4DR4T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr4T00
5LMUT 3T1YT 4B3ST 3T1HT 4JI1T 4DV2T 4JI7T 2UXDT 4KHPT 4JI3T 4JI8T 4YHHT 4X64T 4X66T 4DV4T 1HNWT 1N33T 1XMQT 1HNZT 4LFCT 1HNXT 4DR4T 4NXNT 4GKKT 2ZM6T 4B3TT 4X65T 4DR3T 2HHHT 4NXMT 4DV5T 4GKJT 4K0KT 2UXCT 1XMOT 2UU9T 4B3RT 4LFAT 1N34T 1FJGT 2UUCT 4LFBT 1J5ET 4JI6T 1XNQT 4LF9T 2F4VT 4LF8T 4DV3T 5BR8T 1I94T 4DUZT 4X62T 1N32T 4B3MT 2E5LT 4JI2T 4DUYT 1IBKT 1HR0T 1N36T 4DV7T 4JV5T 4DR6T 4DV6T 4DV0T 2UXBT 5IWAT 1IBLT 4LF7T 1IBMT 4DR7T 2VQFT 4YY3T 4LF5T 5LMNT 4DR5T 4LF4T 3OTOT 2UUBT 4DV1T 4JI5T 4LF6T 4JYAT 2UUAT 4DR2T 4JI4T 4AQYT 4OX9T 4DR1T 1XNRT 4JI0T 2VQET
chains in the Genus database with same CATH superfamily
1G73A 2GK9A 1T8BA 1UX4A 2W67A 2QVAA 3A7MA 2XAGB 3S4UA 5FXZA 4Q25A 2CEAA 3Q5XA 4KBMB 4KMCA 4I50E 3N9QA 3UU5A 3KBUA 4O2BE 5C2TA 1T72A 4K0UA 1VCSA 4GK0E 3EI0A 4ZI2D 2JQQA 3UUBA 3L8RA 4AXPA 4K0KT 2CRBA 4KX6A 3QB5K 3GN5B 4YXDA 1BR4A 4LF9T 2H88A 2I59A 3AE6A 4JUYA 1HR0T 4DV7T 5FXXA 3ZYMA 2IMLA 3NVOA 5KX5E 1KNPA 2JMKA 4H63V 3LK42 3IF8B 5IUXA 2L9QA 2CHOA 3C64A 4ZEYA 4JI0T 2E9XB 4J2CA 2BG9E 2QA7A 4IT4A 2XPKA 2K9AA 2X67A 2KWIB 2LJLA 4PJLA 3ZPOA 3KBTA 4COFA 2LSJA 5AQUB 2HN1A 2DL1A 4ZOLE 1JNRA 5AQHB 4F8HA 1WYCA 2E2AA 4LFCT 2VL8A 5J2TE 1W09A 4TWDA 2KNDA 4EV6A 2VL0A 3RYFE 5F5WA 1W9RA 4DV5T 3Q9DA 2UU9T 3J7Yq 3ZYLA 2LE8A 5LHHB 1WRDA 1I94T 3OJAA 3FZMB 2YEVC 1D0YA 1MIVA 3MK7C 4DV6T 3EHZA 2D0TA 5CFBA 2WM9A 2BBJA 3A8YC 2ZM8A 2HPLA 4C91A 3PE0A 2DWGA 3N2OA 3P4QA 3HKCE 4A98A 1YXRA 2C5KT 2DLRA 3VR9A 4PJMA 3JADA 4QH1A 3O9XA 3F2EA 1XNRT 2K48A 3MACA 4MLKA 2H3RA 1KF6A 4B3ST 5JDFA 3UUMA 4NPPA 4JI1T 5LB7B 4UELA 2V7MA 4HFEA 4O2AE 3AEBA 2QGSA 2W0GA 2X0LB 3N9OA 3F31A 4GYRA 2KZ7B 2FJBA 3RIAA 2CWOA 3UU4A 1US7B 1LKXA 5EZYE 3BK9A 3P4PA 4LFAT 2WWUA 3KINB 5AQKB 4U72A 5LCYA 3P4SA 5H6QB 3MXZA 3RRWA 3I9YA 5FKYA 1LRZA 2XUEA 4HWCA 1Z8UA 3LSVA 4CXYA 1SUMB 2MAWA 2XM1A 4ZZBA 4ASKA 5F3JA 4H9NC 3ZN0B 2X0HA 3AA1B 2R6GF 3FZKB 4A56A 5CA0E 4HWDA 3UFEA 2Z6EA 2B1EA 5LMNT 5EK3A 2DWKA 5F8PA 2DCFA 3UULA 1ZKEA 3PDYA 4JI4T 3AAEB 5AQTB 1KNRA 3AB3B 2W00A 1W0BA 1OXZA 4EIWA 2XQ5A 5DQVA 4HFHA 4GOUA 4ZXLA 3LG7A 2V6XA 4JI3T 4XAXB 4L5GA 4P0AA 1U5PA 2NW9A 5KMGP 1HX8A 5JDHA 1S35A 5AQJB 1WFDA 3KVAA 5ABFA 5FYMA 2CE7A 4UXNB 3QK6A 3N2GE 2A72A 1FMVA 4PK5A 3RIUA 2PG8A 2BDEA 2IIUA 5ADXL 3KVBA 4GKJT 4UEMA 4EGWA 4QWNB 4MALA 1FJGT 1WR0A 2WDQA 2PJQA 5FY1A 2WAUA 2VURA 3N9LA 2DHRA 5JDMA 3EABA 3SRZA 4QH5A 1JNZA 4YTMA 1MIWA 3ABVA 3K3NA 4LF5T 1WR6A 1NWMX 3OTOT 3AVSA 3P4RA 3RF1A 3Q2MA 1BR2A 4HWIB 2I6HA 3V5UA 4LF6T 3UTKA 1T98A 4E7SA 3TLSA 3N5LA 5HYAA 4JLEA 2ZM2A 1NAFA 4WBNE 2XAQB 1X9BA 4IGUA 3CVRA 2LSIA 5JREA 2XTLA 2WQYA 3K8PC 3L3PA 2XJ7A 3HL6A 1B7TA 3WAJA 4DV4T 1Y01A 2BVMA 3CX8B 4HFDA 2NOXA 4WNKA 3RKOA 3SOLA 3AA6B 4PFPA 2UXNB 1HCIA 4HKAA 4DR4T 4LMKA 1Y64B 3BQKA 4B3TT 3RX6A 2K24A 2VWAA 2XQ7A 3OBVE 4NXMT 2Y8DA 4G2AA 3UQ7A 3VRAA 3UUNA 2A2FX 2VK9A 4IDOA 1UX5A 2WBLA 3DTOA 2UUCT 5JQGE 2BS4A 1D1AA 4AKHA 5HEOA 3K3OA 1IBKT 4KI0F 