4DR4T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr4T00
1XMOT 2VQET 4DV4T 4DR1T 4LF9T 4YHHT 4JI2T 4AQYT 4DUZT 4DV3T 2F4VT 5LMUT 2UUCT 1N34T 4B3RT 2UXDT 4DV5T 5IWAT 1I94T 5LMNT 4LFBT 4LF6T 2ZM6T 4B3TT 4X62T 4LF7T 2UXCT 2UU9T 4JYAT 1XMQT 1J5ET 1N33T 4JI1T 1HNXT 2E5LT 4DR7T 4DV7T 4OX9T 1N32T 3OTOT 2UXBT 4JI5T 4JI3T 4LF4T 4LFAT 4DV6T 4DV1T 4DR4T 4GKJT 4NXMT 4X64T 4JI7T 1HR0T 4B3ST 4B3MT 1IBKT 4DV2T 1IBLT 4JI6T 4JV5T 4LF5T 4DR6T 1FJGT 2UUBT 4NXNT 4X65T 2VQFT 4YY3T 1N36T 1XNQT 4DR2T 3T1YT 4X66T 2HHHT 4DR3T 4LFCT 1HNWT 3T1HT 4KHPT 4DV0T 4LF8T 4K0KT 4JI4T 4JI0T 4DUYT 4DR5T 1HNZT 4JI8T 1IBMT 5BR8T 4GKKT 1XNRT 2UUAT
chains in the Genus database with same CATH superfamily
5AQFB 3PUGA 4QX7B 5DJQC 2P9BA 3ANWA 3ZMVB 3AE3A 4KHZF 4WYVA 4BJNA 2VVSA 4DR1T 4A98A 2CM0A 4AQGA 2J62A 4CN1A 2L9QA 2BZBA 5CB4E 4PJJA 3MK7C 4YHHT 4ZI2C 2XQ6A 2K3WA 3PJAA 3P4PA 3ONXA 3VR9A 3VKHA 1OEDB 3WAKA 2WAUA 1D1CA 3AXJB 5EK3A 2KWIB 2JQ9A 2MPKA 4PAGA 4HN9A 3FHNA 2LKHA 2J1DG 4Z91A 3F31A 2BG9B 4JUYA 4B3RT 2UXDT 2XQ4A 4M1PA 2NW8A 2BKNA 2WDQA 2CWOA 4HKAA 2LHNA 2ZMAA 3M3ZB 1KF6A 3TLVA 5JDHA 5LHGB 4U31A 2LOSA 4GK0E 5AQQB 3ONJA 4UVAB 2CEAA 3CX8B 3LFMA 4IHJE 1LVFA 4X20E 3UUXB 2PTFA 4COFA 5EK2A 5LMNT 1BR1A 4LFBT 3SS1A 3FZFB 3EUHA 3MXZA 4Z90A 1CHUA 3KVAA 3TKLB 3NKZA 1UX4A 2FJDA 2V5DA 1H7CA 2XHEB 4QH5A 1MNDA 2FJEA 2M67A 3MA9A 3H3AA 4AQFC 3I9YA 4L5GA 2QA7A 4KBMB 5TAOA 4TV9E 3UUMA 2UU9T 3RH3A 2V26A 2BBHA 3EDUA 3UT5E 3VRAA 1YQ4A 1MIVA 3DJBA 4U2ZA 2ZM2A 5KX5E 2PFVA 2G0UA 5J1GA 5FL0A 4CXWA 3U78A 1HNXT 3I1AA 4ILUA 5JTGA 3Q9DA 3I0OA 4J2CA 4EB6E 4OFZA 4IL9A 4NUVA 5LP6E 2FBWA 3KBTA 3AA7B 2VK9A 2HN1A 3KV6A 1KEYA 4XZCA 4YFSA 2BS4A 3E22E 3UTKA 5JR9C 2KWHA 4IE4A 1OEDA 3SFDA 4H9NC 2CLYB 4AQFA 4WZXA 2YDSA 2VL8A 4HEAA 4O4HE 4IGUA 1EZ3A 3ZJ2A 2WU2A 3CX7B 5HXSA 3PUZF 4HFVA 5F5WA 3PUYF 1BR2A 1HG5A 5FVLA 4DV1T 5LBMA 4DR4T 4X64T 2IW5B 4UXNB 5JVDE 4X65T 4IE5A 1XZYA 2JQHA 3J7Yq 4HGAA 3FB2A 4HFEA 5C3JA 1XDOA 3ZJ1A 2CXLA 2QYWA 5C8YE 3JADA 2H7VC 4X1KE 2E2AA 4JI6T 3NWIA 1VOMA 3BQKA 5LGUB 1HX1B 5FNVE 3IEEA 5FXXA 2NP9A 3ZSSA 5J2TE 4NXNT 3NRXA 4IDPA 3UUNA 4IDOA 5HXRA 3VRBA 4H63H 4UF0A 4A5XA 4EV6A 4YY3T 2E9XC 1XNQT 2XAQB 2XSBA 3AB3B 1HTJF 3GN5B 3N2GE 2Q9QA 5L4HA 2V6YB 2E5VA 3OJAA 5ABGA 4CN4A 3ZMTB 2JQQA 3UFGA 4UV9B 5JDNA 1GQEA 4X1IE 1X79A 1HCIA 4EIWA 3C98B 2WS3A 4ZZCA 4QKNA 3GN5A 4OK0A 1VRBA 1KK7A 2KLQA 2XJ7A 2YDQA 4I55E 1FMWA 3FXEB 3QNUA 4P09A 3AE9A 3PU3A 3RF1A 3MZKB 5FXWA 1G8XA 1WFDA 3ZPOA 5CFBA 1W09A 1HNWT 4G2AA 4O4IE 3BK9A 2VVNA 2HN2A 3I0QA 3P7IA 3VR8A 1UUSA 3A5XA 4PFOA 2LLYA 3CX6B 2E9XA 2K24A 3LBXA 3O4XE 4H9OC 1W0AA 2PJQA 4ILBA 4JI4T 4XBFB 4U72A 4DUYT 5F3JA 1LRZA 4OYJA 3ZYKA 5AQUB 1LKXA 4YXDA 2D0TA 4KI0F 3ZMZB 4GKKT 2DHRA 4EZ4A 2VASA 3NZQA 2UUAT 2JPFA 2RPAA 4IT4A 3TLTA 5JR9A 4XAXB 1FMVA 4H9PC 3LJCA 3N2OA 2NW9A 4LF9T 4I43B 3RIFA 2VKOA 4H9SE 4IE7A 4F6RC 5KXJA 2CE7A 4JEUB 2HPLA 2X9HA 4JI2T 3KFWX 3ETUA 3ZT7A 4DBRA 3A7MA 4DUZT 2F4VT 2DWKA 1YQ3A 1J1JA 2VKDA 2VURA 2CRBA 2YEVC 