4DR5K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr5K00
2ZM6K 4LF5K 4B3TK 4LF7K 4KHPK 1FJGK 4NXNK 4X64K 4DV0K 1HR0K 1XMOK 1XNRK 3JAMO 5FLXO 2VQFK 4JI1K 1N33K 4K0KK 4NXMK 4DV7K 2UU9K 1N32K 4GKJK 1IBLK 4CW7B 2UXCK 4DR6K 4DUYK 4YHHK 1HNWK 4DR7K 4DV1K 4B3SK 1J5EK 2VQEK 2UUCK 4DR4K 4LFAK 4JYAK 4DR5K 4B3RK 5LL6Z 4LF9K 3J7AP 1XMQK 2E5LK 4LFCK 1I94K 4AQYK 4JI5K 4JV5K 4DUZK 4LFBK 4LF6K 1XNQK 4DV6K 4DR3K 1HNZK 3J7YP 4CVNE 1IBKK 4B3MK 4X65K 4X66K 4V19S 3T1HK 4DV2K 4X62K 4JI4K 2HHHK 4GKKK 1HNXK 1N36K 4JI2K 4JI0K 4JI3K 4JI6K 4DV3K 5LMNK 1N34K 4DR1K 2UXDK 4OX9K 4YY3K 2UUBK 5IT9O 5LMUK 1IBMK 2UUAK 2UXBK 2F4VK 4DR2K 5IWAK 3J80O 3J81O 3OTOK 4DV5K 5BR8K 4LF4K 4DV4K 5AJ3K 5A2QO 4LF8K 4JI7K 3T1YK 4JI8K
chains in the Genus database with same CATH superfamily
4BRGA 4GVEA 1KRPA 3JS6A 2D4WA 1LW0A 5E26A 3CJ7A 1XMOK 4DSEA 4KAZA 3UE5A 3VN5A 5FLXO 3MEDA 2HB5A 3P1GA 5FDLA 1VQLN 4CJQA 4CZMA 2I7PA 4XIUA 4FJGA 4FJMA 3LDSA 4DV7K 4FWRA 1BG3A 2ASMA 4FLZA 4DS5A 2GV9A 4IO8A 2YNGA 4JKFA 3HM8A 1WBBA 3SBTA 1RDAA 2QWLA 4YHHK 4MO5A 4DV1K 3AAQA 3O9QA 3L6QA 3QBXA 4C8NA 1VQ5N 5AZIB 4H0YB 5M1FA 3E01A 4FJHA 3AVHA 4FOEA 1JXEA 4KRFA 1ASWA 4N76A 4CJTA 4KHQA 4K41A 1WSIA 4E89A 1RDWX 3PY8A 2ZJRL 1QSSA 4DS4A 4B9VA 4DR3K 3OYAA 3E9PA 3MXIA 2HSTA 3FLCO 1VSIA 5BN8A 3ULEA 4FWLA 2ZF5O 3DRSA 2JLEA 3OJUA 4BE2A 4BC4A 4E7JA 4M3UA 4C8MA 4M7YA 5M1QA 1NGIA 5F2RA 4CJVA 2NZTA 1U47A 1QVFM 4FK0A 2XRIA 1JL2A 4EFHA 3KK1A 1SQKA 4DFJA 4KKOA 4BREA 3SMSA 4AHRA 5AQKA 5AQPA 4CFBA 1U45A 4B9SA 2FBXA 4Z0UA 1GOBA 3DLBA 1NKEA 4AILC 3VQ5A 2Q0UA 4JRPA 3PO5A 4XEIA 4WQ5A 4JI8K 1J54A 2E20A 3AVNA 3LL3A 4Q5VA 5C0YA 3ZYYX 3DRPA 2AJQA 1S22A 4JKGB 4RTFD 5CZ2A 1REVA 3O4QA 3JAMO 3P39A 3RTVA 4I7FA 4CJSA 5BRDA 2HNYA 4NXMK 1YHQN 4B9LA 4B8AB 1ESVA 4J2DA 3AAPA 2FSJA 3VEWA 2UXCK 1KXPA 2ZQBA 1HUXA 2QW9A 3VEOA 3CC2N 1SAZA 2D5RA 5BPNA 3ZSYA 3L2RA 2D1KA 2GBZA 2P9IA 1UA0A 5KTQA 1IKXA 2WONA 2DFEA 4AHCA 1S1UA 3SI6A 1I94K 1BDGA 3LM2A 3CJAA 1TYQB 3W0LA 1ZBHA 1JLGA 4IOAL 1WNSA 3GE1A 2O8FB 3OYJA 3EE9A 3WNEA 4BGBA 2QWNA 2GX9A 2DTUA 4ILHA 4NCGA 1IBKK 4IEEA 3RR8A 4H0OA 5TKWA 1BCMA 4FJIA 3NH1A 3NE6A 4OVLA 3NMUA 4W5NA 2BUPA 3QINA 1Q81O 2YCHA 1RT3A 3ZLJA 4H03B 3DLRA 3O1BA 1OH7A 5AQIA 4DKWA 3OYKA 3O3HA 2OCEA 4H0TB 1BA1A 2BDPA 3T3FA 4BR0A 4H5VA 2W6KA 4CBUA 2A40A 5KI6A 4CBWA 5KGXA 3O4WA 4CZIA 1SKRA 3MK6A 3VF6A 3C95A 1RNHA 5LJWA 5AQNA 3CG7A 4FZYA 2FF6A 5I3UA 3ENHA 4H5RA 4DV0K 3K5MA 2IAJA 1IG8A 4CJWA 4IO9L 1WN7A 4JK7A 3IKMA 1YTUA 4BR5A 1NBWA 2QA4N 3GDQA 3U3YA 4FPAA 1SV5A 2O8CA 3VPZA 1YT3A 2HHXA 3TU5A 5JICA 3ZT4A 3I8DA 3A5LC 1NK7A 1JL1A 4E1MA 4CHOA 3HYFA 4DSLA 4LD0A 1RT2A 3LAMA 4CJUA 2UUCK 4BRAA 1KAYA 4IFEA 4LFAK 3WQTA 3SAFA 2W6LA 3AA4A 4PHTX 1C0GA 4CF0A 3Q7CA 3KJVA 2HHTA 2NRWA 1HQUA 2HNZA 1W2BM 1T6CA 1VK0A 3I8BA 5EOYA 2NRHA 3IS9A 2NRRA 4AHTA 4B9UA 3O5BA 3B6PA 2PY5A 2FBVA 3M8RA 4JD2A 5GAGP 1GLFO 4OPJA 3TARA 1QZ5A 3VESA 3W3DA 4AM6A 1K8KA 2P9SB 5AQMA 4WCEL 3OYMA 1MWKA 1EP4A 4CHNA 4E1JA 4JKDA 3DLGA 4FPBA 4JKHA 4AF1A 1ATRA 1X9JA 1QSYA 3OS0A 5CYQA 3HP9A 1K8AO 4HTUA 1BIZA 3O6WA 1D9DA 3AVFA 4CHPA 5BR9A 3SJJA 4PUOA 3R6MA 3CJ9A 4BR9A 2YJFA 1TKDA 3MWTA 4DTRA 1FW6A 1NGCA 2E2QA 3DLHA 4E19A 4AHUA 2RE2A 4A5BA 1T7PA 3WUHA 4LF4K 1S6PA 1DEJA 1DTQA 5GADP 3KWGA 1RBSA 4JHDA 4Z4GA 1ZBLA 1FXXA 5AQYA 4BDPA 1JCEA 2P9IB 1W9HA 1VQKN 