4DR4K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr4K00
2UU9K 4DR7K 1N32K 4DR1K 4CVNE 1IBKK 4B3RK 4DUYK 4LFAK 4JI0K 4DR5K 4LFCK 4X65K 2HHHK 5IWAK 3J7AP 4JI3K 1XMQK 4KHPK 1IBLK 2UUCK 1HNZK 4LF7K 4JI8K 1N36K 1IBMK 4DR6K 4B3TK 4LF5K 4GKKK 4JI2K 4DUZK 4LF6K 4V19S 2UXDK 4LF8K 4LFBK 4B3SK 2UUBK 1N33K 5LL6Z 4X66K 5IT9O 3JAMO 1XNQK 1J5EK 4NXMK 4JI5K 2UXBK 4CW7B 4JYAK 4DR4K 3T1HK 2VQFK 2UUAK 1FJGK 4JV5K 4DV6K 3OTOK 4LF4K 1HNWK 4DV3K 4DV7K 4AQYK 4X62K 4YY3K 3J80O 5LMNK 1HR0K 5A2QO 5LMUK 4K0KK 1XNRK 2UXCK 2VQEK 4DV0K 1N34K 4LF9K 4DR3K 3T1YK 4JI1K 5AJ3K 4GKJK 5FLXO 4DV5K 4DR2K 4DV4K 5BR8K 1I94K 3J7YP 4DV1K 4JI7K 1HNXK 4DV2K 4NXNK 4OX9K 2ZM6K 4X64K 1XMOK 2F4VK 4JI4K 3J81O 4JI6K 4B3MK 2E5LK 4YHHK
chains in the Genus database with same CATH superfamily
3TAPA 4DR7K 4DR1K 4BDPA 4KV8A 3DLEA 2F7TA 3DLRA 4WFAL 2Q31A 4JI0K 4LFAK 3NAEA 1RT7A 4CJ5A 3IRXA 3SK3A 4AF1A 4BY9C 1YHQN 1TKXA 5AQKA 2P9PA 1KFSA 1GLJO 1BCMA 1CZAN 3FZMA 5EVZA 4CJUA 3KD5E 4H5TA 1S9EA 1WOQA 1HLUA 4DCHA 2VWJA 3FR0A 4BRIA 1JL2A 3TU5A 2QKBA 3LPTA 4F3OA 4BC4A 4LF6K 1D5AA 3I0RA 3PSFA 5AQQA 2O8FB 1ZBSA 2Y1JA 1I39A 4KB0A 3MEGA 1YTAA 2BGGA 5LL6Z 3VQ8A 4BREA 4NO7A 3TSUA 1IKWA 5E41A 3U3GA 4NXMK 4CEBA 2A5XA 2OCEA 3OYKA 3C65A 4BRLA 3G0ZA 2IC3A 3CCJN 3LDSA 2FC0A 1NK5A 1MA9B 3H1VX 5HOOA 4B9TA 1E4FT 4O5FA 2CGKA 4DSFA 4HUEA 2P5OA 3TAFA 1ZBLA 1U48A 1EQYA 4K41A 5AQTA 4DFKA 3P4IA 1BISA 3KK3A 2WFBA 4DTOA 1JLCA 4FJIA 4M3XA 1T03A 4WQ5A 1RT5A 1N34K 5GIPA 1YITN 2G8IA 1NGGA 1WAFA 1T05A 2O8CA 1HKCA 1D8YA 4DR2K 3EEQA 4KTZA 1S1WA 5FROA 3MEEA 3O4NA 5KRSA 3SYZA 2KLAA 4YOXA 3CCMN 2AP1A 4DV1K 2UYTA 4CHOA 4FJJA 2XO7A 3VTIA 3VQ6A 4B9LA 4FOEA 1CXUA 4E0DA 4YORA 1NJXA 3OYIA 3J7ZO 3PUFA 2OZSA 1K8KB 1ASWA 3KK7A 4M63C 4KHNA 2YHYA 4JHDB 3LP3A 3PLAA 2P9NB 4DKWA 1TAQA 5JVHL 3AVMA 4I9LA 2E2QA 4MFBA 1R59O 3AGKA 2VG5A 4CHQA 4HTLA 3S41A 4E7KA 3HPHA 5LJVA 2NRVA 2Z1JA 4OKJA 4CECA 3THWB 3L4IA 3O9RA 4K42A 4M7YA 5CYMA 3DXKB 3S3NA 4KH6A 4CF8A 1H1VA 1C0FA 5BPMA 4AHSA 2GEMA 4PUOA 5KGXA 4NB4A 3A5LC 4WFBL 1Q7YO 4A2AA 4DUZK 1SL1A 3DOLA 4B1ZA 1TK5A 3AO3A 3HPGA 4GMJB 3SZ2A 3OY9A 4N5SA 3CPEA 4H5VA 1WBBA 5KPTA 4KI4A 4BR2A 4DSEA 4RTFD 1YVNA 1BOTO 1BWFO 4I7FA 4MDAA 4PQUA 1MU2A 4QOZB 4A2BA 1BI4A 1Z6RA 1R0AA 2KKZA 2QWMA 4AQYK 1KAZA 1RBSA 3B8AX 1VSEA 4B1WB 3QETA 4DB3A 1NK0A 4ZTFA 1N5YA 4FWKA 3GE1A 2O8EB 1Q81O 2Q3SA 4GV3A 5CYQA 4HVJA 1Q86O 1LWCA 3HI0A 3H3OB 4Y1CA 1A5WA 4RW6A 4BE2A 2HHQA 1NJYA 5AQRA 2E2PA 4WFNL 2P5GA 4HWIA 3MX2A 4CEFA 3F9KA 4AHRA 4BR9A 1I94K 4FW2A 5E84A 1CZBA 1SS6A 5AQNA 4O4GA 4C8OA 5I3UA 1NWKA 3CJAA 4BQLA 4JKDA 3L2RA 3RRHA 2E4LA 4KHWA 4DU4A 1EXQA 3T1AA 4FPAA 1A5XA 4YOUA 2QI2A 3BUZB 3EO3A 4ELUA 3PV8A 1VQPN 4YOTA 4OLBA 4BRNA 2E5LK 4FLVA 2RN2A 3L3VA 4E1MA 3LL3A 5M1KA 1EWQA 4E89A 2ZE2A 4DQQA 4GVMA 5AFUA 4EP5A 3JYTA 4CJ3A 1S1VA 1RGIA 4JRQA 4J8FA 1KFDA 4QS9A 5ELZA 3H6EA 2FBVA 1IBMK 2PYLA 2Y1IA 4OGCA 4FJGA 3EKUA 5HL7L 3CCUN 2ZD1A 1C1AA 2A6AA 3WNFA 3PO4A 3THXA 3D7EO 4B1XB 4CGJA 1VSFA 3O9UA 3K9KA 1NM1A 3E1YA 1RDDA 4CK1A 4DF4A 3FGUA 4U7BA 5DK5A 2I7NA 4PL8A 2RPIA 2Q0UA 4CW7B 1NLVA 3P39A 1U45A 2PFUA 4DR4K 3MXMA 2DPNA 2V51B 2D0AA 4DS5A 1EP4A 5F2RA 1WSGA 2FBTA 4JV5K 2E6MA 4LD0A 1UA0A 3WXJA 4X62K 1HYZA 3JXUA 3ZSRA 1JLAA 2X74A 4CHZA 2HHTA 4NYNA 1CZ9A 2IGIA 2FBXA 4Y1DA 4AILC 3KWIA 1S3XA 3O9QA 2KFNA 4OPKA 3ZT4A 3MEDA 1V4TA 1K6YA 4FWSA 3NDKA 4JI1K 3VA3A 1UA1A 1RDAA 3QESA 4N76A 2GUPA 1TV6A 2D5RA 3QNNA 3ZYYX 4CZGA 3AO2A 3C7NA 4FM2A 4IOAL 3DLLL 2Z1HA 1GLEG 4OPHA 4M3UA 4H4MA 1J5OA 1KSPA 4DTSA 1HPMA 1IBKK 4K43A 3I55N 1KLNA 1YF5L 1DTTA 3OA9A 4A62A 4CHYA 3MXIA 2OANA 5AZJA 1TK8A 3LAKA 5GIOA 1EWRA 4I6MB 3OYNA 4F8RA 1QQOA 2W6LA 3G10A 3WXMB 3VQ5A 1RTDA 3HXMA 2YHXA 3PX0A 2HF3A 1NGEA 4DTMA 3V1RA 3V9XA 4B3SK 3EKSA 3O3HA 5C15A 2FSJA 1HJRA 4X66K 5AQXA 3BZKA 3DXMA 4CD3A 3HOSA 4KFBA 5E26A 4OPAA 1LV5A 3BF3A 2ZJQL 2VYPA 2KFZA 2E1YA 2P9IA 4FJMA 2HVHA 3AVLA 5AQSA 4CEOA 2O4GA 1ASVA 4JKHA 1KLMA 1LOTB 4B9SA 4ICLA 1JJ2M 2YJFA 1XNRK 5C2DA 1L3TA 1BGXT 2O4IA 3ATUA 3ZEUB 1BIZA 1NGIA 4DR3K 1ZXOA 4FLZA 4CBUA 3O3FA 4AHVA 3C6UA 1JCEA 1O13A 4CFAA 1DGKN 2IVNA 3J7YP 3VQCA 4DSKA 2P1JA 1U04A 4JI7K 3OYDA 4JD2A 2X6SA 4OX9K 4A5BA 4FJLA 4X64K 3D2EB 1VAZA 1TK0A 2ASOA 2Q36A 2OYQA 1ILYA 2HVIA 4CF1A 5AQJA 4CVNE 4H5RA 4H0OA 4JKGA 3OYCA 5EU7A 1RBVA 3QIOA 4RW9A 2HF4A 4B3RK 5JICA 4DR5K 3K2PA 3DRRA 4CIFA 4DLEA 4BR4A 3C6AA 1HX1A 1LW2A 3V9SA 3NHGA 3SQ4A 2XY6A 1OVQA 4C8KA 4CEEA 4BRFA 4JI3K 3SV4A 2PYJA 3N4PA 4KAZA 3CCVN 3NE6A 5GINA 3NF8A 4JI8K 3VENA 4CZHA 3SUQA 1GLLO 1IG9A 3R8EA 2YX6A 4O0IA 5GAEP 1REVA 1VHXA 4V19S 3ULEA 4YOVA 4E7LA 2NUBA 3VQPA 3ZSXA 1SKWA 3OYHA 3MMVA 4F4KA 4KB1A 3CM5A 5GADP 4MO5A 2G8HA 4CJFA 1L3UA 1GLBG 4DU1A 3Q7CA 4XH1A 1BQMA 4JI5K 5SZTA 4FYDA 2NRTA 3ID8A 3LZJA 2YNFA 3SQ0A 1RILA 4DV6K 1JLEA 1HNWK 3H45C 2P9LB 3TAGA 3THYA 5T7BA 2QWQA 3LWLA 4UY8O 4G9ZA 1ASUA 4JS5A 4FL9A 4IJAA 1TVRA 