4DR5K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr5K00
5BR8K 5LMNK 5IT9O 2UXCK 4YY3K 1IBMK 4DR3K 2UUBK 4NXNK 4LFCK 1HNWK 3JAMO 3OTOK 1IBKK 2UXDK 4B3MK 4DR7K 3T1HK 1N36K 4OX9K 5IWAK 1HNXK 4B3SK 4LF8K 4K0KK 4DV4K 1N34K 4DR6K 4X66K 4GKKK 1IBLK 4LF9K 1N33K 1HR0K 4KHPK 4DUYK 3J81O 3J7AP 4DR1K 5A2QO 1I94K 4JYAK 4LF6K 4DV0K 4DV5K 2UUCK 4JI5K 4V19S 4B3TK 4DV1K 5FLXO 1XMOK 1XMQK 2VQFK 4JI3K 4LFAK 2UUAK 5LMUK 4DV3K 1HNZK 4YHHK 3T1YK 4LF5K 5AJ3K 1XNQK 2VQEK 4JI2K 4LFBK 2ZM6K 4X64K 4JI6K 4DR5K 2HHHK 1FJGK 1J5EK 4DV2K 4NXMK 1XNRK 4GKJK 3J80O 2E5LK 4JI1K 4B3RK 4DUZK 4LF7K 5LL6Z 4CVNE 4JI8K 4X62K 4JI4K 3J7YP 2F4VK 1N32K 4JI7K 4DR4K 4JI0K 4DV7K 4LF4K 4X65K 4DV6K 4CW7B 4AQYK 2UXBK 4DR2K 2UU9K 4JV5K
chains in the Genus database with same CATH superfamily
3THXA 5BR8K 4M7XA 3TAPA 4A59A 1IKVA 4Z4HA 2FBTA 4ILJA 1FKPA 3QNNA 2YNFA 1J5OA 2HHQA 5AFUA 1IBKK 3G0ZA 3L2VA 2ITGA 1A5WA 3T1AA 3W3DA 3P83D 2ATQA 2P9SB 1U49A 5KRTA 4B9LA 3C6UA 1E4FT 1U2VA 3ZX0A 3CFPA 5J2PA 1B92A 4AHRA 1L3UA 2Q31A 4O4GA 4WQ4A 3UE5A 4AH9A 3AO5A 1N34K 4AHTA 4BC4A 2HSTA 4C23A 4JS5A 3TABA 3RMAA 1RDDA 1K8AO 4KFBA 1TVRA 3QIOA 3J7AP 1W9HA 5MLCQ 3PIOL 2DPNA 1C1CA 1HRHA 2NRTA 3CCQN 1JKHA 1CXQA 3KD1E 4JKGB 3A5MC 2E2OA 4CJWA 2BTFA 2V7YA 1S1TA 5FLXO 2ZQBA 1NK4A 2E4LA 4QAGA 3SMPA 4LY7A 2CGLA 4IOAL 3O4WA 1XQSC 3P31A 3G71N 3NH0A 3I56N 2RF2A 4FJLA 3OBYA 2HBLA 4CZKA 5AZJB 3O6WA 5JS2A 4OPJA 4YHHK 3RMCA 4A62A 2NRRA 1VSIA 2VQEK 1NMNA 2UYTA 4BRNA 3S3NA 3SV3A 1R0AA 3HVTA 4DSIA 4GKJK 2PYLA 3RWUA 1ZBFA 4LF7K 1LAWA 4N5SA 1KD1O 4OPKA 4Z4GA 3V6DA 2GX9A 3VTHA 1L3TA 1YXQA 1VQNN 4H5VA 3V9ZA 2YHBA 2Q2RA 3ULEB 4BRDA 3SUNA 1OKJA 2KQ2A 3M8SA 4FCYA 3SV4A 2QWPA 1VSHA 1VRUA 3C95A 3VF4A 3KK7A 1UA0A 2RN2A 2UXCK 4CZMA 4B1XB 3PY8A 4PL8A 3CCVN 3FE1A 4NLCA 1YI2N 5AQXA 4DG1A 2OYQA 3L8BA 3TAEA 3IMXA 4CBUA 4I7FA 2ZD1A 4XIUA 1KLMA 1WAFA 4CHPA 1K6YA 1RT1A 3HL8A 2Q36A 3I8BA 1HJRA 3LALA 3NVMA 2ZWHA 3CI5A 4E7JA 1TYQA 4BY9C 1CLQA 4B1ZA 1YJWN 4ELVA 3WXMB 1NGAA 3SUOA 1Z05A 5AQZA 1IBLK 4C1NK 1VAZA 2IGIA 4JKFA 1YTUA 3L3VA 2YV0X 3AVMA 1ASUA 5J2NA 4O8UA 4GY2B 4B8CA 3H45C 3VEWA 1QHAA 4MLHA 3KWGA 1XMQK 3SBTA 4BRCA 4RG8A 4BRPA 3QETA 3PSFA 1TAQA 3O1BA 4DF8A 1W0HA 2VQFK 2F8SA 2D0AA 3DLHA 1HYZA 1BL3A 3T7ZA 1MU2A 5AQNA 1OH8A 1NOZA 2PY5A 3CFRA 3LP3A 4NLBA 4KB0A 2CH6A 2HF4A 4F3OA 2FBVA 2DY4A 5C10A 5BRDA 4CJEA 3G4SN 2OPPA 4CVNE 4CZHA 3TPQA 1SUQA 5HROA 1BG3A 4OJRA 3VQDA 1N32K 3K59A 3ZEUB 2O8EA 3ZLJA 1CXUA 3AA2A 4KPYA 4DV7K 4X65K 1T3VA 1WSGA 3AA5X 3CG7A 3VQEA 4AHCA 3D2FB 3LPUA 4FWKA 2KW4A 3HPHA 3V4IA 4NXNK 4OVLA 1S22A 4ID5A 2NZTA 3O4QA 3VF2A 5KQDA 1IKYA 1QS4A 1JLGA 4CJQA 1YVUA 3VQ7A 3HP9A 4H0VB 2I5JA 5HRNA 4BDZA 2EWSA 4FWQA 3VQ6A 1N36K 1LCUA 3MEGA 4GW6A 3CCSN 4KV8A 4CJ5A 2A3ZA 3D6RA 4LF8K 4I6MB 4CGDA 1VSMA 1I39A 2WONA 2YNHA 3D7EO 1T05A 3SPZA 4KB1A 2LSNA 2F9WA 4IXCA 1HUXA 2GEMA 3QIPA 3U3YA 4WFBL 4FVUA 5A2QO 2KKZA 3PX4A 4BDYA 2A42A 4CEBA 4LSLA 4BROA 4FJHA 1NGCA 4DQSA 1QSYA 3ASMA 3KVGA 4BGAA 4CF9A 1ASVA 1RDBA 2FXUA 5JVGL 1QQCA 3L4IA 5AQWA 1JLBA 2OPQA 3DI6A 3CCEN 1VK0A 2QA4N 3NF6A 5AQUA 4CFAA 3RR7A 3HK2A 3M8PA 4JHDB 1SV5A 3RTVA 4F2SA 1NK8A 3D2EA 4O0JA 2HHWA 4ELTA 4DLEA 3E9LA 2OPRA 3DAWA 4DSJA 4F9OA 2QWOA 2WOMA 3TAMA 4Z0UA 1NKCA 3KLFA 1N5YA 3WQTA 2FSJA 4Q0BA 3DXKB 1HLUA 4B9QA 5KI6A 3DOKA 4CEOA 3SJJA 5I3UA 4EZ6A 3I0RA 2OA8A 5AQFA 3VQCA 2WFBA 2HHVA 3CERA 3ITHA 4LF4K 3EN9A 3VQ9A 5HRRA 4JV5K 4QCLA 5BREA 3MX5A 3TTDA 2G8WA 3MK6A 3V1OA 4BRFA 4ID1A 4FLWA 3K58A 4H0YB 4XH5A 2W6KA 2BUPA 1S6QA 5DMRA 3CCMN 1S9EA 4QS8A 3UKUA 1EWRA 3UKRB 1NJXA 5KGWA 3WUHA 4Z4EA 1U48A 3KWIA 3LWLA 1KAXA 4FLTA 1S3XA 2F8TA 3N4QA 5GINA 4H0OA 1VQ7N 1HNIA 4OPAA 3SNNA 3IKMA 5JS1A 3LDPA 4FWMA 3AVJA 2GBZA 1ASWA 4KHWA 2HBMA 4FJ8A 2G8VA 2BANA 5J1EA 2GUIA 4EFHA 1C0GA 2YKNA 4LH4A 1L5UA 4B3TK 3TAGA 2GTDA 1WBDA 2FF3B 3ZT4A 2HVIA 3NH2A 1VSJA 3GL1A 4IOXA 3DXKA 5M1KA 2W42A 2FSKA 4KREA 5I42A 4FJNA 3C94A 4A2BA 2KFZA 1RBSA 3EKUA 1HKBA 1QSLA 3D2FA 3AVCA 5KQ8A 3JYTA 3SYZA 3DLGA 5AJ3K 1S1UA 3EL2A 1VSFA 4BC5A 4LFBK 3MEDA 4DSFA 1RT7A 3WNEA 2AA4A 1VHXA 3H46O 4BGBA 2EHGA 2BGGA 4YDUA 4DUZK 4BRKA 3O4NA 4KTZA 4M63C 3TSQA 3SQ1A 2WBNA 4BE2A 3BDPA 1C0UA 4U7BA 4DTNA 4CERA 3SUQA 5HP1A 1Q82O 4OLAA 1J53A 1CZAN 3TR8A 3SMSA 1W2BM 1QQOA 3G25A 4CJTA 4DQPA 1LW0A 4WQ5A 3M6GA 4IFEA 3M3ZA 3V9XA 1NBWA 2G8HA 4FJXA 1VSEA 2UXDK 2KTQA 4A61A 2XY7A 2FBXA 5C12A 4B3MK 2AP1A 4ILHA 2Y1JA 1QTMA 5FDLA 3QEIA 4HUFA 3A5OC 2ASPA 1A5XA 3AAQA 1HX1A 3OA9A 2ITMA 2O8DB 3VN5A 1KVBA 4FM0A 4BDPA 4NB4A 3LWMA 3CHWA 4RW7A 5JLFA 4CGIA 3NH1A 4JD2A 3EY1A 3NGYA 1KCFA 3B8AX 2KFNA 2CGKA 2OTJN 4CIEA 5ADXA 4CFCA 3J81O 1VQPN 1GLDG 4KKOA 1LOTB 5BPLA 2VWBA 4FLVA 1MA9B 2Z1IA 3LDOA 2FSNA 1GLLO 3UKRA 1JJ2M 3DRPA 2YHYA 1N8RO 5AQSA 4J2EA 1WN7A 1XMOK 4DU3A 1RILA 4DTJA 3ATUA 4BG8A 1NU0A 3K5NA 4UQGA 3IUCA 1ZXOA 1WSFA 4FK2A 2D0PA 2BDPA 4OLBA 4FK4A 1HNVA 2P9PA 2IDOA 3AV9A 