4CZLA 3VQ7A 1GLLO 1IH7A 3AA2A 1VSHA 3E1YA 4O0IA 2XY6A 3KD1E 4JI1K 1KTQA 1N33K 1SZ2A 3PIPL 1NMDA 1U04A 3M8QA 3HOTA 2HNDA 4XH4A 4CJPA 4KI6A 1IBLK 3RR7A 1VRTA 4BDYA 4KHNA 4I9LA 3VQ6A 1LAWA 1MA9B 4QCLA 3TAFA 5C2DA 1DGKN 1E4FT 3OY9A 4MDBA 4B3SK 1J5EK 4YOUA 2Z1JA 5M1OA 1IG9A 4HUEA 5KPTA 3LZIA 3CQXA 1QZ6A 3AVIA 3A5OC 2GELA 4FJJA 2O4IA 5AQGA 1TL3A 3KK2A 4NYNA 4CZKA 4O55A 1NK4A 3C94A 3O8MA 2YNHA 4DF8A 3A8YA 3SQ2A 3KLFA 5TKYA 3KLGA 3FFIA 3CCQN 4CEAA 4EP5A 1JLCA 2EHGA 3FE1A 4EHUA 3BY5A 2RN2A 4PKIA 4KH6A 4BQLA 4FJ9A 3G10A 3IRXA 2I7NA 4BE0A 4LF6K 4CJKA 3L4IA 4BG9A 3H6EA 4CESA 1HNZK 1MDUB 4F8RA 4IFYA 2QXFA 3ASMA 3MEEA 3AVGA 1Q9YA 3H46O 3K58A 1FK9A 3V9SA 3HSCA 1GLBG 3B6OA 4NO7A 3T1HK 3SCXA 1CZBA 4AM7A 4FWMA 3TAGA 2HHQA 4K8XA 4FK4A 4BRPA 2GUPA 3MX2A 4E7IA 2IVOA 4DV3K 5C15A 4QS7A 4O5FA 2CGJA 4Z94A 2UUBK 3CETA 4OKEA 3ZT2A 3QEXA 2O8CB 2KQ2A 4MQ3A 5JS2A 3G6EN 4B1ZA 3ITHA 3NH0A 2WOMA 4CE9A 4FLXA 1VSEA 1JCGA 4N56A 4KI4A 4JK8A 5AJ3K 2Z1IA 5C42A 4WFBL 2ZM6K 4BRNA 2QKBA 4DTMA 3V9XA 2HVHA 1HR0K 1NJIO 3KTQA 4KTZA 3NCIA 5GAEP 2ZGYA 3B8AX 1A5WA 3KWIA 3HI0A 4CK1A 3SNNA 3LWLA 4M42A 3TSQA 2F9WA 2A1RA 1N32K 1OVQA 1N6QA 2E6LA 4E7HA 4WFNL 4DR6K 3QEVA 2QXLA 4ELUA 2D0AA 4TSXA 1BGXT 4CEBA 5J2NA 3CCRN 1RT1A 3ATUA 1YVNA 5CY4A 5CYMA 3CPEA 5J2QA 1OH5A 5GIOA 3K5NA 4C1NK 1SL1A 2XHBA 3P5JA 3UKUB 4OPKA 2HMPA 3V1RA 1EO1A 3ISNC 2P51A 3EL2A 2BE2A 2E6MA 2H3GX 3VMFB 1HX1A 5JVGL 1NK8A 2W41A 3F2KA 1TK0A 5KGWA 3NFAA 3CYMA 3R8EA 1NGAA 3SAHA 4W5OA 4JK9A 4BGAA 4JI5K 1T3VA 4BG8A 4CF2A 1S1WA 3LM9A 3O3GA 2VG6A 3CD6N 4A61A 3VEYA 5FPDA 4IZ9A 5JLHA 3SMPA 4QS8A 1WBDA 4JHDB 1ILYA 4FSVA 2O8EA 3VQEA 1HPZA 3MX5A 3HPGA 1ASVA 4H5NA 4CJEA 3VQQA 1MU2A 2P5GA 1BIUA 5AZJA 2G8IA 3KKSA 2QWMA 3RMDA 1VQ8N 3IMXA 1NGEA 1WB9A 3TWHA 4BQZA 2YHAA 1BA0A 3QDKA 1NNEA 4CK3A 3VERA 1Y64A 3VA0A 3CXCM 1LWFA 2JWKA 2J4RA 5BR8K 1DTTA 4KHUA 4DLEA 4CF8A 1QS4A 4CGHA 3J7ZO 2OTLN 1RT5A 2HOEA 4DU1A 5F1XA 3WNFA 3RRGA 4DB3A 3ZT0A 2A6AA 4FL9A 4CF1A 5HRPA 2XO7A 3OYDA 1O13A 4CI6A 3QICA 2UYTA 1G15A 5EX5A 3RMBA 3C0BA 3N4PA 1C1CA 1VRUA 3M6GA 3Q7BA 4A5AA 2HBLA 3BF3A 4PA1A 4FK2A 3VQAA 3VEZA 3RSEA 5AQQA 2JGUA 4LC9B 4ICLA 2ZJQL 2KZMA 4I9QA 4GY2B 5HLFA 1UA1A 2BGGA 1HQEA 4EP4A 1OH6A 4DR4K 1C6VA 3D6RA 3OA9A 4CZHA 2ZJPL 4FLYA 2NRTA 2BANA 1YTAA 4HUGA 2E5LK 1E3MA 3CMAN 1D5AA 3AA3A 3ID6A 1EQYA 4B9TA 4M7XA 4KFBA 3SAGA 4WF9L 3IUCA 5J1EA 3CC7N 3VQ8A 1D8YA 1WSHA 2HHWA 2IS3A 5AQXA 4E7LA 3F9MA 3VGLA 2LSNA 3EKUA 3WXJA 1I39A 4H0PA 4V19S 3IG1A 4X62K 3ZT1A 3CQ8A 5E41A 3A0IX 3VQ4A 3SPYA 3RRHA 1GLJO 3QFUA 3CFOA 1S1VA 5LMNK 1KFDA 1QSLA 2YNFA 2AA4A 1H1VA 1HPMA 4YOXA 4AHSA 1BCOA 2G8FA 4ZHRA 5IT9O 3WXLA 4CIGA 5LMUK 4I2QA 4ID5A 3H1QA 4DG1A 2DFFA 2R7YA 4JKEA 5GIPA 4JKCA 4FM1A 3VF2A 5KQDA 3OTOK 4WQ5C 3JSMA 4J8FA 5FPEA 1IKYA 5HRSA 1ZBIA 2ATQA 1TGOA 4Q0BA 2YJEA 1S5JA 4LSNA 1QQNA 1DT9A 1YI2N 4B3TK 3ZX0A 4CIEA 1FJGK 3UKRA 2HHUA 5M1NA 1NU0A 4E1NA 3D2EA 1SUQA 4KTQA 3KHYA 4IJNA 3K9KA 4OLAA 1I3AA 2HHVA 3EKSA 2PBDA 2HW3A 1S1TA 3R9PA 2P9SA 3L3VA 3FZKA 1D4XA 3LP2A 4IBNA 3NF6A 3HSTB 1K9MO 4MLHA 1HNWK 4BRHA 4Z4EA 5AQVA 1OH8A 3WEEB 1NK0A 3QEIA 3NDKA 2O8EB 3CJ1A 3M8PA 5KPZA 2D0PA 4YOTA 2O8DA 4CGDA 4O5BA 1CXUA 4CJFA 4B3RK 1CLQA 4C1NI 4YORA 5AZJB 5T7BA 1MWMA 5H1SQ 3O9UA 2EX3A 1HYVA 1YF5L 3KVGA 4JLHA 1W0HA 5EY4A 3THWA 3OYFA 1O1WA 1B9DA 3TPQA 3CFRA 1G99A 