4ZHRA 4DTNA 5FPMA 1M90O 1T6DA 3FZHA 3R1XA 5CY4A 2DTUA 5A2QO 1KAXA 3LM2A 4H0YB 4BE1A 4EAHD 5I9EB 1NGBA 3DI6A 2YV0X 5C42A 1XHZA 3BEXA 3AVHA 3HM8A 4OGEA 1TKDA 2VGMA 3UKUA 1DLOA 3F73A 2WUSA 1IKXA 1FKPA 3HL8A 3IG1A 4JS4A 1L5UA 4CBXA 2NRRA 4DSLA 3K59A 4MDBA 4FWQA 1BHLA 2O8DB 4BACA 5C0YA 1XQSC 3V6DA 1YT3A 4CIGA 2XHBA 4JI6K 4CCHA 3CMAN 1S72N 3SLCA 4PY5A 3HPOA 5I42A 3OS2A 4RW8A 4XEIA 5ADXA 3SUOA 4DQ8A 1OH6A 2O8FA 3R3LA 1U49A 2P9SA 3TTDA 1S5JA 3KD1E 3M8QA 3ASMA 4CJPA 2KZZA 1S1TA 4DMNA 2VCPA 4M3ZA 4FJ5A 3TTFA 3M5RA 1CXQA 4CF0A 4CE9A 2UXDK 1NOZA 3AGRA 3ZETB 1RTJA 3MECA 3MX5A 3PX6A 2UUBK 1N33K 1TKTA 4J2EA 2E2NA 4NCAA 4IOCL 4BRKA 2CH6A 5KGWA 4JYAK 4DWIA 3T7ZA 3QNOA 1LCUA 2HBLA 2UUAK 1KCFA 2GWJA 4I2QA 3NGZA 4LF4K 1KVAA 1BQNA 2ZF5O 3NH1A 2E6LA 4KO0A 4KHSA 3CIPA 3RR8A 1N8RO 4CZLA 3OYFA 4KBOA 3HK2A 2P9KB 4DF8A 2NZTA 1RTHA 3SBTA 4ISEA 4FK0A 4HTUA 3ITHA 3ZSOA 5M1QA 5SWMA 3P83D 4LF9K 4JRPA 4FJNA 4ILGB 3B6OA 2A1SA 4EZ9A 3AVCA 2G8VA 4DTPA 4GKJK 3AARA 1TGOA 3A5NC 1EO1A 2GV9A 4LSLA 3AVJA 2HSTA 4MLEA 1D9DA 3QDKA 1HNXK 1SKRA 5AQGA 4GV9A 4KRFA 3ZX3A 3L8BA 4IWVA 2YNHA 2Q2RA 4LH5A 4PKIA 3LDNA 1RBTA 3CJ1A 5EX5A 3CMEN 2HHWA 4KTWA 3RSEB 4A59A 2YKNA 1DEJA 4H5NA 3WQUA 4DU3A 1RNHA 1JXEA 3M6GA 4CK2A 3O4WA 1GLFO 4O8UA 4WF9L 2QKKA 5FPDA 3RMAA 2P9UA 2E88A 4CHNA 4Z94A 4DQRA 3AVKA 3TANA 3K5MA 3I56N 3AV9A 3O9SA 2ETJA 4IBNA 2GBZA 1VK0A 1WAJA 1BA1A 4IOXA 5KRTA 1VQNN 1HQEA 4RW7A 3IDHA 2HMIA 3SUNA 2VG7A 2O8BA 2NNWA 4B3TK 3WNGA 3DWLA 4KH4A 3OJUA 1P90A 4WCEL 1W97L 2J4RA 3TTCA 1U2VB 5FDLA 4BG8A 3BP8A 3TI0A 5AQIA 4FLTA 3U8XA 1K73O 2XY8A 3WXLA 2GELA 4LH4A 2W6KA 4CJWA 2WC9A 4F2RA 2D4WA 3AO4A 3E66A 4CJTA 3OS0A 1MDUB 3AVNA 4H0VB 1KVCA 4DTJA 2PY5A 3KTQA 2X6NA 1TL3A 3WXKA 1W0HA 3R6MA 1X9JA 4NYFA 4XH4A 4DV3K 4B3OA 3M8SA 3NVMA 3O5BA 4YY3K 2FSNA 4W5NA 3KLIA 1C0UA 4CJRA 3VESA 4M3TA 1JLBA 3KVGA 3OBYA 3VETA 1C6VA 3CC7N 3RMBA 1E4GT 2ZGZA 3QICA 4NLCA 4CEDA 1Q9XA 1WSEA 2O8CB 1U6ZA 3DAWA 3VGMA 1WUAA 4DV5K 2ATQA 1M1KO 3VEYA 4IXCA 4ILHA 1KVBA 2OPSA 3LDLA 3SNNA 2D1KA 3G25A 2IIRA 4CJVA 4JEPA 1IO2A 1HKBA 1BCOA 3CC2N 3OYAA 3PSIA 3L0QA 3NF6A 3OBWA 3W0LA 1T44A 2PAVA 3WQTA 5AQOA 4GVEA 5TKYA 1QQNA 3VEWA 1N32K 1VSIA 3DRSA 4JAXA 1U4BA 1NK7A 2ZQBA 1HPZA 1WN7A 3QLHA 1RDWX 4QAGA 4FK4A 1IH7A 4E1JA 4IJNA 2OPPA 4KHUA 1QZ6A 3LDPA 2CGJA 3VPZA 3DLHA 4H0PA 1YIJN 4ID5A 4PKGA 4QS7A 4FWPA 3DJCA 4AHUA 1VSLA 2QWOA 5JS1A 3B6PA 2QXLA 4FCYA 3HP9A 3MCAB 4ID1A 3AA4A 4BR5A 5MLCQ 1VQ7N 2IDOA 4GKKK 5M1FA 5KQ8A 3OYLA 1S6PA 2ZJRL 3SAGA 2ASMA 2D0PA 1JKHA 3QBWA 5C12A 3OYMA 3MK6A 2OPRA 2NRZA 3OYGA 1J5EK 1QVGM 2GUIA 3CQYA 4BVOA 1T6CA 3S9HA 2I7PA 3J8AA 1BI4B 1FJGK 4BRPA 1C0MA 3QMLA 3CCRN 2JGUA 1Q18A 1SZ2A 3KLHA 4FO0A 4CF2A 1RBRA 1NBWA 4CK3A 1WSJA 2EHGA 3M8RA 2UXCK 4EIAA 1YVUA 1ZBUA 1K8AO 4FZZA 4FWOA 1NMDA 1F21A 4CJQA 2XY7A 4CZJA 2WBNA 3OJSA 4C1NI 4F9OA 1XC3A 3QEXA 3OW2M 4FVUA 1RDCA 1A5VA 4YDUC 5JVGL 4CD1A 3QBXA 4R79A 4IZ9A 3QINA 1C0GA 2PBDA 1LWEA 3P5JA 4IDHA 3ULDA 4Z4HA 1BL3A 4HUGA 1JL1A 1RT6A 3TWHA 4IG0A 3KKRA 4Y0WA 2R7YA 4FOIA 4CBWA 1L3SA 1QE1A 1NNEA 3DOKA 3SUPA 1HKGA 2JWLA 2P51A 4L3QA 1J53A 1HQUA 5DM7L 3HTVA 3HYFA 2ZWHA 3ZLJA 1VSMA 1VSDA 4CJ7A 1WB9A 4MO4A 1NGCA 3ZSWA 5AQHA 3CD6N 3ZT0A 4H03B 3KKSA 4B9UA 1BU6O 1G15A 3J7AP 1RFQA 3SBGA 3NH0A 4FK2A 2KTQA 3K0SA 4M42A 4R5PA 1YXQA 4FLXA 1N36K 4DG1A 1OH5A 1ATNA 4J2DA 1X3NA 2BE2A 5FPNA 2E1ZA 5KI6A 2E20A 3O3GA 3THXB 4JI2K 2LSNA 2ITMA 3QEPA 3CJ7A 4LF8K 1S1UA 5M1PA 4AM7A 1BG3A 3S3MA 3VEVA 1J54A 3A5OC 3PIOL 1TAUA 1DKGD 4DTUA 4IFYA 5GAGP 2Q0RA 3C95A 1RT4A 5B8HA 4EP4A 3K57A 1NKCA 4Z4EA 2IVPA 4JKBA 4B9QA 5JS2A 3AY9A 5D3GA 4OO1J 1J9AA 3QFUA 4CFBA 1S6QA 1ZC6A 4O44A 2A41A 2NRXA 3AA5X 4CF9A 4PL7A 3A5MC 1BDGA 2D0CA 3AA2A 3KK1A 1Q8IA 5EOYA 1SL2A 3JSMA 1NMNA 4W5TA 1B9FA 1JXBA 4FLUA 4M3YA 4YDUA 3AA3A 1MWMA 1IKVA 5TKWA 2VWKA 3KHYA 3VF4A 4M3RA 3ATVA 2BANA 3KLGA 3T19A 3WXIA 5FRMA 3L2UA 2YI1A 2Z1GA 2YHAA 3C7NB 3U9DA 1GLDG 4BQZA 3A2FA 3BGRA 3EN9A 3O1WA 3CYMA 4JK9A 4JI4K 1Z05A 3HOTA 2QK9A 3UB5A 3KK2A 1Y97A 4WYBA 4C23A 3KJVA 4B9MA 2UU9K 3CPWM 3ZSVA 5J2PA 2OA8A 3FZKA 4FM1A 3IKMA 3L3UA 3P31A 5AZJB 5HRPA 3NCIA 1TL1A 3KLFA 2HHHK 4EZ6A 4KH5A 4FJ8A 5LJWA 5CZ1A 3QFPA 3D2FA 3AVAA 2QEXN 1ESVA 4M3WA 1IBLK 2BUPA 3VF2A 3PIPL 1EKEA 4DFPA 4IDKA 2EX3A 4LF5K 4EHTA 5M1OA 2P9LA 3HM9A 5KPZA 4CJKA 4CZEA 3NH2A 5HRRA 5BN8A 4W5OA 3DXMB 4QCLA 3CCLN 1WNSA 1XNQK 3CCQN 4Z0UA 2UXBK 5AZIA 4BRHA 4BRMA 2FXUA 1ZBFA 2EWSA 3H08A 3P1GA 2P9IB 3O4QA 4K8XA 5EXWA 3J80O 4CESA 5LMNK 2FF3B 4CFCA 3VQ7A 4J2AA 5BRHA 4BWJA 1C0TA 1S1XA 3I8BA 3U4LA 5DMRA 3ZT1A 4DV0K 3LZIA 3MWTA 5J2NA 3UKRA 1BO5O 4B1UB 3SPYA 5HLFA 1D4XA 1C1BA 5BR8K 1X9MA 2FLOA 3AVGA 3VGKA 4YOWA 4JNEA 4CERA 3VERA 3VMFB 4CGHA 1EX4A 4O55A 3QIPA 1J6ZA 5F1XA 3MAQA 1G99A 3WEEB 3QB0A 3VQBA 2QM1A 1NGHA 4JKGB 1K9MO 4CZKA 3THVA 3GOIA 5BR9A 3N4QA 4H0TB 1ATRA 4DSJA 3VQ9A 4HUFA 3K58A 3OYBA 3BZCA 3ENOA 2AA4A 4CZIA 5AQMA 3JS6A 3BY5A 4NLBA 1FW6A 3EYZA 4FJXA 5HRSA 1NKBA 4IO9L 4FM0A 1NGDA 1XMQK 4BG9A 3LALA 3CFPA 2QWLA 3SAFA 1P8ZA 1JCGA 4O8KA 4LF7K 4ILJA 5AR0A 1SUQA 3ULEB 3KIOA 1VQ4N 5HBMA 4LFBK 1SKSA 3VEZA 4FPBA 5FRNA 4M41A 3JAMO 3HBTA 3L4QA 4B1VA 3KLEA 4FJHA 3VF6A 5HRNA 5EY4A 1E3MA 2BH1A 1NG9A 3LWMA 3S3OA 1RBUA 1GOAA 2BDPA 3MN6A 3OTOK 2HHSA 3THYB 3EZWA 1UAXA 4CZMA 5AQUA 4NCGA 4ZTJA 1QHTA 5M1NA 1QQCA 5AQFA 4NCBA 3CHWA 4AHCA 3V9ZA 2G8FA 3SPZA 2RE2A 2XY5A 3TARA 5LMUK 3IAYA 1NJWA 5KQDA 3AO1A 1XHXA 4Z4CA 3LANA 3UKUB 4DHYA 3NMUA 1XI1A 1T8EA 3VQEA 3OYEA 2VG6A 5HP1A 4F2SA 1KD1O 1NK4A 3M8PA 4J2BA 4I9QA 3E9LA 4FWRA 3TSQA 4BDYA 3D0PA 5BREA 3NF9A 2QA4N 2ZM6K 1QTMA 3ZSYA 1TYQB 1K8KA 3I8DA 1VSHA 1SL0A 4FZXC 3QEIA 4JHDA 2Z1IA 1KTQA 1NKEA 2P9NA 4CZFA 2ASPA 1LAVA 1YJWN 1HYVA 1ATSA 1U2VA 4LFCK 3AVFA 4A5AA 5J2QA 2P9SB 1KXPA 3THWA 4KHPK 4M7XA 3TR8A 1RDUA 3DXKA 3I33A 4XIUA 4CEAA 3TAEA 4RWTA 2VGNA 4CGGA 4ELVA 4GV6A 3D6RA 3WT0A 1RT2A 2YCHA 4IFEA 3OS1A 4BRCA 3HJFA 2KQ2A 1VQON 1WSIA 3CCEN 1VQMN 2P9PB 3PX4A 4JLHA 5AQZA 3VQDA 5C10A 1GLAG 4CEZA 4DTRA 3TSPA 5BRDA 4CGFA 3CI5A 5BPNA 3LP1A 3AVIA 1BUPA 3OHRA 1JLGA 4JN4A 1YI2N 2VWBA 2W41A 4IKFA 4E19A 4A57A 1X9SA 3WUHA 4JKEA 3KZBA 2A40A 2V52B 1MWKA 4FLYA 4B1YB 4PWDA 3ID6A 2W40A 3IUCA 3BDPA 2HHUA 3UIQA 2O8EA 2FF6A 3RTVA 2HW3A 4K8ZA 3FFKB 4QS8A 4Q5VA 3O8MA 4IFVA 3WNHA 4KTQA 1IKYA 4Z4IA 4AHTA 1WSHA 3D45A 1C1CA 5AJ3K 1VQ5N 1QSYA 1I3AA 3K5NA 3U6FA 4YFUA 2HNYA 1CLQA 5LY3A 1FK9A 2KZMA 5BPLA 3A8YA 4NXNK 3OYJA 4FSVA 4OLAA 1IG8A 1LWFA 3O6WA 4BGBA 4Z4FA 5KPRA 3VEOA 3GG4A 1HUXA 4KKOA 5BN9A 2G8KA 4BR7A 1XUPO 3T69A 1Y64A 2HOEA 4FVMA 4OPJA 4OJRA 5C24A 3LAMA 3MN5A 3L2VA 2P9UB 3K5LA 3HZ6A 1NK6A 2JWKA 3G71N 3RR7A 5AQWA 5J2MA 1IJJA 4C8NA 4X65K 1T3VA 2QW9A 2F96A 1RT3A 2YKMA 2QWNA 2HHXA 4RW4A 2O8BB 2B4JA 4ISGA 1EETA 1RTIA 2RHKA 3SQ2A 1QHAA 3DLKA 3DM2A 4DQIA 1VQLN 4Z4GA 1TKZA 5DM6L 3HSCA 1X1PA 2QWPA 3MN7A 4HHTA 3O9TA 4RCHA 2H3GX 4FLWA 3CM6A 2OTLN 1YUWA 3T1HK 4K25A 3CCSN 3VQQA 3RMDA 3VQAA 4FWLA 1X3MA 4A61A 4DV7K 4JKCA 2YNGA 3QEWA 3VA0A 2YJEA 4AH9A 4E7IA 4C8LA 3CJBA 1QSSA 4M45A 4KI6A 1W9HA 4H5WA 3LM9A 2VQEK 5C25A 2WONA 1WLJA 4CGDA 3O1BA 1KC8O 4DTXA 1HYSA 1NK8A 4BRQA 2GWKA 4B8AB 2F9TA 2WOMA 1X9WA 4DV4K 3VEXA 2HMPA 2FBYA 3SI6A 1FXXA 4CJSA 3SJHA 1JLFA 1HNVA 3SQ1A 4JK7A 1NGAA 3RWUA 1GOCA 3CFOA 3FLCO 1XMOK 3VGLA 3G4SN 4E3SA 5JMVA 1HJOA 2HB5A 4G1QA 2GTDA 3EY1A 4W5QA 4ELTA 2E2OA 3M3ZA 1NJIO 2QWRA 2PZSA 3WNEA 2KW4A 3ZSZA 3RVCA 3H1QA 1JLQA 2NRHA 4DUYK 1BA0A 3QERA 3W3DA 5CZ2A 4DFMA 4BRDA 1YTUA 4LC9B 4BGAA 3EE9A 4E7HA 3MDQA 1V4SA 2DFHA 4O5BA 4GNIA 4I6MA 2UUCK 1SAZA 3L2WA 3V9WA 1UWBA 3V4IA 2F8SA 2W42A 4DR6K 1Q9YA 4RG8A 4LY7A 3L6QA 5CHIA 4O0JA 2IOCA 5CE3A 4PKHA 1NOYA 3HVRA 3Q7BA 1NJZA 3SCXA 3F2KA 2A42A 3ZSQA 5IT9O 1NK9A 2DFFA 1VRTA 5K14A 3E01A 1KAYA 4IG3A 3CXCM 1WBDA 2NLXA 5ADXH 4UQGA 3CERA 2X78A 3DLGA 4BVPA 4B8CA 4CEQA 3I0SA 4CFDA 2VQFK 4U67L 1QZ5A 2A3ZA 4OVLA 5KTQA 4HCBA 4IEEA 4L8RB 4YNQA 4FJ7A 3SMSA 4E7JA 5JLFA 3H3NO 1VSKA 4KPYA 4C8MA 4DQPA 3A0IX 4LSNA 3SJJA 2Q97A 1KRPA 1D9FA 3ZEUA 1QVFM 3NFAA 3C0BA 4PA1A 5HROA 2Q1NA 5FLXO 1QSLA 5CR4A 1RCHA 4FWNA 3F5TA 3M1FA 1YJ9N 4KREA 2CGLA 2FSKA 4BC2A 3P38A 1TUYA 1SV5A 1HRHA 4H8KA 2V7YA 3BF1A 1DTQA 3O08A 1N6QA 3CETA 4BROA 3HT3A 1JCFA 4CJEA 3D2EA 1LAWA 3DMJA 2G8UA 3NBPA 2HHVA 4YHHK 3R9PA 1QQMA 4H0XB 3GBTA 3FZLA 4W5RA 3L2QA 3VN5A 3CJ9A 3V1QA 3FFIA 1ITGA 2RF2A 4I2PA 3NVKA 1VQ9N 4CJLA 3CJCA 3LPUA 2I5JA 3TPQA 3SV3A 5IWAK 4BDZA 4N47A 5J1EA 4CGIA 3V1OA 1ZYQA 1UOCA 1LW0A 4DLGA 2GX9A 4GY2B 2XRIA 2F9WA 3DRPA 2KHOA 4KHQA 3HVTA 3RRGA 2V7ZA 1VQ8N 1Q82O 2CH5A 3CF5L 3U9ZA 4N56A 2DFEA 2WTUA 3FE1A 4EHUA 3AVBA 2F8TA 1WSFA 2HNZA 1W2BM 2YHWA 3KWGA 3NGIA 3IS9A 4WE1A 1S22A 4HCCA 4BRAA 3QO9A 4OKKA 3TAMA 2AJQA 3AAQA 4B08A 2G8WA 3E9PA 3AAPA 5F0XA 4DFJA 4YOYA 2A1RA 2B6AA 1RT1A 4JKFA 2BTFA 1OVYA 2QXFA 4TSXA 5AQLA 3ZX0A 5FPEA 3SMPA 3MXJA 4BC3A 4K0KK 4JK8A 3FZFA 1YAGA 5AQYA 5AQPA 3WEEA 3GDQA 3G6EN 1HMVA 1VQ6N 3LP2A 3DLBA 1Z26A 4IO8A 3T1YK 3C6HA 4F3TA 3MWPA 1ZBHA 1VSJA 1Z25A 5C2FA 4FWMA 4DV2K 4GW6A 1W7AA 3T3FA 1S9GA 3ZCMA 4CIEA 2IVOA 1NU0A 4DS4A 2OPQA 4EFHA 3IFRA 2DY4A 3CQXA 4IEIA 2O8DA 2F4VK 1ZBIA 3H46O 2D0BA 4B3MK 2HBKA 3LDOA 4ISFA 2B5JA 4WQ4C 2OTJN 1GLCG 4B9VA 4FJ9A 4CI6A 2HNDA 1B92A 4BC5A 4BR0A 1U47A 2IS3A 4E1NA 1KQSM 1BIUA 3EE8A 3ENBA 4B9NA 4JD2B 3ALYA 2OZMA 3CC4N 1IV0A 3TAQA 3F9MA 1XC9A 1SQKA 3D2FB 4FZYA 4Q0BA 4KHYA 3EL2A 2ZGYA 3O80A 3TABA 3ISNC 1HNZK 4PHTX 3SAHA 3PO5A 4CHPA 3UE5A 3CQ8A 1OKJA 3ZETA 5JLHA 1XWLA 3ZX2A 1OH8A 4MLHA 3GL1A 5H1SQ 3NF7A 3MN9A 4FW1A 1QS4A 4AM6A 4DSIA 2YNIA 3CG7A 3VTHA 5AZIB 3VOVA 4CJ4A 3EZ5A 1T7PA 4FJKA 3K9JA 2ITGA 4BWMA 1RDBA 2E8AA 3LDQA 4BRGA 2D0OA 3RMCA 3VQ4A 3HRGA 4JKAA 2QTDA 3HP6A 3K5OA 5BRFA 1NGFA 3IMXA 2HBMA 1B9DA 1HR0K 1DT9A 4H4OA 1NGJA 1OH7A 4DQSA 1L3VA 3OVNA 3V81A 3QEVA 3PY8A 2P9KA 4OKEA 1HNIA 1TYQA 3C6TA 3DYAA 4C1NK 1O1WA 3UKRB 3C94A 3CFRA 3HSTB 4WQ5C 3NGYA 3LP0A 1GOBA 2HBJA 4MQ3A 5AFUH 4N41A 3MCPA 4XH5A 2NRWA 5AQVA 1TUUA 2RKIA 2JLEA 3E9OA 2IAJA 1VQKN 1VRUA 3AO5A 4BE0A 5GAHP 3HO1A 4FXDA 3ZT2A 1FKOA 3ENHA 2YHBA 4WQ4A 2ZJPL 3J81O 1YJNN 3V9UA 3U3YA 3ZT3A 3RSEA