2LSGA 2MAWA 3OVUA 4H9QC 4MFRA 3TLSA 2PBIA 5AQRB 3UU4A 5HEUA 5KDMC 3B13A 4Z8XA 2FJBA 2H88A 4TV8E 3EHZA 1I94T 5HCMA 2OV9A 3ANWB 3IF8B 1YXRA 4LMJA 3ZC1A 3PTRB 2WU5A 3RI5A 2V6XA 3RIAA 1M7KA 1ZKEA 2QVAA 4PNIA 4B3MT 1SHZC 2JIWA 5E0OA 4PW8A 2M6IA 2JMKA 1HS7A 2BKPA 4AIUA 3CK6A 4DO0A 3L09A 2BS2A 4B3TT 4QXHB 1HFAA 4X5TA 3KVBA 2BBJA 2LT3A 2V7KA 4X62T 2IMLA 4UELA 1S35A 2W4XA 3EABA 3Q5EA 4V1Av 4ZHQE 5FXVA 5EK4A 2Q9QC 3RYIE 4LF7T 3AEFA 3P4RA 4ILCA 5AQIB 3FZKB 2UXCT 4JYAT 5AQOB 1HX8A 1UX5A 4I4TE 1XMQT 4C91A 4GIWA 3K1SA 4JEHB 3ZMUB 2XUEA 3UU6A 4L9IA 1OWAA 3AXJA 4YJ2E 2XM2A 1KNRA 3UULA 4A97A 2EHOA 4DNDA 1DU2A 2BG9A 5DQWA 5ABFB 4DV7T 4PJNA 4B3ST 4WNKA 2LE8A 3C4ZA 3CQCB 3QB5A 4TX5A 5JDQA 2BVLA 3AA0B 4OYKA 4WW0A 2NTYA 2LM9A 2XQ5A 2Y6XA 2YKSA 5AQVB 5FY7A 3ZKRA 2YK0A 2FJAA 2UUBT 1IZNB 5ETWA 1U4QA 3RKGA 1T98A 2XPKA 4CN6A 2V7MA 4HWHA 4LFAT 4UV8B 5AQGB 3T1YT 2VWAA 1S94A 3PUVF 4ILAA 3AA6B 3E08A 5IWAT 4U7IA 1ZHCA 2Y8DA 4O2BE 3MKDA 4ZZBA 3KBUA 5AQNB 2RP4A 3AAIA 3RKOA 4CQIA 3S4UA 3TLUA 3FZMB 4UIGA 3TLWA 3ZCIA 4FJOA 1JNZA 1V9DA 4H9RC 4CI1B 4ZI3D 1VCSA 4LF5T 3AAEB 4P1NA 3RHWA 1ZV4X 2K9AA 1FJGT 4PK4A 2I59A 5AQKB 2DCFA 1Y64B 3AE2A 5HEGA 5JRCB 1KNZA 4HWFA 4QH4A 2J4GA 3L8RA 5JR9B 3JC6D 2W2UA 3AEEA 4LMKA 2LSKA 5JDGA 1NWMX 2L3LA 2KNDA 2PG8A 3CPZA 1WCRA 2V1DB 2X66A 3ETVA 4HFHA 1Z8UA 3PUXF 4X66T 3HL6A 1MNEA 2YU2A 2A9UA 2WWVA 4PFPA 4PK5A 2XAFB 4N78D 5ABFA 2CXDA 3N2KE 2ZLYA 1WR6A 5L3BB 1T8BA 4NPPA 1ZP0A 4U7YA 2DL1A 5AQMB 4ZI3C 3UU5A 2IUBA 3AVRA 3K8PC 4TNWA 4HFDA 2XQYA 4KHPT 3B5MA 3C50A 2XAJB 3LK42 2YOEA 3N9PA 2WM9A 2VB6A 3IA3A 2WBLA 4EGWA 1N32T 3KINB 3Q5WA 1D1BA 1T7SA 2E9XD 2K48A 1KNPA 1MIYA 2QGSA 3CIRA 2N2NA 2MBGA 4CXYA 4JI0T 4CZZB 3ABVA 2D5UA 4NUUA 1CUNA 4UVCB 2L8KA 4YT0A 4YTMA 1IAPA 2EHOC 2V8SV 5ABHA 2BG9C 5JQGE 3G06A 3LG7A 5LXTE 4CI2B 5BMVE 1XMOT 2BS3A 2VQET 3PV0F 2XTLA 3CKDA 4JLEA 2DLRA 2WY2A 2LEHA 1Z0PA 1D1AA 2WMOA 3FXDB 3ZSTA 3EAMA 4ZI2D 3O9XA 3HKEE 1D0YA 3LDQB 3RLFF 3LBXB 2LJLA 2H3RA 3DP7A 3ZYLA 3L39A 5J2UE 2CHNA 4AQYT 1NENA 2V7LA 2XM1A 4GOUA 1UURA 1X9BA 2C5JA 2W67A 4ZS2A 4DV3T 5ABEA 1R8IA 5DQVA 3CMLA 1N34T 5LYJE 2ACZA 4KMCA 2WMNA 2Y48B 5LOVE 5AQTB 3UFEA 1Y01A 3UU3A 3SFEA 2A2FX 2Z6EA 3AE7A 1YKEB 2IHR1 3FZLB 3PJAJ 2QRXA 3P4WA 4HFCA 4I50E 5FP3A 3ESLA 5LA6E 3VKGA 3HKDE 3NZPA 2CBIA 4IE6A 4LFCT 5AQSB 3V5UA 3PUSA 3AA1B 3SWHA 4ZI7E 2NW7A 2C5KT 4MBQA 2CA5A 5HXCA 2LSIA 4UR9A 2E8IA 4AKLA 5CGMA 3J9X1 5FVKA 1U5PA 4O4LE 4UEMA 3ZEFB 2WWUA 4LF6T 2WP9A 4U2YA 1B7TA 2ZM6T 2B76A 4GYRA 4U33A 4IIJE 5HWXA 2A72A 4GK5E 2DI4A 1FEWA 1YD8G 4PJMA 1E2AA 3Q5XA 4UF0B 4Q25A 4YHJA 1W9RA 4O4JE 2CLYC 4E7ZA 3EI0A 2YINA 5F8PA 3BQIA 4ZEYA 5JDMA 5LHIB 5GONE 2XQ7A 5L3CB 2IDOB 3ZT6A 2BG9E 1N33T 1US7B 2V6YA 4IDNA 3ZC0A 3W15B 4O2AE 1HF8A 1QSDA 4L0RA 4JI1T 4AI6A 3OKQA 2LM2A 2XQ3A 1MMGA 3L3PA 2E5LT 5FY1A 3ZYMA 4DR7T 4OX9T 4HFIA 2B1EA 2AXDS 1SUMB 1SA0E 3HI2A 5H6QB 5LG4A 3OTOT 3N5LA 2ZM8A 3O1IA 3I9WA 4DBQA 4YSZA 2R6GF 4JI3T 5JRCA 4YLHA 1L0VA 2LRLA 2M6BA 1E1HB 3QC9A 1QUUA 1BR4A 