2Q0UA 4CJLA 3HSCA 5BRFA 1K8KB 1RBTA 4B9NA 4YOYA 4DQRA 4E0DA 1VRTA 3SAHA 3P38A 5FRMA 2O4IA 4MO4A 1ITGA 2HHHK 1BWFO 3EZWA 4AILC 3DRSA 2B6AA 4YOXA 3M8QA 2NRXA 2P9NB 3K0SA 1XUPO 1WSHA 3IS9A 3O1WA 4KO0A 4LD0A 1DTQA 3DM2A 4HVJA 3CC2N 3I55N 4FXDA 5JVHL 4CHYA 4YDUC 5FPDA 4CW7B 1BGXT 3F9KA 3V9UA 4CZIA 1NK7A 4CJ4A 3AVBA 4PKIA 3L0QA 3TAFA 5IT9O 1RTDA 4ICLA 4FYDA 4IOCL 2UUBK 3FZLA 3KD5E 3OJSA 1T6DA 4DU1A 2JGUA 2QWRA 5HRPA 3G6EN 3LPTA 3NAEA 3SLCA 5M1OA 2HNDA 4K41A 3KHYA 4L8RB 4LH5A 1P90A 2PZSA 2HHXA 3ZT3A 3SCXA 1JLQA 3HYFA 4H0TB 4PKGA 3PX6A 4RWTA 5D3GA 5BR9A 3M5RA 2Z1JA 1QZ6A 4JKAA 2A1RA 5HBMA 2P9IA 1BCMA 4K43A 4H8KA 2X6SA 4KBOA 4BRMA 4K0KK 1WSIA 4DR6K 1J9AA 2NNWA 4CEDA 1YAGA 5HL7L 1NWKA 1SQKA 5F1XA 4MDAA 3AO1A 4CF8A 5F0XA 4HCCA 4GVEA 4JYAK 4CI6A 4FJ9A 4CZGA 2HMPA 4JI5K 2OZMA 4AHVA 3M8RA 4JHDA 3VQQA 1GLCG 4H5WA 5M1NA 2A6AA 5CY4A 3RR8A 2VG6A 2VCPA 4JKHA 4DTRA 2YX6A 4W5NA 4CJFA 4DLGA 1KQSM 3C0BA 3IFRA 3OYLA 1ATSA 4ISFA 3RMDA 3QEWA 1MWKA 4EHTA 3K2PA 4H4OA 4JN4A 3ZX3A 3T1YK 1X1PA 2XHBA 4HTUA 4FWRA 4E7KA 2NUBA 1JL1A 2VYPA 1JXEA 2F96A 4HWIA 1S72N 3B6PA 4KHSA 3CQYA 4JI6K 3VEOA 3W0LA 5HRSA 2A1SA 2ZJPL 4M3RA 2ZGZA 3MEEA 3WNHA 3MECA 3IDHA 3AVNA 4M3ZA 4X62K 4M3UA 4CGFA 2QKKA 1NJZA 5T7BA 4FLZA 4C8LA 3WXKA 1TK0A 3ENBA 2Z1HA 4FW1A 2UXBK 1KTQA 2D0BA 3OS1A 2CH5A 4FOEA 5M1FA 1RT6A 1ZYQA 1RBUA 4XH4A 2HVHA 2WC9A 3SBGA 1Z25A 1E4GT 1WAJA 2IVNA 4DFJA 4FJIA 3FFIA 4LSNA 4DR7K 2IVOA 2QWLA 1RDAA 4BWMA 3PIPL 3T1HK 4QS9A 5FRNA 5DK5A 2ASOA 1KVAA 3C6AA 5ELZA 5BN9A 1FXXA 4FO0A 3C6TA 2IAJA 3OHRA 4BR9A 4C8MA 3SQ0A 4H5RA 1RDCA 2QW9A 1HR0K 1TYQB 1L3VA 2WUSA 1ESVA 4FWNA 3D0PA 3Q7BA 2J4RA 1X9WA 4Z94A 4GV9A 4HUEA 1QQNA 2NRHA 1QHTA 1HKCA 5GAGP 1TUYA 3TAQA 2QWQA 3E9PA 3ZSRA 4KH4A 2O8CA 4EP4A 2BE2A 4Z4IA 3VQ5A 4BVOA 1DGKN 3I0SA 5AQTA 5EU7A 3OBWA 1NJIO 2QXFA 3AY9A 4J2DA 3VENA 2W41A 1LWFA 1HNZK 2RPIA 1BISA 1GOBA 1OVYA 3AVKA 4OGCA 4J2BA 3FZKA 2FLOA 2ZM6K 2DFHA 3HT3A 3KTQA 3H6EA 1H1VA 3L3UA 3J80O 2RE2A 5JMVA 4DU4A 2JLEA 2YJFA 1HQUA 1EQYA 4CBXA 2F4VK 3K9KA 1IG9A 3RSEB 1XHXA 1ZBHA 3QERA 4DR4K 2D5RA 4C1NI 1NKEA 4AQYK 3SQ2A 2V51B 4CZFA 3I8DA 5CR4A 4O0IA 3LZIA 3U3GA 2QI2A 1BA1A 1NGGA 4A5AA 4BR4A 1VQ8N 4XH1A 4I9LA 1R59O 1HYSA 3KK3A 1T6CA 2OZSA 1S1WA 3TI0A 3S9HA 3CIPA 3HZ6A 3MMVA 3PO4A 1IV0A 4F2RA 1GLAG 1W7AA 5HOOA 5CE3A 5H1SQ 4DCHA 1XC9A 1ATNA 4FJGA 1IKXA 2OANA 4E3SA 3H1QA 1ZBUA 2PBDA 1GOAA 3BZCA 4FVMA 1FK9A 1HNXK 1C1AA 1NMDA 5SZTA 4B3OA 4E19A 2E6MA 2G8KA 3RVCA 4DTXA 4BR7A 2YNGA 1RT4A 4FM1A 3E9OA 4WFAL 4HTLA 4IBNA 5LY3A 4W5RA 1N33K 4XEIA 1EO1A 3ENHA 1TUUA 4KHPK 4KHNA 4CK2A 5K14A 1U45A 5E26A 1RGIA 3DRRA 1S6PA 3A2FA 4YOTA 4V19S 3LL3A 4B1UB 4RW9A 3T3FA 3QICA 4Q5VA 1RNHA 2PFUA 1HKGA 1IJJA 1VQ9N 4L3QA 4CD1A 1BDGA 3S41A 1KSPA 1J54A 1YJNN 3AVGA 3CCUN 2YHAA 1D5AA 1NGDA 2VWJA 3F5TA 4WYBA 4F8RA 1VSKA 2X78A 4CHOA 1KAZA 1Q9YA 2E6LA 4CK1A 2IIRA 4NCGA 3QEPA 3U6FA 1NJYA 3LAKA 4H0PA 2H3GX 4ZHRA 3VA3A 1FJGK 2P9PB 4N76A 1J5EK 2Q1NA 4GV3A 4FJJA 5JLHA 2E2QA 1NKBA 3J7YP 4FWSA 3VOVA 3P4IA 1ZBLA 2D4WA 4DV6K 3QFPA 4E7IA 3HPGA 4G9ZA 2XY8A 1SL1A 5KRSA 4JK8A 2YHXA 4O8KA 3OYNA 3P5JA 4O5BA 3C7NA 4PKHA 4LFCK 2YNIA 5LJVA 4WQ5C 1EKEA 5E41A 4IG0A 3DMJA 1L3SA 3FFKB 3BF3A 5C25A 3TARA 4I2QA 5CYQA 4CE9A 2XY5A 3HBTA 3B6OA 4BC3A 1LW2A 3PLAA 1TK5A 1OH7A 3CC4N 5F2RA 4B9TA 1HQEA 4M3WA 1V4SA 2ZJRL 2QXLA 4KTWA 3R1XA 3KK1A 1C0TA 3R3LA 4DV4K 1X9JA 4W5OA 4X66K 4U67L 3GG4A 3SZ2A 1JCEA 1NK6A 1IO2A 1BIUA 3ZSQA 4E1MA 3TANA 4BQLA 4CFBA 1I94K 4DS5A 3OYIA 1T44A 1SAZA 3NGZA 3NDKA 4BRGA 3OJUA 3V81A 4B9MA 5AQKA 4K42A 5BPMA 3O9UA 3CQXA 1BOTO 4BWJA 4ISEA 3H08A 1YUWA 3VPZA 1NJWA 3BGRA 4CJKA 3QBXA 3QNOA 2NRVA 5J2MA 4F3TA 3FZFA 4IEIA 4NO7A 2PYJA 4RCHA 3SI6A 3SPYA 4DV3K 5KPRA 3CM5A 4YFUA 1UA1A 1RBVA 4BE1A 4DFKA 3VGLA 4CESA 2XO7A 4LF5K 4RTFD 1SKRA 1NLVA 4MO5A 1NOYA 3THWB 4HHTA 1K9MO 4BRLA 3TTCA 3SQ4A 4C8NA 5SWMA 2JWLA 3AARA 2E5LK 3PV8A 3LZJA 4JI8K 5EX5A 1JLCA 1BCOA 1E3MA 3AA3A 1IH7A 4IJAA 4DSEA 4N56A 3K57A 3CCJN 3HRGA 3OS2A 3CJBA 3MCAB 3KK2A 2P1JA 3LDLA 4CCHA 4JI0K 2O8DA 2UU9K 1D9DA 3KKSA 1DLOA 5BRHA 3THVA 4Z4CA 1BU6O 4FL9A 3VEXA 4KTQA 2KZZA 1WSJA 1C1BA 2VWKA 3TSPA 1OH5A 1LV5A 1BA0A 1JLFA 2P9IB 3CMEN 3MXIA 4H4MA 3V1RA 3VQAA 3RSEA 4BRHA 5IWAK 4NYFA 1S1VA 4PWDA 5KTQA 1SZ2A 1K73O 4DSKA 4QS7A 4TSXA 4M7YA 1MWMA 5AQYA 2YKMA 3CF5L 3AVHA 1DT9A 3VEVA 4PQUA 1NM1A 2JWKA 2IVPA 4DV5K 3VGKA 4GVMA 3K5LA 3F73A 3ZETB 4BR2A 3IRXA 2CGJA 3NF9A 4H0XB 3PO5A 1KFSA 3EO3A 2O8CB 3Q7CA 3CXCM 2YJEA 1WSEA 1T7PA 3QEVA 1XWLA 3NVKA 1RBRA 4JRPA 4DTPA 3AVIA 1K8KA 3WEEA 1SS6A 3ZCMA 3O3GA 1IG8A 4FSVA 1ATRA 3R6MA 3DLEA 4M3XA 5AQOA 2X74A 1JLAA 2GWKA 5AQIA 3J8AA 2DFEA 5DM7L 4JEPA 4DTOA 5EY4A 3HVRA 3MXMA 2FBYA 1RDWX 2KHOA 3AVFA 5TKYA 4CZEA 2HMIA 3A0IX 4EP5A 4I2PA 4JI7K 3DLKA 5CHIA 3AVLA 2O8FB 3HO1A 4FZXC 4R79A 1J6ZA 1RCHA 1X3NA 3CJCA 4JLHA 4DMNA 1QQMA 1D4XA 1RDUA 3CMAN 4OKJA 4BE0A 4YY3K 4MQ3A 