chains in the Genus database with same CATH topology
2UU9K 4DR7K 1N32K 4DR1K 4CVNE 1IBKK 4B3RK 4DUYK 4LFAK 4JI0K 4DR5K 4LFCK 4X65K 2HHHK 5IWAK 3J7AP 4JI3K 1XMQK 4KHPK 1IBLK 2UUCK 1HNZK 4LF7K 4JI8K 1N36K 1IBMK 4DR6K 4B3TK 4LF5K 4GKKK 4JI2K 4DUZK 4LF6K 4V19S 2UXDK 4LF8K 4LFBK 4B3SK 2UUBK 1N33K 5LL6Z 4X66K 5IT9O 3JAMO 1XNQK 1J5EK 4NXMK 4JI5K 2UXBK 4CW7B 4JYAK 4DR4K 3T1HK 2VQFK 2UUAK 1FJGK 4JV5K 4DV6K 3OTOK 4LF4K 1HNWK 4DV3K 4DV7K 4AQYK 4X62K 4YY3K 3J80O 5LMNK 1HR0K 5A2QO 5LMUK 4K0KK 1XNRK 2UXCK 2VQEK 4DV0K 1N34K 4LF9K 4DR3K 3T1YK 4JI1K 5AJ3K 4GKJK 5FLXO 4DV5K 4DR2K 4DV4K 5BR8K 1I94K 3J7YP 4DV1K 4JI7K 1HNXK 4DV2K 4NXNK 4OX9K 2ZM6K 4X64K 1XMOK 2F4VK 4JI4K 3J81O 4JI6K 4B3MK 2E5LK 4YHHK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 K;  4DR7 K;  1N32 K;  4DR1 K;  4CVN E;  1IBK K;  4B3R K;  4DUY K;  4LFA K;  4JI0 K;  4DR5 K;  4LFC K;  4X65 K;  2HHH K;  5IWA K;  3J7A P;  4JI3 K;  1XMQ K;  4KHP K;  1IBL K;  2UUC K;  1HNZ K;  4LF7 K;  4JI8 K;  1N36 K;  1IBM K;  4DR6 K;  4B3T K;  4LF5 K;  4GKK K;  4JI2 K;  4DUZ K;  4LF6 K;  4V19 S;  2UXD K;  4LF8 K;  4LFB K;  4B3S K;  2UUB K;  1N33 K;  5LL6 Z;  4X66 K;  5IT9 O;  3JAM O;  1XNQ K;  1J5E K;  4NXM K;  4JI5 K;  2UXB K;  4CW7 B;  4JYA K;  4DR4 K;  3T1H K;  2VQF K;  2UUA K;  1FJG K;  4JV5 K;  4DV6 K;  3OTO K;  4LF4 K;  1HNW K;  4DV3 K;  4DV7 K;  4AQY K;  4X62 K;  4YY3 K;  3J80 O;  5LMN K;  1HR0 K;  5A2Q O;  5LMU K;  4K0K K;  1XNR K;  2UXC K;  2VQE K;  4DV0 K;  1N34 K;  4LF9 K;  4DR3 K;  3T1Y K;  4JI1 K;  5AJ3 K;  4GKJ K;  5FLX O;  4DV5 K;  4DR2 K;  4DV4 K;  5BR8 K;  1I94 K;  3J7Y P;  4DV1 K;  4JI7 K;  1HNX K;  4DV2 K;  4NXN K;  4OX9 K;  2ZM6 K;  4X64 K;  1XMO K;  2F4V K;  4JI4 K;  3J81 O;  4JI6 K;  4B3M K;  2E5L K;  4YHH K; 
#chains in the Genus database with same CATH topology
 3TAP A;  4DR7 K;  4DR1 K;  4BDP A;  4KV8 A;  3DLE A;  2F7T A;  3DLR A;  4WFA L;  2Q31 A;  4JI0 K;  4LFA K;  3NAE A;  1RT7 A;  4CJ5 A;  3IRX A;  3SK3 A;  4AF1 A;  4BY9 C;  1YHQ N;  1TKX A;  5AQK A;  2P9P A;  1KFS A;  1GLJ O;  1BCM A;  1CZA N;  3FZM A;  5EVZ A;  4CJU A;  3KD5 E;  4H5T A;  1S9E A;  1WOQ A;  1HLU A;  4DCH A;  2VWJ A;  3FR0 A;  4BRI A;  1JL2 A;  3TU5 A;  2QKB A;  3LPT A;  4F3O A;  4BC4 A;  4LF6 K;  1D5A A;  3I0R A;  3PSF A;  5AQQ A;  2O8F B;  1ZBS A;  2Y1J A;  1I39 A;  4KB0 A;  3MEG A;  1YTA A;  2BGG A;  5LL6 Z;  3VQ8 A;  4BRE A;  4NO7 A;  3TSU A;  1IKW A;  5E41 A;  3U3G A;  4NXM K;  4CEB A;  2A5X A;  2OCE A;  3OYK A;  3C65 A;  4BRL A;  3G0Z A;  2IC3 A;  3CCJ N;  3LDS A;  2FC0 A;  1NK5 A;  1MA9 B;  3H1V X;  5HOO A;  4B9T A;  1E4F T;  4O5F A;  2CGK A;  4DSF A;  4HUE A;  2P5O A;  3TAF A;  1ZBL A;  1U48 A;  1EQY A;  4K41 A;  5AQT A;  4DFK A;  3P4I A;  1BIS A;  3KK3 A;  2WFB A;  4DTO A;  1JLC A;  4FJI A;  4M3X A;  1T03 A;  4WQ5 A;  1RT5 A;  1N34 K;  5GIP A;  1YIT N;  2G8I A;  1NGG A;  1WAF A;  1T05 A;  2O8C A;  1HKC A;  1D8Y A;  4DR2 K;  3EEQ A;  4KTZ A;  1S1W A;  5FRO A;  3MEE A;  3O4N A;  5KRS A;  3SYZ A;  2KLA A;  4YOX A;  3CCM N;  2AP1 A;  4DV1 K;  2UYT A;  4CHO A;  4FJJ A;  2XO7 A;  3VTI A;  3VQ6 A;  4B9L A;  4FOE A;  1CXU A;  4E0D A;  4YOR A;  1NJX A;  3OYI A;  3J7Z O;  3PUF A;  2OZS A;  1K8K B;  1ASW A;  3KK7 A;  4M63 C;  4KHN A;  2YHY A;  4JHD B;  3LP3 A;  3PLA A;  2P9N B;  4DKW A;  1TAQ A;  5JVH L;  3AVM A;  4I9L A;  2E2Q A;  4MFB A;  1R59 O;  3AGK A;  2VG5 A;  4CHQ A;  4HTL A;  3S41 A;  4E7K A;  3HPH A;  5LJV A;  2NRV A;  2Z1J A;  4OKJ A;  4CEC A;  3THW B;  3L4I A;  3O9R A;  4K42 A;  4M7Y A;  5CYM A;  3DXK B;  3S3N A;  4KH6 A;  4CF8 A;  1H1V A;  1C0F A;  5BPM A;  4AHS A;  2GEM A;  4PUO A;  5KGX A;  4NB4 A;  3A5L C;  4WFB L;  1Q7Y O;  4A2A A;  4DUZ K;  1SL1 A;  3DOL A;  4B1Z A;  1TK5 A;  3AO3 A;  3HPG A;  4GMJ B;  3SZ2 A;  3OY9 A;  4N5S A;  3CPE A;  4H5V A;  1WBB A;  5KPT A;  4KI4 A;  4BR2 A;  4DSE A;  4RTF D;  1YVN A;  1BOT O;  1BWF O;  4I7F A;  4MDA A;  4PQU A;  1MU2 A;  4QOZ B;  4A2B A;  1BI4 A;  1Z6R A;  1R0A A;  2KKZ A;  2QWM A;  4AQY K;  1KAZ A;  1RBS A;  3B8A X;  1VSE A;  4B1W B;  3QET A;  4DB3 A;  1NK0 A;  4ZTF A;  1N5Y A;  4FWK A;  3GE1 A;  2O8E B;  1Q81 O;  2Q3S A;  4GV3 A;  5CYQ A;  4HVJ A;  1Q86 O;  1LWC A;  3HI0 A;  3H3O B;  4Y1C A;  1A5W A;  4RW6 A;  4BE2 A;  2HHQ A;  1NJY A;  5AQR A;  2E2P A;  4WFN L;  2P5G A;  4HWI A;  3MX2 A;  4CEF A;  3F9K A;  4AHR A;  4BR9 A;  1I94 K;  4FW2 A;  5E84 A;  1CZB A;  1SS6 A;  5AQN A;  4O4G A;  4C8O A;  5I3U A;  1NWK A;  3CJA A;  4BQL A;  4JKD A;  3L2R A;  3RRH A;  2E4L A;  4KHW A;  4DU4 A;  1EXQ A;  3T1A