4DR4K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr4K00
4LF5K 4LF4K 4LFCK 4JYAK 1IBLK 3J81O 5LL6Z 4JI4K 4YHHK 4JI7K 5LMUK 3T1YK 4B3RK 1XMOK 4DR4K 2UU9K 1IBMK 1N33K 2UXDK 4X66K 4LFBK 4YY3K 1I94K 2UUBK 4DUZK 3T1HK 4JI6K 4DV3K 5IT9O 5IWAK 4LFAK 4AQYK 4V19S 5A2QO 2UXCK 4DV1K 1HNZK 4DV4K 4DV5K 4DR2K 4LF6K 4JI3K 3J7AP 2UUAK 4B3TK 4DV0K 4DR1K 4DR6K 2VQEK 4X65K 4DUYK 4OX9K 4CVNE 4K0KK 5LMNK 4DR3K 4X62K 1HNXK 4X64K 1XMQK 4GKKK 4JI1K 1IBKK 1HR0K 1XNRK 4DV6K 5FLXO 3OTOK 2VQFK 3JAMO 4LF9K 2E5LK 3J7YP 4JV5K 1N34K 1J5EK 2HHHK 4GKJK 2UXBK 2ZM6K 5AJ3K 4DV7K 4NXMK 1N32K 4DV2K 1XNQK 1FJGK 4JI8K 4JI5K 1N36K 4KHPK 4DR5K 3J80O 1HNWK 4LF7K 4LF8K 2UUCK 4NXNK 4CW7B 4JI0K 4B3SK 2F4VK 5BR8K 4DR7K 4JI2K 4B3MK
chains in the Genus database with same CATH superfamily
4LF4K 4I7FA 3GL1A 5C25A 3SUOA 4CGIA 3KK3A 3TAPA 2GTDA 2W6KA 3LDPA 3Q7BA 2ASOA 1C6VA 4KHYA 2E1ZA 1Q18A 4C8OA 4A61A 2HHWA 4OKEA 4DG1A 5HLFA 4KB1A 1C1BA 1DTTA 3LP2A 4BGBA 4KH6A 2KKZA 5AQLA 5FDLA 3CJ9A 1NK4A 5GIOA 4YY3K 1J54A 4BRLA 1S9EA 2UUBK 4XEIA 2AP1A 4DLEA 3MXJA 3RMAA 4FWPA 3ALYA 4G9ZA 2QW9A 3PSFA 4BY9C 4F3TA 5FPEA 4BWJA 1IH7A 4FLVA 4U67L 1BL3A 1P90A 4HUGA 3BUZB 1ASVA 3AV9A 2E6LA 4DR1K 5K14A 4ID5A 4NB4A 3G4SN 4KB0A 4MLHA 2DFHA 3VOVA 4CEFA 3AVBA 3NGZA 2JGUA 4AHVA 4AHRA 1HJRA 2QI2A 3O4QA 3PY8A 2HOEA 1FKOA 4H4MA 1SQKA 3ZYYX 3ATVA 4DLGA 3QERA 5C0YA 4L8RB 3KIOA 3R6MA 4KO0A 4I2PA 1WB9A 4BREA 3CCRN 3CCMN 3LAKA 2O8CB 4O55A 3AVNA 3JS6A 1IKYA 4IOCL 2FC0A 4BG8A 3FZKA 2FF6A 2PAVA 3VQAA 5FRMA 1WBDA 4YOVA 3H1QA 4BQZA 4CJKA 3THXA 3QNNA 3A5NC 3TTDA 3CYMA 4DQ8A 2O8DA 3KLGA 1BU6O 4H5WA 5KRSA 3EKUA 1JL1A 2XY5A 1QSYA 4O8KA 3B6PA 3PO4A 1BCOA 3UIQA 1TK0A 4KHSA 1EWRA 3CIPA 4RWTA 3MK6A 5HRSA 3E9LA 1WAFA 1VQKN 3A5MC 4F3OA 2E2NA 3V9UA 1TVRA 2X6NA 4BVPA 4KRFA 2P9UA 2ZGZA 1RBRA 2GEMA 3E9PA 5M1PA 1BWFO 4IO8A 2W40A 4UQGA 4B1VA 2E1YA 4BWMA 4PKHA 2G8VA 3BF3A 2ITMA 4DR4K 3W0LA 4BDYA 2UXDK 4EZ9A 2P9KA 1BG3A 4GV6A 4JLHA 3J8AA 4FJLA 5LY3A 4V19S 2O4GA 3AVGA 3CQXA 2YJEA 5EOYA 1S72N 3HM9A 2KZZA 2X78A 3PIPL 3QFPA 3CPWM 3PX6A 3OVNA 2UUAK 5AFUH 4CGGA 2KW4A 3BZKA 4B9QA 3KLEA 4WCEL 3WQUA 1YJWN 4M63C 3PO5A 5EXWA 3MEDA 2J4RA 1LWEA 5CR4A 3L6QA 1T6DA 1V4TA 3TAFA 3EYZA 1OKJA 1SV5A 4XIUA 2NRVA 5AQOA 2CH5A 4LSNA 3SJJA 2JWLA 3DYAA 4B9LA 3MECA 1LWCA 4CZJA 4YOXA 1QVFM 3CJ7A 2FBYA 3VEXA 1J53A 3KK2A 4M3ZA 4NXMK 3BP8A 4CZGA 4BRAA 1FJGK 5AQSA 4DF4A 1HYZA 3PSIA 3EE9A 4ILJA 4FWRA 4B9SA 3ASMA 3AO3A 3IS9A 2QA4N 3U3GA 3U6FA 4CZEA 2W6LA 5BRFA 3TAEA 4NXNK 1T05A 1WSIA 1VK0A 3K0SA 3T1AA 1Y97A 4OVLA 1K8KA 1NMDA 1NJZA 3VA0A 1NK0A 4CZFA 4AHUA 1JL2A 4N56A 2VWJA 4YOUA 1ZBFA 2RPIA 1Q9YA 3H1VX 3A0IX 4A2AA 4YHHK 1BIUA 3N4PA 3TTFA 4YNQA 4DFMA 1VQ5N 3OYIA 4H5NA 4CGHA 4FWQA 2OZSA 2A42A 4FJKA 3HT3A 3I8DA 3TWHA 3F2KA 3H3NO 3CCVN 4B1ZA 4FLZA 2A1RA 4DSIA 1I94K 4H0VB 3UKUA 1HQEA 3OBWA 4DSFA 4CF9A 3EEQA 4XH4A 4CJ7A 3WNEA 4KI4A 2A5XA 2VYPA 4DV4K 3C6UA 1KAZA 3SLCA 1XC9A 3BF1A 4JS4A 2X74A 4ELTA 4DQPA 4RW4A 5C2FA 3FGUA 4B1UB 3D2FA 2DFFA 2QWLA 3CC2N 3K57A 4O0JA 4BVOA 4Z4EA 3O3FA 3SUPA 1DTQA 1GLEG 4DTOA 4FXDA 4LC9B 3I8BA 2PY5A 4JI1K 1OH6A 3V1RA 4Z4CA 4F4KA 1QZ5A 4O4GA 1QQMA 3HVRA 1CZAN 3WEEB 2FLOA 4IZ9A 3UKRA 4CFBA 1X9WA 3QBWA 1S9GA 1VQON 1VRUA 1YT3A 5AQHA 2HMIA 1XNQK 1NKCA 2GUPA 3FZLA 1ILYA 3SUQA 4JI5K 4NCAA 2NRXA 4KHPK 3SUNA 3CETA 1D8YA 4WQ5C 1BQMA 4J2EA 2OPQA 1BOTO 3LP3A 3QEPA 4NYNA 2PFUA 4FWKA 4CJWA 4DR7K 3HPOA 1HJOA 4BR0A 4FZZA 4CJTA 3QDKA 4FJ7A 3CC4N 5AQWA 4FK0A 3TI0A 3NHGA 4RCHA 1BISA 3TTCA 3RR8A 1RDAA 5M1FA 3AVMA 3KK1A 3K5LA 5AQKA 1RFQA 1VRTA 1HNVA 3THWA 4E3SA 1JLAA 1YVUA 1S22A 2O8DB 4JHDA 5M1OA 3LPTA 3VTHA 3WT0A 4JD2A 5J2QA 4WFNL 4KHNA 4AM7A 1YAGA 4DB3A 1VQLN 3CPEA 4JNEA 4JKFA 4BRPA 4FWMA 3D0PA 3KVGA 5F2RA 5JVGL 4FOEA 4M7YA 4DV1K 4C8KA 3LDQA 5CYMA 5JLHA 1TK5A 4LF6K 4MLEA 2ASPA 2OPSA 1DT9A 4FL9A 2DY4A 1VSKA 4OO1J 3AAPA 5HP1A 1SS6A 2F7TA 3GG4A 2RF2A 3AVAA 1DKGD 1J9AA 1KC8O 5C24A 3K5MA 4X62K 3WQTA 4PWDA 2VWBA 1VSLA 4O44A 4KHWA 3GDQA 2HVHA 3MWTA 4CFDA 3G25A 4FJJA 1IKWA 3VEZA 2HF3A 3VMFB 5AZJA 4CHQA 2PYJA 3NF8A 4ILGB 2H3GX 3C7NB 4H8KA 3A5LC 5AQTA 4EP5A 3C7NA 3DXMA 2FXUA 3MWPA 3L2QA 1IKVA 4RW8A 4JS5A 2HNYA 3OYGA 3V9XA 2R7YA 4FW2A 1C0TA 3T19A 4KHUA 1TAUA 4H0TB 3AVLA 5AFUA 3VQQA 2P9IB 1BUPA 3CMEN 3NF9A 3ZX3A 4CHZA 3KHYA 1BO5O 4JI0K 5BPNA 1I3AA 2YV0X 1G15A 5AQYA 1SL2A 3NVKA 3H3OB 5FROA 1QVGM 1S6PA 4BE0A 4CE9A 4B3MK 3I55N 3SCXA 3SBTA 3ZSYA 5AQGA 4FCYA 3I56N 5M1QA 1X9JA 3EZ5A 2QWOA 4OKKA 3WUHA 1D5AA 2G8UA 4JI4K 4PY5A 3V1QA 3EL2A 1GOCA 5MLCQ 4R79A 3AVHA 4ISGA 4RW7A 4RW9A 3MAQA 3T1YK 4I9QA 4KH5A 4DSLA 1TK8A 1HPZA 4B9VA 4C23A 3HI0A 1JJ2M 4OKJA 4JK7A 3NH0A 5CE3A 1S1TA 2D5RA 2E88A 4BR2A 4LY7A 3R9PA 1RT1A 4JI6K 4BACA 4NLBA 1BCMA 5AQFA 4M45A 4LFAK 4IWVA 2IVNA 2GV9A 3AA2A 4E89A 4BC3A 3VQEA 4N41A 1T7PA 3MX5A 4IFEA 4QAGA 5KI6A 4CF0A 4B8CA 1ZC6A 3E01A 3AO5A 4CHNA 3CCEN 2HHQA 5HRRA 3C0BA 