3THYB 3O9SA 3UKUB 3OYBA 3OYDA 3K5MA 2OPSA 4JKEA 3NE6A 1HNWK 2HBKA 4RW8A 3AA4A 3OTOK 3U9ZA 2P9NA 3PSIA 1TKDA 4AM7A 2Z1GA 4FZYA 4E89A 4IZ9A 4ELUA 2HW3A 3CCRN 3OVNA 1Z26A 2P9LB 2F9TA 2ETJA 3HSTB 1VQLN 4PHTX 4H03B 4FLUA 3JSMA 2E2PA 1Q9XA 1HPMA 4CJ3A 3KZBA 1HMVA 2QTDA 2QWNA 1HYVA 4CIGA 5GAEP 3LDNA 4ILGB 2D1KA 4DR1K 3VF6A 5FPEA 4AHSA 4YORA 1RTHA 4WE1A 1NGFA 2Q97A 3ZSWA 2QWMA 3BEXA 2Q0RA 4GMJB 3HM9A 2P9KB 3CM6A 3CJAA 2ZJQL 2HHUA 3VQ4A 3ZSXA 4MLEA 1Y97A 1G99A 3CQ8A 4B9SA 3FZHA 3UB5A 1QVFM 2ZE2A 1CZ9A 1JXBA 4CF1A 3VTIA 3H1VX 2HHTA 3DLBA 4X64K 4DR5K 4DFPA 3MN9A 4Y1CA 3TTFA 4DV2K 4NXMK 3VQ8A 1BHLA 3CFOA 1QVGM 5LL6Z 2HNYA 3JS6A 1FW6A 4FWPA 3ZT1A 4AM6A 3LP0A 1TV6A 1ZBSA 1W97L 4DFMA 4KAZA 2P9LA 4E1NA 4DR2K 3OS0A 1IBMK 3EE9A 1X3MA 4CJUA 3KJVA 4B9VA 3HI0A 3CC7N 4WCEL 3HOTA 4CEZA 1MDUB 3ULDA 1SKSA 3U4LA 4IWVA 4CBWA 4YNQA 1YF5L 3L2QA 4PA1A 4FW2A 4FLYA 5BPNA 3NCIA 1KVCA 2P9UB 4CGHA 4DS4A 4CJ7A 3UIQA 2O8FA 1REVA 3ID8A 1TKTA 3WXLA 1TL1A 1D8YA 4GKKK 4EHUA 1DTTA 3QDKA 2YHWA 1DEJA 4LF9K 4UY8O 2E8AA 4JK9A 3QFUA 4CIFA 2HOEA 5EOYA 1Y64A 4LF6K 4BC2A 3PUFA 3K9JA 5M1QA 5C2DA 2E1ZA 3GOIA 4CJVA 4M3YA 2G8IA 4CGJA 1UWBA 5CZ1A 4A57A 4WQ4C 5AQGA 4BR0A 1YT3A 1BO5O 4IJNA 3MX2A 1KRPA 3OYHA 4E7LA 3AAPA 3THYA 3O80A 4KHUA 2V52B 4IO9L 4IKFA 5FPNA 2P51A 3IAYA 3JXUA 5C0YA 4WFNL 3GE1A 4H5TA 1RT2A 1EX4A 5C42A 3GBTA 2I7NA 4B08A 1ILYA 3EYZA 1NK9A 2E88A 4A2AA 3EZ5A 1D9FA 1XNRK 4JI1K 4Y1DA 3C65A 3MXJA 1BQMA 4JI4K 4KI6A 5KPZA 1KFDA 3PX0A 1C0MA 2Q3SA 2YI1A 4DF4A 5AFUH 3HJFA 4F4KA 4FPBA 1Q8IA 2DTUA 2VGMA 4LC9B 5TKWA 2E20A 3KLHA 4BACA 1Q86O 4EAHD 3A5LC 1KAYA 3AGKA 4BG9A 4NCAA 4DR3K 3MWTA 4JK7A 4OGEA 4BR5A 3DLRA 4BREA 3P39A 4DHYA 3V1QA 1U04A 1NGIA 3MAQA 5KGXA 2GWJA 5LJWA 3OYGA 1XHZA 1P8ZA 1VSDA 2QM1A 3SK3A 1S1XA 5EXWA 4DKWA 3S3OA 1S5JA 3ULEA 4K8ZA 1C0FA 1TKXA 5I9EB 4DQ8A 4C8OA 3T19A 2W6LA 3NHGA 4IO8A 3GDQA 1Q81O 2P9KA 3EEQA 1N6QA 4AF1A 4M42A 3VETA 1QE1A 4CD3A 3ID6A 1B9FA 4FJMA 3THWA 1JL2A 2UUCK 1Q18A 3MWPA 4DSLA 2KZMA 3O5BA 2XRIA 3ZEUA 1VQ4N 2O8EB 1YITN 4JD2B 4KRFA 3O9RA 2HBJA 4CK3A 1QSSA 4CZJA 4B8AB 1EP4A 5AQVA 1OVQA 4JI3K 4K8XA 1GLJO 1GLFO 2FC0A 3VQPA 2V7ZA 4CEEA 3O3FA 3LM9A 3SJHA 4JKGA 3O08A 5BN8A 4R5PA 1O13A 3TWHA 3ZSYA 1S9GA 4OKEA 1VQKN 3K5OA 2PAVA 4E7HA 4B3RK 2RKIA 4FJ5A 1RT5A 3NF8A 3E1YA 1XI1A 3G10A 3DXMA 1KC8O 3ZSZA 2D0OA 3NFAA 3VGMA 3QBWA 3VA0A 1X9MA 3LANA 1FKOA 1U2VB 3D2EB 3KLIA 4C8KA 2VG7A 2VGNA 3SAFA 4G1QA 3KLGA 5AQJA 3WT0A 1DKGD 3J7ZO 1QZ5A 4JKDA 3E66A 5DM6L 1M1KO 3H3NO 3F9MA 3RRGA 4MFBA 4W5QA 2I7PA 1WNSA 4NYNA 3MCPA 1WLJA 4CJSA 3S3MA 3CPWM 2IOCA 3WQUA 3CD6N 4CECA 3O9QA 1G15A 4CFDA 3THXB 3CJ9A 1M90O 3ZT0A 5CZ2A 1LWEA 5M1PA 3QMLA 1BIZA 3R8EA 2G8UA 1C6VA 4RW4A 1U6ZA 2E1YA 2KLAA 3OYEA 4B3SK 3OY9A 4AHUA 5J2QA 1WUAA 3ISNC 2IS3A 1A5VA 1KXPA 4BVPA 3VEZA 4CHZA 3P1GA 3D45A 2ASMA 2OTLN 1F21A 1NGHA 4WF9L 2GV9A 4BRAA 3A8YA 5C2FA 3C6HA 3WNGA 3WXJA 3NBPA 4O5FA 4PUOA 4DB3A 5E84A 3QEXA 1VQ5N 1NGEA 3CPEA 4DV1K 1HJOA 3CJ1A 3MN7A 4IFYA 3LDSA 4JRQA 4RW6A 2P5GA 2GELA 3O3HA 3FLCO 4N47A 5CYMA 5GIPA 2B4JA 3RMBA 4IDKA 3AO3A 4B9UA 2A40A 4FM2A 2P9UA 4DQIA 4KI4A 2P5OA 3ENOA 1SL2A 1ZC6A 3QB0A 4M41A 4HCBA 1BI4B 3VERA 4Z4FA 4DWIA 3AGRA 1XNQK 4B1WB 5AQRA 4IG3A 4O55A 3HPOA 1RFQA 3O9TA 5FROA 4CJRA 2R7YA 1NG9A 4A5BA 5AQPA 3TSUA 4CJPA 1OH6A 2YCHA 4FOIA 5C24A 2HNZA 3LP1A 3AO2A 4JKCA 1YIJN 3HXMA 3BF1A 4W5TA 2WTUA 1U47A 4MDBA 2X6NA 3L2WA 1B9DA 1RTJA 3AO4A 4OO1J 4FPAA 4CF2A 4DTSA 3I33A 3WEEB 3O8MA 3NMUA 1YVNA 1NK5A 1T03A 3FR0A 1VQMN 1JCGA 1O1WA 3LP2A 5LMNK 3LDQA 3QO9A 4JAXA 5GADP 3M1FA 4KH6A 1BUPA 3FZMA 3VEYA 3VQBA 4QOZB 4PL7A 5AZIB 4M3TA 2HB5A 3NF7A 3U9DA 4EZ9A 1I3AA 1RT3A 3ZETA 1BQNA 3ZX2A 1Z6RA 3U8XA 1KLNA 5GIOA 4OX9K 4GNIA 1CZBA 4E1JA 5AZJA 3LM2A 4FZZA 2A5XA 3ZSOA 3SAGA 2Y1IA 3KIOA 4FK0A 3V9SA 1EETA 5AZIA 2QK9A 4OKKA 4BRQA 3C7NB 3CCLN 1EWQA 1JLEA 4JS4A 4OPHA 3ZT2A 4DUYK 1YTAA 3IG1A 3VESA 3WXIA 3RRHA 3HOSA 3QESA 4CZLA 4DV0K 2IC3A 3DLLL 5AR0A 4IEEA 3QLHA 2HHSA 3NGIA 5AQLA 3DOLA 3BP8A 1VQ6N 3HP6A 1TKZA 4IDHA 3TU5A 5JICA 3DJCA 4I6MA 3EE8A 1LWCA 3F2KA 2ZF5O 3L2RA 4FJKA 4YOWA 3CETA 3QINA 4B1YB 2B5JA 4DTUA 2UUAK 4FWOA 3KKRA 1NK0A 5FPMA 1NGJA 1TAUA 1T8EA 1GLBG 4YOVA 5AQMA 3N4PA 4BRIA 4N41A 3CJ7A 2W40A 3MN5A 1WB9A 5AQHA 4Y0WA 3H3OB 2FF6A 3VMFB 3L2UA 1SKWA 2XY6A 1WOQA 1WBBA 4CF0A 3V9WA 4O44A 1X9SA 2DFFA 3SUPA 1VSLA 3ZYYX 2OCEA 4FWLA 3BUZB 3LAMA 3OYFA 3AVAA 1NNEA 5ADXH 3OW2M 4I9QA 2QEXN 2VG5A 1UOCA 2GUPA 1IKWA 1HPZA 2O4GA 4DQQA 1V4TA 3L4QA 4JKBA 4J2AA 5KPTA 3JAMO 1XC3A 1YHQN 1GOCA 4B1VA 1RTIA 1ZBIA 3OYMA 3OYCA 4KHQA 4HUGA 3HTVA 3MDQA 4CGGA 5C15A 2NRWA 3OYAA 4CEFA 1EXQA 3ZSVA 1SL0A 4FJ7A 5GAHP 4JNEA 1TL3A 1JCFA 4ISGA 4M45A 2G8FA 4CEQA 4NCBA 1TGOA 4FLXA 4H5NA 5B8HA 1GLEG 4K25A 4ZTJA 2HF3A 4IFVA 4KH5A 1U4BA 3BZKA 1BI4A 3MN6A 3DXMB 3WNFA 1VQON 3ATVA 4BQZA 2BH1A 3HM8A 3OYKA 3EKSA 3OYJA 5EVZA 2A41A 3T69A 3DYAA 3L6QA 4GV6A 3A5NC 4LFAK 2NLXA 1NGBA 4EIAA 5LMUK 3KLEA 1LAVA 4PY5A 2D0CA 3ALYA 3BY5A 3E01A 2ZGYA 1YJ9N 2O8BB 4JI2K 2AJQA 3DWLA 1Q7YO 4KHYA 5HLFA 2EX3A 5AQQA 4CEAA 3R9PA 4YOUA 2QKBA 2E2NA 4CHQA 2F7TA 3FGUA 4J8FA 4CHNA 2NRZA 1TK8A 4DTMA 2O8BA 2RHKA 4ZTFA 2P9SA 3CYMA 1UAXA