4AKRB 1OXZA 3PE0A 3JAEA 4QXCB 5LB7B 4DV6T 4ERRA 3A8YC 4PJLA 3RIUC 5LJNA 4JI7T 4GKJT 5FY0A 1LVKA 2CCQA 4KP3C 4QHOA 1MIWA 2FUPA 1D0XA 2JJ9A 3GA8A 2OA5A 3JAFA 4K0UA 2W0GA 3O1HA 3N9QA 4QH1A 4X1YE 3ZMSB 3OYZA 5LHHB 1MMNA 3AAAB 1IBLT 3RC8A 4AXPA 1O3XA 1UGOA 2WB5A 2X9YA 3AEDA 4U3CA 4YSYA 4JV5T 2J47A 3K3OA 2LSYA 2W63A 2CPTA 3N9LA 2WQYA 5L3EB 4QXBB 2VKJA 2W62A 3AEBA 2VQFT 2X0YA 2I6HA 3WAJA 2Q9QB 2WZHA 2BVMA 3CQGB 4IE0A 5CA1E 1NAFA 3KDSE 4LMLA 2EHOB 5AFUL 5HEHA 3JC6C 5IUXA 1WRDA 2MYSA 2WCAA 3X1DA 5AQPB 3C4WA 3PDYA 2KINB 4HTEA 3RIUA 2YN6A 3RYHE 5JREA 3AEGA 4B6XA 1WLXA 3NVOA 3VHLA 3IHRA 2HHHT 2D0UA 2LKGA 2VKHA 1MMDA 3JCFA 4ADZA 4HWCA 3D0TA 1D0ZA 4MHCA 5HYAA 5DABA 3RQUA 3H37A 4BAYB 1G73A 3AVSA 4YTNA 3PU8A 4F8HA 3T1HT 2W66A 4MLKA 4I0UA 2DNXA 2XQ9A 1UCUA 4IL4A 3ZT5A 3AE8A 4IDQA 4FI5A 4PK6A 2CXFA 3RRWA 5LGNB 4K0KT 3PUQA 5EZYE 4AISA 1ZOYA 5FXZA 3FBLA 3K3QC 3RYCE 4MALA 4DR5T 3M65A 2HPJA 2KT9A 4ZS3A 4IDZA 5BR8T 3FZHB 4EZHA 4YSXA 3KV5A 2LOPA 4JBWF 1XNRT 4HE8A 4P0BA 1IJ5A 3CWZB 3OPCA 2YDRA 3RC3A 5JH7E 3PUAA 4DV4T 1M62A 1E7PA 2H89A 2HH7A 3C64A 5HXHA 1AJ3A 4AKHA 5C2TA 3N9OA 4G63A 5HCJA 1T72A 2C5IT 5JDFA 2K5BB 5LCYA 3ONLC 1WR0A 2XZEA 3UUBA 4EYYR 3EDVA 2IIUA 5LJMA 3QOFA 5LGTB 5L4EA 2I0MA 2ACXA 5M4YA 5LMUT 2UUCT 3AE4A 3ZCJA 2DWGA 2JRKA 3F2EA 2NWBA 4ASKA 4DIDB 1XWMA 5FKYA 2XASB 2X67A 2ODVA 3LSVA 2UXXB 1JNRA 2GK9A 3H3MA 5L3DB 4DR2T 4EYUA 3AECA 4OHFA 3KV4A 3O1JA 5HXEA 2IC9A 4BA9A 3MJXA 5A1LA 5LBQB 1NEKA 3V5SA 5LG3A 2OLTA 2X0HA 3GWHA 2EHOD 2BKOA 2W61A 2X68A 4TWDA 2KXPB 3C4XA 2WDRA 4TN7B 2LHRA 4EEDA 2CMRA 1VCTA 2AE9A 1WYBA 4WBOA 2X51A 3RX6A 2X9XA 4DMWA 2E9XB 1KFYA 4H63V 3ZN1B 4DV5T 4QX8B 3WI3A 3UQ7A 2Q9QD 1OEDE 4EOZB 4P0AA 4EAHA 3LK2B 5IYZE 4CXXA 5L2LA 2SPCA 3AE5A 4ZOLE 4HWIB 2V7JA 5AQLB 2X0LB 3AEAA 3SRZA 2NTXA 2NR4A 1J5ET 3P4SA 5HAXA 2VL0A 3QUJA 3T8OA 4IREA 2RA1A 3SOLA 3ZLIA 5L47A 5L3FB 3QK6A 3E0ZA 3P8CD 3RQWA 3U3IA 5L3GB 2IAKA 2KZ7B 4WBNE 2BDEA 2UXNB 2WDVA 2XAHB 4AKIA 2W00A 1W0BA 3N9NA 2ZM0A 2XSAA 4ANJA 2UXBT 3DTOA 4JI5T 3AE1A 5HEOA 4ZXLA 3OYXA 1YKHB 2C0SA 1ZEEA 2NOXA 4DMVA 4TNVA 4E7SA 1HG2A 3BQLA 3C51A 2CHOA 4O8SA 4LF4T 3NRYA 4HWDA 5AQJB 3RPUA 2CWYA 2CBJA 4NXMT 2KSRA 5JDLA 1UK5A 5IHYA 3B57A 2WZIA 5AQHB 1HR0T 3NBXX 2ES0A 2N1GA 4HFBA 3ZN0B 2LSJA 2MOZA 3HKCE 3RRCA 1IBKT 3CQXC 2XQ8A 4DV2T 5J0ZA 4AKGA 4KX6A 4TWFA 3HA4A 3FBZA 4ISSA 4TZ4C 3R84B 3RGLA 4DVDA 3Q2MA 4DR6T 2XQAA 2D9DA 5CJ5A 2JMHA 2YU1A 2KMFA 5CA0E 5KMGP 3KV9A 5HEJA 4YTPA 3F57A 4TWHA 4UVBB 1XDPA 3R6NA 5FYMA 1N36T 2N9DA 3RYFE 2MTQA 3P4QA 2V5CA 2IC6A 1WYCA 1MMAA 4EXTA 4CI3B 3HR0A 2H7OA 2XAGB 5ADXL 1FIOA 3LK3B 1BR0A 4DR3T 4KUMB 4A56A 4U74A 5LNKA 1YW0A 1IJ6A 4TUYE 2ODUA 2X9WA 2XY8B 3EVYA 5HWYA 1I6ZA 3PUWF 4EEBA 3IBPA 3P50A 5FMNA 3UQ4A 4C90A 2V7IA 3GMIA 3OBVE 2LRKA 4YJ3E 1QLBA 3AE6A 2D2SA 3UU8A 3HKBE 4BJMA 4DV0T 4GYSA 1SE7A 3MACA 3N9MA 4LF8T 5H6RB 1OEDC 2WSSV 3K3NA 3VU7H 5FL1A 1J5WA 3CVRA 4ISTA 3Q5DA 3QB5K 4QWNB 1HNZT 4JI8T 1IBMT 2A3DA 3PURA 2JQKA 4NIQA