4A97A 3QB5A 4UIGA 4JV5T 3LK3B 4PFOA 5DABA 4TV8E 3ZT6A 2MYSA 1E1HB 4XBFB 3VKGA 4QXHB 3ZCJA 1UCUA 4KUMB 3OKQA 3RIFA 5DJQC 3HKDE 3NWIA 2JQKA 2E9XA 3ETVA 3PU3A 2RA1A 5LMUT 2YDSA 1KK7A 3P50A 3RC8A 2J47A 3EDUA 2XQ9A 4OHFA 3UU3A 3IA3A 4BAYB 4DV2T 3PV0F 3AAAB 5LOVE 2B76A 2IC6A 1WCRA 4DMWA 2VVNA 3ANWB 2X0YA 1MMNA 1IJ5A 4U7IA 2CXDA 2XSBA 3CKDA 3PUAA 5ABHA 5KDMC 4IDZA 3CX6B 1IAPA 2WSSV 4DR3T 1CUNA 3AE8A 5IHYA 3NRXA 3AXJA 4PK6A 5L3EB 2I0MA 2XQ8A 1HS7A 3RPUA 4IE6A 2WP9A 4B3MT 3E22E 2WB5A 3I9WA 2A9UA 4ILUA 2X9WA 3AEAA 5JTGA 4EYUA 2H89A 3AE9A 2M6IA 3TKLB 5LHIB 2E9XD 2KT9A 2Y6XA 5FVKA 4LF7T 1V9DA 1ZP0A 2X9YA 4IDPA 4AISA 1U4QA 3O1HA 4MBQA 3CIRA 4FJOA 2WU2A 2LHNA 2BZBA 5LBQB 5JDQA 5LGUB 3LDQB 2EHOC 3PUQA 4EEBA 5LGNB 4Z90A 3Q5WA 3NKZA 2XSAA 3ZT7A 2N9DA 4I43B 5AFUL 2W63A 2EHOA 2VKDA 3NBXX 3M3ZB 2XASB 1IJ6A 4KP3C 3VR8A 3H37A 3UUXB 5FNVE 3RHWA 1SHZC 4ILCA 4G63A 1WLXA 5HWXA 2ZM6T 2X9XA 2V5DA 3SS1A 2BBHA 2V7KA 2ZLYA 5TAOA 2KINB 4BJNA 3F57A 4ISTA 2ZM0A 4NUUA 4AQGA 4CXWA 2YN6A 3FZHB 4LMLA 4QXCB 4EEDA 3N9PA 4O4JE 1UGOA 4X5TA 4WZXA 5AQRB 5CJ5A 2KSRA 4HFCA 5AQMB 3ZKRA 3Q5DA 3U78A 2E5LT 3ZSTA 2LRLA 2CM0A 5M4YA 3TLUA 2Y48B 2BVLA 5AQLB 5HAXA 3UFGA 2L3LA 5L3GB 4IE7A 5AQPB 3AXJB 4X1KE 2EHOD 4DR5T 5JR9C 3KDSE 4DV1T 4CI1B 2AXDS 5AQQB 2YK0A 1OEDC 5EK4A 3PUSA 3QC9A 4HN9A 5JR9A 3H3MA 1YD8G 4IDNA 2BS2A 2CPTA 4TV9E 3ZJ1A 1N33T 4PK4A 3FXDB 2W4XA 3KV6A 2WWVA 2LLYA 5ABEA 1XDOA 2JQHA 3RH3A 2MBGA 3UU8A 3AEGA 5HCJA 2VASA 5CB4E 3OYXA 2BKOA 2EHOB 2LM9A 2WZHA 3JC6C 3ZJ2A 1W0AA 4JI6T 2WU5A 2YKSA 4HFBA 4U7YA 3B13A 1BR0A 5AQGB 4OFZA 2XAJB 1D0ZA 4HWFA 1YW0A 4ERRA 4DIDB 3J9X1 5FL0A 3AE1A 2P9BA 5LNKA 4ANJA 5HEUA 4CN1A 3RYIE 4CQIA 3AE2A 2XY8B 4QXBB 2UXXB 4A5XA 3GA8A 1L0VA 1O3XA 2L8KA 5HXSA 1EZ3A 3TLTA 3RI5A 3NRYA 2LSYA 2JQ9A 1M62A 2E5VA 2QRXA 4JI7T 2YU2A 1D1CA 5LP6E 4FI5A 4IE4A 3C4ZA 5L47A 1FMWA 3OPCA 3DP7A 3QOFA 4JEHB 5JR9B 1R8IA 2WZIA 3L09A 5ABGA 5CA1E 1OEDB 2AE9A 2VKHA 4P09A 5C3JA 2Q9QC 2WCAA 5FP3A 4Z8XA 4BA9A 1N34T 2HPJA 3O1IA 2JPFA 2N1GA 3FB2A 3ZYKA 2IW5B 3ZN1B 2Q9QA 4YSYA 4P0BA 2IAKA 1N32T 1VCTA 5LHGB 5FXWA 1GQEA 3I1AA 3FBZA 4L9IA 2MOZA 4OYJA 2D5UA 3CK6A 1IBLT 3UQ4A 2LM2A 1D0XA 4O4HE 2NW8A 4PNIA 2YDRA 4U2YA 3ONXA 4O4LE 4HE8A 2A3DA 3ZLIA 2C5IT 4IE0A 2UUAT 1WYBA 4AI6A 2XQAA 4LMJA 5LXTE 1XDPA 4TZ4C 4U2ZA 5L4HA 4QHOA 2PFVA 5HXRA 1CHUA 3HKEE 5JVDE 1UK5A 2UXDT 4TWHA 4ZI3C 4H9RC 4UVAB 5AQVB 4U33A 4WYVA 4X66T 1HNWT 1QLBA 2WY2A 4JBWF 2J1DG 3ANWA 5DQWA 4EXTA 2V8SV 5LYJE 4WW0A 5L3BB 4UV8B 2KWHA 2Q9QD 2H7VC 3FZLB 4EAHA 3A5XA 4DBQA 5HCMA 4DNDA 2V7IA 3FZFB 1XMOT 2NR4A 3EAMA 2V1DB 3RGLA 5J0ZA 5AQNB 1XNQT 5AQSB 5BR8T 3VKHA 3P7IA 5L3DB 3RQUA 3AA7B 4IHJE 2VKJA 4U31A 1M7KA 2V6YB 1BR1A 4TNVA 4KHZF 4MFRA 2X9HA 1XZYA 3ONJA 3E0ZA 3LFMA 3ZEFB 3PUYF 2VQFT 4YT0A 2NWBA 2Q9QB 3AEDA 2RP4A 4JI5T 1YQ4A 2LHRA 3R6NA 4AQYT 4AQFC 4ZI7E 3SFDA 3ONLC 3T1YT 4IE5A 3HKBE 2SPCA 1LVKA 2CHNA 4YTPA 2CLYC 4JI8T 4YLHA 1XMQT 4YSZA 5AQOB 3N2KE 4ZI2C 5LJMA 4PW8A 4AKGA 1HNXT 2DNXA 3CPZA 4X1YE 4EOZB 