chains in the Genus database with same CATH topology
5BR8K 5LMNK 5IT9O 2UXCK 4YY3K 1IBMK 4DR3K 2UUBK 4NXNK 4LFCK 1HNWK 3JAMO 3OTOK 1IBKK 2UXDK 4B3MK 4DR7K 3T1HK 1N36K 4OX9K 5IWAK 1HNXK 4B3SK 4LF8K 4K0KK 4DV4K 1N34K 4DR6K 4X66K 4GKKK 1IBLK 4LF9K 1N33K 1HR0K 4KHPK 4DUYK 3J81O 3J7AP 4DR1K 5A2QO 1I94K 4JYAK 4LF6K 4DV0K 4DV5K 2UUCK 4JI5K 4V19S 4B3TK 4DV1K 5FLXO 1XMOK 1XMQK 2VQFK 4JI3K 4LFAK 2UUAK 5LMUK 4DV3K 1HNZK 4YHHK 3T1YK 4LF5K 5AJ3K 1XNQK 2VQEK 4JI2K 4LFBK 2ZM6K 4X64K 4JI6K 4DR5K 2HHHK 1FJGK 1J5EK 4DV2K 4NXMK 1XNRK 4GKJK 3J80O 2E5LK 4JI1K 4B3RK 4DUZK 4LF7K 5LL6Z 4CVNE 4JI8K 4X62K 4JI4K 3J7YP 2F4VK 1N32K 4JI7K 4DR4K 4JI0K 4DV7K 4LF4K 4X65K 4DV6K 4CW7B 4AQYK 2UXBK 4DR2K 2UU9K 4JV5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 K;  5LMN K;  5IT9 O;  2UXC K;  4YY3 K;  1IBM K;  4DR3 K;  2UUB K;  4NXN K;  4LFC K;  1HNW K;  3JAM O;  3OTO K;  1IBK K;  2UXD K;  4B3M K;  4DR7 K;  3T1H K;  1N36 K;  4OX9 K;  5IWA K;  1HNX K;  4B3S K;  4LF8 K;  4K0K K;  4DV4 K;  1N34 K;  4DR6 K;  4X66 K;  4GKK K;  1IBL K;  4LF9 K;  1N33 K;  1HR0 K;  4KHP K;  4DUY K;  3J81 O;  3J7A P;  4DR1 K;  5A2Q O;  1I94 K;  4JYA K;  4LF6 K;  4DV0 K;  4DV5 K;  2UUC K;  4JI5 K;  4V19 S;  4B3T K;  4DV1 K;  5FLX O;  1XMO K;  1XMQ K;  2VQF K;  4JI3 K;  4LFA K;  2UUA K;  5LMU K;  4DV3 K;  1HNZ K;  4YHH K;  3T1Y K;  4LF5 K;  5AJ3 K;  1XNQ K;  2VQE K;  4JI2 K;  4LFB K;  2ZM6 K;  4X64 K;  4JI6 K;  4DR5 K;  2HHH K;  1FJG K;  1J5E K;  4DV2 K;  4NXM K;  1XNR K;  4GKJ K;  3J80 O;  2E5L K;  4JI1 K;  4B3R K;  4DUZ K;  4LF7 K;  5LL6 Z;  4CVN E;  4JI8 K;  4X62 K;  4JI4 K;  3J7Y P;  2F4V K;  1N32 K;  4JI7 K;  4DR4 K;  4JI0 K;  4DV7 K;  4LF4 K;  4X65 K;  4DV6 K;  4CW7 B;  4AQY K;  2UXB K;  4DR2 K;  2UU9 K;  4JV5 K; 
#chains in the Genus database with same CATH topology
 3THX A;  5BR8 K;  4M7X A;  3TAP A;  4A59 A;  1IKV A;  4Z4H A;  2FBT A;  4ILJ A;  1FKP A;  3QNN A;  2YNF A;  1J5O A;  2HHQ A;  5AFU A;  1IBK K;  3G0Z A;  3L2V A;  2ITG A;  1A5W A;  3T1A A;  3W3D A;  3P83 D;  2ATQ A;  2P9S B;  1U49 A;  5KRT A;  4B9L A;  3C6U A;  1E4F T;  1U2V A;  3ZX0 A;  3CFP A;  5J2P A;  1B92 A;  4AHR A;  1L3U A;  2Q31 A;  4O4G A;  4WQ4 A;  3UE5 A;  4AH9 A;  3AO5 A;  1N34 K;  4AHT A;  4BC4 A;  2HST A;  4C23 A;  4JS5 A;  3TAB A;  3RMA A;  1RDD A;  1K8A O;  4KFB A;  1TVR A;  3QIO A;  3J7A P;  1W9H A;  5MLC Q;  3PIO L;  2DPN A;  1C1C A;  1HRH A;  2NRT A;  3CCQ N;  1JKH A;  1CXQ A;  3KD1 E;  4JKG B;  3A5M C;  2E2O A;  4CJW A;  2BTF A;  2V7Y A;  1S1T A;  5FLX O;  2ZQB A;  1NK4 A;  2E4L A;  4QAG A;  3SMP A;  4LY7 A;  2CGL A;  4IOA L;  3O4W A;  1XQS C;  3P31 A;  3G71 N;  3NH0 A;  3I56 N;  2RF2 A;  4FJL A;  3OBY A;  2HBL A;  4CZK A;  5AZJ B;  3O6W A;  5JS2 A;  4OPJ A;  4YHH K;  3RMC A;  4A62 A;  2NRR A;  1VSI A;  2VQE K;  1NMN A;  2UYT A;  4BRN A;  3S3N A;  3SV3 A;  1R0A A;  3HVT A;  4DSI A;  4GKJ K;  2PYL A;  3RWU A;  1ZBF A;  4LF7 K;  1LAW A;  4N5S A;  1KD1 O;  4OPK A;  4Z4G A;  3V6D A;  2GX9 A;  3VTH A;  1L3T A;  1YXQ A;  1VQN N;  4H5V A;  3V9Z A;  2YHB A;  2Q2R A;  3ULE B;  4BRD A;  3SUN A;  1OKJ A;  2KQ2 A;  3M8S A;  4FCY A;  3SV4 A;  2QWP A;  1VSH A;  1VRU A;  3C95 A;  3VF4 A;  3KK7 A;  1UA0 A;  2RN2 A;  2UXC K;  4CZM A;  4B1X B;  3PY8 A;  4PL8 A;  3CCV N;  3FE1 A;  4NLC A;  1YI2 N;  5AQX A;  4DG1 A;  2OYQ A;  3L8B A;  3TAE A;  3IMX A;  4CBU A;  4I7F A;  2ZD1 A;  4XIU A;  1KLM A;  1WAF A;  4CHP A;  1K6Y A;  1RT1 A;  3HL8 A;  2Q36 A;  3I8B A;  1HJR A;  3LAL A;  3NVM A;  2ZWH A;  3CI5 A;  4E7J A;  1TYQ A;  4BY9 C;  1CLQ A;  4B1Z A;  1YJW N;  4ELV A;  3WXM B;  1NGA A;  3SUO A;  1Z05 A;  5AQZ A;  1IBL K;  4C1N K;  1VAZ A;  2IGI A;  4JKF A;  1YTU A;  3L3V A;  2YV0 X;  3AVM A;  1ASU A;  5J2N A;  4O8U A;  4GY2 B;  4B8C A;  3H45 C;  3VEW A;  1QHA A;  4MLH A;  3KWG A;  1XMQ K;  3SBT A;  4BRC A;  4RG8 A;  4BRP A;  3QET A;  3PSF A;  1TAQ A;  3O1B A;  4DF8 A;  1W0H A;  2VQF K;  2F8S A;  2D0A A;  3DLH A;  1HYZ A;  1BL3 A;  3T7Z A;  1MU2 A;  5AQN A;  1OH8 A;  1NOZ A;  2PY5 A;  3CFR A;  3LP3 A;  4NLB A;  4KB0 A;  2CH6 A;  2HF4 A;  4F3O A;  2FBV A;  2DY4 A;  5C10 A;  5BRD A;  4CJE A;  3G4S N;  2OPP A;  4CVN E;  4CZH A;  3TPQ A;  1SUQ A;  5HRO A;  1BG3 A;  4OJR A;  3VQD A;  1N32 K;  3K59 A;  3ZEU B;  2O8E A;  3ZLJ A;  1CXU A;  3AA2 A;  4KPY A;  4DV7 K;  4X65 K;  1T3V A;  1WSG A;  3AA5 X;  3CG7 A;  3VQE A;  4AHC A;  3D2F B;  3LPU A;  4FWK A;  2KW4 A;  3HPH A;  3V4I A;  4NXN K;  4OVL A;  1S22 A;  4ID5 A;  2NZT A;  3O4Q A;  3VF2 A;  5KQD A;  1IKY A;  1QS4 A;  1JLG A;  4CJQ A;  1YVU A;  3VQ7 A;  3HP9 A;  4H0V B;  2I5J A;  5HRN A;  4BDZ A;  2EWS A;  4FWQ A;  3VQ6 A;  1N36 K;  1LCU A;  3MEG A;  4GW6 A;  3CCS N;  4KV8 A;  4CJ5 A;  2A3Z A;  3D6R A;  4LF8 K;  4I6M B;  4CGD A;  1VSM A;  1I39 A;  2WON A;  2YNH A;  3D7E O;  1T05 A;  3SPZ A;  4KB1 A;  2LSN A;  2F9W A;  4IXC A;  1HUX A;  2GEM A;  3QIP A;  3U3Y A;  4WFB L;  4FVU A;  5A2Q O;  2KKZ A;  3PX4 A;  4BDY A;  2A42 A;  4CEB A;  4LSL A;  4BRO A;  4FJH A;  1NGC A;  4DQS A;  1QSY A;  3ASM A;  3KVG A;  4BGA A;  4CF9 A;  1ASV A;  1RDB A;  2FXU A;  5JVG L;  1QQC A;  3L4I A;  5AQW A;  1JLB A;  2OPQ A;  3DI6 A;  3CCE N;  1VK0 A;  2QA4 N;  3NF6 A;  5AQU A;  4CFA A;  3RR7 A;  3HK2 A;  3M8P A;  4JHD B;  1SV5 A;  3RTV A;  4F2S A;  1NK8 A;  3D2E A;  4O0J A;  2HHW A;  4ELT A;  4DLE A;  3E9L A;  2OPR A;  3DAW A;  4DSJ A;  4F9O A;  2QWO A;  2WOM A;  3TAM A;  4Z0U A;  1NKC A;  3KLF A;  1N5Y A;  3WQT A;  2FSJ A;  4Q0B A;  3DXK B;  1HLU A;  4B9Q A;  5KI6 A;  3DOK A;  4CEO A;  3SJJ A;  5I3U A;  4EZ6 A;  3I0R A;  2OA8 A;  5AQF A;  3VQC A;  2WFB A;  2HHV A;  3CER A;  3ITH A;  4LF4 K;  3EN9 A;  3VQ9 A;  5HRR A;  4JV5 K;  4QCL A;  5BRE A;  3MX5 A;  3TTD A;  2G8W A;  3MK6 A;  3V1O A;  4BRF A;  4ID1 A;  4FLW A;  3K58 A;  4H0Y B;  4XH5 A;  2W6K A;  2BUP A;  1S6Q A;  5DMR A;  3CCM N;  1S9E A;  4QS8 A;  3UKU A;  1EWR A;  3UKR B;  1NJX A;  5KGW A;  3WUH A;  4Z4E A;  1U48 A;  3KWI A;  3LWL A;  1KAX A;  4FLT A;  1S3X A;  2F8T A;  3N4Q A;  5GIN A;  4H0O A;  1VQ7 N;  1HNI A;  4OPA A;  3SNN A;  3IKM A;  5JS1 A;  3LDP A;  4FWM A;  3AVJ A;  2GBZ A;  1ASW A;  4KHW A;  2HBM A;  4FJ8 A;  2G8V A;  2BAN A;  5J1E A;  2GUI A;  4EFH A;  1C0G A;  2YKN A;  4LH4 A;  1L5U A;  4B3T K;  3TAG A;  2GTD A;  1WBD A;  2FF3 B;  3ZT4 A;  2HVI A;  3NH2 A;  1VSJ A;  3GL1 A;  4IOX A;  3DXK A;  5M1K A;  2W42 A;  2FSK A;  4KRE A;  5I42 A;  4FJN A;  3C94 A;  4A2B A;  2KFZ A;  1RBS A;  3EKU A;  1HKB A;  1QSL A;  3D2F A;  3AVC A;  5KQ8 A;  3JYT A;  3SYZ A;  3DLG A;  5AJ3 K;  1S1U A;  3EL2 A;  1VSF A;  4BC5 A;  4LFB K;  3MED A;  4DSF A;  1RT7 A;  3WNE A;  2AA4 A;  1VHX A;  3H46 O;  4BGB A;  2EHG A;  2BGG A;  4YDU A;  4DUZ K;  4BRK A;  3O4N A;  4KTZ A;  4M63 C;  3TSQ A;  3SQ1 A;  2WBN A;  4BE2 A;  3BDP A;  1C0U A;  4U7B A;  4DTN A;  4CER A;  3SUQ A;  5HP1 A;  1Q82 O;  4OLA A;  1J53 A;  1CZA N;  3TR8 A;  3SMS A;  1W2B M;  1QQO A;  3G25 A;  4CJT A;  4DQP A;  1LW0 A;  4WQ5 A;  3M6G A;  4IFE A;  3M3Z A;  3V9X A;  1NBW A;  2G8H A;  4FJX A;  1VSE A;  2UXD K;  2KTQ A;  4A61 A;  2XY7 A;  2FBX A;  5C12 A;  4B3M K;  2AP1 A;  4ILH A;  2Y1J A;  1QTM A;  5FDL A;  3QEI A;  4HUF A;  3A5O C;  2ASP A;  1A5X A;  3AAQ A;  1HX1 A;  3OA9 A;  2ITM A;  2O8D B;  3VN5 A;  1KVB A;  4FM0 A;  4BDP A;  4NB4 A;  3LWM A;  3CHW A;  4RW7 A;  5JLF A;  4CGI A;  3NH1 A;  4JD2 A;  3EY1 A;  3NGY A;  1KCF A;  3B8A X;  2KFN A;  2CGK A;  2OTJ N;  4CIE A;  5ADX A;  4CFC A;  3J81 O;  1VQP N;  1GLD G;  4KKO A;  1LOT B;  5BPL A;  2VWB A;  4FLV A;  1MA9 B;  2Z1I A;  3LDO A;  2FSN A;  1GLL O;  3UKR A;  1JJ2 M;  3DRP A;  2YHY A;  1N8R O;  5AQS A;  4J2E A;  1WN7 A;  1XMO K;  4DU3 A;  1RIL A;  4DTJ A;  3ATU A;  4BG8 A;  1NU0 A;  3K5N A;  4UQG A;  3IUC A;  1ZXO A;  1WSF A;  4FK2 A;  2D0P A;  2BDP A;  4OLB A;  4FK4 A;  1HNV A;  2P9P A;  2IDO A;  3AV9 A;  2Q0U A;  4CJL A;  3HSC A;  5BRF A;  1K8K B;  1RBT A;  4B9N A;  4YOY A;  4DQR A;  4E0D A;  1VRT A;  3SAH A;  3P38 A;  5FRM A;  2O4I A;  4MO4 A;  1ITG A;  2HHH K;  1BWF O;  3EZW A;  4AIL C;  3DRS A;  2B6A A;  4YOX A;  3M8Q A;  2NRX A;  2P9N B;  3K0S A;  1XUP O;  1WSH A;  3IS9 A;  3O1W A;  4KO0 A;  4LD0 A;  1DTQ A;  3DM2 A;  4HVJ A;  3CC2 N;  3I55 N;  4FXD A;  5JVH L;  4CHY A;  4YDU C;  5FPD A;  4CW7 B;  1BGX T;  3F9K A;  3V9U A;  4CZI A;  1NK7 A;  4CJ4 A;  3AVB A;  4PKI A;  3L0Q A;  3TAF A;  5IT9 O;  1RTD A;  4ICL A;  4FYD A;  4IOC L;  2UUB K;  3FZL A;  3KD5 E;  3OJS A;  1T6D A;  4DU1 A;  2JGU A;  2QWR A;  5HRP A;  3G6E N;  3LPT A;  3NAE A;  3SLC A;  5M1O A;  2HND A;  4K41 A;  3KHY A;  4L8R B;  4LH5 A;  1P90 A;  2PZS A;  2HHX A;  3ZT3 A;  3SCX A;  1JLQ A;  3HYF A;  4H0T B;  4PKG A;  3PX6 A;  4RWT A;  5D3G A;  5BR9 A;  3M5R A;  2Z1J A;  1QZ6 A;  4JKA A;  2A1R A;  5HBM A;  2P9I A;  1BCM A;  4K43 A;  4H8K A;  2X6S A;  4KBO A;  4BRM A;  4K0K K;  1WSI A;  4DR6 K;  1J9A A;  2NNW A;  4CED A;  1YAG A;  5HL7 L;  1NWK A;  1SQK A;  5F1X A;  4MDA A;  3AO1 A;  4CF8 A;  5F0X A;  4HCC A;  4GVE A;  4JYA K;  4CI6 A;  4FJ9 A;  4CZG A;  2HMP A;  4JI5 K;  2OZM A;  4AHV A;  3M8R A;  4JHD A;  3VQQ A;  1GLC G;  4H5W A;  5M1N A;  2A6A A;  5CY4 A;  3RR8 A;  2VG6 A;  2VCP A;  4JKH A;  4DTR A;  2YX6 A;  4W5N A;  4CJF A;  4DLG A;  1KQS M;  3C0B A;  3IFR A;  3OYL A;  1ATS A;  4ISF A;  3RMD A;  3QEW A;  1MWK A;  4EHT A;  3K2P A;  4H4O A;  4JN4 A;  3ZX3 