chains in the Genus database with same CATH topology
1XMOT 2VQET 4DV4T 4DR1T 4LF9T 4YHHT 4JI2T 4AQYT 4DUZT 4DV3T 2F4VT 5LMUT 2UUCT 1N34T 4B3RT 2UXDT 4DV5T 5IWAT 1I94T 5LMNT 4LFBT 4LF6T 2ZM6T 4B3TT 4X62T 4LF7T 2UXCT 2UU9T 4JYAT 1XMQT 1J5ET 1N33T 4JI1T 1HNXT 2E5LT 4DR7T 4DV7T 4OX9T 1N32T 3OTOT 2UXBT 4JI5T 4JI3T 4LF4T 4LFAT 4DV6T 4DV1T 4DR4T 4GKJT 4NXMT 4X64T 4JI7T 1HR0T 4B3ST 4B3MT 1IBKT 4DV2T 1IBLT 4JI6T 4JV5T 4LF5T 4DR6T 1FJGT 2UUBT 4NXNT 4X65T 2VQFT 4YY3T 1N36T 1XNQT 4DR2T 3T1YT 4X66T 2HHHT 4DR3T 4LFCT 1HNWT 3T1HT 4KHPT 4DV0T 4LF8T 4K0KT 4JI4T 4JI0T 4DUYT 4DR5T 1HNZT 4JI8T 1IBMT 5BR8T 4GKKT 1XNRT 2UUAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO T;  2VQE T;  4DV4 T;  4DR1 T;  4LF9 T;  4YHH T;  4JI2 T;  4AQY T;  4DUZ T;  4DV3 T;  2F4V T;  5LMU T;  2UUC T;  1N34 T;  4B3R T;  2UXD T;  4DV5 T;  5IWA T;  1I94 T;  5LMN T;  4LFB T;  4LF6 T;  2ZM6 T;  4B3T T;  4X62 T;  4LF7 T;  2UXC T;  2UU9 T;  4JYA T;  1XMQ T;  1J5E T;  1N33 T;  4JI1 T;  1HNX T;  2E5L T;  4DR7 T;  4DV7 T;  4OX9 T;  1N32 T;  3OTO T;  2UXB T;  4JI5 T;  4JI3 T;  4LF4 T;  4LFA T;  4DV6 T;  4DV1 T;  4DR4 T;  4GKJ T;  4NXM T;  4X64 T;  4JI7 T;  1HR0 T;  4B3S T;  4B3M T;  1IBK T;  4DV2 T;  1IBL T;  4JI6 T;  4JV5 T;  4LF5 T;  4DR6 T;  1FJG T;  2UUB T;  4NXN T;  4X65 T;  2VQF T;  4YY3 T;  1N36 T;  1XNQ T;  4DR2 T;  3T1Y T;  4X66 T;  2HHH T;  4DR3 T;  4LFC T;  1HNW T;  3T1H T;  4KHP T;  4DV0 T;  4LF8 T;  4K0K T;  4JI4 T;  4JI0 T;  4DUY T;  4DR5 T;  1HNZ T;  4JI8 T;  1IBM T;  5BR8 T;  4GKK T;  1XNR T;  2UUA T; 
#chains in the Genus database with same CATH topology
 5AQF B;  3PUG A;  4QX7 B;  5DJQ C;  2P9B A;  3ANW A;  3ZMV B;  3AE3 A;  4KHZ F;  4WYV A;  4BJN A;  2VVS A;  4DR1 T;  4A98 A;  2CM0 A;  4AQG A;  2J62 A;  4CN1 A;  2L9Q A;  2BZB A;  5CB4 E;  4PJJ A;  3MK7 C;  4YHH T;  4ZI2 C;  2XQ6 A;  2K3W A;  3PJA A;  3P4P A;  3ONX A;  3VR9 A;  3VKH A;  1OED B;  3WAK A;  2WAU A;  1D1C A;  3AXJ B;  5EK3 A;  2KWI B;  2JQ9 A;  2MPK A;  4PAG A;  4HN9 A;  3FHN A;  2LKH A;  2J1D G;  4Z91 A;  3F31 A;  2BG9 B;  4JUY A;  4B3R T;  2UXD T;  2XQ4 A;  4M1P A;  2NW8 A;  2BKN A;  2WDQ A;  2CWO A;  4HKA A;  2LHN A;  2ZMA A;  3M3Z B;  1KF6 A;  3TLV A;  5JDH A;  5LHG B;  4U31 A;  2LOS A;  4GK0 E;  5AQQ B;  3ONJ A;  4UVA B;  2CEA A;  3CX8 B;  3LFM A;  4IHJ E;  1LVF A;  4X20 E;  3UUX B;  2PTF A;  4COF A;  5EK2 A;  5LMN T;  1BR1 A;  4LFB T;  3SS1 A;  3FZF B;  3EUH A;  3MXZ A;  4Z90 A;  1CHU A;  3KVA A;  3TKL B;  3NKZ A;  1UX4 A;  2FJD A;  2V5D A;  1H7C A;  2XHE B;  4QH5 A;  1MND A;  2FJE A;  2M67 A;  3MA9 A;  3H3A A;  4AQF C;  3I9Y A;  4L5G A;  2QA7 A;  4KBM B;  5TAO A;  4TV9 E;  3UUM A;  2UU9 T;  3RH3 A;  2V26 A;  2BBH A;  3EDU A;  3UT5 E;  3VRA A;  1YQ4 A;  1MIV A;  3DJB A;  4U2Z A;  2ZM2 A;  5KX5 E;  2PFV A;  2G0U A;  5J1G A;  5FL0 A;  4CXW A;  3U78 A;  1HNX T;  3I1A A;  4ILU A;  5JTG A;  3Q9D A;  3I0O A;  4J2C A;  4EB6 E;  4OFZ A;  4IL9 A;  4NUV A;  5LP6 E;  2FBW A;  3KBT A;  3AA7 