1ZOYA 4UV9B 2YINA 4U3CA 2W62A 5L2LA 3JCFA 4QH4A 2PTFA 4B3RT 5LA6E 2YU1A 3QUJA 3NZQA 3AE4A 2J4GA 3WI3A 4EZHA 3FBLA 4P1NA 1SA0E 4CN4A 3PJAA 3PJAJ 2XQ6A 3ZMSB 4HFIA 1MNEA 3SFEA 4DR7T 5LG3A 3R84B 5AQFB 3V5SA 4N78D 2W2UA 2IC9A 1X79A 1FEWA 2UUBT 2YOEA 3KV9A 2W61A 1UURA 4DR2T 1MMGA 3PU8A 1HG2A 5FVLA 4ISSA 2VQET 4X1IE 2ODUA 2XZEA 3JAEA 4DO0A 2XM2A 2FUPA 1KNZA 4TUYE 4B6XA 5FY0A 2E8IA 4ILBA 1D1BA 3I0QA 2WDVA 4YSXA 4HEAA 2FJEA 2LOSA 3RC3A 2JRKA 5HXCA 4X20E 4IL9A 3RKGA 4GKKT 4NIQA 3W15B 1MNDA 1OEDE 4X65T 4TWFA 3BQIA 3P8CD 5ETWA 3EDVA 1ZHCA 3MZKB 5JDNA 3ZMZB 3CQXC 1J5ET 2FJDA 3VU7H 4AKRB 3EVYA 4C90A 3VHLA 2HN2A 2CA5A 2LT3A 4BJMA 2CLYB 3UU6A 4CZZB 4CI2B 3FXEB 1ZV4X 5BMVE 2NP9A 4H9PC 3LBXB 1HG5A 2UXBT 3IHRA 3C4WA 4EB6E 2VB6A 4ADZA 3N9MA 4I4TE 3K1SA 3GMIA 2X68A 3P4WA 2NTYA 2PBIA 2CCQA 4YY3T 2CBIA 2CBJA 4OK0A 5C8YE 4V1Av 5JRCB 2XQ3A 5LBMA 1HX1B 4OX9T 2LKHA 3LJCA 2X66A 3N9NA 2BS3A 1XWMA 3MKDA 3HR0A 4OYKA 1MMAA 2FJAA 4MHCA 2NW7A 1HFAA 4KHPT 4YHHT 1J1JA 2JMHA 5FY7A 1NENA 1HNZT 4O4IE 4IIJE 2LSKA 2BKPA 3ZC0A 2K3WA 3QNUA 4WBOA 5KXJA 2YDQA 4NXNT 3PTRB 3NZPA 5HEGA 1OEDA 3ZCIA 1VOMA 2H7OA 2HHHT 4DVDA 3MA9A 2HH7A 2M67A 1NEKA 4LFBT 4LF8T 5JDLA 3PUVF 2XHEB 3RYCE 4O8SA 2BG9C 3PUZF 4DUZT 4GYSA 4JI2T 2CMRA 2CWYA 2D0UA 1YKEB 1AJ3A 4ZZCA 5JDGA 4UVBB 2BG9A 3K3QC 3TLWA 1HTJF 5LJNA 4Z91A 4AKIA 5A1LA 5E0OA 4LF4T 3PUGA 2D9DA 3KV5A 4GIWA 1J5WA 1E7PA 4YHJA 1IZNB 4DR1T 1FIOA 4ZS3A 3PUWF 3DJBA 4HGAA 5HXEA 4EZ4A 4UF0A 3WAKA 3C51A 2WDRA 4X64T 4H9OC 2LRKA 4IREA 3KFWX 2V7LA 4HWHA 4YJ3E 2M6BA 3ZSSA 3HA4A 3HI2A 2OA5A 3SWHA 1UUSA 2WS3A 3GWHA 3FHNA 4YJ2E 2UXCT 4IL4A 4PJNA 2W66A 3AE5A 2V5CA 4DV3T 5FXVA 3T8OA 3JC6D 4QKNA 2ES0A 3PURA 2N2NA 3IBPA 1YKHB 2LSGA 3LK2B 2V6YA 4DUYT 1Z0PA 4QX8B 2X51A 3VRBA 5FL1A 3AAIA 1QSDA 3OVUA 3M65A 4DMVA 2MPKA 1IBMT 3RQWA 3C50A 2ACZA 5CGMA 3B57A 4CN6A 2V7JA 3ZC1A 5HXHA 1ZEEA 4DBRA 2ZMAA 4TN7B 5J1GA 2XQYA 3RIUC 2OLTA 3C98B 2ODVA 2J62A 1VRBA 3ZT5A 4I0UA 2BG9B 3AECA 5L3FB 3EUHA 4ZHQE 4H9QC 3BQLA 2C5JA 2OV9A 4EYYR 1E2AA 1MIYA 3G06A 3MJXA 3O1JA 4QX7B 2FBWA 3ESLA 2XAFB 4HTEA 3KV4A 1LVFA 4ZS2A 4UF0B 2JJ9A 3ZMUB 1OWAA 3TLVA 2BKNA 4HFVA 4XZCA 3AE3A 4PAGA 2F4VT 2CXFA 4F6RC 5FMNA 2K5BB 1KEYA 4X62T 2LOPA 4JEUB 1YQ3A 3E08A 3ZMVB 3AA0B 5HEJA 4DR6T 5LG4A 2IHR1 3ZMTB 4DV0T 4L0RA 4UR9A 5L4EA 5IWAT 3IEEA 3D0TA 4UVCB 2KLQA 4IDQA 4M1PA 1HF8A 4AIUA 2KMFA 2IUBA 3AVRA 1G8XA 2WMNA 3C4XA 3JAFA 4E7ZA 5JH7E 3RLFF 1KFYA 5J2UE 2VKOA 2RPAA 1MMDA 3AEFA 4CXXA 3AE7A 3X1DA 5L3CB 5LGTB 5H6RB 3T1HT 2IDOB 3L39A 3H3AA 4ILAA 2CXLA 4TX5A 4U74A 3CQCB 4AKLA 3I0OA 2XAHB 3GN5A 1SE7A 3U3IA 1QUUA 4PJJA 3Q5EA 4ZI3D 1S94A 3CX7B 3O4XE 5ABFB 4I55E 5GONE 4H9SE 4CI3B 4AQFA 3RYHE 3B5MA 3ETUA 5HWYA 2V26A 5IYZE 2QYWA 2VVSA 3CMLA 1H7CA 2KXPB 2E9XC 5AQIB 1I6ZA 1DU2A 2XQ4A 2WMOA 4YTNA 3LBXA 4H63H 4NUVA 1N36T 2NTXA 2DI4A 3AEEA 2G0UA 3CWZB 3OYZA 1T7SA 2C0SA 2D2SA 2MTQA 2LKGA 3RRCA 2JIWA 5EK2A 4GK5E 2LEHA 4YFSA 3CQGB 5HEHA 5JRCA 4JYAT 4TNWA 3PUXF 2ACXA 3UT5E