3O1WA 5AR0A 1Z6RA 4HHTA 2FF3B 5I42A 4HTLA 3J8AA 4X65K 3U9DA 3OYLA 3CCUN 3ULDA 2DFHA 3DWLA 4ILGB 5DM7L 4JI0K 2E88A 5I9EB 1ATSA 3D7EO 3I56N 4WFAL 4CZJA 1QTMA 4FJNA 3EYZA 3KLIA 2F4VK 3L8BA 4FLTA 3RSEB 4CFCA 2QEXN 1VQ6N 1IKWA 1NGJA 3CJBA 3AVLA 5DMRA 4DV4K 3CHWA 4CJLA 3KLEA 3KLHA 3SUQA 5AQOA 3IDHA 1QHAA 1Q82O 1C0TA 2FLOA 3TABA 4H0VB 4HCBA 2AP1A 3QMLA 1VSFA 2IVNA 4BROA 4M45A 4DTXA 4H5WA 1Z25A 3KKRA 4CEQA 1LCUA 2A1SA 3U4LA 2QKKA 3TAMA 4GKJK 4DWIA 2KFZA 4M63C 4KH5A 1BWFO 2V7ZA 3AV9A 3RWUA 1EKEA 4ISGA 3THVA 4I2PA 4WQ4C 3SPZA 1EXQA 1WSEA 4F3OA 2F8TA 3EO3A 1A5XA 1CZ9A 2A41A 3L2QA 5BN9A 3QIPA 1YXQA 3LP0A 4JYAK 4K42A 1X9MA 1XQSC 1YUWA 1HKGA 4CD3A 4C23A 4E0DA 1ZBUA 1RBRA 3J7AP 2B4JA 1XI1A 4BRCA 4B1XB 3AA5X 3MWPA 1BU6O 4FWNA 4AQYK 1B92A 1RFQA 2QWQA 3O9TA 4CJ7A 1DKGD 4K25A 3P4IA 4LSLA 3LAKA 3MEGA 1JLBA 1WOQA 2HF3A 4BC3A 4WQ4A 3J7YP 4U7BA 1ZC6A 5HROA 3FZMA 3SQ0A 3VGKA 3TTDA 4JEPA 3H1VX 3DLEA 2ITMA 2P9UA 3UKRB 3ZX2A 1VQPN 4G1QA 4JI4K 2WUSA 1BISA 3QEPA 3D2EB 4NB4A 4IFVA 4CCHA 1JLQA 1N34K 3LPTA 4DR1K 1KVAA 2BH1A 3LDLA 3SQ4A 5KQ8A 2F7TA 1L5UA 4ISFA 3THYA 4CGJA 3D2FA 1FKOA 3AO4A 3O9SA 1X3MA 4Y1DA 3MN6A 1LV5A 2VG7A 4DU4A 2VGMA 4CGFA 3AARA 3BZKA 3H3OB 3UKUA 3DLLL 3DM2A 2P9KA 3HK2A 4CW7B 3QBWA 4O0JA 3OYHA 1L3SA 3VQBA 4NXNK 2O8DB 3BGRA 3O9RA 5ADXH 4DTPA 3C7NA 1HRHA 3HBTA 2QM1A 3HRGA 3FR0A 3I0SA 3HP6A 2HMIA 4CJ5A 2KZZA 2NRVA 4FJ8A 1ZBFA 5J2PA 2PFUA 3THWB 4FVUA 3D0PA 3GG4A 4DHYA 1LWCA 2A5XA 2HVIA 5B8HA 3L0QA 2Q1NA 1R59O 3PX4A 3MXJA 4DQPA 3V9UA 1ZYQA 4CK2A 1S3XA 1YJ9N 3VQ9A 4DCHA 5SWMA 2WFBA 2ZWHA 2D0CA 1EX4A 2OPSA 3FZHA 3CERA 2HHSA 2Y1JA 3I55N 3S3NA 3FGUA 5AQRA 4GV9A 3DYAA 4FJXA 5AQLA 3DJCA 1VQNN 2VYPA 1VHXA 1NOZA 3ZCMA 3RMCA 3ID8A 4MDAA 4CHZA 3WQUA 3QB0A 3R3LA 1L3UA 1KFSA 2E2OA 4PY5A 4DV2K 2YHBA 5FPNA 1VSJA 3LZJA 1C0UA 4PKHA 3KIOA 4BR4A 4GKKK 4IOCL 3SV4A 3OYEA 3VTHA 2BTFA 4JI6K 1JLEA 3KK3A 4E3SA 5HOOA 1UOCA 2F9TA 4F3TA 1GLEG 1T05A 3OHRA 3PIOL 4WYBA 2P9LA 2P1JA 4C8LA 4PWDA 3TTCA 3T1YK 4BY9C 2YKMA 3CCVN 3BEXA 5EVZA 1S72N 4FZZA 5GAHP 5FRNA 2RHKA 1BUPA 4NLCA 2IGIA 3VETA 1TAQA 3MMVA 3QERA 3LANA 1WUAA 4YOYA 3NF7A 3AO1A 3HM9A 1K6YA 3P31A 2UU9K 4EHTA 4R79A 4JS4A 1NK9A 4Y0WA 1R0AA 3DRRA 4JN4A 3L4QA 3TSPA 3N4QA 3K5LA 1C1BA 2KHOA 4DR7K 1T03A 3AY9A 1WSFA 2VQEK 3EE8A 1T6DA 4FVMA 1QHTA 2P9UB 1SKSA 3QIOA 3DAWA 1NGBA 1XWLA 3CCSN 4KREA 4IDHA 5EU7A 4C8KA 1L3VA 4ELVA 5D3GA 3CI5A 3H3NO 1XMQK 2Y1IA 3KZBA 4DFPA 3OS2A 3EEQA 4KV8A 1P8ZA 4CEDA 3SV3A 4BRLA 2IVPA 3FZFA 3V9WA 1NK5A 4B1UB 3THYB 3D2FB 4GW6A 4KB1A 4DV6K 4IKFA 2P9PB 1RTJA 4H5TA 4DSFA 1TKXA 4BACA 1RGIA 2QWRA 4H4MA 3LDOA 4YOWA 2P9KB 4B3MK 1GOAA 4Y1CA 3VQDA 3ZSWA 4B9NA 1NG9A 3MCAB 4IJAA 4JRQA 3BF1A 4O44A 2KLAA 2Q0RA 1U49A 4I6MB 1F21A 3C7NB 3ZSVA 2QWPA 1YJNN 5AQJA 3HOSA 1DLOA 4UY8O 3A5NC 3WXIA 4LY7A 4BDZA 4FJLA 3LPUA 1TL1A 3EZ5A 5GINA 2NNWA 3NF9A 1IBMK 3NGYA 1W97L 3WEEA 4PL8A 4OGEA 5KPRA 4NCAA 1E4GT 1JCFA 2JWLA 4FCYA 2IDOA 4JI7K 3I0RA 1HLUA 4LF7K 4RW8A 5C24A 3FZLA 3VEXA 3NH2A 3S41A 2NUBA 4B1YB 4J2EA 3HJFA 1U48A 3AVMA 2DY4A 1N5YA 2FBYA 2PAVA 4EZ9A 3DLKA 4DTUA 1S6QA 1KVBA 4IG3A 3NHGA 2VWBA 1YAGA 3IFRA 4CGGA 1X1PA 4Z4IA 3NGIA 1KQSM 1ITGA 3DOKA 3LALA 3C6HA 4JKAA 2X6SA 3AVAA 1X3NA 4JKBA 3LP1A 4DSKA 1VSMA 1VQON 4C8OA 4IXCA 3U3GA 2CGLA 4B1WB 1UAXA 5J2MA 4A59A 2NRZA 4FJKA 3M1FA 4JNEA 3MN9A 1RBTA 