4DR6K 3ZT0A 3AAQA 2P9SB 2D1KA 3B6OA 3UKRB 3VQ4A 4FLTA 1M1KO 1HQUA 4DHYA 5CY4A 1Q8IA 4U7BA 4DTRA 1NM1A 1H1VA 3DOKA 3QINA 2OYQA 5DK5A 1Q81O 4LD0A 3AVIA 4FZXC 4KFBA 4DTUA 5AQQA 1W2BM 4LF9K 4KKOA 3NF6A 2DTUA 4DS5A 2P9LB 5JS1A 5M1KA 1OH5A 1IG8A 3ID8A 4BRMA 5AJ3K 3I33A 4MFBA 1EKEA 1Q9XA 3CCQN 3MEEA 3H46O 2WOMA 3L0QA 1QZ6A 5GAHP 2ZJRL 4DTSA 5DMRA 5E84A 4IG3A 1YI2N 2BGGA 3OYFA 4PKGA 2XY7A 3SQ0A 3VQ7A 3AA5X 3AARA 3TAGA 3SJHA 4AHSA 2IS3A 1RBSA 1SUQA 4BRDA 4WFAL 4PL8A 3ZSQA 1JLEA 4C8MA 3LDNA 1TGOA 4JKDA 1NGEA 3UE5A 4PQUA 1TUYA 3A2FA 3HO1A 3KWIA 3CJ1A 4K41A 1WLJA 2E20A 1QTMA 4ICLA 4YORA 5D3GA 4EAHD 1NK6A 1VHXA 3MEGA 1KRPA 1XMOK 1KQSM 1TKZA 4BE1A 4JK8A 5C15A 4BRHA 2P9PB 3AGRA 4AILC 1B9FA 1YHQN 1F21A 1VQ6N 1OVYA 3GBTA 3V4IA 4B3OA 1KFDA 3EO3A 1TKDA 3RR7A 5C42A 3RVCA 5SZTA 5KGWA 2QWRA 2YKMA 1RBUA 4H0YB 4CCHA 4BR4A 3NFAA 3HSCA 3SQ1A 4DV0K 3M8SA 3CD6N 2VQEK 3P5JA 3D45A 4X65K 4FJ9A 3PX0A 2B6AA 2QK9A 4K0KK 5T7BA 5LMNK 3LL3A 1T6CA 3AA3A 4M3RA 4BGAA 1FK9A 2E6MA 3SYZA 3AA4A 2QTDA 4ELVA 3SPZA 4CGFA 4IBNA 1C1CA 3ENOA 4H5VA 2V7YA 2O4IA 3F73A 3L2RA 2YJFA 4QS7A 1JCGA 1VQ4N 1WSGA 4C1NK 3NGYA 3SI6A 2NRTA 1CZBA 3LZIA 5J1EA 4Y0WA 4AHTA 4M3YA 3L4IA 3VTIA 1SL0A 3AO1A 4JKAA 1K73O 1YTAA 1X9MA 1FKPA 2JLEA 4KBOA 1IO2A 2AA4A 5GAGP 2V7ZA 3VENA 1KVCA 3DLLL 3IFRA 1RT7A 2W42A 1L5UA 1MDUB 1U48A 2P5GA 4BRKA 1EWQA 3C6HA 1D4XA 3OJSA 3J81O 4B08A 2ZJQL 1RT5A 2NRHA 2EWSA 5CHIA 1S5JA 5CYQA 4GV9A 1VSJA 4CD3A 4YOWA 1C0MA 1Z26A 2X6SA 1EP4A 4CHYA 4IJNA 5LMUK 3TABA 3KZBA 2BDPA 4EZ6A 4JN4A 4KTZA 3RSEB 1N33K 3QIOA 3T7ZA 1S1WA 4MO5A 4IKFA 4CFCA 1TAQA 4H0OA 4FPAA 2P9SA 4OPAA 5IWAK 5IT9O 3FR0A 4E7LA 4CI6A 3L4QA 4M3WA 1HNIA 4LH4A 2KFNA 3DRRA 3NAEA 2YHYA 3R3LA 4BROA 1NGGA 2FBXA 3ENBA 1NJXA 4DSKA 2XY8A 4CIGA 2KFZA 4I6MB 4BC5A 4KREA 4DKWA 1O1WA 4GKKK 2WBNA 3DMJA 3FZMA 1GLDG 2CGKA 3IRXA 1GLLO 3VEWA 3IAYA 4IG0A 2O8CA 4CJEA 3UKUB 1LWFA 2WFBA 4FWNA 1JCFA 5GADP 3SZ2A 3IDHA 1NU0A 3R8EA 1N32K 2CGLA 3NH2A 1NKEA 1K6YA 4BRFA 1ESVA 1NJIO 4CIEA 2BUPA 3NBPA 4DR5K 3CERA 2O8BB 3HPGA 1SKRA 1E3MA 1DEJA 5KRTA 1YIJN 4LF8K 2UUCK 3DAWA 3NMUA 1HLUA 1NWKA 4IDKA 2NNWA 3D2EB 3AY9A 4GNIA 4CK1A 3HBTA 5C12A 3P83D 3CG7A 3ZSVA 3RWUA 4WQ5A 1TL1A 3G71N 1Z6RA 4JKGA 3TARA 1VAZA 1S3XA 3A8YA 2NLXA 4K25A 4FJ5A 4BC2A 5B8HA 3UB5A 5BR9A 3QBXA 3ZX2A 3W3DA 1P8ZA 3ULDA 1RBTA 1RNHA 3NH1A 3U8XA 4KTQA 3OW2M 3MCAB 3CM6A 3NVMA 5JVHL 3THWB 5KGXA 4Z4IA 4XH1A 3L2VA 1NGHA 1TKXA 2ETJA 1JKHA 3HVTA 4CEQA 4OLAA 4B1WB 5BREA 3NCIA 4B9NA 1Y64A 1J6ZA 2V51B 4CJFA 3OYCA 4B3TK 4PUOA 2FBTA 3K5NA 2HBJA 4B9MA 1EXQA 3O08A 4CEEA 2QWQA 4DUYK 1X9SA 3K5OA 1ATRA 3DXKA 5HBMA 3RMDA 4CESA 1OVQA 1LAWA 1HKCA 1W9HA 4H5TA 1RBVA 3DLRA 4DTMA 3DM2A 4W5NA 2Z1GA 2A1SA 4CGJA 3O4NA 3CFPA 4GKJK 3LWLA 3M6GA 2ZQBA 4IOXA 1L3VA 4N76A 5AZIB 1L3UA 1T3VA 2KHOA 4W5TA 3ULEA 1G99A 4JKEA 2IVPA 4DCHA 2HB5A 1ZBSA 1YUWA 1MWMA 3V9ZA 3PX4A 4CF8A 2O8FB 1S1UA 5EY4A 1VQ7N 4CZMA 4BQLA 2OANA 4KTWA 4LH5A 4KH4A 2IC3A 2FSJA 3DWLA 3MX2A 1LW2A 4O5BA 4NCGA 5F1XA 4CHPA 3D2FB 5DM7L 1BI4B 4QOZB 1RCHA 4ILHA 1UOCA 4CJPA 1T44A 2QWPA 3VQPA 1U2VA 1VSHA 2P9UB 3HSTB 4FO0A 3O6WA 2P9PA 2JWKA 1XWLA 5AQUA 1LV5A 3A5OC 4DSEA 3WXIA 3HK2A 4DFJA 2A40A 4J8FA 4ZTFA 1BA0A 4B3RK 1RT4A 3H08A 5ADXH 1L3SA 2UU9K 1IBMK 4CJ5A 2OPRA 4EHTA 3V6DA 4HUEA 1Q86O 2KLAA 2KTQA 2B4JA 1VQMN 4LFBK 3O1WA 4CJVA 1N8RO 3MXIA 4F2RA 3T1HK 2LSNA 3HZ6A 1BQNA 3JXUA 5A2QO 3QEIA 4FVUA 4OJRA 4EIAA 3TAMA 3VEYA 1C0UA 5BPMA 1C0GA 3KD5E 3VQDA 1T8EA 2O8EA 2E4LA 2Q31A 3D2EA 4Z94A 2QM1A 2HSTA 5KPRA 3SAFA 1TL3A 4CFAA 2G8HA 4DMNA 1E4FT 2D0PA 3THYB 1VSEA 2E2PA 4DTPA 3QNOA 4FJGA 4Z4FA 4A57A 2D0AA 1U45A 2O8FA 3AVCA 3ZT1A 3DOLA 3EE8A 2HVIA 1GOAA 3SPYA 1J5OA 2P1JA 4Y1DA 1N6QA 2HHTA 1LOTB 4CF2A 3OYNA 3OYEA 3QESA 3WXKA 3THYA 1BIZA 2I7NA 1FW6A 4Z4HA 5EVZA 3O9SA 1WN7A 2ZM6K 4E7JA 4YOTA 3VQ9A 1BGXT 2YHXA 3ZEUA 3O8MA 2RHKA 4ZHRA 3IUCA 2D0BA 3DRSA 1A5WA 3AVKA 1WAJA 4CJQA 1HKBA 2HHVA 4I6MA 1GLJO 2F9WA 2BTFA 3HP6A 1XQSC 4C1NI 4Q5VA 3K2PA 2D0CA 3M5RA 3LM9A 5BN9A 1KD1O 1LAVA 1K8KB 2WTUA 4NYFA 3VGMA 1GLBG 1UA1A 4PA1A 2AJQA 3F9MA 3BEXA 1NBWA 5LL6Z 1GLAG 3C65A 2YHWA 3D6RA 1GOBA 1RTHA 4XH5A 4JRPA 1REVA 2I7PA 4CZKA 5AR0A 3MCPA 1Q82O 3GE1A 3T69A 3I0RA 5KPTA 4X66K 4HHTA 4KPYA 2XO7A 2YX6A 1W97L 3VQCA 2CGJA 3PUFA 3LDSA 4DV3K 3F9KA 4FK4A 4F9OA 5KPZA 5FPMA 4O0IA 4H0PA 1C0FA 1ITGA 4B8AB 1QQNA 4JI3K 3ZETB 5KQDA 3ZT3A 5ADXA 1NGCA 5BN8A 4IXCA 2Q0RA 3OYKA 3U9ZA 3VESA 3D7EO 3R1XA 3CCSN 3U4LA 1OH7A 3M8PA 3O5BA 4YDUC 3SV3A 2BE2A 4BRQA 5I9EB 3ZT2A 3HTVA 4FLXA 3JSMA 3THXB 3ZSOA 3VGKA 3L8BA 3P39A 3OS1A 1JLBA 3VERA 3DXMB 1NJWA 3NE6A 3MN9A 4MDAA 2F9TA 2ZJPL 2EHGA 4RTFD 1L3TA 1VQ9N 4M3TA 3OY9A 2IVOA 3PIOL 4BRGA 2BANA 2F96A 1ATSA 3ZLJA 5C2DA 3MN6A 3OA9A 5DM6L 3M8QA 3O9TA 5BRHA 4FLYA 1YJNN 3HJFA 3K58A 1QQOA 3GOIA 4E0DA 5JICA 4CZIA 3KD1E 5JS2A 2VGNA 4OPKA 5BRDA 4B3SK 3OJUA 2F4VK 4AF1A 4C8LA 2RE2A 3P38A 1RILA 