chains in the Genus database with same CATH topology
5LMUT 3T1YT 4B3ST 3T1HT 4JI1T 4DV2T 4JI7T 2UXDT 4KHPT 4JI3T 4JI8T 4YHHT 4X64T 4X66T 4DV4T 1HNWT 1N33T 1XMQT 1HNZT 4LFCT 1HNXT 4DR4T 4NXNT 4GKKT 2ZM6T 4B3TT 4X65T 4DR3T 2HHHT 4NXMT 4DV5T 4GKJT 4K0KT 2UXCT 1XMOT 2UU9T 4B3RT 4LFAT 1N34T 1FJGT 2UUCT 4LFBT 1J5ET 4JI6T 1XNQT 4LF9T 2F4VT 4LF8T 4DV3T 5BR8T 1I94T 4DUZT 4X62T 1N32T 4B3MT 2E5LT 4JI2T 4DUYT 1IBKT 1HR0T 1N36T 4DV7T 4JV5T 4DR6T 4DV6T 4DV0T 2UXBT 5IWAT 1IBLT 4LF7T 1IBMT 4DR7T 2VQFT 4YY3T 4LF5T 5LMNT 4DR5T 4LF4T 3OTOT 2UUBT 4DV1T 4JI5T 4LF6T 4JYAT 2UUAT 4DR2T 4JI4T 4AQYT 4OX9T 4DR1T 1XNRT 4JI0T 2VQET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU T;  3T1Y T;  4B3S T;  3T1H T;  4JI1 T;  4DV2 T;  4JI7 T;  2UXD T;  4KHP T;  4JI3 T;  4JI8 T;  4YHH T;  4X64 T;  4X66 T;  4DV4 T;  1HNW T;  1N33 T;  1XMQ T;  1HNZ T;  4LFC T;  1HNX T;  4DR4 T;  4NXN T;  4GKK T;  2ZM6 T;  4B3T T;  4X65 T;  4DR3 T;  2HHH T;  4NXM T;  4DV5 T;  4GKJ T;  4K0K T;  2UXC T;  1XMO T;  2UU9 T;  4B3R T;  4LFA T;  1N34 T;  1FJG T;  2UUC T;  4LFB T;  1J5E T;  4JI6 T;  1XNQ T;  4LF9 T;  2F4V T;  4LF8 T;  4DV3 T;  5BR8 T;  1I94 T;  4DUZ T;  4X62 T;  1N32 T;  4B3M T;  2E5L T;  4JI2 T;  4DUY T;  1IBK T;  1HR0 T;  1N36 T;  4DV7 T;  4JV5 T;  4DR6 T;  4DV6 T;  4DV0 T;  2UXB T;  5IWA T;  1IBL T;  4LF7 T;  1IBM T;  4DR7 T;  2VQF T;  4YY3 T;  4LF5 T;  5LMN T;  4DR5 T;  4LF4 T;  3OTO T;  2UUB T;  4DV1 T;  4JI5 T;  4LF6 T;  4JYA T;  2UUA T;  4DR2 T;  4JI4 T;  4AQY T;  4OX9 T;  4DR1 T;  1XNR T;  4JI0 T;  2VQE T; 
#chains in the Genus database with same CATH topology
 1G73 A;  2GK9 A;  1T8B A;  1UX4 A;  2W67 A;  2QVA A;  3A7M A;  2XAG B;  3S4U A;  5FXZ A;  4Q25 A;  2CEA A;  3Q5X A;  4KBM B;  4KMC A;  4I50 E;  3N9Q A;  3UU5 A;  3KBU A;  4O2B E;  5C2T A;  1T72 A;  4K0U A;  1VCS A;  4GK0 E;  3EI0 A;  4ZI2 D;  2JQQ A;  3UUB A;  3L8R A;  4AXP A;  4K0K T;  2CRB A;  4KX6 A;  3QB5 K;  3GN5 B;  4YXD A;  1BR4 A;  4LF9 T;  2H88 A;  2I59 A;  3AE6 A;  4JUY A;  1HR0 T;  4DV7 T;  5FXX A;  3ZYM A;  2IML A;  3NVO A;  5KX5 E;  1KNP A;  2JMK A;  4H63 V;  3LK4 2;  3IF8 B;  5IUX A;  2L9Q A;  2CHO A;  3C64 A;  4ZEY A;  4JI0 T;  2E9X B;  4J2C A;  2BG9 E;  2QA7 A;  4IT4 A;  2XPK A;  2K9A A;  2X67 A;  2KWI B;  2LJL A;  4PJL A;  3ZPO A;  3KBT A;  4COF A;  2LSJ A;  5AQU B;  2HN1 A;  2DL1 A;  4ZOL E;  1JNR A;  5AQH B;  4F8H A;  1WYC A;  2E2A A;  4LFC T;  2VL8 A;  5J2T E;  1W09 A;  4TWD A;  2KND A;  4EV6 A;  2VL0 A;  3RYF E;  5F5W A;  1W9R A;  4DV5 T;  3Q9D A;  2UU9 T;  3J7Y q;  3ZYL A;  2LE8 A;  5LHH B;  1WRD A;  1I94 T;  3OJA A;  3FZM B;  2YEV C;  1D0Y A;  1MIV A;  3MK7 C;  4DV6 T;  3EHZ A;  2D0T A;  5CFB A;  2WM9 A;  2BBJ A;  3A8Y C;  2ZM8 A;  2HPL A;  4C91 A;  3PE0 A;  2DWG A;  3N2O A;  3P4Q A;  3HKC E;  4A98 A;  1YXR A;  2C5K T;  2DLR A;  3VR9 A;  4PJM A;  3JAD A;  4QH1 A;  3O9X A;  3F2E A;  1XNR T;  2K48 A;  3MAC A;  4MLK A;  2H3R A;  1KF6 A;  4B3S T;  5JDF A;  3UUM A;  4NPP A;  4JI1 