3VEVA 3ZSRA 3K57A 3ALYA 2WC9A 3CCMN 3PSIA 4KPYA 1VSDA 2YI1A 1IO2A 1KAXA 1XHXA 2ITGA 4B9QA 4M3TA 4KBOA 3VQPA 3AGKA 2Q97A 3SUPA 1S9EA 3L3UA 2EWSA 4BC5A 1SL2A 2CH5A 2P9LB 4CVNE 4K43A 3TTFA 5E84A 4ID1A 1JLAA 3CCLN 4MLEA 5CR4A 1Q7YO 1RTDA 4FJ7A 1V4SA 3ZSQA 4CJ3A 4ISEA 4G9ZA 3ENOA 3LP3A 4XH1A 1BO5O 4EZ6A 1ZBSA 4A62A 3HT3A 1SL0A 5JS1A 4FO0A 1HNIA 3O08A 4FYDA 1NWKA 1VSKA 3CMEN 4KHWA 3AVBA 1BL3A 4BE1A 4FLUA 4QOZB 2QWOA 3CM6A 1P90A 1HJOA 3K5OA 3NAEA 2FXUA 3V6DA 2PZSA 3U6FA 3TANA 3CF5L 2VCPA 2QI2A 2V51B 3MCPA 3QFPA 2KKZA 1LWEA 1U2VA 4YFUA 3EZWA 3MDQA 1XHZA 3VOVA 1HKBA 1CXQA 2E4LA 4K0KK 1W7AA 3SZ2A 4HUFA 3ZSZA 2E1YA 1BHLA 1K73O 2HBKA 3OBYA 4PL7A 4OPHA 2GWJA 4LH4A 4J2BA 4DUYK 2ZGZA 3IAYA 3G4SN 2VWKA 3PV8A 4ZTJA 4DFMA 1J9AA 2O4GA 1J6ZA 4IG0A 2Q2RA 4PKGA 1S1XA 4DLGA 2P5OA 4BRKA 4OPAA 3HXMA 4CFAA 5HRNA 1VQ4N 3R1XA 2A42A 4CF9A 2O8BB 4DR5K 1VQMN 4H4OA 3A5MC 3QO9A 4FW1A 1TK5A 4GVMA 1KD1O 4FM0A 4KO0A 3L2VA 2E2PA 3THXA 4RW7A 1HKCA 3CPWM 4LFBK 1RBVA 4ELTA 4RCHA 5AQUA 2OA8A 2OPQA 2XY8A 5K14A 3VGMA 1YIJN 3F9KA 2YHYA 4CIFA 1QE1A 4X66K 5M1KA 4H8KA 1RDCA 2HHHK 3V4IA 4AHVA 4CEEA 3OYCA 1WAFA 2GEMA 4F2SA 5JLFA 2OTJN 4CFDA 5KRTA 4JI3K 3AO5A 3PX0A 3WXKA 2XY5A 4EAHD 4XH5A 2OANA 1QQOA 4CGIA 2WTUA 1RDUA 3TAPA 3OVNA 5BPLA 1BQNA 2RF2A 2A3ZA 4DR2K 1UWBA 1RT4A 3TR8A 4U67L 3J81O 2G8WA 4RW6A 4BR2A 2E2NA 1KC8O 4JAXA 4MFBA 4O8UA 3CFPA 1TUUA 2CH6A 2F8SA 4KHPK 1XC3A 3BP8A 3K2PA 4CJ4A 1NLVA 1NGGA 3U8XA 1SKWA 4DMNA 2F96A 3S3MA 1KLMA 1RBUA 1RT6A 2IC3A 3O4NA 4AH9A 4DQSA 5LY3A 3ZSXA 5HL7L 2RKIA 1NJZA 5DK5A 1RDDA 3WNGA 1LAVA 1JKHA 3DXMB 1X9WA 5KRSA 5ELZA 3KK7A 4CZFA 1NMNA 2Q36A 4W5QA 3PX6A 3ZETA 2PYLA 4NLBA 4N41A 1C1AA 1RDBA 3C6TA 2YNIA 1WLJA 3OJSA 3E66A 3SJHA 1XC9A 4CERA 1HJRA 3CQYA 3DXKA 2QTDA 3L2WA 1M1KO 2E1ZA 4CD1A 1VSLA 4F2RA 3BZCA 1BQMA 5AQWA 4LH5A 1VQ9N 3SYZA 3WXMB 3OW2M 5AQZA 4IWVA 3V81A 5ADXA 2X74A 2G8UA 3A2FA 4GV3A 1A5VA 4IOXA 1NKCA 2FSNA 4FWKA 5AQHA 2NRXA 3CCEN 4RWTA 1RILA 1U6ZA 2XY7A 3QLHA 1QQMA 2KW4A 1U2VB 1Q9XA 4N5SA 5BREA 5SZTA 1HYZA 5C10A 1T44A 3ATVA 3MN7A 2ASOA 4OLBA 1VAZA 2D0OA 3ZX3A 4BRMA 2E8AA 2V7YA 4O4GA 1LW2A 4L8RB 1U4BA 4DTSA 4R5PA 5M1PA 5HP1A 4M3RA 2Z1HA 1TKTA 3C6UA 3QNNA 4EIAA 3ULEB 4O8KA 2ASPA 3SQ1A 2X78A 4W5TA 4DQ8A 3DI6A 4Z4HA 5BPMA 4UQGA 2OPRA 4CBXA 4BC2A 5EXWA 3L2UA 4GNIA 3PUFA 4JS5A 3ENBA 4FOIA 1WSJA 2YX6A 1NJYA 1L3TA 2QK9A 4QS9A 2OYQA 2P9NA 2P9PA 3EY1A 3THXB 2PYJA 3K9JA 5DM6L 4CZEA 4KB0A 4CEZA 4L3QA 3M3ZA 3BUZB 3T1AA 4B1VA 4CJRA 3TAEA 1NGDA 3CM5A 4FZXC 1WAJA 2IOCA 1NKBA 3CCJN 5FRMA 4BR7A 2OPPA 1HNVA 1WSGA 1NGFA 4I6MA 4YOVA 4FWPA 1FKPA 3M5RA 3G71N 5LJVA 3MN5A 3MAQA 3CJCA 5FROA 1OKJA 3AVKA 4LF9K 2KTQA 3O3FA 3VTIA 2V52B 4E7KA 5AQTA 4CEOA 3K0SA 1QVGM 3LDQA 4A57A 2VGNA 3SUNA 1OVYA 1Q8IA 1RCHA 3T19A 4CECA 5AFUA 2GUIA 4M3ZA 3V9ZA 4HCCA 1XNQK 3AO2A 4DF4A 4N47A 2ETJA 4KHSA 1GOCA 4IDKA 1Z05A 1B9FA 4RW4A 5JVHL 4NCBA 4J2AA 5HBMA 1Z26A 1C0FA 5CHIA 4DTJA 4BRFA 3S3OA 5BRHA 1KAZA 4JI2K 3G0ZA 3S9HA 4NYFA 4GV6A 3WNHA 3VF4A 1RT7A 5CE3A 3OS1A 3D45A 3P38A 4FLVA 2UXBK 3GOIA 3OYBA 4DTNA 2HF4A 1EWQA 3C6AA 4Z4CA 1J5OA 4DFKA 5CZ1A 3HO1A 4OO1J 4BRQA 4FWOA 1SS6A 3ZETB 1VQ7N 3HVTA 3AVCA 4HVJA 2RPIA 4DSJA 3NVKA 3OYGA 5C2FA 4OKKA 1NOYA 4BRDA 5FPMA 4YNQA 3RVCA 2YHWA 4X64K 2KFNA 1QQCA 1KVCA 1HMVA 3LDPA 3ZEUA 3DXKB 3ZSOA 3FFKB 3QNOA 3CC4N 3K59A 