3CMAN 5ELZA 3H6EA 2PBDA 1HX1A 1CLQA 4K43A 1WUAA 3KLIA 1VQNN 5HRPA 1HYSA 1RT2A 3OYAA 2QXFA 4CK3A 2HNZA 3CJBA 2Y1IA 5FPNA 2YHAA 4FWSA 3V9SA 3VQ6A 3ZSZA 3OBYA 1D9DA 3CHWA 1WNSA 3F5TA 4I2QA 2QWNA 3QEVA 1R59O 4DQIA 4CEOA 2UXCK 4CBUA 3E66A 4YDUA 1BDGA 4PHTX 3O3GA 1DLOA 1FXXA 3BDPA 1HNZK 4IOAL 3OYDA 1U2VB 3SMPA 2IDOA 4OLBA 4CJUA 2HHXA 1NG9A 5AQRA 1KAXA 4AHCA 4CJ4A 4DU4A 4UY8O 1YF5L 3ZX0A 3N4QA 1NK7A 4CVNE 3LZJA 1KVAA 1RDUA 1U4BA 3RTVA 3FZFA 1RTDA 3L2WA 1ASUA 4CEDA 1HNXK 3H45C 3VQ8A 4CBWA 3C6AA 1XNRK 4K42A 3WNGA 3ID6A 4B1XB 3LP1A 5FLXO 2F8TA 4OPJA 3IMXA 2RKIA 4W5RA 5TKWA 5CZ2A 4JV5K 1TKTA 1ZBIA 4G1QA 4DQRA 2ZD1A 4EP4A 1EX4A 3WEEA 5HRNA 1U49A 2HHSA 2VG5A 4DV2K 4FJMA 2FF3B 3CJAA 1UA0A 3MN7A 3QMLA 1JCEA 4GY2B 1VSFA 1NOYA 2XY6A 3I0SA 3CCUN 4FJ8A 1VQPN 3VQ5A 3CQYA 4M3XA 4ISEA 2B5JA 3OYJA 4JI2K 4K8ZA 4KHQA 2BH1A 4HUFA 2XRIA 4CEZA 1BI4A 5E41A 3L2UA 1X3NA 3QIPA 5AZIA 1CXUA 4RG8A 2P9NB 3CI5A 4CF1A 3TAQA 1ZBHA 2YCHA 3MDQA 5F0XA 3VEVA 3QETA 3V81A 1IG9A 1NGJA 4KAZA 2D0OA 5HL7L 2OZMA 2RN2A 3SQ2A 5BPLA 1X3MA 3U3YA 1EO1A 2IGIA 4DU1A 3KJVA 3K59A 3ISNC 5FRNA 2WUSA 1B9DA 2YNGA 4CGDA 2P9IA 3QB0A 2VGMA 2HBMA 3AVFA 1TUUA 5AQXA 2YNIA 3ZETA 2G8KA 4DR2K 3HL8A 4QS8A 4A5BA 3RRHA 4IDHA 3HM8A 4FM0A 3DXKB 1RGIA 2E2QA 1QQCA 1NKBA 4FW1A 4DR3K 4F2SA 3LDLA 5AZJB 4FLWA 2W41A 2ZE2A 1NK5A 5E26A 4WFBL 3AVJA 4DSJA 4DTXA 4J2BA 1QHAA 2O8BA 3MN5A 1HPMA 1DGKN 3O80A 3JAMO 1YXQA 1NMNA 2G8FA 1XI1A 2O8EB 1X1PA 2YNHA 2OTLN 4RW6A 3TSUA 1RDWX 1ZBUA 3FFKB 4DV7K 1RDBA 2IAJA 3QFUA 3HP9A 4QS9A 2GELA 1K9MO 4E7HA 1NGAA 5M1NA 3E1YA 3J80O 1QS4A 4LF7K 4NLCA 1KAYA 1U6ZA 1RT6A 3S41A 3J7ZO 2P51A 5FPDA 5TKYA 1NGBA 3LM2A 3SBGA 1TV6A 2PZSA 5BR8K 1Q7YO 4ISFA 3OYMA 3AO2A 4JYAK 3P1GA 4O5FA 4FZYA 3HPHA 3QLHA 4FSVA 2HBKA 4BR5A 3NGIA 2ITGA 2Q2RA 1KFSA 3DRPA 3G6EN 4ELUA 1QE1A 4M3UA 3CXCM 3CC7N 2ZGYA 4WQ4A 4FJHA 5LJWA 4BDZA 3PLAA 3BGRA 3LALA 3SAGA 4HVJA 4AM6A 2YI1A 2Q0UA 1JLGA 1NGDA 1TYQB 4NCBA 4O8UA 4ZTJA 3CJCA 1WBBA 3ULEB 3IKMA 2QEXN 3CCLN 4CEAA 4OGEA 3OHRA 5KQ8A 3FFIA 1W7AA 2IOCA 3OS0A 4OGCA 2Q1NA 4N5SA 5AQMA 3J7AP 4CJSA 1A5XA 5JMVA 3E9OA 5KTQA 2UYTA 3VPZA 1IV0A 5GIPA 4CD1A 3HRGA 1Z05A 1S6QA 4K8XA 4F8RA 2OPPA 4X64K 3C94A 3JYTA 2QXLA 2VWKA 2HMPA 4E1JA 1U47A 1HR0K 1U04A 4BC4A 2Z1IA 3V9WA 5AQIA 4TSXA 3OTOK 1NK8A 4MO4A 4JD2B 3DI6A 2E2OA 2E8AA 4JKHA 1J5EK 2UXBK 3LP0A 3S3OA 4CECA 4B9UA 3L3UA 4A59A 4MDBA 3S3MA 3ZSXA 4OPHA 5AQNA 3VETA 4GVEA 3CQ8A 3DLBA 3TU5A 1NJYA 3LPUA 4E19A 2P9NA 3B8AX 1SZ2A 1QHTA 4H5RA 3P31A 4CIFA 4WE1A 3O9QA 4CW7B 3C6TA 4H4OA 5SWMA 5JLFA 3NDKA 1WOQA 3RMBA 2QWMA 4IFVA 2Q97A 4CERA 3LWMA 4JKCA 1XHZA 4A62A 4AH9A 3WNFA 3T3FA 2HNDA 3FE1A 2CH6A 4DS4A 2HBLA 4R5PA 3RRGA 3RMCA 3OYHA 3ITHA 2P5OA 4CK2A 2VCPA 1IJJA 2Z1HA 3WXLA 3SQ4A 4GW6A 5AQJA 3SMSA 3VQBA 3L3VA 2FBVA 1VSIA 3KK7A 4JHDB 3DLGA 4FWLA 1NNEA 4IO9L 1A5VA 3VN5A 5J2PA 1JLCA 1NLVA 3Q7CA 1MWKA 4AQYK 3ZEUB 1IKXA 4FJIA 4DWIA 4DV5K 1GLCG 4J2AA 1VSMA 1KLMA 2GUIA 3ENHA 1ATNA 4BG9A 4FVMA 4J2DA 3P4IA 2FSNA 2Z1JA 4CHOA 4FPBA 5EX5A 1YTUA 1EETA 1BA1A 4W5QA 1LW0A 4E7KA 1ZBLA 3VF4A 1RTIA 4CJ3A 3QEWA 1ZYQA 1NOZA 1XMQK 5I3UA 1HRHA 1CZ9A 2KQ2A 1O13A 4DV6K 3S3NA 4HCCA 4FJXA 3ZCMA 1XHXA 3EY1A 2HHHK 3ZSWA 4Z4GA 1QSLA 1OH8A 4CJLA 4DFKA 3AGKA 2V52B 4Q0BA 3WNHA 3KKRA 5HOOA 1RTJA 3M8RA 1SKSA 4PL7A 2HF4A 4BRCA 3HXMA 4MQ3A 2G8IA 3ATUA 4DF8A 3QEXA 3DLHA 3VEOA 4E7IA 1JXBA 4FOIA 4KI6A 2GWJA 1VQ8N 3TSQA 2QKBA 1EQYA 4B9TA 1NGFA 2HW3A 1NK9A 5J2NA 3M1FA 4LFCK 1IBLK 4GVMA 3KKSA 4BR7A 4FM2A 4CZHA 3SNNA 1SKWA 4FYDA 2NUBA 1E4GT 2Q36A 2GX9A 2P9LA 2YHBA 4IFYA 2NRWA 1I39A 1KTQA 3TR8A 4DFPA 3O9RA 1RDDA 5C10A 4JRQA 1RT3A 1UAXA 1WSFA 3O1BA 3IG1A 1N5YA 1HUXA 4DTNA 3VF2A 4BRIA 3O4WA 5EU7A 4LSLA 1WSHA 2PYLA 4IEIA 2YKNA 4JKGB 3EKSA 1K8AO 1KLNA 4YFUA 4FM1A 3LAMA 4CZLA 2KZMA 1LCUA 1D9FA 4A5AA 5LJVA 4M41A 4C8NA 4DTJA 4BRNA 3ZSRA 4NO7A 2DPNA 3KTQA 4JK9A 4FK2A 4EHUA 2ASMA 3SAHA 4JKBA 1R0AA 1BHLA 1C1AA 3BZCA 3MMVA 1TYQA 3CCJN 3VGLA 3OYLA 3AO4A 3CF5L 1IBKK 2NRZA 3OYBA 3HOTA 3WXJA 2A41A 4WF9L 3J7YP 3SK3A 3KLFA 3TPQA 1SL1A 4N47A 3PV8A 2VG7A 3LDOA 2WC9A 1UWBA 1KVBA 1S1VA 1W0HA 2A3ZA 2D4WA 2WONA 5AQZA 4B1YB 4BE2A 3EN9A 3HOSA 2FSKA 3EZWA 1HMVA 1JLFA 1HNWK 1JLQA 1WSJA 1YVNA 3FZHA 2GBZA 1WSEA 3QICA 2ATQA 3KWGA 3TANA 4H0XB 3THVA 4BDPA 3MXMA 4I9LA 4M42A 3K9JA 2OCEA 5I42A 3M3ZA 4LF5K 1S1XA 1ZXOA 3CM5A 4M7XA 3VA3A 3FLCO 1RDCA 3OS2A 2F8SA 4JEPA 4IJAA 1KSPA 4H03B 3O3HA 4E1MA 3K9KA 3TSPA 4HTUA 4JI7K 2HHUA 1T03A 1KCFA 3BY5A 2NZTA 4QCLA 1B92A 3V1OA 4FLUA 1Z25A 1MA9B 4Y1CA 2XHBA 3DJCA 1KXPA 4DQSA 1HKGA 2YNFA 2IIRA 3WXMB 3DLKA 3DLEA 4DUZK 5H1SQ 1YITN 1YJ9N 2Y1JA 2I5JA 4HTLA 3G0ZA 4CBXA 4FJNA 1CXQA 4HCBA 3CFOA 2DFEA 2VG6A 1ASWA 3LANA 5GINA 4GMJB 3SV4A 4WYBA 4OX9K 2ZF5O 4BR9A 4HWIA 3VF6A 3S9HA 4FWOA 1NGIA 4IEEA 3C95A 4EFHA 2OA8A 1QSSA 2GWKA 2QKKA 3O9UA 2VQFK 3QO9A 2E5LK 2ZWHA 1GLFO 4L3QA 3G10A 3NF7A 4KV8A 1N34K 2EX3A 1M90O 2NRRA 3CFRA 4PKIA 5AQVA 4ID1A 4WQ4C 5AQPA 3U9DA 4YOYA 5J2MA 4E1NA 3ZT4A 4JI8K 1XC3A 5GAEP 1VSDA 1N36K 1MU2A 1XUPO 3KLHA 2A6AA 4DU3A 3HYFA 1JXEA 4W5OA 4GV3A 2G8WA 2OTJN 5HROA 4A2BA 1SAZA 3RSEA 5CZ1A 4Z0UA 1V4SA 4CJRA 2Q3SA 2P9KB 4DQQA 1HYVA 4JAXA 4CEBA