A;  4FPA A;  1A5X A;  4YOU A;  2QI2 A;  3BUZ B;  3EO3 A;  4ELU A;  3PV8 A;  1VQP N;  4YOT A;  4OLB A;  4BRN A;  2E5L K;  4FLV A;  2RN2 A;  3L3V A;  4E1M A;  3LL3 A;  5M1K A;  1EWQ A;  4E89 A;  2ZE2 A;  4DQQ A;  4GVM A;  5AFU A;  4EP5 A;  3JYT A;  4CJ3 A;  1S1V A;  1RGI A;  4JRQ A;  4J8F A;  1KFD A;  4QS9 A;  5ELZ A;  3H6E A;  2FBV A;  1IBM K;  2PYL A;  2Y1I A;  4OGC A;  4FJG A;  3EKU A;  5HL7 L;  3CCU N;  2ZD1 A;  1C1A A;  2A6A A;  3WNF A;  3PO4 A;  3THX A;  3D7E O;  4B1X B;  4CGJ A;  1VSF A;  3O9U A;  3K9K A;  1NM1 A;  3E1Y A;  1RDD A;  4CK1 A;  4DF4 A;  3FGU A;  4U7B A;  5DK5 A;  2I7N A;  4PL8 A;  2RPI A;  2Q0U A;  4CW7 B;  1NLV A;  3P39 A;  1U45 A;  2PFU A;  4DR4 K;  3MXM A;  2DPN A;  2V51 B;  2D0A A;  4DS5 A;  1EP4 A;  5F2R A;  1WSG A;  2FBT A;  4JV5 K;  2E6M A;  4LD0 A;  1UA0 A;  3WXJ A;  4X62 K;  1HYZ A;  3JXU A;  3ZSR A;  1JLA A;  2X74 A;  4CHZ A;  2HHT A;  4NYN A;  1CZ9 A;  2IGI A;  2FBX A;  4Y1D A;  4AIL C;  3KWI A;  1S3X A;  3O9Q A;  2KFN A;  4OPK A;  3ZT4 A;  3MED A;  1V4T A;  1K6Y A;  4FWS A;  3NDK A;  4JI1 K;  3VA3 A;  1UA1 A;  1RDA A;  3QES A;  4N76 A;  2GUP A;  1TV6 A;  2D5R A;  3QNN A;  3ZYY X;  4CZG A;  3AO2 A;  3C7N A;  4FM2 A;  4IOA L;  3DLL L;  2Z1H A;  1GLE G;  4OPH A;  4M3U A;  4H4M A;  1J5O A;  1KSP A;  4DTS A;  1HPM A;  1IBK K;  4K43 A;  3I55 N;  1KLN A;  1YF5 L;  1DTT A;  3OA9 A;  4A62 A;  4CHY A;  3MXI A;  2OAN A;  5AZJ A;  1TK8 A;  3LAK A;  5GIO A;  1EWR A;  4I6M B;  3OYN A;  4F8R A;  1QQO A;  2W6L A;  3G10 A;  3WXM B;  3VQ5 A;  1RTD A;  3HXM A;  2YHX A;  3PX0 A;  2HF3 A;  1NGE A;  4DTM A;  3V1R A;  3V9X A;  4B3S K;  3EKS A;  3O3H A;  5C15 A;  2FSJ A;  1HJR A;  4X66 K;  5AQX A;  3BZK A;  3DXM A;  4CD3 A;  3HOS A;  4KFB A;  5E26 A;  4OPA A;  1LV5 A;  3BF3 A;  2ZJQ L;  2VYP A;  2KFZ A;  2E1Y A;  2P9I A;  4FJM A;  2HVH A;  3AVL A;  5AQS A;  4CEO A;  2O4G A;  1ASV A;  4JKH A;  1KLM A;  1LOT B;  4B9S A;  4ICL A;  1JJ2 M;  2YJF A;  1XNR K;  5C2D A;  1L3T A;  1BGX T;  2O4I A;  3ATU A;  3ZEU B;  1BIZ A;  1NGI A;  4DR3 K;  1ZXO A;  4FLZ A;  4CBU A;  3O3F A;  4AHV A;  3C6U A;  1JCE A;  1O13 A;  4CFA A;  1DGK N;  2IVN A;  3J7Y P;  3VQC A;  4DSK A;  2P1J A;  1U04 A;  4JI7 K;  3OYD A;  4JD2 A;  2X6S A;  4OX9 K;  4A5B A;  4FJL A;  4X64 K;  3D2E B;  1VAZ A;  1TK0 A;  2ASO A;  2Q36 A;  2OYQ A;  1ILY A;  2HVI A;  4CF1 A;  5AQJ A;  4CVN E;  4H5R A;  4H0O A;  4JKG A;  3OYC A;  5EU7 A;  1RBV A;  3QIO A;  4RW9 A;  2HF4 A;  4B3R K;  5JIC A;  4DR5 K;  3K2P A;  3DRR A;  4CIF A;  4DLE A;  4BR4 A;  3C6A A;  1HX1 A;  1LW2 A;  3V9S A;  3NHG A;  3SQ4 A;  2XY6 A;  1OVQ A;  4C8K A;  4CEE A;  4BRF A;  4JI3 K;  3SV4 A;  2PYJ A;  3N4P A;  4KAZ A;  3CCV N;  3NE6 A;  5GIN A;  3NF8 A;  4JI8 K;  3VEN A;  4CZH A;  3SUQ A;  1GLL O;  1IG9 A;  3R8E A;  2YX6 A;  4O0I A;  5GAE P;  1REV A;  1VHX A;  4V19 S;  3ULE A;  4YOV A;  4E7L A;  2NUB A;  3VQP A;  3ZSX A;  1SKW A;  3OYH A;  3MMV A;  4F4K A;  4KB1 A;  3CM5 A;  5GAD P;  4MO5 A;  2G8H A;  4CJF A;  1L3U A;  1GLB G;  4DU1 A;  3Q7C A;  4XH1 A;  1BQM A;  4JI5 K;  5SZT A;  4FYD A;  2NRT A;  3ID8 A;  3LZJ A;  2YNF A;  3SQ0 A;  1RIL A;  4DV6 K;  1JLE A;  1HNW K;  3H45 C;  2P9L B;  3TAG A;  3THY A;  5T7B A;  2QWQ A;  3LWL A;  4UY8 O;  4G9Z A;  1ASU A;  4JS5 A;  4FL9 A;  4IJA A;  1TVR A;  4ZHR A;  4DTN A;  5FPM A;  1M90 O;  1T6D A;  3FZH A;  3R1X A;  5CY4 A;  2DTU A;  5A2Q O;  1KAX A;  3LM2 A;  4H0Y B;  4BE1 A;  4EAH D;  5I9E B;  1NGB A;  3DI6 A;  2YV0 X;  5C42 A;  1XHZ A;  3BEX A;  3AVH A;  3HM8 A;  4OGE A;  1TKD A;  2VGM A;  3UKU A;  1DLO A;  3F73 A;  2WUS A;  1IKX A;  1FKP A;  3HL8 A;  3IG1 A;  4JS4 A;  1L5U A;  4CBX A;  2NRR A;  4DSL A;  3K59 A;  4MDB A;  4FWQ A;  1BHL A;  2O8D B;  4BAC A;  5C0Y A;  1XQS C;  3V6D A;  1YT3 A;  4CIG A;  2XHB A;  4JI6 K;  4CCH A;  3CMA N;  1S72 N;  3SLC A;  4PY5 A;  3HPO A;  5I42 A;  3OS2 A;  4RW8 A;  4XEI A;  5ADX A;  3SUO A;  4DQ8 A;  1OH6 A;  2O8F A;  3R3L A;  1U49 A;  2P9S A;  3TTD A;  1S5J A;  3KD1 E;  3M8Q A;  3ASM A;  4CJP A;  2KZZ A;  1S1T A;  4DMN A;  2VCP A;  4M3Z A;  4FJ5 A;  3TTF A;  3M5R A;  1CXQ A;  4CF0 A;  4CE9 A;  2UXD K;  1NOZ A;  3AGR A;  3ZET B;  1RTJ A;  3MEC A;  3MX5 A;  3PX6 A;  2UUB K;  1N33 K;  1TKT A;  4J2E A;  2E2N A;  4NCA A;  4IOC L;  4BRK A;  2CH6 A;  5KGW A;  4JYA K;  4DWI A;  3T7Z A;  3QNO A;  1LCU A;  2HBL A;  2UUA K;  1KCF A;  2GWJ A;  4I2Q A;  3NGZ A;  4LF4 K;  1KVA A;  1BQN A;  2ZF5 O;  3NH1 A;  2E6L A;  4KO0 A;  4KHS A;  3CIP A;  3RR8 A;  1N8R O;  4CZL A;  3OYF A;  4KBO A;  3HK2 A;  2P9K B;  4DF8 A;  2NZT A;  1RTH A;  3SBT A;  4ISE A;  4FK0 A;  4HTU A;  3ITH A;  3ZSO A;  5M1Q A;  5SWM A;  3P83 D;  4LF9 K;  4JRP A;  4FJN A;  4ILG B;  3B6O A;  2A1S A;  4EZ9 A;  3AVC A;  2G8V A;  4DTP A;  4GKJ K;  3AAR A;  1TGO A;  3A5N C;  1EO1 A;  2GV9 