1TUYA 2HBJA 2ZE2A 2NLXA 4QAGA 3JXUA 4YDUC 2W42A 4FM2A 4K8ZA 4FJ5A 4Z4FA 4B3OA 1YVUA 1ATNA 3P83D 5AFUH 3T7ZA 1X9SA 1IV0A 3U9ZA 4DQRA 1BI4A 3H45C 3UIQA 4RW9A 1NK6A 4BWJA 3RMAA 4M3YA 5LL6Z 3NVMA 1T8EA 1N8RO 3OYNA 3SBGA 4BVOA 3V1OA 3UB5A 2YKNA 4F4KA 3TAQA 4OKJA 4YDUA 3BDPA 3SK3A 4M3XA 4B9MA 4DUZK 1J53A 3OBWA 1GLAG 1TK8A 1LOTB 4FWQA 2G8KA 1JXBA 1RTHA 5C25A 1TKZA 3C65A 3O80A 3NF8A 3NBPA 2FC0A 2G8VA 4MO4A 2VWJA 4FW2A 3I33A 5AZIA 2FBTA 3JYTA 1TV6A 3PSFA 4ILJA 3DMJA 1HNXK 3QEWA 3GL1A 2GWKA 2WBNA 3CIPA 1ZXOA 1KSPA 4DSIA 3HL8A 2OZSA 2UXDK 4OX9K 1C0MA 2P9NB 3TI0A 4GMJB 2UUAK 1XUPO 1ASUA 1IJJA 3SUOA 5IWAK 2Q31A 4JD2B 5F0XA 4PQUA 4H0XB 2IIRA 5AQSA 5A2QO 4LF8K 1CZAN 2O8BA 3M8SA 4LF5K 1K8KB 4CHYA 3HTVA 3EN9A 4B08A 4OGCA 3F5TA 2CGKA 4KH4A 4B8CA 1XNRK 4HWIA 3HPOA 3H08A 2VQFK 4FXDA 1EWRA 3VQCA 1GLDG 4W5RA 1JJ2M 1Y97A 4FLWA 3LWMA 3SLCA 4BVPA 1JLFA 3V1QA 3KD5E 1NJWA 3VENA 1Q86O 2HBMA 4CEFA 3MXMA 4CZGA 3AO3A 1GLCG 1EETA 3HZ6A 1HYSA 3QESA 3PO4A 3WT0A 1RTIA 4KHYA 4M41A 2D0BA 3DOLA 1IKVA 2YV0X 4JKGA 3QETA 3AVJA 4IEIA 1NM1A 1YITN 3ZT3A 4FWSA 5HRRA 4LFCK 3AGRA 1KCFA 1S9GA 5MLCQ 2B6AA 3F73A 4JV5K 1NJXA 1NGHA 3HVRA 2ZD1A 4F9OA 3TSUA 4CHQA 5AQFA 5JMVA 4M3WA 2DPNA 1D9FA 2I5JA 4DQIA 4DTOA 1M90O 4A2AA 5BRFA 4ZTFA 2GTDA 4DU3A 1Q18A 1KLNA 4BRIA 3GBTA 2G8HA 4KTWA 3G25A 4BWMA 4DQQA 2FSKA 3MECA 3PLAA 4RG8A 1TAUA 1YJWN 3ZEUB 1N36K 5C12A 3E9LA 2X6NA 2OZMA 2Z1GA 3VA3A 4OJRA 1TYQA 1BOTO 4YY3K 1V4TA 4A2BA 3E9OA 2Q3SA 3T69A 3OYIA 3DXMA 2W40A 2B5JA 2O8FA 3HPHA 3J80O 4DV5K 3LDNA 1TVRA 2YHXA 3NGZA 2VG5A 4WE1A 1BI4B
chains in the Genus database with same CATH topology
2ZM6K 4LF5K 4B3TK 4LF7K 4KHPK 1FJGK 4NXNK 4X64K 4DV0K 1HR0K 1XMOK 1XNRK 3JAMO 5FLXO 2VQFK 4JI1K 1N33K 4K0KK 4NXMK 4DV7K 2UU9K 1N32K 4GKJK 1IBLK 4CW7B 2UXCK 4DR6K 4DUYK 4YHHK 1HNWK 4DR7K 4DV1K 4B3SK 1J5EK 2VQEK 2UUCK 4DR4K 4LFAK 4JYAK 4DR5K 4B3RK 5LL6Z 4LF9K 3J7AP 1XMQK 2E5LK 4LFCK 1I94K 4AQYK 4JI5K 4JV5K 4DUZK 4LFBK 4LF6K 1XNQK 4DV6K 4DR3K 1HNZK 3J7YP 4CVNE 1IBKK 4B3MK 4X65K 4X66K 4V19S 3T1HK 4DV2K 4X62K 4JI4K 2HHHK 4GKKK 1HNXK 1N36K 4JI2K 4JI0K 4JI3K 4JI6K 4DV3K 5LMNK 1N34K 4DR1K 2UXDK 4OX9K 4YY3K 2UUBK 5IT9O 5LMUK 1IBMK 2UUAK 2UXBK 2F4VK 4DR2K 5IWAK 3J80O 3J81O 3OTOK 4DV5K 5BR8K 4LF4K 4DV4K 5AJ3K 5A2QO 4LF8K 4JI7K 3T1YK 4JI8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 K;  4LF5 K;  4B3T K;  4LF7 K;  4KHP K;  1FJG K;  4NXN K;  4X64 K;  4DV0 K;  1HR0 K;  1XMO K;  1XNR K;  3JAM O;  5FLX O;  2VQF K;  4JI1 K;  1N33 K;  4K0K K;  4NXM K;  4DV7 K;  2UU9 K;  1N32 K;  4GKJ K;  1IBL K;  4CW7 B;  2UXC K;  4DR6 K;  4DUY K;  4YHH K;  1HNW K;  4DR7 K;  4DV1 K;  4B3S K;  1J5E K;  2VQE K;  2UUC K;  4DR4 K;  4LFA K;  4JYA K;  4DR5 K;  4B3R K;  5LL6 Z;  4LF9 K;  3J7A P;  1XMQ K;  2E5L K;  4LFC K;  1I94 K;  4AQY K;  4JI5 K;  4JV5 K;  4DUZ K;  4LFB K;  4LF6 K;  1XNQ K;  4DV6 K;  4DR3 K;  1HNZ K;  3J7Y P;  4CVN E;  1IBK K;  4B3M K;  4X65 K;  4X66 K;  4V19 S;  3T1H K;  4DV2 K;  4X62 K;  4JI4 K;  2HHH K;  4GKK K;  1HNX K;  1N36 K;  4JI2 K;  4JI0 K;  4JI3 K;  4JI6 K;  4DV3 K;  5LMN K;  1N34 K;  4DR1 K;  2UXD K;  4OX9 K;  4YY3 K;  2UUB K;  5IT9 O;  5LMU K;  1IBM K;  2UUA K;  2UXB K;  2F4V K;  4DR2 K;  5IWA K;  3J80 O;  3J81 O;  3OTO K;  4DV5 K;  5BR8 K;  4LF4 K;  4DV4 K;  5AJ3 K;  5A2Q O;  4LF8 K;  4JI7 K;  3T1Y K;  4JI8 K; 