B;  2VK9 A;  2HN1 A;  3KV6 A;  1KEY A;  4XZC A;  4YFS A;  2BS4 A;  3E22 E;  3UTK A;  5JR9 C;  2KWH A;  4IE4 A;  1OED A;  3SFD A;  4H9N C;  2CLY B;  4AQF A;  4WZX A;  2YDS A;  2VL8 A;  4HEA A;  4O4H E;  4IGU A;  1EZ3 A;  3ZJ2 A;  2WU2 A;  3CX7 B;  5HXS A;  3PUZ F;  4HFV A;  5F5W A;  3PUY F;  1BR2 A;  1HG5 A;  5FVL A;  4DV1 T;  5LBM A;  4DR4 T;  4X64 T;  2IW5 B;  4UXN B;  5JVD E;  4X65 T;  4IE5 A;  1XZY A;  2JQH A;  3J7Y q;  4HGA A;  3FB2 A;  4HFE A;  5C3J A;  1XDO A;  3ZJ1 A;  2CXL A;  2QYW A;  5C8Y E;  3JAD A;  2H7V C;  4X1K E;  2E2A A;  4JI6 T;  3NWI A;  1VOM A;  3BQK A;  5LGU B;  1HX1 B;  5FNV E;  3IEE A;  5FXX A;  2NP9 A;  3ZSS A;  5J2T E;  4NXN T;  3NRX A;  4IDP A;  3UUN A;  4IDO A;  5HXR A;  3VRB A;  4H63 H;  4UF0 A;  4A5X A;  4EV6 A;  4YY3 T;  2E9X C;  1XNQ T;  2XAQ B;  2XSB A;  3AB3 B;  1HTJ F;  3GN5 B;  3N2G E;  2Q9Q A;  5L4H A;  2V6Y B;  2E5V A;  3OJA A;  5ABG A;  4CN4 A;  3ZMT B;  2JQQ A;  3UFG A;  4UV9 B;  5JDN A;  1GQE A;  4X1I E;  1X79 A;  1HCI A;  4EIW A;  3C98 B;  2WS3 A;  4ZZC A;  4QKN A;  3GN5 A;  4OK0 A;  1VRB A;  1KK7 A;  2KLQ A;  2XJ7 A;  2YDQ A;  4I55 E;  1FMW A;  3FXE B;  3QNU A;  4P09 A;  3AE9 A;  3PU3 A;  3RF1 A;  3MZK B;  5FXW A;  1G8X A;  1WFD A;  3ZPO A;  5CFB A;  1W09 A;  1HNW T;  4G2A A;  4O4I E;  3BK9 A;  2VVN A;  2HN2 A;  3I0Q A;  3P7I A;  3VR8 A;  1UUS A;  3A5X A;  4PFO A;  2LLY A;  3CX6 B;  2E9X A;  2K24 A;  3LBX A;  3O4X E;  4H9O C;  1W0A A;  2PJQ A;  4ILB A;  4JI4 T;  4XBF B;  4U72 A;  4DUY T;  5F3J A;  1LRZ A;  4OYJ A;  3ZYK A;  5AQU B;  1LKX A;  4YXD A;  2D0T A;  4KI0 F;  3ZMZ B;  4GKK T;  2DHR A;  4EZ4 A;  2VAS A;  3NZQ A;  2UUA T;  2JPF A;  2RPA A;  4IT4 A;  3TLT A;  5JR9 A;  4XAX B;  1FMV A;  4H9P C;  3LJC A;  3N2O A;  2NW9 A;  4LF9 T;  4I43 B;  3RIF A;  2VKO A;  4H9S E;  4IE7 A;  4F6R C;  5KXJ A;  2CE7 A;  4JEU B;  2HPL A;  2X9H A;  4JI2 T;  3KFW X;  3ETU A;  3ZT7 A;  4DBR A;  3A7M A;  4DUZ T;  2F4V T;  2DWK A;  1YQ3 A;  1J1J A;  2VKD A;  2VUR A;  2CRB A;  2YEV C;  2LSG A;  2MAW A;  3OVU A;  4H9Q C;  4MFR A;  3TLS A;  2PBI A;  5AQR B;  3UU4 A;  5HEU A;  5KDM C;  3B13 A;  4Z8X A;  2FJB A;  2H88 A;  4TV8 E;  3EHZ A;  1I94 T;  5HCM A;  2OV9 A;  3ANW B;  3IF8 B;  1YXR A;  4LMJ A;  3ZC1 A;  3PTR B;  2WU5 A;  3RI5 A;  2V6X A;  3RIA A;  1M7K A;  1ZKE A;  2QVA A;  4PNI A;  4B3M T;  1SHZ C;  2JIW A;  5E0O A;  4PW8 A;  2M6I A;  2JMK A;  1HS7 A;  2BKP A;  4AIU A;  3CK6 A;  4DO0 A;  3L09 A;  2BS2 A;  4B3T T;  4QXH B;  1HFA A;  4X5T A;  3KVB A;  2BBJ A;  2LT3 A;  2V7K A;  4X62 T;  2IML A;  4UEL A;  1S35 A;  2W4X A;  3EAB A;  3Q5E A;  4V1A v;  4ZHQ E;  5FXV A;  5EK4 A;  2Q9Q C;  3RYI E;  4LF7 T;  3AEF A;  3P4R A;  4ILC A;  5AQI B;  3FZK B;  2UXC T;  4JYA T;  5AQO B;  1HX8 A;  1UX5 A;  4I4T E;  1XMQ T;  4C91 A;  4GIW A;  3K1S A;  4JEH B;  3ZMU B;  2XUE A;  3UU6 A;  4L9I A;  1OWA A;  3AXJ A;  4YJ2 E;  2XM2 A;  1KNR A;  3UUL A;  4A97 A;  2EHO A;  4DND A;  1DU2 A;  2BG9 A;  