A;  3T1Y K;  1X1P A;  2XHB A;  4HTU A;  4FWR A;  4E7K A;  2NUB A;  1JL1 A;  2VYP A;  1JXE A;  2F96 A;  4HWI A;  1S72 N;  3B6P A;  4KHS A;  3CQY A;  4JI6 K;  3VEO A;  3W0L A;  5HRS A;  2A1S A;  2ZJP L;  4M3R A;  2ZGZ A;  3MEE A;  3WNH A;  3MEC A;  3IDH A;  3AVN A;  4M3Z A;  4X62 K;  4M3U A;  4CGF A;  2QKK A;  1NJZ A;  5T7B A;  4FLZ A;  4C8L A;  3WXK A;  1TK0 A;  3ENB A;  2Z1H A;  4FW1 A;  2UXB K;  1KTQ A;  2D0B A;  3OS1 A;  2CH5 A;  4FOE A;  5M1F A;  1RT6 A;  1ZYQ A;  1RBU A;  4XH4 A;  2HVH A;  2WC9 A;  3SBG A;  1Z25 A;  1E4G T;  1WAJ A;  2IVN A;  4DFJ A;  4FJI A;  3FFI A;  4LSN A;  4DR7 K;  2IVO A;  2QWL A;  1RDA A;  4BWM A;  3PIP L;  3T1H K;  4QS9 A;  5FRN A;  5DK5 A;  2ASO A;  1KVA A;  3C6A A;  5ELZ A;  5BN9 A;  1FXX A;  4FO0 A;  3C6T A;  2IAJ A;  3OHR A;  4BR9 A;  4C8M A;  3SQ0 A;  4H5R A;  1RDC A;  2QW9 A;  1HR0 K;  1TYQ B;  1L3V A;  2WUS A;  1ESV A;  4FWN A;  3D0P A;  3Q7B A;  2J4R A;  1X9W A;  4Z94 A;  4GV9 A;  4HUE A;  1QQN A;  2NRH A;  1QHT A;  1HKC A;  5GAG P;  1TUY A;  3TAQ A;  2QWQ A;  3E9P A;  3ZSR A;  4KH4 A;  2O8C A;  4EP4 A;  2BE2 A;  4Z4I A;  3VQ5 A;  4BVO A;  1DGK N;  3I0S A;  5AQT A;  5EU7 A;  3OBW A;  1NJI O;  2QXF A;  3AY9 A;  4J2D A;  3VEN A;  2W41 A;  1LWF A;  1HNZ K;  2RPI A;  1BIS A;  1GOB A;  1OVY A;  3AVK A;  4OGC A;  4J2B A;  3FZK A;  2FLO A;  2ZM6 K;  2DFH A;  3HT3 A;  3KTQ A;  3H6E A;  1H1V A;  3L3U A;  3J80 O;  2RE2 A;  5JMV A;  4DU4 A;  2JLE A;  2YJF A;  1HQU A;  1EQY A;  4CBX A;  2F4V K;  3K9K A;  1IG9 A;  3RSE B;  1XHX A;  1ZBH A;  3QER A;  4DR4 K;  2D5R A;  4C1N I;  1NKE A;  4AQY K;  3SQ2 A;  2V51 B;  4CZF A;  3I8D A;  5CR4 A;  4O0I A;  3LZI A;  3U3G A;  2QI2 A;  1BA1 A;  1NGG A;  4A5A A;  4BR4 A;  1VQ8 N;  4XH1 A;  4I9L A;  1R59 O;  1HYS A;  3KK3 A;  1T6C A;  2OZS A;  1S1W A;  3TI0 A;  3S9H A;  3CIP A;  3HZ6 A;  3MMV A;  3PO4 A;  1IV0 A;  4F2R A;  1GLA G;  1W7A A;  5HOO A;  5CE3 A;  5H1S Q;  4DCH A;  1XC9 A;  1ATN A;  4FJG A;  1IKX A;  2OAN A;  4E3S A;  3H1Q A;  1ZBU A;  2PBD A;  1GOA A;  3BZC A;  4FVM A;  1FK9 A;  1HNX K;  1C1A A;  1NMD A;  5SZT A;  4B3O A;  4E19 A;  2E6M A;  2G8K A;  3RVC A;  4DTX A;  4BR7 A;  2YNG A;  1RT4 A;  4FM1 A;  3E9O A;  4WFA L;  4HTL A;  4IBN A;  5LY3 A;  4W5R A;  1N33 K;  4XEI A;  1EO1 A;  3ENH A;  1TUU A;  4KHP K;  4KHN A;  4CK2 A;  5K14 A;  1U45 A;  5E26 A;  1RGI A;  3DRR A;  1S6P A;  3A2F A;  4YOT A;  4V19 S;  3LL3 A;  4B1U B;  4RW9 A;  3T3F A;  3QIC A;  4Q5V A;  1RNH A;  2PFU A;  1HKG A;  1IJJ A;  1VQ9 N;  4L3Q A;  4CD1 A;  1BDG A;  3S41 A;  1KSP A;  1J54 A;  1YJN N;  3AVG A;  3CCU N;  2YHA A;  1D5A A;  1NGD A;  2VWJ A;  3F5T A;  4WYB A;  4F8R A;  1VSK A;  2X78 A;  4CHO A;  1KAZ A;  1Q9Y A;  2E6L A;  4CK1 A;  2IIR A;  4NCG A;  3QEP A;  3U6F A;  1NJY A;  3LAK A;  4H0P A;  2H3G X;  4ZHR A;  3VA3 A;  1FJG K;  2P9P B;  4N76 A;  1J5E K;  2Q1N A;  4GV3 A;  4FJJ A;  5JLH A;  2E2Q A;  1NKB A;  3J7Y P;  4FWS A;  3VOV A;  3P4I A;  1ZBL A;  2D4W A;  4DV6 K;  3QFP A;  4E7I A;  3HPG A;  4G9Z A;  2XY8 A;  1SL1 A;  5KRS A;  4JK8 A;  2YHX A;  4O8K A;  3OYN A;  3P5J A;  4O5B A;  3C7N A;  4PKH A;  4LFC K;  2YNI A;  5LJV A;  4WQ5 C;  1EKE A;  5E41 A;  4IG0 A;  3DMJ A;  1L3S A;  3FFK B;  3BF3 A;  5C25 A;  3TAR A;  4I2Q A;  5CYQ A;  4CE9 A;  2XY5 A;  3HBT A;  3B6O A;  4BC3 A;  1LW2 A;  3PLA A;  1TK5 A;  1OH7 A;  3CC4 N;  5F2R A;  4B9T A;  1HQE A;  4M3W A;  1V4S A;  2ZJR L;  2QXL A;  4KTW A;  3R1X A;  3KK1 A;  1C0T A;  3R3L A;  4DV4 K;  1X9J A;  4W5O A;  4X66 K;  4U67 L;  3GG4 A;  3SZ2 A;  1JCE A;  1NK6 A;  1IO2 A;  1BIU A;  3ZSQ A;  4E1M A;  3TAN A;  4BQL A;  4CFB A;  1I94 K;  4DS5 A;  3OYI A;  1T44 A;  1SAZ A;  3NGZ A;  3NDK A;  4BRG A;  3OJU A;  3V81 A;  4B9M A;  5AQK A;  4K42 A;  5BPM A;  3O9U A;  3CQX A;  1BOT O;  4BWJ A;  4ISE A;  3H08 A;  1YUW A;  3VPZ A;  1NJW A;  3BGR A;  4CJK A;  3QBX A;  3QNO A;  2NRV A;  5J2M A;  4F3T A;  3FZF A;  4IEI A;  4NO7 A;  2PYJ A;  4RCH A;  3SI6 A;  3SPY A;  4DV3 K;  5KPR A;  3CM5 A;  4YFU A;  1UA1 A;  1RBV A;  4BE1 A;  4DFK A;  3VGL A;  4CES A;  2XO7 A;  4LF5 K;  4RTF D;  1SKR A;  1NLV A;  4MO5 A;  1NOY A;  3THW B;  4HHT A;  1K9M O;  4BRL A;  3TTC A;  3SQ4 A;  4C8N A;  5SWM A;  2JWL A;  3AAR A;  2E5L K;  3PV8 A;  3LZJ A;  4JI8 K;  5EX5 A;  1JLC A;  1BCO A;  1E3M A;  3AA3 A;  1IH7 A;  4IJA A;  4DSE A;  4N56 A;  3K57 A;  3CCJ N;  3HRG A;  3OS2 A;  3CJB A;  3MCA B;  3KK2 A;  2P1J A;  3LDL A;  4CCH A;  4JI0 K;  2O8D A;  2UU9 K;  1D9D A;  3KKS A;  1DLO A;  5BRH A;  3THV A;  4Z4C A;  1BU6 O;  4FL9 A;  3VEX A;  4KTQ A;  2KZZ A;  1WSJ A;  1C1B A;  2VWK A;  3TSP A;  1OH5 A;  1LV5 A;  1BA0 A;  1JLF A;  2P9I B;  3CME N;  3MXI A;  4H4M A;  3V1R A;  3VQA A;  3RSE A;  4BRH A;  5IWA K;  4NYF A;  1S1V A;  4PWD A;  5KTQ A;  1SZ2 A;  1K73 O;  4DSK A;  4QS7 A;  