#chains in the Genus database with same CATH topology
 4BRG A;  4GVE A;  1KRP A;  3JS6 A;  2D4W A;  1LW0 A;  5E26 A;  3CJ7 A;  1XMO K;  4DSE A;  4KAZ A;  3UE5 A;  3VN5 A;  5FLX O;  3MED A;  2HB5 A;  3P1G A;  5FDL A;  1VQL N;  4CJQ A;  4CZM A;  2I7P A;  4XIU A;  4FJG A;  4FJM A;  3LDS A;  4DV7 K;  4FWR A;  1BG3 A;  2ASM A;  4FLZ A;  4DS5 A;  2GV9 A;  4IO8 A;  2YNG A;  4JKF A;  3HM8 A;  1WBB A;  3SBT A;  1RDA A;  2QWL A;  4YHH K;  4MO5 A;  4DV1 K;  3AAQ A;  3O9Q A;  3L6Q A;  3QBX A;  4C8N A;  1VQ5 N;  5AZI B;  4H0Y B;  5M1F A;  3E01 A;  4FJH A;  3AVH A;  4FOE A;  1JXE A;  4KRF A;  1ASW A;  4N76 A;  4CJT A;  4KHQ A;  4K41 A;  1WSI A;  4E89 A;  1RDW X;  3PY8 A;  2ZJR L;  1QSS A;  4DS4 A;  4B9V A;  4DR3 K;  3OYA A;  3E9P A;  3MXI A;  2HST A;  3FLC O;  1VSI A;  5BN8 A;  3ULE A;  4FWL A;  2ZF5 O;  3DRS A;  2JLE A;  3OJU A;  4BE2 A;  4BC4 A;  4E7J A;  4M3U A;  4C8M A;  4M7Y A;  5M1Q A;  1NGI A;  5F2R A;  4CJV A;  2NZT A;  1U47 A;  1QVF M;  4FK0 A;  2XRI A;  1JL2 A;  4EFH A;  3KK1 A;  1SQK A;  4DFJ A;  4KKO A;  4BRE A;  3SMS A;  4AHR A;  5AQK A;  5AQP A;  4CFB A;  1U45 A;  4B9S A;  2FBX A;  4Z0U A;  1GOB A;  3DLB A;  1NKE A;  4AIL C;  3VQ5 A;  2Q0U A;  4JRP A;  3PO5 A;  4XEI A;  4WQ5 A;  4JI8 K;  1J54 A;  2E20 A;  3AVN A;  3LL3 A;  4Q5V A;  5C0Y A;  3ZYY X;  3DRP A;  2AJQ A;  1S22 A;  4JKG B;  4RTF D;  5CZ2 A;  1REV A;  3O4Q A;  3JAM O;  3P39 A;  3RTV A;  4I7F A;  4CJS A;  5BRD A;  2HNY A;  4NXM K;  1YHQ N;  4B9L A;  4B8A B;  1ESV A;  4J2D A;  3AAP A;  2FSJ A;  3VEW A;  2UXC K;  1KXP A;  2ZQB A;  1HUX A;  2QW9 A;  3VEO A;  3CC2 N;  1SAZ A;  2D5R A;  5BPN A;  3ZSY A;  3L2R A;  2D1K A;  2GBZ A;  2P9I A;  1UA0 A;  5KTQ A;  1IKX A;  2WON A;  2DFE A;  4AHC A;  1S1U A;  3SI6 A;  1I94 K;  1BDG A;  3LM2 A;  3CJA A;  1TYQ B;  3W0L A;  1ZBH A;  1JLG A;  4IOA L;  1WNS A;  3GE1 A;  2O8F B;  3OYJ A;  3EE9 A;  3WNE A;  4BGB A;  2QWN A;  2GX9 A;  2DTU A;  4ILH A;  4NCG A;  1IBK K;  4IEE A;  3RR8 A;  4H0O A;  5TKW A;  1BCM A;  4FJI A;  3NH1 A;  3NE6 A;  4OVL A;  3NMU A;  4W5N A;  2BUP A;  3QIN A;  1Q81 O;  2YCH A;  1RT3 A;  3ZLJ A;  4H03 B;  3DLR A;  3O1B A;  1OH7 A;  5AQI A;  4DKW A;  3OYK A;  3O3H A;  2OCE A;  4H0T B;  1BA1 A;  2BDP A;  3T3F A;  4BR0 A;  4H5V A;  2W6K A;  4CBU A;  2A40 A;  5KI6 A;  4CBW A;  5KGX A;  3O4W A;  4CZI A;  1SKR A;  3MK6 A;  3VF6 A;  3C95 A;  1RNH A;  5LJW A;  5AQN A;  3CG7 A;  4FZY A;  2FF6 A;  5I3U A;  3ENH A;  4H5R A;  4DV0 K;  3K5M A;  2IAJ A;  1IG8 A;  4CJW A;  4IO9 L;  1WN7 A;  4JK7 A;  3IKM A;  1YTU A;  4BR5 A;  1NBW A;  2QA4 N;  3GDQ A;  3U3Y A;  4FPA A;  1SV5 A;  2O8C A;  3VPZ A;  1YT3 A;  2HHX A;  3TU5 A;  5JIC A;  3ZT4 A;  3I8D A;  3A5L C;  1NK7 A;  1JL1 A;  4E1M A;  4CHO A;  3HYF A;  4DSL A;  4LD0 A;  1RT2 A;  3LAM A;  4CJU A;  2UUC K;  4BRA A;  1KAY A;  4IFE A;  4LFA K;  3WQT A;  3SAF A;  2W6L A;  3AA4 A;  4PHT X;  1C0G A;  4CF0 A;  3Q7C A;  3KJV A;  2HHT A;  2NRW A;  1HQU A;  2HNZ A;  1W2B M;  1T6C A;  1VK0 A;  3I8B A;  5EOY A;  2NRH A;  3IS9 A;  2NRR A;  4AHT A;  4B9U A;  3O5B A;  3B6P A;  2PY5 A;  2FBV A;  3M8R A;  4JD2 A;  5GAG P;  1GLF O;  4OPJ A;  3TAR A;  1QZ5 A;  3VES A;  3W3D A;  4AM6 A;  1K8K A;  2P9S B;  5AQM A;  4WCE L;  3OYM A;  1MWK