chains in the Genus database with same CATH topology
4LF5K 4LF4K 4LFCK 4JYAK 1IBLK 3J81O 5LL6Z 4JI4K 4YHHK 4JI7K 5LMUK 3T1YK 4B3RK 1XMOK 4DR4K 2UU9K 1IBMK 1N33K 2UXDK 4X66K 4LFBK 4YY3K 1I94K 2UUBK 4DUZK 3T1HK 4JI6K 4DV3K 5IT9O 5IWAK 4LFAK 4AQYK 4V19S 5A2QO 2UXCK 4DV1K 1HNZK 4DV4K 4DV5K 4DR2K 4LF6K 4JI3K 3J7AP 2UUAK 4B3TK 4DV0K 4DR1K 4DR6K 2VQEK 4X65K 4DUYK 4OX9K 4CVNE 4K0KK 5LMNK 4DR3K 4X62K 1HNXK 4X64K 1XMQK 4GKKK 4JI1K 1IBKK 1HR0K 1XNRK 4DV6K 5FLXO 3OTOK 2VQFK 3JAMO 4LF9K 2E5LK 3J7YP 4JV5K 1N34K 1J5EK 2HHHK 4GKJK 2UXBK 2ZM6K 5AJ3K 4DV7K 4NXMK 1N32K 4DV2K 1XNQK 1FJGK 4JI8K 4JI5K 1N36K 4KHPK 4DR5K 3J80O 1HNWK 4LF7K 4LF8K 2UUCK 4NXNK 4CW7B 4JI0K 4B3SK 2F4VK 5BR8K 4DR7K 4JI2K 4B3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 K;  4LF4 K;  4LFC K;  4JYA K;  1IBL K;  3J81 O;  5LL6 Z;  4JI4 K;  4YHH K;  4JI7 K;  5LMU K;  3T1Y K;  4B3R K;  1XMO K;  4DR4 K;  2UU9 K;  1IBM K;  1N33 K;  2UXD K;  4X66 K;  4LFB K;  4YY3 K;  1I94 K;  2UUB K;  4DUZ K;  3T1H K;  4JI6 K;  4DV3 K;  5IT9 O;  5IWA K;  4LFA K;  4AQY K;  4V19 S;  5A2Q O;  2UXC K;  4DV1 K;  1HNZ K;  4DV4 K;  4DV5 K;  4DR2 K;  4LF6 K;  4JI3 K;  3J7A P;  2UUA K;  4B3T K;  4DV0 K;  4DR1 K;  4DR6 K;  2VQE K;  4X65 K;  4DUY K;  4OX9 K;  4CVN E;  4K0K K;  5LMN K;  4DR3 K;  4X62 K;  1HNX K;  4X64 K;  1XMQ K;  4GKK K;  4JI1 K;  1IBK K;  1HR0 K;  1XNR K;  4DV6 K;  5FLX O;  3OTO K;  2VQF K;  3JAM O;  4LF9 K;  2E5L K;  3J7Y P;  4JV5 K;  1N34 K;  1J5E K;  2HHH K;  4GKJ K;  2UXB K;  2ZM6 K;  5AJ3 K;  4DV7 K;  4NXM K;  1N32 K;  4DV2 K;  1XNQ K;  1FJG K;  4JI8 K;  4JI5 K;  1N36 K;  4KHP K;  4DR5 K;  3J80 O;  1HNW K;  4LF7 K;  4LF8 K;  2UUC K;  4NXN K;  4CW7 B;  4JI0 K;  4B3S K;  2F4V K;  5BR8 K;  4DR7 K;  4JI2 K;  4B3M K; 
#chains in the Genus database with same CATH topology
 4LF4 K;  4I7F A;  3GL1 A;  5C25 A;  3SUO A;  4CGI A;  3KK3 A;  3TAP A;  2GTD A;  2W6K A;  3LDP A;  3Q7B A;  2ASO A;  1C6V A;  4KHY A;  2E1Z A;  1Q18 A;  4C8O A;  4A61 A;  2HHW A;  4OKE A;  4DG1 A;  5HLF A;  4KB1 A;  1C1B A;  1DTT A;  3LP2 A;  4BGB A;  4KH6 A;  2KKZ A;  5AQL A;  5FDL A;  3CJ9 A;  1NK4 A;  5GIO A;  4YY3 K;  1J54 A;  4BRL A;  1S9E A;  2UUB K;  4XEI A;  2AP1 A;  4DLE A;  3MXJ A;  3RMA A;  4FWP A;  3ALY A;  4G9Z A;  2QW9 A;  3PSF A;  4BY9 C;  4F3T A;  5FPE A;  4BWJ A;  1IH7 A;  4FLV A;  4U67 L;  1BL3 A;  1P90 A;  4HUG A;  3BUZ B;  1ASV A;  3AV9 A;  2E6L A;  4DR1 K;  5K14 A;  4ID5 A;  4NB4 A;  3G4S N;  4KB0 A;  4MLH A;  2DFH A;  3VOV A;  4CEF A;  3AVB A;  3NGZ A;  2JGU A;  4AHV A;  4AHR A;  1HJR A;  2QI2 A;  3O4Q A;  3PY8 A;  2HOE A;  1FKO A;  4H4M A;  1SQK A;  3ZYY X;  3ATV A;  4DLG A;  3QER A;  5C0Y A;  4L8R B;  3KIO A;  3R6M A;  4KO0 A;  4I2P A;  1WB9 A;  4BRE A;  3CCR N;  3CCM N;  3LAK A;  2O8C B;  4O55 A;  3AVN A;  3JS6 A;  1IKY A;  4IOC L;  2FC0 A;  4BG8 A;  3FZK A;  2FF6 A;  2PAV A;  3VQA A;  5FRM A;  1WBD A;  4YOV A;  3H1Q A;  4BQZ A;  4CJK A;  3THX A;  3QNN A;  3A5N C;  3TTD A;  3CYM A;  4DQ8 A;  2O8D A;  3KLG A;  1BU6 O;  4H5W A;  5KRS A;  3EKU A;  1JL1 A;  2XY5 A;  1QSY A;  4O8K A;  3B6P A;  3PO4 A;  1BCO A;  3UIQ A;  1TK0 A;  4KHS A;  1EWR A;  3CIP A;  4RWT A;  3MK6 A;  5HRS A;  3E9L A;  1WAF A;  1VQK N;  3A5M C;  4F3O A;  2E2N A;  3V9U A;  1TVR A;  2X6N A;  4BVP A;  4KRF A;  2P9U A;  2ZGZ A;  1RBR A;  2GEM A;  3E9P A;  5M1P A;  1BWF O;  4IO8 A;  2W40 A;  4UQG A;  4B1V A;  2E1Y A;  4BWM A;  4PKH A;  2G8V A;  3BF3 A;  2ITM A;  4DR4 K;  3W0L A;  4BDY A;  2UXD K;  4EZ9 A;  2P9K A;  1BG3 A;  4GV6 A;  4JLH A;  3J8A A;  4FJL A;  5LY3 A;  4V19 S;  2O4G A;  3AVG A;  3CQX A;  2YJE A;  5EOY A;  1S72 N;  3HM9 A;  2KZZ A;  2X78 A;  3PIP L;  3QFP A;  3CPW M;  3PX6 A;  3OVN A;  2UUA K;  5AFU H;  4CGG A;  2KW4 A;  3BZK A;  4B9Q A;  3KLE A;  4WCE L;  3WQU A;  1YJW N;  4M63 C;  3PO5 A;  5EXW A;  3MED A;  2J4R A;  1LWE A;  5CR4 A;  3L6Q A;  1T6D A;  1V4T A;  3TAF A;  3EYZ A;  1OKJ A;  1SV5 A;  4XIU A;  2NRV A;  5AQO A;  2CH5 A;  4LSN A;  3SJJ A;  2JWL A;  3DYA A;  4B9L A;  3MEC A;  1LWC A;  4CZJ A;  4YOX A;  1QVF M;  3CJ7 A;  2FBY A;  3VEX A;  1J53 A;  3KK2 A;  4M3Z A;  4NXM K;  3BP8 A;  4CZG A;  4BRA A;  1FJG K;  5AQS A;  4DF4 A;  1HYZ A;  3PSI A;  3EE9 A;  4ILJ A;  4FWR A;  4B9S A;  3ASM A;  3AO3 A;  3IS9 A;  2QA4 N;  3U3G A;  3U6F A;  4CZE A;  2W6L A;  5BRF A;  3TAE A;  4NXN K;  1T05 A;  1WSI A;  1VK0 A;  3K0S A;  3T1A A;  1Y97 A;  4OVL A;  1K8K A;  1NMD A;  1NJZ A;  3VA0 A;  1NK0 A;  4CZF A;  4AHU A;  1JL2 A;  4N56 A;  2VWJ A;  4YOU A;  1ZBF A;  2RPI A;  1Q9Y