4TSX A;  4M7Y A;  1MWM A;  5AQY A;  2YKM A;  3CF5 L;  3AVH A;  1DT9 A;  3VEV A;  4PQU A;  1NM1 A;  2JWK A;  2IVP A;  4DV5 K;  3VGK A;  4GVM A;  3K5L A;  3F73 A;  3ZET B;  4BR2 A;  3IRX A;  2CGJ A;  3NF9 A;  4H0X B;  3PO5 A;  1KFS A;  3EO3 A;  2O8C B;  3Q7C A;  3CXC M;  2YJE A;  1WSE A;  1T7P A;  3QEV A;  1XWL A;  3NVK A;  1RBR A;  4JRP A;  4DTP A;  3AVI A;  1K8K A;  3WEE A;  1SS6 A;  3ZCM A;  3O3G A;  1IG8 A;  4FSV A;  1ATR A;  3R6M A;  3DLE A;  4M3X A;  5AQO A;  2X74 A;  1JLA A;  2GWK A;  5AQI A;  3J8A A;  2DFE A;  5DM7 L;  4JEP A;  4DTO A;  5EY4 A;  3HVR A;  3MXM A;  2FBY A;  1RDW X;  2KHO A;  3AVF A;  5TKY A;  4CZE A;  2HMI A;  3A0I X;  4EP5 A;  4I2P A;  4JI7 K;  3DLK A;  5CHI A;  3AVL A;  2O8F B;  3HO1 A;  4FZX C;  4R79 A;  1J6Z A;  1RCH A;  1X3N A;  3CJC A;  4JLH A;  4DMN A;  1QQM A;  1D4X A;  1RDU A;  3CMA N;  4OKJ A;  4BE0 A;  4YY3 K;  4MQ3 A;  3THY B;  3O9S A;  3UKU B;  3OYB A;  3OYD A;  3K5M A;  2OPS A;  4JKE A;  3NE6 A;  1HNW K;  2HBK A;  4RW8 A;  3AA4 A;  3OTO K;  3U9Z A;  2P9N A;  3PSI A;  1TKD A;  4AM7 A;  2Z1G A;  4FZY A;  4E89 A;  4IZ9 A;  4ELU A;  2HW3 A;  3CCR N;  3OVN A;  1Z26 A;  2P9L B;  2F9T A;  2ETJ A;  3HST B;  1VQL N;  4PHT X;  4H03 B;  4FLU A;  3JSM A;  2E2P A;  1Q9X A;  1HPM A;  4CJ3 A;  3KZB A;  1HMV A;  2QTD A;  2QWN A;  1HYV A;  4CIG A;  5GAE P;  3LDN A;  4ILG B;  2D1K A;  4DR1 K;  3VF6 A;  5FPE A;  4AHS A;  4YOR A;  1RTH A;  4WE1 A;  1NGF A;  2Q97 A;  3ZSW A;  2QWM A;  3BEX A;  2Q0R A;  4GMJ B;  3HM9 A;  2P9K B;  3CM6 A;  3CJA A;  2ZJQ L;  2HHU A;  3VQ4 A;  3ZSX A;  4MLE A;  1Y97 A;  1G99 A;  3CQ8 A;  4B9S A;  3FZH A;  3UB5 A;  1QVF M;  2ZE2 A;  1CZ9 A;  1JXB A;  4CF1 A;  3VTI A;  3H1V X;  2HHT A;  3DLB A;  4X64 K;  4DR5 K;  4DFP A;  3MN9 A;  4Y1C A;  3TTF A;  4DV2 K;  4NXM K;  3VQ8 A;  1BHL A;  3CFO A;  1QVG M;  5LL6 Z;  2HNY A;  3JS6 A;  1FW6 A;  4FWP A;  3ZT1 A;  4AM6 A;  3LP0 A;  1TV6 A;  1ZBS A;  1W97 L;  4DFM A;  4KAZ A;  2P9L A;  4E1N A;  4DR2 K;  3OS0 A;  1IBM K;  3EE9 A;  1X3M A;  4CJU A;  3KJV A;  4B9V A;  3HI0 A;  3CC7 N;  4WCE L;  3HOT A;  4CEZ A;  1MDU B;  3ULD A;  1SKS A;  3U4L A;  4IWV A;  4CBW A;  4YNQ A;  1YF5 L;  3L2Q A;  4PA1 A;  4FW2 A;  4FLY A;  5BPN A;  3NCI A;  1KVC A;  2P9U B;  4CGH A;  4DS4 A;  4CJ7 A;  3UIQ A;  2O8F A;  1REV A;  3ID8 A;  1TKT A;  3WXL A;  1TL1 A;  1D8Y A;  4GKK K;  4EHU A;  1DTT A;  3QDK A;  2YHW A;  1DEJ A;  4LF9 K;  4UY8 O;  2E8A A;  4JK9 A;  3QFU A;  4CIF A;  2HOE A;  5EOY A;  1Y64 A;  4LF6 K;  4BC2 A;  3PUF A;  3K9J A;  5M1Q A;  5C2D A;  2E1Z A;  3GOI A;  4CJV A;  4M3Y A;  2G8I A;  4CGJ A;  1UWB A;  5CZ1 A;  4A57 A;  4WQ4 C;  5AQG A;  4BR0 A;  1YT3 A;  1BO5 O;  4IJN A;  3MX2 A;  1KRP A;  3OYH A;  4E7L A;  3AAP A;  3THY A;  3O80 A;  4KHU A;  2V52 B;  4IO9 L;  4IKF A;  5FPN A;  2P51 A;  3IAY A;  3JXU A;  5C0Y A;  4WFN L;  3GE1 A;  4H5T A;  1RT2 A;  1EX4 A;  5C42 A;  3GBT A;  2I7N A;  4B08 A;  1ILY A;  3EYZ A;  1NK9 A;  2E88 A;  4A2A A;  3EZ5 A;  1D9F A;  1XNR K;  4JI1 K;  4Y1D A;  3C65 A;  3MXJ A;  1BQM A;  4JI4 K;  4KI6 A;  5KPZ A;  1KFD A;  3PX0 A;  1C0M A;  2Q3S A;  2YI1 A;  4DF4 A;  5AFU H;  3HJF A;  4F4K A;  4FPB A;  1Q8I A;  2DTU A;  2VGM A;  4LC9 B;  5TKW A;  2E20 A;  3KLH A;  4BAC A;  1Q86 O;  4EAH D;  3A5L C;  1KAY A;  3AGK A;  4BG9 A;  4NCA A;  4DR3 K;  3MWT A;  4JK7 A;  4OGE A;  4BR5 A;  3DLR A;  4BRE A;  3P39 A;  4DHY A;  3V1Q A;  1U04 A;  1NGI A;  3MAQ A;  5KGX A;  2GWJ A;  5LJW A;  3OYG A;  1XHZ A;  1P8Z A;  1VSD A;  2QM1 A;  3SK3 A;  1S1X A;  5EXW A;  4DKW A;  3S3O A;  1S5J A;  3ULE A;  4K8Z A;  1C0F A;  1TKX A;  5I9E B;  4DQ8 A;  4C8O A;  3T19 A;  2W6L A;  3NHG A;  4IO8 A;  3GDQ A;  1Q81 O;  2P9K A;  3EEQ A;  1N6Q A;  4AF1 A;  4M42 A;  3VET A;  1QE1 A;  4CD3 A;  3ID6 A;  1B9F A;  4FJM A;  3THW A;  1JL2 A;  2UUC K;  1Q18 A;  3MWP A;  4DSL A;  2KZM A;  3O5B A;  2XRI A;  3ZEU A;  1VQ4 N;  2O8E B;  1YIT N;  4JD2 B;  4KRF A;  3O9R A;  2HBJ A;  4CK3 A;  1QSS A;  4CZJ A;  4B8A B;  1EP4 A;  5AQV A;  1OVQ A;  4JI3 K;  4K8X A;  1GLJ O;  1GLF O;  2FC0 A;  3VQP A;  2V7Z A;  4CEE A;  3O3F A;  3LM9 A;  3SJH A;  4JKG A;  3O08 A;  5BN8 A;  4R5P A;  1O13 A;  3TWH A;  3ZSY A;  1S9G A;  4OKE A;  1VQK N;  3K5O A;  2PAV A;  4E7H A;  4B3R K;  2RKI A;  4FJ5 A;  1RT5 A;  3NF8 A;  3E1Y A;  1XI1 A;  3G10 A;  3DXM A;  1KC8 O;  3ZSZ A;  2D0O A;  3NFA A;  3VGM A;  3QBW A;  3VA0 A;  1X9M A;  3LAN A;  1FKO A;  1U2V B;  3D2E B;  3KLI A;  4C8K A;  2VG7 A;  2VGN A;  3SAF A;  4G1Q A;  3KLG A;  5AQJ A;  3WT0 A;  1DKG D;  3J7Z O;  1QZ5 A;  4JKD A;  3E66 A;  5DM6 L;  1M1K O;  3H3N O;  3F9M A;  3RRG A;  4MFB A;  4W5Q A;  2I7P A;  1WNS A;  4NYN A;  3MCP A;  1WLJ A;  4CJS A;  3S3M A;  3CPW M;  2IOC A;  3WQU A;  3CD6 N;  4CEC A;  3O9Q A;  1G15 A;  4CFD A;  3THX B;  3CJ9 A;  1M90 O;  