A;  1EP4 A;  4CHN A;  4E1J A;  4JKD A;  3DLG A;  4FPB A;  4JKH A;  4AF1 A;  1ATR A;  1X9J A;  1QSY A;  3OS0 A;  5CYQ A;  3HP9 A;  1K8A O;  4HTU A;  1BIZ A;  3O6W A;  1D9D A;  3AVF A;  4CHP A;  5BR9 A;  3SJJ A;  4PUO A;  3R6M A;  3CJ9 A;  4BR9 A;  2YJF A;  1TKD A;  3MWT A;  4DTR A;  1FW6 A;  1NGC A;  2E2Q A;  3DLH A;  4E19 A;  4AHU A;  2RE2 A;  4A5B A;  1T7P A;  3WUH A;  4LF4 K;  1S6P A;  1DEJ A;  1DTQ A;  5GAD P;  3KWG A;  1RBS A;  4JHD A;  4Z4G A;  1ZBL A;  1FXX A;  5AQY A;  4BDP A;  1JCE A;  2P9I B;  1W9H A;  1VQK N;  4CZL A;  3VQ7 A;  1GLL O;  1IH7 A;  3AA2 A;  1VSH A;  3E1Y A;  4O0I A;  2XY6 A;  3KD1 E;  4JI1 K;  1KTQ A;  1N33 K;  1SZ2 A;  3PIP L;  1NMD A;  1U04 A;  3M8Q A;  3HOT A;  2HND A;  4XH4 A;  4CJP A;  4KI6 A;  1IBL K;  3RR7 A;  1VRT A;  4BDY A;  4KHN A;  4I9L A;  3VQ6 A;  1LAW A;  1MA9 B;  4QCL A;  3TAF A;  5C2D A;  1DGK N;  1E4F T;  3OY9 A;  4MDB A;  4B3S K;  1J5E K;  4YOU A;  2Z1J A;  5M1O A;  1IG9 A;  4HUE A;  5KPT A;  3LZI A;  3CQX A;  1QZ6 A;  3AVI A;  3A5O C;  2GEL A;  4FJJ A;  2O4I A;  5AQG A;  1TL3 A;  3KK2 A;  4NYN A;  4CZK A;  4O55 A;  1NK4 A;  3C94 A;  3O8M A;  2YNH A;  4DF8 A;  3A8Y A;  3SQ2 A;  3KLF A;  5TKY A;  3KLG A;  3FFI A;  3CCQ N;  4CEA A;  4EP5 A;  1JLC A;  2EHG A;  3FE1 A;  4EHU A;  3BY5 A;  2RN2 A;  4PKI A;  4KH6 A;  4BQL A;  4FJ9 A;  3G10 A;  3IRX A;  2I7N A;  4BE0 A;  4LF6 K;  4CJK A;  3L4I A;  4BG9 A;  3H6E A;  4CES A;  1HNZ K;  1MDU B;  4F8R A;  4IFY A;  2QXF A;  3ASM A;  3MEE A;  3AVG A;  1Q9Y A;  3H46 O;  3K58 A;  1FK9 A;  3V9S A;  3HSC A;  1GLB G;  3B6O A;  4NO7 A;  3T1H K;  3SCX A;  1CZB A;  4AM7 A;  4FWM A;  3TAG A;  2HHQ A;  4K8X A;  4FK4 A;  4BRP A;  2GUP A;  3MX2 A;  4E7I A;  2IVO A;  4DV3 K;  5C15 A;  4QS7 A;  4O5F A;  2CGJ A;  4Z94 A;  2UUB K;  3CET A;  4OKE A;  3ZT2 A;  3QEX A;  2O8C B;  2KQ2 A;  4MQ3 A;  5JS2 A;  3G6E N;  4B1Z A;  3ITH A;  3NH0 A;  2WOM A;  4CE9 A;  4FLX A;  1VSE A;  1JCG A;  4N56 A;  4KI4 A;  4JK8 A;  5AJ3 K;  2Z1I A;  5C42 A;  4WFB L;  2ZM6 K;  4BRN A;  2QKB A;  4DTM A;  3V9X A;  2HVH A;  1HR0 K;  1NJI O;  3KTQ A;  4KTZ A;  3NCI A;  5GAE P;  2ZGY A;  3B8A X;  1A5W A;  3KWI A;  3HI0 A;  4CK1 A;  3SNN A;  3LWL A;  4M42 A;  3TSQ A;  2F9W A;  2A1R A;  1N32 K;  1OVQ A;  1N6Q A;  2E6L A;  4E7H A;  4WFN L;  4DR6 K;  3QEV A;  2QXL A;  4ELU A;  2D0A A;  4TSX A;  1BGX T;  4CEB A;  5J2N A;  3CCR N;  1RT1 A;  3ATU A;  1YVN A;  5CY4 A;  5CYM A;  3CPE A;  5J2Q A;  1OH5 A;  5GIO A;  3K5N A;  4C1N K;  1SL1 A;  2XHB A;  3P5J A;  3UKU B;  4OPK A;  2HMP A;  3V1R A;  1EO1 A;  3ISN C;  2P51 A;  3EL2 A;  2BE2 A;  2E6M A;  2H3G X;  3VMF B;  1HX1 A;  5JVG L;  1NK8 A;  2W41 A;  3F2K A;  1TK0 A;  5KGW A;  3NFA A;  3CYM A;  3R8E A;  1NGA A;  3SAH A;  4W5O A;  4JK9 A;  4BGA A;  4JI5 K;  1T3V A;  4BG8 A;  4CF2 A;  1S1W A;  3LM9 A;  3O3G A;  2VG6 A;  3CD6 N;  4A61 A;  3VEY A;  5FPD A;  4IZ9 A;  5JLH A;  3SMP A;  4QS8 A;  1WBD A;  4JHD B;  1ILY A;  4FSV A;  2O8E A;  3VQE A;  1HPZ A;  3MX5 A;  3HPG A;  1ASV A;  4H5N A;  4CJE A;  3VQQ A;  1MU2 A;  2P5G A;  1BIU A;  5AZJ A;  2G8I A;  3KKS A;  2QWM A;  3RMD A;  1VQ8 N;  3IMX A;  1NGE A;  1WB9 A;  3TWH A;  4BQZ A;  2YHA A;  1BA0 A;  3QDK A;  1NNE A;  4CK3 A;  3VER A;  1Y64 A;  3VA0 A;  3CXC M;  1LWF A;  2JWK A;  