T;  5LB7 B;  4UEL A;  2V7M A;  4HFE A;  4O2A E;  3AEB A;  2QGS A;  2W0G A;  2X0L B;  3N9O A;  3F31 A;  4GYR A;  2KZ7 B;  2FJB A;  3RIA A;  2CWO A;  3UU4 A;  1US7 B;  1LKX A;  5EZY E;  3BK9 A;  3P4P A;  4LFA T;  2WWU A;  3KIN B;  5AQK B;  4U72 A;  5LCY A;  3P4S A;  5H6Q B;  3MXZ A;  3RRW A;  3I9Y A;  5FKY A;  1LRZ A;  2XUE A;  4HWC A;  1Z8U A;  3LSV A;  4CXY A;  1SUM B;  2MAW A;  2XM1 A;  4ZZB A;  4ASK A;  5F3J A;  4H9N C;  3ZN0 B;  2X0H A;  3AA1 B;  2R6G F;  3FZK B;  4A56 A;  5CA0 E;  4HWD A;  3UFE A;  2Z6E A;  2B1E A;  5LMN T;  5EK3 A;  2DWK A;  5F8P A;  2DCF A;  3UUL A;  1ZKE A;  3PDY A;  4JI4 T;  3AAE B;  5AQT B;  1KNR A;  3AB3 B;  2W00 A;  1W0B A;  1OXZ A;  4EIW A;  2XQ5 A;  5DQV A;  4HFH A;  4GOU A;  4ZXL A;  3LG7 A;  2V6X A;  4JI3 T;  4XAX B;  4L5G A;  4P0A A;  1U5P A;  2NW9 A;  5KMG P;  1HX8 A;  5JDH A;  1S35 A;  5AQJ B;  1WFD A;  3KVA A;  5ABF A;  5FYM A;  2CE7 A;  4UXN B;  3QK6 A;  3N2G E;  2A72 A;  1FMV A;  4PK5 A;  3RIU A;  2PG8 A;  2BDE A;  2IIU A;  5ADX L;  3KVB A;  4GKJ T;  4UEM A;  4EGW A;  4QWN B;  4MAL A;  1FJG T;  1WR0 A;  2WDQ A;  2PJQ A;  5FY1 A;  2WAU A;  2VUR A;  3N9L A;  2DHR A;  5JDM A;  3EAB A;  3SRZ A;  4QH5 A;  1JNZ A;  4YTM A;  1MIW A;  3ABV A;  3K3N A;  4LF5 T;  1WR6 A;  1NWM X;  3OTO T;  3AVS A;  3P4R A;  3RF1 A;  3Q2M A;  1BR2 A;  4HWI B;  2I6H A;  3V5U A;  4LF6 T;  3UTK A;  1T98 A;  4E7S A;  3TLS A;  3N5L A;  5HYA A;  4JLE A;  2ZM2 A;  1NAF A;  4WBN E;  2XAQ B;  1X9B A;  4IGU A;  3CVR A;  2LSI A;  5JRE A;  2XTL A;  2WQY A;  3K8P C;  3L3P A;  2XJ7 A;  3HL6 A;  1B7T A;  3WAJ A;  4DV4 T;  1Y01 A;  2BVM A;  3CX8 B;  4HFD A;  2NOX A;  4WNK A;  3RKO A;  3SOL A;  3AA6 B;  4PFP A;  2UXN B;  1HCI A;  4HKA A;  4DR4 T;  4LMK A;  1Y64 B;  3BQK A;  4B3T T;  3RX6 A;  2K24 A;  2VWA A;  2XQ7 A;  3OBV E;  4NXM T;  2Y8D A;  4G2A A;  3UQ7 A;  3VRA A;  3UUN A;  2A2F X;  2VK9 A;  4IDO A;  1UX5 A;  2WBL A;  3DTO A;  2UUC T;  5JQG E;  2BS4 A;  1D1A A;  4AKH A;  5HEO A;  3K3O A;  1IBK T;  4KI0 F;  4A97 A;  3QB5 A;  4UIG A;  4JV5 T;  3LK3 B;  4PFO A;  5DAB A;  4TV8 E;  3ZT6 A;  2MYS A;  1E1H B;  4XBF B;  3VKG A;  4QXH B;  3ZCJ A;  1UCU A;  4KUM B;  3OKQ A;  3RIF A;  5DJQ C;  3HKD E;  3NWI A;  2JQK A;  2E9X A;  3ETV A;  3PU3 A;  2RA1 A;  5LMU T;  2YDS A;  1KK7 A;  3P50 A;  3RC8 A;  2J47 A;  3EDU A;  2XQ9 A;  4OHF A;  3UU3 A;  3IA3 A;  4BAY B;  4DV2 T;  3PV0 F;  3AAA B;  5LOV E;  2B76 A;  2IC6 A;  1WCR A;  4DMW A;  2VVN A;  3ANW B;  2X0Y A;  1MMN A;  1IJ5 A;  4U7I A;  2CXD A;  2XSB A;  3CKD A;  3PUA A;  5ABH A;  5KDM C;  4IDZ A;  3CX6 B;  1IAP A;  2WSS V;  4DR3 T;  1CUN A;  3AE8 A;  5IHY A;  3NRX A;  3AXJ A;  4PK6 A;  5L3E B;  2I0M A;  2XQ8 A;  1HS7 A;  3RPU A;  4IE6 A;  2WP9 A;  4B3M T;  3E22 E;  2WB5 A;  3I9W A;  2A9U A;  4ILU A;  2X9W A;  3AEA A;  5JTG A;  4EYU A;  2H89 A;  3AE9 A;  2M6I A;  3TKL B;  5LHI B;  2E9X D;  2KT9 A;  2Y6X A;  5FVK A;  4LF7 T;  1V9D A;  1ZP0 A;  2X9Y A;  4IDP A;  