A;  4LSL A;  3AVJ A;  2HST A;  4MLE A;  1D9D A;  3QDK A;  1HNX K;  1SKR A;  5AQG A;  4GV9 A;  4KRF A;  3ZX3 A;  3L8B A;  4IWV A;  2YNH A;  2Q2R A;  4LH5 A;  4PKI A;  3LDN A;  1RBT A;  3CJ1 A;  5EX5 A;  3CME N;  2HHW A;  4KTW A;  3RSE B;  4A59 A;  2YKN A;  1DEJ A;  4H5N A;  3WQU A;  4DU3 A;  1RNH A;  1JXE A;  3M6G A;  4CK2 A;  3O4W A;  1GLF O;  4O8U A;  4WF9 L;  2QKK A;  5FPD A;  3RMA A;  2P9U A;  2E88 A;  4CHN A;  4Z94 A;  4DQR A;  3AVK A;  3TAN A;  3K5M A;  3I56 N;  3AV9 A;  3O9S A;  2ETJ A;  4IBN A;  2GBZ A;  1VK0 A;  1WAJ A;  1BA1 A;  4IOX A;  5KRT A;  1VQN N;  1HQE A;  4RW7 A;  3IDH A;  2HMI A;  3SUN A;  2VG7 A;  2O8B A;  2NNW A;  4B3T K;  3WNG A;  3DWL A;  4KH4 A;  3OJU A;  1P90 A;  4WCE L;  1W97 L;  2J4R A;  3TTC A;  1U2V B;  5FDL A;  4BG8 A;  3BP8 A;  3TI0 A;  5AQI A;  4FLT A;  3U8X A;  1K73 O;  2XY8 A;  3WXL A;  2GEL A;  4LH4 A;  2W6K A;  4CJW A;  2WC9 A;  4F2R A;  2D4W A;  3AO4 A;  3E66 A;  4CJT A;  3OS0 A;  1MDU B;  3AVN A;  4H0V B;  1KVC A;  4DTJ A;  2PY5 A;  3KTQ A;  2X6N A;  1TL3 A;  3WXK A;  1W0H A;  3R6M A;  1X9J A;  4NYF A;  4XH4 A;  4DV3 K;  4B3O A;  3M8S A;  3NVM A;  3O5B A;  4YY3 K;  2FSN A;  4W5N A;  3KLI A;  1C0U A;  4CJR A;  3VES A;  4M3T A;  1JLB A;  3KVG A;  3OBY A;  3VET A;  1C6V A;  3CC7 N;  3RMB A;  1E4G T;  2ZGZ A;  3QIC A;  4NLC A;  4CED A;  1Q9X A;  1WSE A;  2O8C B;  1U6Z A;  3DAW A;  3VGM A;  1WUA A;  4DV5 K;  2ATQ A;  1M1K O;  3VEY A;  4IXC A;  4ILH A;  1KVB A;  2OPS A;  3LDL A;  3SNN A;  2D1K A;  3G25 A;  2IIR A;  4CJV A;  4JEP A;  1IO2 A;  1HKB A;  1BCO A;  3CC2 N;  3OYA A;  3PSI A;  3L0Q A;  3NF6 A;  3OBW A;  3W0L A;  1T44 A;  2PAV A;  3WQT A;  5AQO A;  4GVE A;  5TKY A;  1QQN A;  3VEW A;  1N32 K;  1VSI A;  3DRS A;  4JAX A;  1U4B A;  1NK7 A;  2ZQB A;  1HPZ A;  1WN7 A;  3QLH A;  1RDW X;  4QAG A;  4FK4 A;  1IH7 A;  4E1J A;  4IJN A;  2OPP A;  4KHU A;  1QZ6 A;  3LDP A;  2CGJ A;  3VPZ A;  3DLH A;  4H0P A;  1YIJ N;  4ID5 A;  4PKG A;  4QS7 A;  4FWP A;  3DJC A;  4AHU A;  1VSL A;  2QWO A;  5JS1 A;  3B6P A;  2QXL A;  4FCY A;  3HP9 A;  3MCA B;  4ID1 A;  3AA4 A;  4BR5 A;  5MLC Q;  1VQ7 N;  2IDO A;  4GKK K;  5M1F A;  5KQ8 A;  3OYL A;  1S6P A;  2ZJR L;  3SAG A;  2ASM A;  2D0P A;  1JKH A;  3QBW A;  5C12 A;  3OYM A;  3MK6 A;  2OPR A;  2NRZ A;  3OYG A;  1J5E K;  1QVG M;  2GUI A;  3CQY A;  4BVO A;  1T6C A;  3S9H A;  2I7P A;  3J8A A;  1BI4 B;  1FJG K;  4BRP A;  1C0M A;  3QML A;  3CCR N;  2JGU A;  1Q18 A;  1SZ2 A;  3KLH A;  4FO0 A;  4CF2 A;  1RBR A;  1NBW A;  4CK3 A;  1WSJ A;  2EHG A;  3M8R A;  2UXC K;  4EIA A;  1YVU A;  1ZBU A;  1K8A O;  4FZZ A;  4FWO A;  1NMD A;  1F21 A;  4CJQ A;  2XY7 A;  4CZJ A;  2WBN A;  3OJS A;  4C1N I;  4F9O A;  1XC3 A;  3QEX A;  3OW2 M;  4FVU A;  1RDC A;  1A5V A;  4YDU C;  5JVG L;  4CD1 A;  3QBX A;  4R79 A;  4IZ9 A;  3QIN A;  1C0G A;  2PBD A;  1LWE A;  3P5J A;  4IDH A;  3ULD A;  4Z4H A;  1BL3 A;  4HUG A;  1JL1 A;  1RT6 A;  3TWH A;  4IG0 A;  3KKR A;  4Y0W A;  2R7Y A;  4FOI A;  4CBW A;  1L3S A;  1QE1 A;  1NNE A;  3DOK A;  3SUP A;  1HKG A;  2JWL A;  2P51 A;  4L3Q A;  1J53 A;  1HQU A;  5DM7 L;  3HTV A;  3HYF A;  2ZWH A;  3ZLJ A;  1VSM A;  1VSD A;  4CJ7 A;  1WB9 A;  4MO4 A;  1NGC A;  3ZSW A;  5AQH A;  3CD6 N;  3ZT0 A;  4H03 B;  3KKS A;  4B9U A;  1BU6 O;  1G15 A;  3J7A P;  1RFQ A;  3SBG A;  3NH0 A;  4FK2 A;  2KTQ A;  3K0S A;  4M42 A;  4R5P A;  1YXQ A;  4FLX A;  1N36 K;  4DG1 A;  1OH5 A;  1ATN A;  4J2D A;  1X3N A;  2BE2 A;  5FPN A;  2E1Z A;  5KI6 A;  2E20 A;  3O3G A;  3THX B;  4JI2 K;  2LSN A;  2ITM A;  3QEP A;  3CJ7 A;  4LF8 K;  1S1U A;  5M1P A;  4AM7 A;  1BG3 A;  3S3M A;  3VEV A;  1J54 A;  3A5O C;  3PIO L;  1TAU A;  1DKG D;  4DTU A;  4IFY A;  5GAG P;  2Q0R A;  3C95 A;  1RT4 A;  5B8H A;  4EP4 A;  3K57 A;  1NKC A;  4Z4E A;  2IVP A;  4JKB A;  4B9Q A;  5JS2 A;  3AY9 A;  5D3G A;  4OO1 J;  1J9A A;  3QFU A;  4CFB A;  1S6Q A;  1ZC6 A;  4O44 A;  2A41 A;  2NRX A;  3AA5 X;  4CF9 A;  4PL7 A;  3A5M C;  1BDG A;  2D0C A;  3AA2 A;  3KK1 A;  1Q8I A;  5EOY A;  1SL2 A;  3JSM A;  1NMN A;  4W5T A;  1B9F A;  1JXB A;  4FLU A;  4M3Y A;  4YDU A;  3AA3 A;  1MWM A;  1IKV A;  5TKW A;  2VWK A;  3KHY A;  3VF4 A;  4M3R A;  3ATV A;  2BAN A;  3KLG A;  3T19 A;  3WXI A;  5FRM A;  3L2U A;  2YI1 A;  2Z1G A;  2YHA A;  3C7N B;  3U9D A;  1GLD G;  4BQZ A;  3A2F A;  3BGR A;  3EN9 A;  3O1W A;  3CYM A;  4JK9 A;  4JI4 K;  1Z05 A;  3HOT A;  2QK9 A;  3UB5 A;  3KK2 A;  1Y97 A;  4WYB A;  4C23 A;  3KJV A;  4B9M A;  2UU9 K;  3CPW M;  3ZSV A;  5J2P A;  2OA8 A;  3FZK A;  4FM1 A;  3IKM A;  3L3U A;  3P31 A;  5AZJ B;  5HRP A;  3NCI A;  1TL1 A;  3KLF A;  2HHH K;  4EZ6 A;  4KH5 A;  4FJ8 A;  5LJW A;  5CZ1 A;  3QFP A;  3D2F A;  3AVA A;  2QEX N;  1ESV A;  4M3W A;  1IBL K;  2BUP A;  3VF2 A;  3PIP L;  1EKE A;  4DFP A;  4IDK A;  2EX3 A;  4LF5 K;  4EHT A;  5M1O