A;  3H1V X;  3A0I X;  4A2A A;  4YHH K;  1BIU A;  3N4P A;  3TTF A;  4YNQ A;  4DFM A;  1VQ5 N;  3OYI A;  4H5N A;  4CGH A;  4FWQ A;  2OZS A;  2A42 A;  4FJK A;  3HT3 A;  3I8D A;  3TWH A;  3F2K A;  3H3N O;  3CCV N;  4B1Z A;  4FLZ A;  2A1R A;  4DSI A;  1I94 K;  4H0V B;  3UKU A;  1HQE A;  3OBW A;  4DSF A;  4CF9 A;  3EEQ A;  4XH4 A;  4CJ7 A;  3WNE A;  4KI4 A;  2A5X A;  2VYP A;  4DV4 K;  3C6U A;  1KAZ A;  3SLC A;  1XC9 A;  3BF1 A;  4JS4 A;  2X74 A;  4ELT A;  4DQP A;  4RW4 A;  5C2F A;  3FGU A;  4B1U B;  3D2F A;  2DFF A;  2QWL A;  3CC2 N;  3K57 A;  4O0J A;  4BVO A;  4Z4E A;  3O3F A;  3SUP A;  1DTQ A;  1GLE G;  4DTO A;  4FXD A;  4LC9 B;  3I8B A;  2PY5 A;  4JI1 K;  1OH6 A;  3V1R A;  4Z4C A;  4F4K A;  1QZ5 A;  4O4G A;  1QQM A;  3HVR A;  1CZA N;  3WEE B;  2FLO A;  4IZ9 A;  3UKR A;  4CFB A;  1X9W A;  3QBW A;  1S9G A;  1VQO N;  1VRU A;  1YT3 A;  5AQH A;  2HMI A;  1XNQ K;  1NKC A;  2GUP A;  3FZL A;  1ILY A;  3SUQ A;  4JI5 K;  4NCA A;  2NRX A;  4KHP K;  3SUN A;  3CET A;  1D8Y A;  4WQ5 C;  1BQM A;  4J2E A;  2OPQ A;  1BOT O;  3LP3 A;  3QEP A;  4NYN A;  2PFU A;  4FWK A;  4CJW A;  4DR7 K;  3HPO A;  1HJO A;  4BR0 A;  4FZZ A;  4CJT A;  3QDK A;  4FJ7 A;  3CC4 N;  5AQW A;  4FK0 A;  3TI0 A;  3NHG A;  4RCH A;  1BIS A;  3TTC A;  3RR8 A;  1RDA A;  5M1F A;  3AVM A;  3KK1 A;  3K5L A;  5AQK A;  1RFQ A;  1VRT A;  1HNV A;  3THW A;  4E3S A;  1JLA A;  1YVU A;  1S22 A;  2O8D B;  4JHD A;  5M1O A;  3LPT A;  3VTH A;  3WT0 A;  4JD2 A;  5J2Q A;  4WFN L;  4KHN A;  4AM7 A;  1YAG A;  4DB3 A;  1VQL N;  3CPE A;  4JNE A;  4JKF A;  4BRP A;  4FWM A;  3D0P A;  3KVG A;  5F2R A;  5JVG L;  4FOE A;  4M7Y A;  4DV1 K;  4C8K A;  3LDQ A;  5CYM A;  5JLH A;  1TK5 A;  4LF6 K;  4MLE A;  2ASP A;  2OPS A;  1DT9 A;  4FL9 A;  2DY4 A;  1VSK A;  4OO1 J;  3AAP A;  5HP1 A;  1SS6 A;  2F7T A;  3GG4 A;  2RF2 A;  3AVA A;  1DKG D;  1J9A A;  1KC8 O;  5C24 A;  3K5M A;  4X62 K;  3WQT A;  4PWD A;  2VWB A;  1VSL A;  4O44 A;  4KHW A;  3GDQ A;  2HVH A;  3MWT A;  4CFD A;  3G25 A;  4FJJ A;  1IKW A;  3VEZ A;  2HF3 A;  3VMF B;  5AZJ A;  4CHQ A;  2PYJ A;  3NF8 A;  4ILG B;  2H3G X;  3C7N B;  4H8K A;  3A5L C;  5AQT A;  4EP5 A;  3C7N A;  3DXM A;  2FXU A;  3MWP A;  3L2Q A;  1IKV A;  4RW8 A;  4JS5 A;  2HNY A;  3OYG A;  3V9X A;  2R7Y A;  4FW2 A;  1C0T A;  3T19 A;  4KHU A;  1TAU A;  4H0T B;  3AVL A;  5AFU A;  3VQQ A;  2P9I B;  1BUP A;  3CME N;  3NF9 A;  3ZX3 A;  4CHZ A;  3KHY A;  1BO5 O;  4JI0 K;  5BPN A;  1I3A A;  2YV0 X;  1G15 A;  5AQY A;  1SL2 A;  3NVK A;  3H3O B;  5FRO A;  1QVG M;  1S6P A;  4BE0 A;  4CE9 A;  4B3M K;  3I55 N;  3SCX A;  3SBT A;  3ZSY A;  5AQG A;  4FCY A;  3I56 N;  5M1Q A;  1X9J A;  3EZ5 A;  2QWO A;  4OKK A;  3WUH A;  1D5A A;  2G8U A;  4JI4 K;  4PY5 A;  3V1Q A;  3EL2 A;  1GOC A;  5MLC Q;  4R79 A;  3AVH A;  4ISG A;  4RW7 A;  4RW9 A;  3MAQ A;  3T1Y K;  4I9Q A;  4KH5 A;  4DSL A;  1TK8 A;  1HPZ A;  4B9V A;  4C23 A;  3HI0 A;  1JJ2 M;  4OKJ A;  4JK7 A;  3NH0 A;  5CE3 A;  1S1T A;  2D5R A;  2E88 A;  4BR2 A;  4LY7 A;  3R9P A;  1RT1 A;  4JI6 K;  4BAC A;  4NLB A;  1BCM A;  5AQF A;  4M45 A;  4LFA K;  4IWV A;  2IVN A;  2GV9 A;  3AA2 A;  4E89 A;  4BC3 A;  3VQE A;  4N41 A;  1T7P A;  3MX5 A;  4IFE A;  4QAG A;  5KI6 A;  4CF0 A;  4B8C A;  1ZC6 A;  3E01 A;  3AO5 A;  4CHN A;  3CCE N;  2HHQ A;  5HRR A;  3C0B A;  4DR6 K;  3ZT0 A;  3AAQ A;  2P9S B;  2D1K A;  3B6O A;  3UKR B;  3VQ4 A;  4FLT A;  1M1K O;  1HQU A;  4DHY A;  5CY4 A;  1Q8I A;  4U7B A;  4DTR A;  1NM1 A;  1H1V A;  3DOK A;  3QIN A;  2OYQ A;  5DK5 A;  1Q81 O;  4LD0 A;  3AVI A;  4FZX C;  4KFB A;  4DTU A;  5AQQ A;  1W2B M;  4LF9 K;  4KKO A;  3NF6 A;  2DTU A;  4DS5 A;  2P9L B;  5JS1 A;  5M1K A;  1OH5 A;  1IG8 A;  3ID8 A;  4BRM A;  5AJ3 K;  3I33 A;  4MFB A;  1EKE A;  1Q9X A;  3CCQ N;  3MEE A;  3H46 O;  2WOM A;  3L0Q A;  1QZ6 A;  5GAH P;  2ZJR L;  4DTS A;  5DMR A;  5E84 A;  4IG3 A;  1YI2 N;  2BGG A;  3OYF A;  4PKG A;  2XY7 A;  3SQ0 A;  3VQ7 A;  3AA5 X;  3AAR A;  3TAG A;  3SJH A;  4AHS A;  2IS3 A;  1RBS A;  1SUQ A;  4BRD A;  4WFA L;  4PL8 A;  3ZSQ A;  1JLE A;  4C8M A;  3LDN A;  1TGO A;  4JKD A;  1NGE A;  3UE5 A;  4PQU A;  1TUY A;  3A2F A;  3HO1 A;  3KWI A;  3CJ1 A;  4K41 A;  1WLJ A;  2E20 A;  1QTM A;  4ICL A;  4YOR A;  5D3G A;  4EAH D;  1NK6 A;  1VHX A;  3MEG A;  1KRP A;  1XMO K;  1KQS M;  1TKZ A;  4BE1 A;  4JK8 A;  5C15 A;  4BRH A;  2P9P B;  3AGR A;  4AIL C;  1B9F A;  1YHQ N;  1F21 A;  1VQ6 N;  1OVY A;  3GBT A;  3V4I A;  4B3O A;  1KFD A;  3EO3 A;  1TKD A;  3RR7 A;  5C42 A;  3RVC A;  5SZT A;  5KGW A;  2QWR A;  2YKM A;  1RBU A;  4H0Y B;  4CCH A;  4BR4 A;  3NFA A;  3HSC A;  3SQ1 A;  4DV0 K;  3M8S A;  3CD6 N;  2VQE K;  3P5J A;  3D45 A;  4X65 K;  4FJ9 A;  3PX0 A;  2B6A A;  2QK9 A;  4K0K K;  5T7B A;  5LMN K;  3LL3 A;  1T6C A;  3AA3 A;  4M3R A;  4BGA A;  1FK9 A;  2E6M A;  3SYZ A;  3AA4 