4AIS A;  1U4Q A;  3O1H A;  4MBQ A;  3CIR A;  4FJO A;  2WU2 A;  2LHN A;  2BZB A;  5LBQ B;  5JDQ A;  5LGU B;  3LDQ B;  2EHO C;  3PUQ A;  4EEB A;  5LGN B;  4Z90 A;  3Q5W A;  3NKZ A;  2XSA A;  3ZT7 A;  2N9D A;  4I43 B;  5AFU L;  2W63 A;  2EHO A;  2VKD A;  3NBX X;  3M3Z B;  2XAS B;  1IJ6 A;  4KP3 C;  3VR8 A;  3H37 A;  3UUX B;  5FNV E;  3RHW A;  1SHZ C;  4ILC A;  4G63 A;  1WLX A;  5HWX A;  2ZM6 T;  2X9X A;  2V5D A;  3SS1 A;  2BBH A;  2V7K A;  2ZLY A;  5TAO A;  2KIN B;  4BJN A;  3F57 A;  4IST A;  2ZM0 A;  4NUU A;  4AQG A;  4CXW A;  2YN6 A;  3FZH B;  4LML A;  4QXC B;  4EED A;  3N9P A;  4O4J E;  1UGO A;  4X5T A;  4WZX A;  5AQR B;  5CJ5 A;  2KSR A;  4HFC A;  5AQM B;  3ZKR A;  3Q5D A;  3U78 A;  2E5L T;  3ZST A;  2LRL A;  2CM0 A;  5M4Y A;  3TLU A;  2Y48 B;  2BVL A;  5AQL B;  5HAX A;  3UFG A;  2L3L A;  5L3G B;  4IE7 A;  5AQP B;  3AXJ B;  4X1K E;  2EHO D;  4DR5 T;  5JR9 C;  3KDS E;  4DV1 T;  4CI1 B;  2AXD S;  5AQQ B;  2YK0 A;  1OED C;  5EK4 A;  3PUS A;  3QC9 A;  4HN9 A;  5JR9 A;  3H3M A;  1YD8 G;  4IDN A;  2BS2 A;  2CPT A;  4TV9 E;  3ZJ1 A;  1N33 T;  4PK4 A;  3FXD B;  2W4X A;  3KV6 A;  2WWV A;  2LLY A;  5ABE A;  1XDO A;  2JQH A;  3RH3 A;  2MBG A;  3UU8 A;  3AEG A;  5HCJ A;  2VAS A;  5CB4 E;  3OYX A;  2BKO A;  2EHO B;  2LM9 A;  2WZH A;  3JC6 C;  3ZJ2 A;  1W0A A;  4JI6 T;  2WU5 A;  2YKS A;  4HFB A;  4U7Y A;  3B13 A;  1BR0 A;  5AQG B;  4OFZ A;  2XAJ B;  1D0Z A;  4HWF A;  1YW0 A;  4ERR A;  4DID B;  3J9X 1;  5FL0 A;  3AE1 A;  2P9B A;  5LNK A;  4ANJ A;  5HEU A;  4CN1 A;  3RYI E;  4CQI A;  3AE2 A;  2XY8 B;  4QXB B;  2UXX B;  4A5X A;  3GA8 A;  1L0V A;  1O3X A;  2L8K A;  5HXS A;  1EZ3 A;  3TLT A;  3RI5 A;  3NRY A;  2LSY A;  2JQ9 A;  1M62 A;  2E5V A;  2QRX A;  4JI7 T;  2YU2 A;  1D1C A;  5LP6 E;  4FI5 A;  4IE4 A;  3C4Z A;  5L47 A;  1FMW A;  3OPC A;  3DP7 A;  3QOF A;  4JEH B;  5JR9 B;  1R8I A;  2WZI A;  3L09 A;  5ABG A;  5CA1 E;  1OED B;  2AE9 A;  2VKH A;  4P09 A;  5C3J A;  2Q9Q C;  2WCA A;  5FP3 A;  4Z8X A;  4BA9 A;  1N34 T;  2HPJ A;  3O1I A;  2JPF A;  2N1G A;  3FB2 A;  3ZYK A;  2IW5 B;  3ZN1 B;  2Q9Q A;  4YSY A;  4P0B A;  2IAK A;  1N32 T;  1VCT A;  5LHG B;  5FXW A;  1GQE A;  3I1A A;  3FBZ A;  4L9I A;  2MOZ A;  4OYJ A;  2D5U A;  3CK6 A;  1IBL T;  3UQ4 A;  2LM2 A;  1D0X A;  4O4H E;  2NW8 A;  4PNI A;  2YDR A;  4U2Y A;  3ONX A;  4O4L E;  4HE8 A;  2A3D A;  3ZLI A;  2C5I T;  4IE0 A;  2UUA T;  1WYB A;  4AI6 A;  2XQA A;  4LMJ A;  5LXT E;  1XDP A;  4TZ4 C;  4U2Z A;  5L4H A;  4QHO A;  2PFV A;  5HXR A;  1CHU A;  3HKE E;  5JVD E;  1UK5 A;  2UXD T;  4TWH A;  4ZI3 C;  4H9R C;  4UVA B;  5AQV B;  4U33 A;  4WYV A;  4X66 T;  1HNW T;  1QLB A;  2WY2 A;  4JBW F;  2J1D G;  3ANW A;  5DQW A;  4EXT A;  2V8S V;  5LYJ E;  4WW0 A;  5L3B B;  4UV8 B;  2KWH A;  2Q9Q D;  2H7V C;  3FZL B;  4EAH A;  3A5X A;  4DBQ A;  5HCM A;  4DND A;  2V7I A;  3FZF B;  1XMO T;  2NR4 A;  3EAM A;  2V1D B;  3RGL A;  5J0Z A;  5AQN B;  1XNQ T;  5AQS B;  5BR8 T;  3VKH A;  3P7I A;  