A;  2P9L A;  3HM9 A;  5KPZ A;  4CJK A;  4CZE A;  3NH2 A;  5HRR A;  5BN8 A;  4W5O A;  3DXM B;  4QCL A;  3CCL N;  1WNS A;  1XNQ K;  3CCQ N;  4Z0U A;  2UXB K;  5AZI A;  4BRH A;  4BRM A;  2FXU A;  1ZBF A;  2EWS A;  3H08 A;  3P1G A;  2P9I B;  3O4Q A;  4K8X A;  5EXW A;  3J80 O;  4CES A;  5LMN K;  2FF3 B;  4CFC A;  3VQ7 A;  4J2A A;  5BRH A;  4BWJ A;  1C0T A;  1S1X A;  3I8B A;  3U4L A;  5DMR A;  3ZT1 A;  4DV0 K;  3LZI A;  3MWT A;  5J2N A;  3UKR A;  1BO5 O;  4B1U B;  3SPY A;  5HLF A;  1D4X A;  1C1B A;  5BR8 K;  1X9M A;  2FLO A;  3AVG A;  3VGK A;  4YOW A;  4JNE A;  4CER A;  3VER A;  3VMF B;  4CGH A;  1EX4 A;  4O55 A;  3QIP A;  1J6Z A;  5F1X A;  3MAQ A;  1G99 A;  3WEE B;  3QB0 A;  3VQB A;  2QM1 A;  1NGH A;  4JKG B;  1K9M O;  4CZK A;  3THV A;  3GOI A;  5BR9 A;  3N4Q A;  4H0T B;  1ATR A;  4DSJ A;  3VQ9 A;  4HUF A;  3K58 A;  3OYB A;  3BZC A;  3ENO A;  2AA4 A;  4CZI A;  5AQM A;  3JS6 A;  3BY5 A;  4NLB A;  1FW6 A;  3EYZ A;  4FJX A;  5HRS A;  1NKB A;  4IO9 L;  4FM0 A;  1NGD A;  1XMQ K;  4BG9 A;  3LAL A;  3CFP A;  2QWL A;  3SAF A;  1P8Z A;  1JCG A;  4O8K A;  4LF7 K;  4ILJ A;  5AR0 A;  1SUQ A;  3ULE B;  3KIO A;  1VQ4 N;  5HBM A;  4LFB K;  1SKS A;  3VEZ A;  4FPB A;  5FRN A;  4M41 A;  3JAM O;  3HBT A;  3L4Q A;  4B1V A;  3KLE A;  4FJH A;  3VF6 A;  5HRN A;  5EY4 A;  1E3M A;  2BH1 A;  1NG9 A;  3LWM A;  3S3O A;  1RBU A;  1GOA A;  2BDP A;  3MN6 A;  3OTO K;  2HHS A;  3THY B;  3EZW A;  1UAX A;  4CZM A;  5AQU A;  4NCG A;  4ZTJ A;  1QHT A;  5M1N A;  1QQC A;  5AQF A;  4NCB A;  3CHW A;  4AHC A;  3V9Z A;  2G8F A;  3SPZ A;  2RE2 A;  2XY5 A;  3TAR A;  5LMU K;  3IAY A;  1NJW A;  5KQD A;  3AO1 A;  1XHX A;  4Z4C A;  3LAN A;  3UKU B;  4DHY A;  3NMU A;  1XI1 A;  1T8E A;  3VQE A;  3OYE A;  2VG6 A;  5HP1 A;  4F2S A;  1KD1 O;  1NK4 A;  3M8P A;  4J2B A;  4I9Q A;  3E9L A;  4FWR A;  3TSQ A;  4BDY A;  3D0P A;  5BRE A;  3NF9 A;  2QA4 N;  2ZM6 K;  1QTM A;  3ZSY A;  1TYQ B;  1K8K A;  3I8D A;  1VSH A;  1SL0 A;  4FZX C;  3QEI A;  4JHD A;  2Z1I A;  1KTQ A;  1NKE A;  2P9N A;  4CZF A;  2ASP A;  1LAV A;  1YJW N;  1HYV A;  1ATS A;  1U2V A;  4LFC K;  3AVF A;  4A5A A;  5J2Q A;  2P9S B;  1KXP A;  3THW A;  4KHP K;  4M7X A;  3TR8 A;  1RDU A;  3DXK A;  3I33 A;  4XIU A;  4CEA A;  3TAE A;  4RWT A;  2VGN A;  4CGG A;  4ELV A;  4GV6 A;  3D6R A;  3WT0 A;  1RT2 A;  2YCH A;  4IFE A;  3OS1 A;  4BRC A;  3HJF A;  2KQ2 A;  1VQO N;  1WSI A;  3CCE N;  1VQM N;  2P9P B;  3PX4 A;  4JLH A;  5AQZ A;  3VQD A;  5C10 A;  1GLA G;  4CEZ A;  4DTR A;  3TSP A;  5BRD A;  4CGF A;  3CI5 A;  5BPN A;  3LP1 A;  3AVI A;  1BUP A;  3OHR A;  1JLG A;  4JN4 A;  1YI2 N;  2VWB A;  2W41 A;  4IKF A;  4E19 A;  4A57 A;  1X9S A;  3WUH A;  4JKE A;  3KZB A;  2A40 A;  2V52 B;  1MWK A;  4FLY A;  4B1Y B;  4PWD A;  3ID6 A;  2W40 A;  3IUC A;  3BDP A;  2HHU A;  3UIQ A;  2O8E A;  2FF6 A;  3RTV A;  2HW3 A;  4K8Z A;  3FFK B;  4QS8 A;  4Q5V A;  3O8M A;  4IFV A;  3WNH A;  4KTQ A;  1IKY A;  4Z4I A;  4AHT A;  1WSH A;  3D45 A;  1C1C A;  5AJ3 K;  1VQ5 N;  1QSY A;  1I3A A;  3K5N A;  3U6F A;  4YFU A;  2HNY A;  1CLQ A;  5LY3 A;  1FK9 A;  2KZM A;  5BPL A;  3A8Y A;  4NXN K;  3OYJ A;  4FSV A;  4OLA A;  1IG8 A;  1LWF A;  3O6W A;  4BGB A;  4Z4F A;  5KPR A;  3VEO A;  3GG4 A;  1HUX A;  4KKO A;  5BN9 A;  2G8K A;  4BR7 A;  1XUP O;  3T69 A;  1Y64 A;  2HOE A;  4FVM A;  4OPJ A;  4OJR A;  5C24 A;  3LAM A;  3MN5 A;  3L2V A;  2P9U B;  3K5L A;  3HZ6 A;  1NK6 A;  2JWK A;  3G71 N;  3RR7 A;  5AQW A;  5J2M A;  1IJJ A;  4C8N A;  4X65 K;  1T3V A;  2QW9 A;  2F96 A;  1RT3 A;  2YKM A;  2QWN A;  2HHX A;  4RW4 A;  2O8B B;  2B4J A;  4ISG A;  1EET A;  1RTI A;  2RHK A;  3SQ2 A;  1QHA A;  3DLK A;  3DM2 A;  4DQI A;  1VQL N;  4Z4G A;  1TKZ A;  5DM6 L;  3HSC A;  1X1P A;  2QWP A;  3MN7 A;  4HHT A;  3O9T A;  4RCH A;  2H3G X;  4FLW A;  3CM6 A;  2OTL N;  1YUW A;  3T1H K;  4K25 A;  3CCS N;  3VQQ A;  3RMD A;  3VQA A;  4FWL A;  1X3M A;  4A61 A;  4DV7 K;  4JKC A;  2YNG A;  3QEW A;  3VA0 A;  2YJE A;  4AH9 A;  4E7I A;  4C8L A;  3CJB A;  1QSS A;  4M45 A;  4KI6 A;  1W9H A;  4H5W A;  3LM9 A;  2VQE K;  5C25 A;  2WON A;  1WLJ A;  4CGD A;  3O1B A;  1KC8 O;  4DTX A;  1HYS A;  1NK8 A;  4BRQ A;  2GWK A;  4B8A B;  2F9T A;  2WOM A;  1X9W A;  4DV4 K;  3VEX A;  2HMP A;  2FBY A;  3SI6 A;  1FXX A;  4CJS A;  3SJH A;  1JLF A;  1HNV A;  3SQ1 A;  4JK7 A;  1NGA A;  3RWU A;  1GOC A;  3CFO A;  3FLC O;  1XMO K;  3VGL A;  3G4S N;  4E3S A;  5JMV A;  1HJO A;  2HB5 A;  4G1Q A;  2GTD A;  3EY1 A;  4W5Q A;  4ELT A;  2E2O A;  3M3Z A;  1NJI O;  2QWR A;  2PZS A;  3WNE A;  2KW4 A;  3ZSZ A;  3RVC A;  3H1Q A;  1JLQ A;  2NRH A;  4DUY K;  1BA0 A;  3QER A;  3W3D A;  5CZ2 A;  4DFM A;  4BRD A;  1YTU A;  4LC9 B;  4BGA A;  3EE9 A;  4E7H A;  3MDQ A;  1V4S A;  2DFH A;  4O5B A;  4GNI A;  4I6M A;  2UUC K;  1SAZ A;  3L2W A;  3V9W A;  1UWB A;  