3ZT0 A;  5CZ2 A;  1LWE A;  5M1P A;  3QML A;  1BIZ A;  3R8E A;  2G8U A;  1C6V A;  4RW4 A;  1U6Z A;  2E1Y A;  2KLA A;  3OYE A;  4B3S K;  3OY9 A;  4AHU A;  5J2Q A;  1WUA A;  3ISN C;  2IS3 A;  1A5V A;  1KXP A;  4BVP A;  3VEZ A;  4CHZ A;  3P1G A;  3D45 A;  2ASM A;  2OTL N;  1F21 A;  1NGH A;  4WF9 L;  2GV9 A;  4BRA A;  3A8Y A;  5C2F A;  3C6H A;  3WNG A;  3WXJ A;  3NBP A;  4O5F A;  4PUO A;  4DB3 A;  5E84 A;  3QEX A;  1VQ5 N;  1NGE A;  3CPE A;  4DV1 K;  1HJO A;  3CJ1 A;  3MN7 A;  4IFY A;  3LDS A;  4JRQ A;  4RW6 A;  2P5G A;  2GEL A;  3O3H A;  3FLC O;  4N47 A;  5CYM A;  5GIP A;  2B4J A;  3RMB A;  4IDK A;  3AO3 A;  4B9U A;  2A40 A;  4FM2 A;  2P9U A;  4DQI A;  4KI4 A;  2P5O A;  3ENO A;  1SL2 A;  1ZC6 A;  3QB0 A;  4M41 A;  4HCB A;  1BI4 B;  3VER A;  4Z4F A;  4DWI A;  3AGR A;  1XNQ K;  4B1W B;  5AQR A;  4IG3 A;  4O55 A;  3HPO A;  1RFQ A;  3O9T A;  5FRO A;  4CJR A;  2R7Y A;  1NG9 A;  4A5B A;  5AQP A;  3TSU A;  4CJP A;  1OH6 A;  2YCH A;  4FOI A;  5C24 A;  2HNZ A;  3LP1 A;  3AO2 A;  4JKC A;  1YIJ N;  3HXM A;  3BF1 A;  4W5T A;  2WTU A;  1U47 A;  4MDB A;  2X6N A;  3L2W A;  1B9D A;  1RTJ A;  3AO4 A;  4OO1 J;  4FPA A;  4CF2 A;  4DTS A;  3I33 A;  3WEE B;  3O8M A;  3NMU A;  1YVN A;  1NK5 A;  1T03 A;  3FR0 A;  1VQM N;  1JCG A;  1O1W A;  3LP2 A;  5LMN K;  3LDQ A;  3QO9 A;  4JAX A;  5GAD P;  3M1F A;  4KH6 A;  1BUP A;  3FZM A;  3VEY A;  3VQB A;  4QOZ B;  4PL7 A;  5AZI B;  4M3T A;  2HB5 A;  3NF7 A;  3U9D A;  4EZ9 A;  1I3A A;  1RT3 A;  3ZET A;  1BQN A;  3ZX2 A;  1Z6R A;  3U8X A;  1KLN A;  5GIO A;  4OX9 K;  4GNI A;  1CZB A;  4E1J A;  5AZJ A;  3LM2 A;  4FZZ A;  2A5X A;  3ZSO A;  3SAG A;  2Y1I A;  3KIO A;  4FK0 A;  3V9S A;  1EET A;  5AZI A;  2QK9 A;  4OKK A;  4BRQ A;  3C7N B;  3CCL N;  1EWQ A;  1JLE A;  4JS4 A;  4OPH A;  3ZT2 A;  4DUY K;  1YTA A;  3IG1 A;  3VES A;  3WXI A;  3RRH A;  3HOS A;  3QES A;  4CZL A;  4DV0 K;  2IC3 A;  3DLL L;  5AR0 A;  4IEE A;  3QLH A;  2HHS A;  3NGI A;  5AQL A;  3DOL A;  3BP8 A;  1VQ6 N;  3HP6 A;  1TKZ A;  4IDH A;  3TU5 A;  5JIC A;  3DJC A;  4I6M A;  3EE8 A;  1LWC A;  3F2K A;  2ZF5 O;  3L2R A;  4FJK A;  4YOW A;  3CET A;  3QIN A;  4B1Y B;  2B5J A;  4DTU A;  2UUA K;  4FWO A;  3KKR A;  1NK0 A;  5FPM A;  1NGJ A;  1TAU A;  1T8E A;  1GLB G;  4YOV A;  5AQM A;  3N4P A;  4BRI A;  4N41 A;  3CJ7 A;  2W40 A;  3MN5 A;  1WB9 A;  5AQH A;  4Y0W A;  3H3O B;  2FF6 A;  3VMF B;  3L2U A;  1SKW A;  2XY6 A;  1WOQ A;  1WBB A;  4CF0 A;  3V9W A;  4O44 A;  1X9S A;  2DFF A;  3SUP A;  1VSL A;  3ZYY X;  2OCE A;  4FWL A;  3BUZ B;  3LAM A;  3OYF A;  3AVA A;  1NNE A;  5ADX H;  3OW2 M;  4I9Q A;  2QEX N;  2VG5 A;  1UOC A;  2GUP A;  1IKW A;  1HPZ A;  2O4G A;  4DQQ A;  1V4T A;  3L4Q A;  4JKB A;  4J2A A;  5KPT A;  3JAM O;  1XC3 A;  1YHQ N;  1GOC A;  4B1V A;  1RTI A;  1ZBI A;  3OYM A;  3OYC A;  4KHQ A;  4HUG A;  3HTV A;  3MDQ A;  4CGG A;  5C15 A;  2NRW A;  3OYA A;  4CEF A;  1EXQ A;  3ZSV A;  1SL0 A;  4FJ7 A;  5GAH P;  4JNE A;  1TL3 A;  1JCF A;  4ISG A;  4M45 A;  2G8F A;  4CEQ A;  4NCB A;  1TGO A;  4FLX A;  4H5N A;  5B8H A;  1GLE G;  4K25 A;  4ZTJ A;  2HF3 A;  4IFV A;  4KH5 A;  1U4B A;  3BZK A;  1BI4 A;  3MN6 A;  3DXM B;  3WNF A;  1VQO N;  3ATV A;  4BQZ A;  2BH1 A;  3HM8 A;  3OYK A;  3EKS A;  3OYJ A;  5EVZ A;  2A41 A;  3T69 A;  3DYA A;  3L6Q A;  4GV6 A;  3A5N C;  4LFA K;  2NLX A;  1NGB A;  4EIA A;  5LMU K;  3KLE A;  1LAV A;  4PY5 A;  2D0C A;  3ALY A;  3BY5 A;  3E01 A;  2ZGY A;  1YJ9 N;  2O8B B;  4JI2 K;  2AJQ A;  3DWL A;  1Q7Y O;  4KHY A;  5HLF A;  2EX3 A;  5AQQ A;  4CEA A;  3R9P A;  4YOU A;  2QKB A;  2E2N A;  4CHQ A;  2F7T A;  3FGU A;  4J8F A;  4CHN A;  2NRZ A;  1TK8 A;  4DTM A;  2O8B A;  2RHK A;  4ZTF A;  2P9S A;  3CYM A;  1UAX A; 
#chains in the Genus database with same CATH homology
 5BR8 K;  5LMN K;  5IT9 O;  2UXC K;  4YY3 K;  1IBM K;  4DR3 K;  2UUB K;  4NXN K;  4LFC K;  1HNW K;  3JAM O;  3OTO K;  1IBK K;  2UXD K;  4B3M K;  4DR7 K;  3T1H K;  1N36 K;  4OX9 K;  5IWA K;  1HNX K;  4B3S K;  4LF8 K;  4K0K K;  4DV4 K;  1N34 K;  4DR6 K;  4X66 K;  4GKK K;  1IBL K;  4LF9 K;  1N33 K;  1HR0 K;  4KHP K;  4DUY K;  3J81 O;  3J7A P;  4DR1 K;  5A2Q O;  1I94 K;  4JYA K;  4LF6 K;  4DV0 K;  4DV5 K;  2UUC K;  4JI5 K;  4V19 S;  4B3T K;  4DV1 K;  5FLX O;  1XMO K;  1XMQ K;  2VQF K;  4JI3 K;  4LFA K;  2UUA K;  5LMU K;  4DV3 K;  1HNZ K;  4YHH K;  3T1Y K;  4LF5 K;  5AJ3 K;  1XNQ K;  2VQE K;  4JI2 K;  4LFB K;  2ZM6 K;  4X64 K;  4JI6 K;  4DR5 K;  2HHH K;  1FJG K;  1J5E K;  4DV2 K;  4NXM K;  1XNR K;  4GKJ K;  3J80 O;  2E5L K;  4JI1 K;  4B3R K;  4DUZ K;  4LF7 K;  5LL6 Z;  4CVN E;  4JI8 K;  4X62 K;  4JI4 K;  3J7Y P;  2F4V K;  1N32 K;  4JI7 K;  4DR4 K;  4JI0 K;  4DV7 K;  4LF4 K;  4X65 K;  4DV6 K;  4CW7 B;  4AQY K;  2UXB K;  4DR2 K;  2UU9 K;  4JV5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...