5DQW A;  5ABF B;  4DV7 T;  4PJN A;  4B3S T;  4WNK A;  2LE8 A;  3C4Z A;  3CQC B;  3QB5 A;  4TX5 A;  5JDQ A;  2BVL A;  3AA0 B;  4OYK A;  4WW0 A;  2NTY A;  2LM9 A;  2XQ5 A;  2Y6X A;  2YKS A;  5AQV B;  5FY7 A;  3ZKR A;  2YK0 A;  2FJA A;  2UUB T;  1IZN B;  5ETW A;  1U4Q A;  3RKG A;  1T98 A;  2XPK A;  4CN6 A;  2V7M A;  4HWH A;  4LFA T;  4UV8 B;  5AQG B;  3T1Y T;  2VWA A;  1S94 A;  3PUV F;  4ILA A;  3AA6 B;  3E08 A;  5IWA T;  4U7I A;  1ZHC A;  2Y8D A;  4O2B E;  3MKD A;  4ZZB A;  3KBU A;  5AQN B;  2RP4 A;  3AAI A;  3RKO A;  4CQI A;  3S4U A;  3TLU A;  3FZM B;  4UIG A;  3TLW A;  3ZCI A;  4FJO A;  1JNZ A;  1V9D A;  4H9R C;  4CI1 B;  4ZI3 D;  1VCS A;  4LF5 T;  3AAE B;  4P1N A;  3RHW A;  1ZV4 X;  2K9A A;  1FJG T;  4PK4 A;  2I59 A;  5AQK B;  2DCF A;  1Y64 B;  3AE2 A;  5HEG A;  5JRC B;  1KNZ A;  4HWF A;  4QH4 A;  2J4G A;  3L8R A;  5JR9 B;  3JC6 D;  2W2U A;  3AEE A;  4LMK A;  2LSK A;  5JDG A;  1NWM X;  2L3L A;  2KND A;  2PG8 A;  3CPZ A;  1WCR A;  2V1D B;  2X66 A;  3ETV A;  4HFH A;  1Z8U A;  3PUX F;  4X66 T;  3HL6 A;  1MNE A;  2YU2 A;  2A9U A;  2WWV A;  4PFP A;  4PK5 A;  2XAF B;  4N78 D;  5ABF A;  2CXD A;  3N2K E;  2ZLY A;  1WR6 A;  5L3B B;  1T8B A;  4NPP A;  1ZP0 A;  4U7Y A;  2DL1 A;  5AQM B;  4ZI3 C;  3UU5 A;  2IUB A;  3AVR A;  3K8P C;  4TNW A;  4HFD A;  2XQY A;  4KHP T;  3B5M A;  3C50 A;  2XAJ B;  3LK4 2;  2YOE A;  3N9P A;  2WM9 A;  2VB6 A;  3IA3 A;  2WBL A;  4EGW A;  1N32 T;  3KIN B;  3Q5W A;  1D1B A;  1T7S A;  2E9X D;  2K48 A;  1KNP A;  1MIY A;  2QGS A;  3CIR A;  2N2N A;  2MBG A;  4CXY A;  4JI0 T;  4CZZ B;  3ABV A;  2D5U A;  4NUU A;  1CUN A;  4UVC B;  2L8K A;  4YT0 A;  4YTM A;  1IAP A;  2EHO C;  2V8S V;  5ABH A;  2BG9 C;  5JQG E;  3G06 A;  3LG7 A;  5LXT E;  4CI2 B;  5BMV E;  1XMO T;  2BS3 A;  2VQE T;  3PV0 F;  2XTL A;  3CKD A;  4JLE A;  2DLR A;  2WY2 A;  2LEH A;  1Z0P A;  1D1A A;  2WMO A;  3FXD B;  3ZST A;  3EAM A;  4ZI2 D;  3O9X A;  3HKE E;  1D0Y A;  3LDQ B;  3RLF F;  3LBX B;  2LJL A;  2H3R A;  3DP7 A;  3ZYL A;  3L39 A;  5J2U E;  2CHN A;  4AQY T;  1NEN A;  2V7L A;  2XM1 A;  4GOU A;  1UUR A;  1X9B A;  2C5J A;  2W67 A;  4ZS2 A;  4DV3 T;  5ABE A;  1R8I A;  5DQV A;  3CML A;  1N34 T;  5LYJ E;  2ACZ A;  4KMC A;  2WMN A;  2Y48 B;  5LOV E;  5AQT B;  3UFE A;  1Y01 A;  3UU3 A;  3SFE A;  2A2F X;  2Z6E A;  3AE7 A;  1YKE B;  2IHR 1;  3FZL B;  3PJA J;  2QRX A;  3P4W A;  4HFC A;  4I50 E;  5FP3 A;  3ESL A;  5LA6 E;  3VKG A;  3HKD E;  3NZP A;  2CBI A;  4IE6 A;  4LFC T;  5AQS B;  3V5U A;  3PUS A;  3AA1 B;  3SWH A;  4ZI7 E;  2NW7 A;  2C5K T;  4MBQ A;  2CA5 A;  5HXC A;  2LSI A;  4UR9 A;  2E8I A;  4AKL A;  5CGM A;  3J9X 1;  5FVK A;  1U5P A;  4O4L E;  4UEM A;  3ZEF B;  2WWU A;  4LF6 T;  2WP9 A;  4U2Y A;  1B7T A;  2ZM6 T;  2B76 A;  4GYR A;  4U33 A;  4IIJ E;  5HWX A;  2A72 A;  4GK5 E;  2DI4 A;  1FEW A;  1YD8 G;  4PJM A;  1E2A A;  3Q5X A;  4UF0 B;  4Q25 A;  4YHJ A;  1W9R A;  4O4J E;  2CLY C;  4E7Z A;  3EI0 A;  2YIN A;  5F8P A;  3BQI