5L3D B;  3RQU A;  3AA7 B;  4IHJ E;  2VKJ A;  4U31 A;  1M7K A;  2V6Y B;  1BR1 A;  4TNV A;  4KHZ F;  4MFR A;  2X9H A;  1XZY A;  3ONJ A;  3E0Z A;  3LFM A;  3ZEF B;  3PUY F;  2VQF T;  4YT0 A;  2NWB A;  2Q9Q B;  3AED A;  2RP4 A;  4JI5 T;  1YQ4 A;  2LHR A;  3R6N A;  4AQY T;  4AQF C;  4ZI7 E;  3SFD A;  3ONL C;  3T1Y T;  4IE5 A;  3HKB E;  2SPC A;  1LVK A;  2CHN A;  4YTP A;  2CLY C;  4JI8 T;  4YLH A;  1XMQ T;  4YSZ A;  5AQO B;  3N2K E;  4ZI2 C;  5LJM A;  4PW8 A;  4AKG A;  1HNX T;  2DNX A;  3CPZ A;  4X1Y E;  4EOZ B;  1ZOY A;  4UV9 B;  2YIN A;  4U3C A;  2W62 A;  5L2L A;  3JCF A;  4QH4 A;  2PTF A;  4B3R T;  5LA6 E;  2YU1 A;  3QUJ A;  3NZQ A;  3AE4 A;  2J4G A;  3WI3 A;  4EZH A;  3FBL A;  4P1N A;  1SA0 E;  4CN4 A;  3PJA A;  3PJA J;  2XQ6 A;  3ZMS B;  4HFI A;  1MNE A;  3SFE A;  4DR7 T;  5LG3 A;  3R84 B;  5AQF B;  3V5S A;  4N78 D;  2W2U A;  2IC9 A;  1X79 A;  1FEW A;  2UUB T;  2YOE A;  3KV9 A;  2W61 A;  1UUR A;  4DR2 T;  1MMG A;  3PU8 A;  1HG2 A;  5FVL A;  4ISS A;  2VQE T;  4X1I E;  2ODU A;  2XZE A;  3JAE A;  4DO0 A;  2XM2 A;  2FUP A;  1KNZ A;  4TUY E;  4B6X A;  5FY0 A;  2E8I A;  4ILB A;  1D1B A;  3I0Q A;  2WDV A;  4YSX A;  4HEA A;  2FJE A;  2LOS A;  3RC3 A;  2JRK A;  5HXC A;  4X20 E;  4IL9 A;  3RKG A;  4GKK T;  4NIQ A;  3W15 B;  1MND A;  1OED E;  4X65 T;  4TWF A;  3BQI A;  3P8C D;  5ETW A;  3EDV A;  1ZHC A;  3MZK B;  5JDN A;  3ZMZ B;  3CQX C;  1J5E T;  2FJD A;  3VU7 H;  4AKR B;  3EVY A;  4C90 A;  3VHL A;  2HN2 A;  2CA5 A;  2LT3 A;  4BJM A;  2CLY B;  3UU6 A;  4CZZ B;  4CI2 B;  3FXE B;  1ZV4 X;  5BMV E;  2NP9 A;  4H9P C;  3LBX B;  1HG5 A;  2UXB T;  3IHR A;  3C4W A;  4EB6 E;  2VB6 A;  4ADZ A;  3N9M A;  4I4T E;  3K1S A;  3GMI A;  2X68 A;  3P4W A;  2NTY A;  2PBI A;  2CCQ A;  4YY3 T;  2CBI A;  2CBJ A;  4OK0 A;  5C8Y E;  4V1A v;  5JRC B;  2XQ3 A;  5LBM A;  1HX1 B;  4OX9 T;  2LKH A;  3LJC A;  2X66 A;  3N9N A;  2BS3 A;  1XWM A;  3MKD A;  3HR0 A;  4OYK A;  1MMA A;  2FJA A;  4MHC A;  2NW7 A;  1HFA A;  4KHP T;  4YHH T;  1J1J A;  2JMH A;  5FY7 A;  1NEN A;  1HNZ T;  4O4I E;  4IIJ E;  2LSK A;  2BKP A;  3ZC0 A;  2K3W A;  3QNU A;  4WBO A;  5KXJ A;  2YDQ A;  4NXN T;  3PTR B;  3NZP A;  5HEG A;  1OED A;  3ZCI A;  1VOM A;  2H7O A;  2HHH T;  4DVD A;  3MA9 A;  2HH7 A;  2M67 A;  1NEK A;  4LFB T;  4LF8 T;  5JDL A;  3PUV F;  2XHE B;  3RYC E;  4O8S A;  2BG9 C;  3PUZ F;  4DUZ T;  4GYS A;  4JI2 T;  2CMR A;  2CWY A;  2D0U A;  1YKE B;  1AJ3 A;  4ZZC A;  5JDG A;  4UVB B;  2BG9 A;  3K3Q C;  3TLW A;  1HTJ F;  5LJN A;  4Z91 A;  4AKI A;  5A1L A;  5E0O A;  4LF4 T;  3PUG A;  2D9D A;  3KV5 A;  4GIW A;  1J5W A;  1E7P A;  4YHJ A;  1IZN B;  4DR1 T;  1FIO A;  4ZS3 A;  3PUW F;  3DJB A;  4HGA A;  5HXE A;  4EZ4 A;  4UF0 A;  3WAK A;  3C51 A;  2WDR A;  4X64 T;  4H9O C;  2LRK A;  4IRE A;  3KFW X;  2V7L A;  4HWH A;  4YJ3 E;  2M6B A;  3ZSS A;  3HA4 A;  3HI2 A;  2OA5 A;  3SWH A;  1UUS A;  2WS3 A;  3GWH A;  3FHN A;  4YJ2 E;  2UXC T;  4IL4 A;  4PJN A;  2W66 A;  3AE5 