A;  2QTD A;  4ELV A;  3SPZ A;  4CGF A;  4IBN A;  1C1C A;  3ENO A;  4H5V A;  2V7Y A;  2O4I A;  3F73 A;  3L2R A;  2YJF A;  4QS7 A;  1JCG A;  1VQ4 N;  1WSG A;  4C1N K;  3NGY A;  3SI6 A;  2NRT A;  1CZB A;  3LZI A;  5J1E A;  4Y0W A;  4AHT A;  4M3Y A;  3L4I A;  3VTI A;  1SL0 A;  3AO1 A;  4JKA A;  1K73 O;  1YTA A;  1X9M A;  1FKP A;  2JLE A;  4KBO A;  1IO2 A;  2AA4 A;  5GAG P;  2V7Z A;  3VEN A;  1KVC A;  3DLL L;  3IFR A;  1RT7 A;  2W42 A;  1L5U A;  1MDU B;  1U48 A;  2P5G A;  4BRK A;  1EWQ A;  3C6H A;  1D4X A;  3OJS A;  3J81 O;  4B08 A;  2ZJQ L;  1RT5 A;  2NRH A;  2EWS A;  5CHI A;  1S5J A;  5CYQ A;  4GV9 A;  1VSJ A;  4CD3 A;  4YOW A;  1C0M A;  1Z26 A;  2X6S A;  1EP4 A;  4CHY A;  4IJN A;  5LMU K;  3TAB A;  3KZB A;  2BDP A;  4EZ6 A;  4JN4 A;  4KTZ A;  3RSE B;  1N33 K;  3QIO A;  3T7Z A;  1S1W A;  4MO5 A;  4IKF A;  4CFC A;  1TAQ A;  4H0O A;  4FPA A;  2P9S A;  4OPA A;  5IWA K;  5IT9 O;  3FR0 A;  4E7L A;  4CI6 A;  3L4Q A;  4M3W A;  1HNI A;  4LH4 A;  2KFN A;  3DRR A;  3NAE A;  2YHY A;  3R3L A;  4BRO A;  1NGG A;  2FBX A;  3ENB A;  1NJX A;  4DSK A;  2XY8 A;  4CIG A;  2KFZ A;  4I6M B;  4BC5 A;  4KRE A;  4DKW A;  1O1W A;  4GKK K;  2WBN A;  3DMJ A;  3FZM A;  1GLD G;  2CGK A;  3IRX A;  1GLL O;  3VEW A;  3IAY A;  4IG0 A;  2O8C A;  4CJE A;  3UKU B;  1LWF A;  2WFB A;  4FWN A;  1JCF A;  5GAD P;  3SZ2 A;  3IDH A;  1NU0 A;  3R8E A;  1N32 K;  2CGL A;  3NH2 A;  1NKE A;  1K6Y A;  4BRF A;  1ESV A;  1NJI O;  4CIE A;  2BUP A;  3NBP A;  4DR5 K;  3CER A;  2O8B B;  3HPG A;  1SKR A;  1E3M A;  1DEJ A;  5KRT A;  1YIJ N;  4LF8 K;  2UUC K;  3DAW A;  3NMU A;  1HLU A;  1NWK A;  4IDK A;  2NNW A;  3D2E B;  3AY9 A;  4GNI A;  4CK1 A;  3HBT A;  5C12 A;  3P83 D;  3CG7 A;  3ZSV A;  3RWU A;  4WQ5 A;  1TL1 A;  3G71 N;  1Z6R A;  4JKG A;  3TAR A;  1VAZ A;  1S3X A;  3A8Y A;  2NLX A;  4K25 A;  4FJ5 A;  4BC2 A;  5B8H A;  3UB5 A;  5BR9 A;  3QBX A;  3ZX2 A;  3W3D A;  1P8Z A;  3ULD A;  1RBT A;  1RNH A;  3NH1 A;  3U8X A;  4KTQ A;  3OW2 M;  3MCA B;  3CM6 A;  3NVM A;  5JVH L;  3THW B;  5KGX A;  4Z4I A;  4XH1 A;  3L2V A;  1NGH A;  1TKX A;  2ETJ A;  1JKH A;  3HVT A;  4CEQ A;  4OLA A;  4B1W B;  5BRE A;  3NCI A;  4B9N A;  1Y64 A;  1J6Z A;  2V51 B;  4CJF A;  3OYC A;  4B3T K;  4PUO A;  2FBT A;  3K5N A;  2HBJ A;  4B9M A;  1EXQ A;  3O08 A;  4CEE A;  2QWQ A;  4DUY K;  1X9S A;  3K5O A;  1ATR A;  3DXK A;  5HBM A;  3RMD A;  4CES A;  1OVQ A;  1LAW A;  1HKC A;  1W9H A;  4H5T A;  1RBV A;  3DLR A;  4DTM A;  3DM2 A;  4W5N A;  2Z1G A;  2A1S A;  4CGJ A;  3O4N A;  3CFP A;  4GKJ K;  3LWL A;  3M6G A;  2ZQB A;  4IOX A;  1L3V A;  4N76 A;  5AZI B;  1L3U A;  1T3V A;  2KHO A;  4W5T A;  3ULE A;  1G99 A;  4JKE A;  2IVP A;  4DCH A;  2HB5 A;  1ZBS A;  1YUW A;  1MWM A;  3V9Z A;  3PX4 A;  4CF8 A;  2O8F B;  1S1U A;  5EY4 A;  1VQ7 N;  4CZM A;  4BQL A;  2OAN A;  4KTW A;  4LH5 A;  4KH4 A;  2IC3 A;  2FSJ A;  3DWL A;  3MX2 A;  1LW2 A;  4O5B A;  4NCG A;  5F1X A;  4CHP A;  3D2F B;  5DM7 L;  1BI4 B;  4QOZ B;  1RCH A;  4ILH A;  1UOC A;  4CJP A;  1T44 A;  2QWP A;  3VQP A;  1U2V A;  1VSH A;  2P9U B;  3HST B;  4FO0 A;  3O6W A;  2P9P A;  2JWK A;  1XWL A;  5AQU A;  1LV5 A;  3A5O C;  4DSE A;  3WXI A;  3HK2 A;  4DFJ A;  2A40 A;  4J8F A;  4ZTF A;  1BA0 A;  4B3R K;  1RT4 A;  3H08 A;  5ADX H;  1L3S A;  2UU9 K;  1IBM K;  4CJ5 A;  2OPR A;  4EHT A;  3V6D A;  4HUE A;  1Q86 O;  2KLA A;  2KTQ A;  2B4J A;  1VQM N;  4LFB K;  3O1W A;  4CJV A;  1N8R O;  3MXI A;  4F2R A;  3T1H K;  2LSN A;  3HZ6 A;  1BQN A;  3JXU A;  5A2Q O;  3QEI A;  4FVU A;  4OJR A;  4EIA A;  3TAM A;  3VEY A;  1C0U A;  5BPM A;  1C0G A;  3KD5 E;  3VQD A;  1T8E A;  2O8E A;  2E4L A;  2Q31 A;  3D2E A;  4Z94 A;  2QM1 A;  2HST A;  5KPR A;  3SAF A;  1TL3 A;  4CFA A;  2G8H A;  4DMN A;  1E4F T;  2D0P A;  3THY B;  1VSE A;  2E2P A;  4DTP A;  3QNO A;  4FJG A;  4Z4F A;  4A57 A;  2D0A A;  1U45 A;  2O8F A;  3AVC A;  3ZT1 A;  3DOL A;  3EE8 A;  2HVI A;  1GOA A;  3SPY A;  1J5O A;  2P1J A;  4Y1D A;  1N6Q A;  2HHT A;  1LOT B;  4CF2 A;  3OYN A;  3OYE A;  3QES A;  3WXK A;  3THY A;  1BIZ A;  2I7N A;  1FW6 A;  4Z4H A;  5EVZ A;  3O9S A;  1WN7 A;  2ZM6 K;  4E7J A;  4YOT A;  3VQ9 A;  1BGX T;  2YHX A;  3ZEU A;  3O8M A;  2RHK A;  4ZHR A;  3IUC A;  2D0B A;  3DRS A;  1A5W A;  3AVK A;  1WAJ A;  4CJQ A;  1HKB A;  2HHV A;  4I6M A;  1GLJ O;  2F9W A;  2BTF A;  3HP6 A;  1XQS C;  4C1N I;  4Q5V A;  3K2P A;  2D0C A;  3M5R A;  3LM9 A;  5BN9 A;  1KD1 O;  1LAV A;  1K8K B;  2WTU A;  4NYF A;  3VGM A;  1GLB G;  1UA1 A;  4PA1 A;  2AJQ A;  3F9M A;  3BEX A;  1NBW A;  5LL6 Z;  1GLA G;  3C65 A;  2YHW A;  3D6R A;  1GOB A;  1RTH A;  4XH5 A;  4JRP A;  1REV A;  2I7P A;  4CZK A;  5AR0 A;  3MCP A;  1Q82 O;  3GE1 A;  3T69 A;  3I0R A;  5KPT A;  4X66 K;  4HHT A;  4KPY A;  2XO7 A;  2YX6 A;  1W97 L;  3VQC A;  2CGJ A;  3PUF A;  3LDS A;  4DV3 K;  