A;  4ZEY A;  5JDM A;  5LHI B;  5GON E;  2XQ7 A;  5L3C B;  2IDO B;  3ZT6 A;  2BG9 E;  1N33 T;  1US7 B;  2V6Y A;  4IDN A;  3ZC0 A;  3W15 B;  4O2A E;  1HF8 A;  1QSD A;  4L0R A;  4JI1 T;  4AI6 A;  3OKQ A;  2LM2 A;  2XQ3 A;  1MMG A;  3L3P A;  2E5L T;  5FY1 A;  3ZYM A;  4DR7 T;  4OX9 T;  4HFI A;  2B1E A;  2AXD S;  1SUM B;  1SA0 E;  3HI2 A;  5H6Q B;  5LG4 A;  3OTO T;  3N5L A;  2ZM8 A;  3O1I A;  3I9W A;  4DBQ A;  4YSZ A;  2R6G F;  4JI3 T;  5JRC A;  4YLH A;  1L0V A;  2LRL A;  2M6B A;  1E1H B;  3QC9 A;  1QUU A;  1BR4 A;  4AKR B;  1OXZ A;  3PE0 A;  3JAE A;  4QXC B;  5LB7 B;  4DV6 T;  4ERR A;  3A8Y C;  4PJL A;  3RIU C;  5LJN A;  4JI7 T;  4GKJ T;  5FY0 A;  1LVK A;  2CCQ A;  4KP3 C;  4QHO A;  1MIW A;  2FUP A;  1D0X A;  2JJ9 A;  3GA8 A;  2OA5 A;  3JAF A;  4K0U A;  2W0G A;  3O1H A;  3N9Q A;  4QH1 A;  4X1Y E;  3ZMS B;  3OYZ A;  5LHH B;  1MMN A;  3AAA B;  1IBL T;  3RC8 A;  4AXP A;  1O3X A;  1UGO A;  2WB5 A;  2X9Y A;  3AED A;  4U3C A;  4YSY A;  4JV5 T;  2J47 A;  3K3O A;  2LSY A;  2W63 A;  2CPT A;  3N9L A;  2WQY A;  5L3E B;  4QXB B;  2VKJ A;  2W62 A;  3AEB A;  2VQF T;  2X0Y A;  2I6H A;  3WAJ A;  2Q9Q B;  2WZH A;  2BVM A;  3CQG B;  4IE0 A;  5CA1 E;  1NAF A;  3KDS E;  4LML A;  2EHO B;  5AFU L;  5HEH A;  3JC6 C;  5IUX A;  1WRD A;  2MYS A;  2WCA A;  3X1D A;  5AQP B;  3C4W A;  3PDY A;  2KIN B;  4HTE A;  3RIU A;  2YN6 A;  3RYH E;  5JRE A;  3AEG A;  4B6X A;  1WLX A;  3NVO A;  3VHL A;  3IHR A;  2HHH T;  2D0U A;  2LKG A;  2VKH A;  1MMD A;  3JCF A;  4ADZ A;  4HWC A;  3D0T A;  1D0Z A;  4MHC A;  5HYA A;  5DAB A;  3RQU A;  3H37 A;  4BAY B;  1G73 A;  3AVS A;  4YTN A;  3PU8 A;  4F8H A;  3T1H T;  2W66 A;  4MLK A;  4I0U A;  2DNX A;  2XQ9 A;  1UCU A;  4IL4 A;  3ZT5 A;  3AE8 A;  4IDQ A;  4FI5 A;  4PK6 A;  2CXF A;  3RRW A;  5LGN B;  4K0K T;  3PUQ A;  5EZY E;  4AIS A;  1ZOY A;  5FXZ A;  3FBL A;  3K3Q C;  3RYC E;  4MAL A;  4DR5 T;  3M65 A;  2HPJ A;  2KT9 A;  4ZS3 A;  4IDZ A;  5BR8 T;  3FZH B;  4EZH A;  4YSX A;  3KV5 A;  2LOP A;  4JBW F;  1XNR T;  4HE8 A;  4P0B A;  1IJ5 A;  3CWZ B;  3OPC A;  2YDR A;  3RC3 A;  5JH7 E;  3PUA A;  4DV4 T;  1M62 A;  1E7P A;  2H89 A;  2HH7 A;  3C64 A;  5HXH A;  1AJ3 A;  4AKH A;  5C2T A;  3N9O A;  4G63 A;  5HCJ A;  1T72 A;  2C5I T;  5JDF A;  2K5B B;  5LCY A;  3ONL C;  1WR0 A;  2XZE A;  3UUB A;  4EYY R;  3EDV A;  2IIU A;  5LJM A;  3QOF A;  5LGT B;  5L4E A;  2I0M A;  2ACX A;  5M4Y A;  5LMU T;  2UUC T;  3AE4 A;  3ZCJ A;  2DWG A;  2JRK A;  3F2E A;  2NWB A;  4ASK A;  4DID B;  1XWM A;  5FKY A;  2XAS B;  2X67 A;  2ODV A;  3LSV A;  2UXX B;  1JNR A;  2GK9 A;  3H3M A;  5L3D B;  4DR2 T;  4EYU A;  3AEC A;  4OHF A;  3KV4 A;  3O1J A;  5HXE A;  2IC9 A;  4BA9 A;  3MJX A;  5A1L A;  5LBQ B;  1NEK A;  3V5S A;  5LG3 A;  2OLT A;  2X0H A;  3GWH A;  2EHO D;  2BKO A;  2W61 A;  2X68 A;  4TWD A;  2KXP B;  3C4X A;  2WDR A;  4TN7 B;  2LHR A;  4EED A;  2CMR A;  1VCT A;  2AE9 A;  1WYB A;  4WBO A;  2X51 A;  3RX6 A;  2X9X A;  4DMW A;  2E9X B;  