A;  2V5C A;  4DV3 T;  5FXV A;  3T8O A;  3JC6 D;  4QKN A;  2ES0 A;  3PUR A;  2N2N A;  3IBP A;  1YKH B;  2LSG A;  3LK2 B;  2V6Y A;  4DUY T;  1Z0P A;  4QX8 B;  2X51 A;  3VRB A;  5FL1 A;  3AAI A;  1QSD A;  3OVU A;  3M65 A;  4DMV A;  2MPK A;  1IBM T;  3RQW A;  3C50 A;  2ACZ A;  5CGM A;  3B57 A;  4CN6 A;  2V7J A;  3ZC1 A;  5HXH A;  1ZEE A;  4DBR A;  2ZMA A;  4TN7 B;  5J1G A;  2XQY A;  3RIU C;  2OLT A;  3C98 B;  2ODV A;  2J62 A;  1VRB A;  3ZT5 A;  4I0U A;  2BG9 B;  3AEC A;  5L3F B;  3EUH A;  4ZHQ E;  4H9Q C;  3BQL A;  2C5J A;  2OV9 A;  4EYY R;  1E2A A;  1MIY A;  3G06 A;  3MJX A;  3O1J A;  4QX7 B;  2FBW A;  3ESL A;  2XAF B;  4HTE A;  3KV4 A;  1LVF A;  4ZS2 A;  4UF0 B;  2JJ9 A;  3ZMU B;  1OWA A;  3TLV A;  2BKN A;  4HFV A;  4XZC A;  3AE3 A;  4PAG A;  2F4V T;  2CXF A;  4F6R C;  5FMN A;  2K5B B;  1KEY A;  4X62 T;  2LOP A;  4JEU B;  1YQ3 A;  3E08 A;  3ZMV B;  3AA0 B;  5HEJ A;  4DR6 T;  5LG4 A;  2IHR 1;  3ZMT B;  4DV0 T;  4L0R A;  4UR9 A;  5L4E A;  5IWA T;  3IEE A;  3D0T A;  4UVC B;  2KLQ A;  4IDQ A;  4M1P A;  1HF8 A;  4AIU A;  2KMF A;  2IUB A;  3AVR A;  1G8X A;  2WMN A;  3C4X A;  3JAF A;  4E7Z A;  5JH7 E;  3RLF F;  1KFY A;  5J2U E;  2VKO A;  2RPA A;  1MMD A;  3AEF A;  4CXX A;  3AE7 A;  3X1D A;  5L3C B;  5LGT B;  5H6R B;  3T1H T;  2IDO B;  3L39 A;  3H3A A;  4ILA A;  2CXL A;  4TX5 A;  4U74 A;  3CQC B;  4AKL A;  3I0O A;  2XAH B;  3GN5 A;  1SE7 A;  3U3I A;  1QUU A;  4PJJ A;  3Q5E A;  4ZI3 D;  1S94 A;  3CX7 B;  3O4X E;  5ABF B;  4I55 E;  5GON E;  4H9S E;  4CI3 B;  4AQF A;  3RYH E;  3B5M A;  3ETU A;  5HWY A;  2V26 A;  5IYZ E;  2QYW A;  2VVS A;  3CML A;  1H7C A;  2KXP B;  2E9X C;  5AQI B;  1I6Z A;  1DU2 A;  2XQ4 A;  2WMO A;  4YTN A;  3LBX A;  4H63 H;  4NUV A;  1N36 T;  2NTX A;  2DI4 A;  3AEE A;  2G0U A;  3CWZ B;  3OYZ A;  1T7S A;  2C0S A;  2D2S A;  2MTQ A;  2LKG A;  3RRC A;  2JIW A;  5EK2 A;  4GK5 E;  2LEH A;  4YFS A;  3CQG B;  5HEH A;  5JRC A;  4JYA T;  4TNW A;  3PUX F;  2ACX A;  3UT5 E; 
#chains in the Genus database with same CATH homology
 5LMU T;  3T1Y T;  4B3S T;  3T1H T;  4JI1 T;  4DV2 T;  4JI7 T;  2UXD T;  4KHP T;  4JI3 T;  4JI8 T;  4YHH T;  4X64 T;  4X66 T;  4DV4 T;  1HNW T;  1N33 T;  1XMQ T;  1HNZ T;  4LFC T;  1HNX T;  4DR4 T;  4NXN T;  4GKK T;  2ZM6 T;  4B3T T;  4X65 T;  4DR3 T;  2HHH T;  4NXM T;  4DV5 T;  4GKJ T;  4K0K T;  2UXC T;  1XMO T;  2UU9 T;  4B3R T;  4LFA T;  1N34 T;  1FJG T;  2UUC T;  4LFB T;  1J5E T;  4JI6 T;  1XNQ T;  4LF9 T;  2F4V T;  4LF8 T;  4DV3 T;  5BR8 T;  1I94 T;  4DUZ T;  4X62 T;  1N32 T;  4B3M T;  2E5L T;  4JI2 T;  4DUY T;  1IBK T;  1HR0 T;  1N36 T;  4DV7 T;  4JV5 T;  4DR6 T;  4DV6 T;  4DV0 T;  2UXB T;  5IWA T;  1IBL T;  4LF7 T;  1IBM T;  4DR7 T;  2VQF T;  4YY3 T;  4LF5 T;  5LMN T;  4DR5 T;  4LF4 T;  3OTO T;  2UUB T;  4DV1 T;  4JI5 T;  4LF6 T;  4JYA T;  2UUA T;  4DR2 T;  4JI4 T;  4AQY T;  4OX9 T;  4DR1 T;  1XNR T;  4JI0 T;  2VQE T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...