3F9K A;  4FK4 A;  4F9O A;  5KPZ A;  5FPM A;  4O0I A;  4H0P A;  1C0F A;  1ITG A;  4B8A B;  1QQN A;  4JI3 K;  3ZET B;  5KQD A;  3ZT3 A;  5ADX A;  1NGC A;  5BN8 A;  4IXC A;  2Q0R A;  3OYK A;  3U9Z A;  3VES A;  3D7E O;  3R1X A;  3CCS N;  3U4L A;  1OH7 A;  3M8P A;  3O5B A;  4YDU C;  3SV3 A;  2BE2 A;  4BRQ A;  5I9E B;  3ZT2 A;  3HTV A;  4FLX A;  3JSM A;  3THX B;  3ZSO A;  3VGK A;  3L8B A;  3P39 A;  3OS1 A;  1JLB A;  3VER A;  3DXM B;  1NJW A;  3NE6 A;  3MN9 A;  4MDA A;  2F9T A;  2ZJP L;  2EHG A;  4RTF D;  1L3T A;  1VQ9 N;  4M3T A;  3OY9 A;  2IVO A;  3PIO L;  4BRG A;  2BAN A;  2F96 A;  1ATS A;  3ZLJ A;  5C2D A;  3MN6 A;  3OA9 A;  5DM6 L;  3M8Q A;  3O9T A;  5BRH A;  4FLY A;  1YJN N;  3HJF A;  3K58 A;  1QQO A;  3GOI A;  4E0D A;  5JIC A;  4CZI A;  3KD1 E;  5JS2 A;  2VGN A;  4OPK A;  5BRD A;  4B3S K;  3OJU A;  2F4V K;  4AF1 A;  4C8L A;  2RE2 A;  3P38 A;  1RIL A;  3CMA N;  5ELZ A;  3H6E A;  2PBD A;  1HX1 A;  1CLQ A;  4K43 A;  1WUA A;  3KLI A;  1VQN N;  5HRP A;  1HYS A;  1RT2 A;  3OYA A;  2QXF A;  4CK3 A;  2HNZ A;  3CJB A;  2Y1I A;  5FPN A;  2YHA A;  4FWS A;  3V9S A;  3VQ6 A;  3ZSZ A;  3OBY A;  1D9D A;  3CHW A;  1WNS A;  3F5T A;  4I2Q A;  2QWN A;  3QEV A;  1R59 O;  4DQI A;  4CEO A;  2UXC K;  4CBU A;  3E66 A;  4YDU A;  1BDG A;  4PHT X;  3O3G A;  1DLO A;  1FXX A;  3BDP A;  1HNZ K;  4IOA L;  3OYD A;  1U2V B;  3SMP A;  2IDO A;  4OLB A;  4CJU A;  2HHX A;  1NG9 A;  5AQR A;  1KAX A;  4AHC A;  4CJ4 A;  4DU4 A;  4UY8 O;  1YF5 L;  3ZX0 A;  3N4Q A;  1NK7 A;  4CVN E;  3LZJ A;  1KVA A;  1RDU A;  1U4B A;  3RTV A;  3FZF A;  1RTD A;  3L2W A;  1ASU A;  4CED A;  1HNX K;  3H45 C;  3VQ8 A;  4CBW A;  3C6A A;  1XNR K;  4K42 A;  3WNG A;  3ID6 A;  4B1X B;  3LP1 A;  5FLX O;  2F8T A;  4OPJ A;  3IMX A;  2RKI A;  4W5R A;  5TKW A;  5CZ2 A;  4JV5 K;  1TKT A;  1ZBI A;  4G1Q A;  4DQR A;  2ZD1 A;  4EP4 A;  1EX4 A;  3WEE A;  5HRN A;  1U49 A;  2HHS A;  2VG5 A;  4DV2 K;  4FJM A;  2FF3 B;  3CJA A;  1UA0 A;  3MN7 A;  3QML A;  1JCE A;  4GY2 B;  1VSF A;  1NOY A;  2XY6 A;  3I0S A;  3CCU N;  4FJ8 A;  1VQP N;  3VQ5 A;  3CQY A;  4M3X A;  4ISE A;  2B5J A;  3OYJ A;  4JI2 K;  4K8Z A;  4KHQ A;  2BH1 A;  4HUF A;  2XRI A;  4CEZ A;  1BI4 A;  5E41 A;  3L2U A;  1X3N A;  3QIP A;  5AZI A;  1CXU A;  4RG8 A;  2P9N B;  3CI5 A;  4CF1 A;  3TAQ A;  1ZBH A;  2YCH A;  3MDQ A;  5F0X A;  3VEV A;  3QET A;  3V81 A;  1IG9 A;  1NGJ A;  4KAZ A;  2D0O A;  5HL7 L;  2OZM A;  2RN2 A;  3SQ2 A;  5BPL A;  1X3M A;  3U3Y A;  1EO1 A;  2IGI A;  4DU1 A;  3KJV A;  3K59 A;  3ISN C;  5FRN A;  2WUS A;  1B9D A;  2YNG A;  4CGD A;  2P9I A;  3QB0 A;  2VGM A;  2HBM A;  3AVF A;  1TUU A;  5AQX A;  2YNI A;  3ZET A;  2G8K A;  4DR2 K;  3HL8 A;  4QS8 A;  4A5B A;  3RRH A;  4IDH A;  3HM8 A;  4FM0 A;  3DXK B;  1RGI A;  2E2Q A;  1QQC A;  1NKB A;  4FW1 A;  4DR3 K;  4F2S A;  3LDL A;  5AZJ B;  4FLW A;  2W41 A;  2ZE2 A;  1NK5 A;  5E26 A;  4WFB L;  3AVJ A;  4DSJ A;  4DTX A;  4J2B A;  1QHA A;  2O8B A;  3MN5 A;  1HPM A;  1DGK N;  3O80 A;  3JAM O;  1YXQ A;  1NMN A;  2G8F A;  1XI1 A;  2O8E B;  1X1P A;  2YNH A;  2OTL N;  4RW6 A;  3TSU A;  1RDW X;  1ZBU A;  3FFK B;  4DV7 K;  1RDB A;  2IAJ A;  3QFU A;  3HP9 A;  4QS9 A;  2GEL A;  1K9M O;  4E7H A;  1NGA A;  5M1N A;  3E1Y A;  3J80 O;  1QS4 A;  4LF7 K;  4NLC A;  1KAY A;  1U6Z A;  1RT6 A;  3S41 A;  3J7Z O;  2P51 A;  5FPD A;  5TKY A;  1NGB A;  3LM2 A;  3SBG A;  1TV6 A;  2PZS A;  5BR8 K;  1Q7Y O;  4ISF A;  3OYM A;  3AO2 A;  4JYA K;  3P1G A;  4O5F A;  4FZY A;  3HPH A;  3QLH A;  4FSV A;  2HBK A;  4BR5 A;  3NGI A;  2ITG A;  2Q2R A;  1KFS A;  3DRP A;  3G6E N;  4ELU A;  1QE1 A;  4M3U A;  3CXC M;  3CC7 N;  2ZGY A;  4WQ4 A;  4FJH A;  5LJW A;  4BDZ A;  3PLA A;  3BGR A;  3LAL A;  3SAG A;  4HVJ A;  4AM6 A;  2YI1 A;  2Q0U A;  1JLG A;  1NGD A;  1TYQ B;  4NCB A;  4O8U A;  4ZTJ A;  3CJC A;  1WBB A;  3ULE B;  3IKM A;  2QEX N;  3CCL N;  4CEA A;  4OGE A;  3OHR A;  5KQ8 A;  3FFI A;  1W7A A;  2IOC A;  3OS0 A;  4OGC A;  2Q1N A;  4N5S A;  5AQM A;  3J7A P;  4CJS A;  1A5X A;  5JMV A;  3E9O A;  5KTQ A;  2UYT A;  3VPZ A;  1IV0 A;  5GIP A;  4CD1 A;  3HRG A;  1Z05 A;  1S6Q A;  4K8X A;  4F8R A;  2OPP A;  4X64 K;  3C94 A;  3JYT A;  2QXL A;  2VWK A;  2HMP A;  4E1J A;  1U47 A;  1HR0 K;  1U04 A;  4BC4 A;  2Z1I A;  3V9W A;  5AQI A;  4TSX A;  3OTO K;  1NK8 A;  4MO4 A;  4JD2 B;  3DI6 A;  2E2O A;  2E8A A;  4JKH A;  1J5E K;  2UXB K;  3LP0 A;  3S3O A;  4CEC A;  4B9U A;  3L3U A;  4A59 A;  4MDB A;  3S3M A;  3ZSX A;  4OPH A;  5AQN A;  3VET A;  4GVE A;  3CQ8 A;  3DLB A;  3TU5 A;  1NJY A;  3LPU A;  4E19 A;  2P9N A;  3B8A X;  1SZ2 A;  1QHT A;  4H5R A;  3P31 A;  4CIF A;  4WE1 A;  3O9Q A;  4CW7 B;  3C6T A;  4H4O A;  5SWM A;  5JLF A;  3NDK A;  1WOQ A;  3RMB A;  2QWM A;  4IFV A;  2Q97 A;  4CER A;  3LWM A;  4JKC A;  1XHZ A;  4A62 A;  4AH9 A;  3WNF A;  3T3F A;  