1KFY A;  4H63 V;  3ZN1 B;  4DV5 T;  4QX8 B;  3WI3 A;  3UQ7 A;  2Q9Q D;  1OED E;  4EOZ B;  4P0A A;  4EAH A;  3LK2 B;  5IYZ E;  4CXX A;  5L2L A;  2SPC A;  3AE5 A;  4ZOL E;  4HWI B;  2V7J A;  5AQL B;  2X0L B;  3AEA A;  3SRZ A;  2NTX A;  2NR4 A;  1J5E T;  3P4S A;  5HAX A;  2VL0 A;  3QUJ A;  3T8O A;  4IRE A;  2RA1 A;  3SOL A;  3ZLI A;  5L47 A;  5L3F B;  3QK6 A;  3E0Z A;  3P8C D;  3RQW A;  3U3I A;  5L3G B;  2IAK A;  2KZ7 B;  4WBN E;  2BDE A;  2UXN B;  2WDV A;  2XAH B;  4AKI A;  2W00 A;  1W0B A;  3N9N A;  2ZM0 A;  2XSA A;  4ANJ A;  2UXB T;  3DTO A;  4JI5 T;  3AE1 A;  5HEO A;  4ZXL A;  3OYX A;  1YKH B;  2C0S A;  1ZEE A;  2NOX A;  4DMV A;  4TNV A;  4E7S A;  1HG2 A;  3BQL A;  3C51 A;  2CHO A;  4O8S A;  4LF4 T;  3NRY A;  4HWD A;  5AQJ B;  3RPU A;  2CWY A;  2CBJ A;  4NXM T;  2KSR A;  5JDL A;  1UK5 A;  5IHY A;  3B57 A;  2WZI A;  5AQH B;  1HR0 T;  3NBX X;  2ES0 A;  2N1G A;  4HFB A;  3ZN0 B;  2LSJ A;  2MOZ A;  3HKC E;  3RRC A;  1IBK T;  3CQX C;  2XQ8 A;  4DV2 T;  5J0Z A;  4AKG A;  4KX6 A;  4TWF A;  3HA4 A;  3FBZ A;  4ISS A;  4TZ4 C;  3R84 B;  3RGL A;  4DVD A;  3Q2M A;  4DR6 T;  2XQA A;  2D9D A;  5CJ5 A;  2JMH A;  2YU1 A;  2KMF A;  5CA0 E;  5KMG P;  3KV9 A;  5HEJ A;  4YTP A;  3F57 A;  4TWH A;  4UVB B;  1XDP A;  3R6N A;  5FYM A;  1N36 T;  2N9D A;  3RYF E;  2MTQ A;  3P4Q A;  2V5C A;  2IC6 A;  1WYC A;  1MMA A;  4EXT A;  4CI3 B;  3HR0 A;  2H7O A;  2XAG B;  5ADX L;  1FIO A;  3LK3 B;  1BR0 A;  4DR3 T;  4KUM B;  4A56 A;  4U74 A;  5LNK A;  1YW0 A;  1IJ6 A;  4TUY E;  2ODU A;  2X9W A;  2XY8 B;  3EVY A;  5HWY A;  1I6Z A;  3PUW F;  4EEB A;  3IBP A;  3P50 A;  5FMN A;  3UQ4 A;  4C90 A;  2V7I A;  3GMI A;  3OBV E;  2LRK A;  4YJ3 E;  1QLB A;  3AE6 A;  2D2S A;  3UU8 A;  3HKB E;  4BJM A;  4DV0 T;  4GYS A;  1SE7 A;  3MAC A;  3N9M A;  4LF8 T;  5H6R B;  1OED C;  2WSS V;  3K3N A;  3VU7 H;  5FL1 A;  1J5W A;  3CVR A;  4IST A;  3Q5D A;  3QB5 K;  4QWN B;  1HNZ T;  4JI8 T;  1IBM T;  2A3D A;  3PUR A;  2JQK A;  4NIQ A; 
#chains in the Genus database with same CATH homology
 1XMO T;  2VQE T;  4DV4 T;  4DR1 T;  4LF9 T;  4YHH T;  4JI2 T;  4AQY T;  4DUZ T;  4DV3 T;  2F4V T;  5LMU T;  2UUC T;  1N34 T;  4B3R T;  2UXD T;  4DV5 T;  5IWA T;  1I94 T;  5LMN T;  4LFB T;  4LF6 T;  2ZM6 T;  4B3T T;  4X62 T;  4LF7 T;  2UXC T;  2UU9 T;  4JYA T;  1XMQ T;  1J5E T;  1N33 T;  4JI1 T;  1HNX T;  2E5L T;  4DR7 T;  4DV7 T;  4OX9 T;  1N32 T;  3OTO T;  2UXB T;  4JI5 T;  4JI3 T;  4LF4 T;  4LFA T;  4DV6 T;  4DV1 T;  4DR4 T;  4GKJ T;  4NXM T;  4X64 T;  4JI7 T;  1HR0 T;  4B3S T;  4B3M T;  1IBK T;  4DV2 T;  1IBL T;  4JI6 T;  4JV5 T;  4LF5 T;  4DR6 T;  1FJG T;  2UUB T;  4NXN T;  4X65 T;  2VQF T;  4YY3 T;  1N36 T;  1XNQ T;  4DR2 T;  3T1Y T;  4X66 T;  2HHH T;  4DR3 T;  4LFC T;  1HNW T;  3T1H T;  4KHP T;  4DV0 T;  4LF8 T;  4K0K T;  4JI4 T;  4JI0 T;  4DUY T;  4DR5 T;  1HNZ T;  4JI8 T;  1IBM T;  5BR8 T;  4GKK T;  1XNR T;  2UUA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...