3V4I A;  2F8S A;  2W42 A;  4DR6 K;  1Q9Y A;  4RG8 A;  4LY7 A;  3L6Q A;  5CHI A;  4O0J A;  2IOC A;  5CE3 A;  4PKH A;  1NOY A;  3HVR A;  3Q7B A;  1NJZ A;  3SCX A;  3F2K A;  2A42 A;  3ZSQ A;  5IT9 O;  1NK9 A;  2DFF A;  1VRT A;  5K14 A;  3E01 A;  1KAY A;  4IG3 A;  3CXC M;  1WBD A;  2NLX A;  5ADX H;  4UQG A;  3CER A;  2X78 A;  3DLG A;  4BVP A;  4B8C A;  4CEQ A;  3I0S A;  4CFD A;  2VQF K;  4U67 L;  1QZ5 A;  2A3Z A;  4OVL A;  5KTQ A;  4HCB A;  4IEE A;  4L8R B;  4YNQ A;  4FJ7 A;  3SMS A;  4E7J A;  5JLF A;  3H3N O;  1VSK A;  4KPY A;  4C8M A;  4DQP A;  3A0I X;  4LSN A;  3SJJ A;  2Q97 A;  1KRP A;  1D9F A;  3ZEU A;  1QVF M;  3NFA A;  3C0B A;  4PA1 A;  5HRO A;  2Q1N A;  5FLX O;  1QSL A;  5CR4 A;  1RCH A;  4FWN A;  3F5T A;  3M1F A;  1YJ9 N;  4KRE A;  2CGL A;  2FSK A;  4BC2 A;  3P38 A;  1TUY A;  1SV5 A;  1HRH A;  4H8K A;  2V7Y A;  3BF1 A;  1DTQ A;  3O08 A;  1N6Q A;  3CET A;  4BRO A;  3HT3 A;  1JCF A;  4CJE A;  3D2E A;  1LAW A;  3DMJ A;  2G8U A;  3NBP A;  2HHV A;  4YHH K;  3R9P A;  1QQM A;  4H0X B;  3GBT A;  3FZL A;  4W5R A;  3L2Q A;  3VN5 A;  3CJ9 A;  3V1Q A;  3FFI A;  1ITG A;  2RF2 A;  4I2P A;  3NVK A;  1VQ9 N;  4CJL A;  3CJC A;  3LPU A;  2I5J A;  3TPQ A;  3SV3 A;  5IWA K;  4BDZ A;  4N47 A;  5J1E A;  4CGI A;  3V1O A;  1ZYQ A;  1UOC A;  1LW0 A;  4DLG A;  2GX9 A;  4GY2 B;  2XRI A;  2F9W A;  3DRP A;  2KHO A;  4KHQ A;  3HVT A;  3RRG A;  2V7Z A;  1VQ8 N;  1Q82 O;  2CH5 A;  3CF5 L;  3U9Z A;  4N56 A;  2DFE A;  2WTU A;  3FE1 A;  4EHU A;  3AVB A;  2F8T A;  1WSF A;  2HNZ A;  1W2B M;  2YHW A;  3KWG A;  3NGI A;  3IS9 A;  4WE1 A;  1S22 A;  4HCC A;  4BRA A;  3QO9 A;  4OKK A;  3TAM A;  2AJQ A;  3AAQ A;  4B08 A;  2G8W A;  3E9P A;  3AAP A;  5F0X A;  4DFJ A;  4YOY A;  2A1R A;  2B6A A;  1RT1 A;  4JKF A;  2BTF A;  1OVY A;  2QXF A;  4TSX A;  5AQL A;  3ZX0 A;  5FPE A;  3SMP A;  3MXJ A;  4BC3 A;  4K0K K;  4JK8 A;  3FZF A;  1YAG A;  5AQY A;  5AQP A;  3WEE A;  3GDQ A;  3G6E N;  1HMV A;  1VQ6 N;  3LP2 A;  3DLB A;  1Z26 A;  4IO8 A;  3T1Y K;  3C6H A;  4F3T A;  3MWP A;  1ZBH A;  1VSJ A;  1Z25 A;  5C2F A;  4FWM A;  4DV2 K;  4GW6 A;  1W7A A;  3T3F A;  1S9G A;  3ZCM A;  4CIE A;  2IVO A;  1NU0 A;  4DS4 A;  2OPQ A;  4EFH A;  3IFR A;  2DY4 A;  3CQX A;  4IEI A;  2O8D A;  2F4V K;  1ZBI A;  3H46 O;  2D0B A;  4B3M K;  2HBK A;  3LDO A;  4ISF A;  2B5J A;  4WQ4 C;  2OTJ N;  1GLC G;  4B9V A;  4FJ9 A;  4CI6 A;  2HND A;  1B92 A;  4BC5 A;  4BR0 A;  1U47 A;  2IS3 A;  4E1N A;  1KQS M;  1BIU A;  3EE8 A;  3ENB A;  4B9N A;  4JD2 B;  3ALY A;  2OZM A;  3CC4 N;  1IV0 A;  3TAQ A;  3F9M A;  1XC9 A;  1SQK A;  3D2F B;  4FZY A;  4Q0B A;  4KHY A;  3EL2 A;  2ZGY A;  3O80 A;  3TAB A;  3ISN C;  1HNZ K;  4PHT X;  3SAH A;  3PO5 A;  4CHP A;  3UE5 A;  3CQ8 A;  1OKJ A;  3ZET A;  5JLH A;  1XWL A;  3ZX2 A;  1OH8 A;  4MLH A;  3GL1 A;  5H1S Q;  3NF7 A;  3MN9 A;  4FW1 A;  1QS4 A;  4AM6 A;  4DSI A;  2YNI A;  3CG7 A;  3VTH A;  5AZI B;  3VOV A;  4CJ4 A;  3EZ5 A;  1T7P A;  4FJK A;  3K9J A;  2ITG A;  4BWM A;  1RDB A;  2E8A A;  3LDQ A;  4BRG A;  2D0O A;  3RMC A;  3VQ4 A;  3HRG A;  4JKA A;  2QTD A;  3HP6 A;  3K5O A;  5BRF A;  1NGF A;  3IMX A;  2HBM A;  1B9D A;  1HR0 K;  1DT9 A;  4H4O A;  1NGJ A;  1OH7 A;  4DQS A;  1L3V A;  3OVN A;  3V81 A;  3QEV A;  3PY8 A;  2P9K A;  4OKE A;  1HNI A;  1TYQ A;  3C6T A;  3DYA A;  4C1N K;  1O1W A;  3UKR B;  3C94 A;  3CFR A;  3HST B;  4WQ5 C;  3NGY A;  3LP0 A;  1GOB A;  2HBJ A;  4MQ3 A;  5AFU H;  4N41 A;  3MCP A;  4XH5 A;  2NRW A;  5AQV A;  1TUU A;  2RKI A;  2JLE A;  3E9O A;  2IAJ A;  1VQK N;  1VRU A;  3AO5 A;  4BE0 A;  5GAH P;  3HO1 A;  4FXD A;  3ZT2 A;  1FKO A;  3ENH A;  2YHB A;  4WQ4 A;  2ZJP L;  3J81 O;  1YJN N;  3V9U A;  3U3Y A;  3ZT3 A;  3RSE A; 
#chains in the Genus database with same CATH homology
 2UU9 K;  4DR7 K;  1N32 K;  4DR1 K;  4CVN E;  1IBK K;  4B3R K;  4DUY K;  4LFA K;  4JI0 K;  4DR5 K;  4LFC K;  4X65 K;  2HHH K;  5IWA K;  3J7A P;  4JI3 K;  1XMQ K;  4KHP K;  1IBL K;  2UUC K;  1HNZ K;  4LF7 K;  4JI8 K;  1N36 K;  1IBM K;  4DR6 K;  4B3T K;  4LF5 K;  4GKK K;  4JI2 K;  4DUZ K;  4LF6 K;  4V19 S;  2UXD K;  4LF8 K;  4LFB K;  4B3S K;  2UUB K;  1N33 K;  5LL6 Z;  4X66 K;  5IT9 O;  3JAM O;  1XNQ K;  1J5E K;  4NXM K;  4JI5 K;  2UXB K;  4CW7 B;  4JYA K;  4DR4 K;  3T1H K;  2VQF K;  2UUA K;  1FJG K;  4JV5 K;  4DV6 K;  3OTO K;  4LF4 K;  1HNW K;  4DV3 K;  4DV7 K;  4AQY K;  4X62 K;  4YY3 K;  3J80 O;  5LMN K;  1HR0 K;  5A2Q O;  5LMU K;  4K0K K;  1XNR K;  2UXC K;  2VQE K;  4DV0 K;  1N34 K;  4LF9 K;  4DR3 K;  3T1Y K;  4JI1 K;  5AJ3 K;  4GKJ K;  5FLX O;  4DV5 K;  4DR2 K;  4DV4 K;  5BR8 K;  1I94 K;  3J7Y P;  4DV1 K;  4JI7 K;  1HNX K;  4DV2 K;  4NXN K;  4OX9 K;  2ZM6 K;  4X64 K;  1XMO K;  2F4V K;  4JI4 K;  3J81 O;  4JI6 K;  4B3M K;  2E5L K;  4YHH K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...