2HND A;  3FE1 A;  2CH6 A;  4DS4 A;  2HBL A;  4R5P A;  3RRG A;  3RMC A;  3OYH A;  3ITH A;  2P5O A;  4CK2 A;  2VCP A;  1IJJ A;  2Z1H A;  3WXL A;  3SQ4 A;  4GW6 A;  5AQJ A;  3SMS A;  3VQB A;  3L3V A;  2FBV A;  1VSI A;  3KK7 A;  4JHD B;  3DLG A;  4FWL A;  1NNE A;  4IO9 L;  1A5V A;  3VN5 A;  5J2P A;  1JLC A;  1NLV A;  3Q7C A;  1MWK A;  4AQY K;  3ZEU B;  1IKX A;  4FJI A;  4DWI A;  4DV5 K;  1GLC G;  4J2A A;  1VSM A;  1KLM A;  2GUI A;  3ENH A;  1ATN A;  4BG9 A;  4FVM A;  4J2D A;  3P4I A;  2FSN A;  2Z1J A;  4CHO A;  4FPB A;  5EX5 A;  1YTU A;  1EET A;  1BA1 A;  4W5Q A;  1LW0 A;  4E7K A;  1ZBL A;  3VF4 A;  1RTI A;  4CJ3 A;  3QEW A;  1ZYQ A;  1NOZ A;  1XMQ K;  5I3U A;  1HRH A;  1CZ9 A;  2KQ2 A;  1O13 A;  4DV6 K;  3S3N A;  4HCC A;  4FJX A;  3ZCM A;  1XHX A;  3EY1 A;  2HHH K;  3ZSW A;  4Z4G A;  1QSL A;  1OH8 A;  4CJL A;  4DFK A;  3AGK A;  2V52 B;  4Q0B A;  3WNH A;  3KKR A;  5HOO A;  1RTJ A;  3M8R A;  1SKS A;  4PL7 A;  2HF4 A;  4BRC A;  3HXM A;  4MQ3 A;  2G8I A;  3ATU A;  4DF8 A;  3QEX A;  3DLH A;  3VEO A;  4E7I A;  1JXB A;  4FOI A;  4KI6 A;  2GWJ A;  1VQ8 N;  3TSQ A;  2QKB A;  1EQY A;  4B9T A;  1NGF A;  2HW3 A;  1NK9 A;  5J2N A;  3M1F A;  4LFC K;  1IBL K;  4GVM A;  3KKS A;  4BR7 A;  4FM2 A;  4CZH A;  3SNN A;  1SKW A;  4FYD A;  2NUB A;  1E4G T;  2Q36 A;  2GX9 A;  2P9L A;  2YHB A;  4IFY A;  2NRW A;  1I39 A;  1KTQ A;  3TR8 A;  4DFP A;  3O9R A;  1RDD A;  5C10 A;  4JRQ A;  1RT3 A;  1UAX A;  1WSF A;  3O1B A;  3IG1 A;  1N5Y A;  1HUX A;  4DTN A;  3VF2 A;  4BRI A;  3O4W A;  5EU7 A;  4LSL A;  1WSH A;  2PYL A;  4IEI A;  2YKN A;  4JKG B;  3EKS A;  1K8A O;  1KLN A;  4YFU A;  4FM1 A;  3LAM A;  4CZL A;  2KZM A;  1LCU A;  1D9F A;  4A5A A;  5LJV A;  4M41 A;  4C8N A;  4DTJ A;  4BRN A;  3ZSR A;  4NO7 A;  2DPN A;  3KTQ A;  4JK9 A;  4FK2 A;  4EHU A;  2ASM A;  3SAH A;  4JKB A;  1R0A A;  1BHL A;  1C1A A;  3BZC A;  3MMV A;  1TYQ A;  3CCJ N;  3VGL A;  3OYL A;  3AO4 A;  3CF5 L;  1IBK K;  2NRZ A;  3OYB A;  3HOT A;  3WXJ A;  2A41 A;  4WF9 L;  3J7Y P;  3SK3 A;  3KLF A;  3TPQ A;  1SL1 A;  4N47 A;  3PV8 A;  2VG7 A;  3LDO A;  2WC9 A;  1UWB A;  1KVB A;  1S1V A;  1W0H A;  2A3Z A;  2D4W A;  2WON A;  5AQZ A;  4B1Y B;  4BE2 A;  3EN9 A;  3HOS A;  2FSK A;  3EZW A;  1HMV A;  1JLF A;  1HNW K;  1JLQ A;  1WSJ A;  1YVN A;  3FZH A;  2GBZ A;  1WSE A;  3QIC A;  2ATQ A;  3KWG A;  3TAN A;  4H0X B;  3THV A;  4BDP A;  3MXM A;  4I9L A;  4M42 A;  3K9J A;  2OCE A;  5I42 A;  3M3Z A;  4LF5 K;  1S1X A;  1ZXO A;  3CM5 A;  4M7X A;  3VA3 A;  3FLC O;  1RDC A;  3OS2 A;  2F8S A;  4JEP A;  4IJA A;  1KSP A;  4H03 B;  3O3H A;  4E1M A;  3K9K A;  3TSP A;  4HTU A;  4JI7 K;  2HHU A;  1T03 A;  1KCF A;  3BY5 A;  2NZT A;  4QCL A;  1B92 A;  3V1O A;  4FLU A;  1Z25 A;  1MA9 B;  4Y1C A;  2XHB A;  3DJC A;  1KXP A;  4DQS A;  1HKG A;  2YNF A;  2IIR A;  3WXM B;  3DLK A;  3DLE A;  4DUZ K;  5H1S Q;  1YIT N;  1YJ9 N;  2Y1J A;  2I5J A;  4HTL A;  3G0Z A;  4CBX A;  4FJN A;  1CXQ A;  4HCB A;  3CFO A;  2DFE A;  2VG6 A;  1ASW A;  3LAN A;  5GIN A;  4GMJ B;  3SV4 A;  4WYB A;  4OX9 K;  2ZF5 O;  4BR9 A;  4HWI A;  3VF6 A;  3S9H A;  4FWO A;  1NGI A;  4IEE A;  3C95 A;  4EFH A;  2OA8 A;  1QSS A;  2GWK A;  2QKK A;  3O9U A;  2VQF K;  3QO9 A;  2E5L K;  2ZWH A;  1GLF O;  4L3Q A;  3G10 A;  3NF7 A;  4KV8 A;  1N34 K;  2EX3 A;  1M90 O;  2NRR A;  3CFR A;  4PKI A;  5AQV A;  4ID1 A;  4WQ4 C;  5AQP A;  3U9D A;  4YOY A;  5J2M A;  4E1N A;  3ZT4 A;  4JI8 K;  1XC3 A;  5GAE P;  1VSD A;  1N36 K;  1MU2 A;  1XUP O;  3KLH A;  2A6A A;  4DU3 A;  3HYF A;  1JXE A;  4W5O A;  4GV3 A;  2G8W A;  2OTJ N;  5HRO A;  4A2B A;  1SAZ A;  3RSE A;  5CZ1 A;  4Z0U A;  1V4S A;  4CJR A;  2Q3S A;  2P9K B;  4DQQ A;  1HYV A;  4JAX A;  4CEB A; 
#chains in the Genus database with same CATH homology
 4LF5 K;  4LF4 K;  4LFC K;  4JYA K;  1IBL K;  3J81 O;  5LL6 Z;  4JI4 K;  4YHH K;  4JI7 K;  5LMU K;  3T1Y K;  4B3R K;  1XMO K;  4DR4 K;  2UU9 K;  1IBM K;  1N33 K;  2UXD K;  4X66 K;  4LFB K;  4YY3 K;  1I94 K;  2UUB K;  4DUZ K;  3T1H K;  4JI6 K;  4DV3 K;  5IT9 O;  5IWA K;  4LFA K;  4AQY K;  4V19 S;  5A2Q O;  2UXC K;  4DV1 K;  1HNZ K;  4DV4 K;  4DV5 K;  4DR2 K;  4LF6 K;  4JI3 K;  3J7A P;  2UUA K;  4B3T K;  4DV0 K;  4DR1 K;  4DR6 K;  2VQE K;  4X65 K;  4DUY K;  4OX9 K;  4CVN E;  4K0K K;  5LMN K;  4DR3 K;  4X62 K;  1HNX K;  4X64 K;  1XMQ K;  4GKK K;  4JI1 K;  1IBK K;  1HR0 K;  1XNR K;  4DV6 K;  5FLX O;  3OTO K;  2VQF K;  3JAM O;  4LF9 K;  2E5L K;  3J7Y P;  4JV5 K;  1N34 K;  1J5E K;  2HHH K;  4GKJ K;  2UXB K;  2ZM6 K;  5AJ3 K;  4DV7 K;  4NXM K;  1N32 K;  4DV2 K;  1XNQ K;  1FJG K;  4JI8 K;  4JI5 K;  1N36 K;  4KHP K;  4DR5 K;  3J80 O;  1HNW K;  4LF7 K;  4LF8 K;  2UUC K;  4NXN K;  4CW7 B;  4JI0 K;  4B3S K;  2F4V K;  5BR8 K;  4DR7 K;  4JI2 K;  4B3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...