  4FW2 A;  4FM0 A;  1RDB A;  4YOW A;  1K8A O;  4YHH K;  2A1S A;  3CM5 A;  5FPE A;  1S9E A;  4IKF A;  1RGI A;  1KLM A;  4CE9 A;  1KXP A;  3NF8 A;  3VPZ A;  4CZF A;  4JKG B;  2DPN A;  3ENO A;  3HK2 A;  4FWM A;  2YCH A;  5AJ3 K;  2LSN A;  4E1M A;  1T7P A;  1S9G A;  2RHK A;  4JKF A;  2Z1J A;  1RTH A;  3U3G A;  2UUA K;  2YNH A;  4FLY A;  5FPN A;  4LF6 K;  1HNV A;  1T3V A;  1GOA A;  1Y97 A;  2VCP A;  3MN9 A;  4YOY A;  2HBJ A; 
#chains in the Genus database with same CATH homology
 1HNW K;  4YY3 K;  4LF8 K;  4CW7 B;  3T1Y K;  2ZM6 K;  1J5E K;  2UUC K;  5BR8 K;  5IWA K;  4DV3 K;  5FLX O;  4DUY K;  1XMQ K;  1IBL K;  4B3R K;  4B3M K;  4GKK K;  4X66 K;  2VQF K;  4LFB K;  4B3T K;  4DV4 K;  4LF7 K;  3OTO K;  2E5L K;  4X65 K;  1HR0 K;  4DV6 K;  4DUZ K;  2F4V K;  3J7A P;  4LF4 K;  1N36 K;  3T1H K;  4X62 K;  4DR6 K;  5LL6 Z;  4KHP K;  5A2Q O;  4LFC K;  2UXD K;  1N34 K;  1I94 K;  5LMN K;  4OX9 K;  2UXB K;  4JI4 K;  1IBM K;  1N33 K;  4V19 S;  3J80 O;  4LFA K;  3J7Y P;  4DR1 K;  4DV5 K;  1XNR K;  3JAM O;  1HNZ K;  4DV2 K;  4B3S K;  4X64 K;  4JV5 K;  4JI0 K;  4DV7 K;  4DR4 K;  4JI8 K;  4NXM K;  4NXN K;  4YHH K;  4DR3 K;  1XMO K;  4DV1 K;  4CVN E;  1FJG K;  4JI6 K;  4DR7 K;  4JI5 K;  4LF9 K;  1HNX K;  1N32 K;  2HHH K;  2UUB K;  4DV0 K;  4JI7 K;  2UXC K;  4LF5 K;  4JI3 K;  1IBK K;  4K0K K;  4DR2 K;  5AJ3 K;  4GKJ K;  4JI1 K;  3J81 O;  1XNQ K;  2UUA K;  2VQE K;  2UU9 K;  4LF6 K;  4JI2 K;  4JYA K;  4DR5 K;  5LMU K;  5IT9 O;  4AQY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...