2J4R A;  5BR8 K;  1DTT A;  4KHU A;  4DLE A;  4CF8 A;  1QS4 A;  4CGH A;  3J7Z O;  2OTL N;  1RT5 A;  2HOE A;  4DU1 A;  5F1X A;  3WNF A;  3RRG A;  4DB3 A;  3ZT0 A;  2A6A A;  4FL9 A;  4CF1 A;  5HRP A;  2XO7 A;  3OYD A;  1O13 A;  4CI6 A;  3QIC A;  2UYT A;  1G15 A;  5EX5 A;  3RMB A;  3C0B A;  3N4P A;  1C1C A;  1VRU A;  3M6G A;  3Q7B A;  4A5A A;  2HBL A;  3BF3 A;  4PA1 A;  4FK2 A;  3VQA A;  3VEZ A;  3RSE A;  5AQQ A;  2JGU A;  4LC9 B;  4ICL A;  2ZJQ L;  2KZM A;  4I9Q A;  4GY2 B;  5HLF A;  1UA1 A;  2BGG A;  1HQE A;  4EP4 A;  1OH6 A;  4DR4 K;  1C6V A;  3D6R A;  3OA9 A;  4CZH A;  2ZJP L;  4FLY A;  2NRT A;  2BAN A;  1YTA A;  4HUG A;  2E5L K;  1E3M A;  3CMA N;  1D5A A;  3AA3 A;  3ID6 A;  1EQY A;  4B9T A;  4M7X A;  4KFB A;  3SAG A;  4WF9 L;  3IUC A;  5J1E A;  3CC7 N;  3VQ8 A;  1D8Y A;  1WSH A;  2HHW A;  2IS3 A;  5AQX A;  4E7L A;  3F9M A;  3VGL A;  2LSN A;  3EKU A;  3WXJ A;  1I39 A;  4H0P A;  4V19 S;  3IG1 A;  4X62 K;  3ZT1 A;  3CQ8 A;  5E41 A;  3A0I X;  3VQ4 A;  3SPY A;  3RRH A;  1GLJ O;  3QFU A;  3CFO A;  1S1V A;  5LMN K;  1KFD A;  1QSL A;  2YNF A;  2AA4 A;  1H1V A;  1HPM A;  4YOX A;  4AHS A;  1BCO A;  2G8F A;  4ZHR A;  5IT9 O;  3WXL A;  4CIG A;  5LMU K;  4I2Q A;  4ID5 A;  3H1Q A;  4DG1 A;  2DFF A;  2R7Y A;  4JKE A;  5GIP A;  4JKC A;  4FM1 A;  3VF2 A;  5KQD A;  3OTO K;  4WQ5 C;  3JSM A;  4J8F A;  5FPE A;  1IKY A;  5HRS A;  1ZBI A;  2ATQ A;  1TGO A;  4Q0B A;  2YJE A;  1S5J A;  4LSN A;  1QQN A;  1DT9 A;  1YI2 N;  4B3T K;  3ZX0 A;  4CIE A;  1FJG K;  3UKR A;  2HHU A;  5M1N A;  1NU0 A;  4E1N A;  3D2E A;  1SUQ A;  4KTQ A;  3KHY A;  4IJN A;  3K9K A;  4OLA A;  1I3A A;  2HHV A;  3EKS A;  2PBD A;  2HW3 A;  1S1T A;  3R9P A;  2P9S A;  3L3V A;  3FZK A;  1D4X A;  3LP2 A;  4IBN A;  3NF6 A;  3HST B;  1K9M O;  4MLH A;  1HNW K;  4BRH A;  4Z4E A;  5AQV A;  1OH8 A;  3WEE B;  1NK0 A;  3QEI A;  3NDK A;  2O8E B;  3CJ1 A;  3M8P A;  5KPZ A;  2D0P A;  4YOT A;  2O8D A;  4CGD A;  4O5B A;  1CXU A;  4CJF A;  4B3R K;  1CLQ A;  4C1N I;  4YOR A;  5AZJ B;  5T7B A;  1MWM A;  5H1S Q;  3O9U A;  2EX3 A;  1HYV A;  1YF5 L;  3KVG A;  4JLH A;  1W0H A;  5EY4 A;  3THW A;  3OYF A;  1O1W A;  1B9D A;  3TPQ A;  3CFR A;  1G99 A;  3O1W A;  5AR0 A;  1Z6R A;  4HHT A;  2FF3 B;  5I42 A;  4HTL A;  3J8A A;  4X65 K;  3U9D A;  3OYL A;  3CCU N;  3ULD A;  2DFH A;  3DWL A;  4ILG B;  5DM7 L;  4JI0 K;  2E88 A;  5I9E B;  1ATS A;  3D7E O;  3I56 N;  4WFA L;  4CZJ A;  1QTM A;  4FJN A;  3EYZ A;  3KLI A;  2F4V K;  3L8B A;  4FLT A;  3RSE B;  4CFC A;  2QEX N;  1VQ6 N;  1IKW A;  1NGJ A;  3CJB A;  3AVL A;  5DMR A;  4DV4 K;  3CHW A;  4CJL A;  3KLE A;  3KLH A;  3SUQ A;  5AQO A;  3IDH A;  1QHA A;  1Q82 O;  1C0T A;  2FLO A;  3TAB A;  4H0V B;  4HCB A;  2AP1 A;  3QML A;  1VSF A;  2IVN A;  4BRO A;  4M45 A;  4DTX A;  4H5W A;  1Z25 A;  3KKR A;  4CEQ A;  1LCU A;  2A1S A;  3U4L A;  2QKK A;  3TAM A;  4GKJ K;  4DWI A;  2KFZ A;  4M63 C;  4KH5 A;  1BWF O;  2V7Z A;  3AV9 A;  3RWU A;  1EKE A;  4ISG A;  3THV A;  4I2P A;  4WQ4 C;  3SPZ A;  1EXQ A;  1WSE A;  4F3O A;  2F8T A;  3EO3 A;  1A5X A;  1CZ9 A;  2A41 A;  3L2Q A;  5BN9 A;  3QIP A;  1YXQ A;  3LP0 A;  4JYA K;  4K42 A;  1X9M A;  1XQS C;  1YUW A;  1HKG A;  4CD3 A;  4C23 A;  4E0D A;  1ZBU A;  1RBR A;  3J7A P;  2B4J A;  1XI1 A;  4BRC A;  4B1X B;  3AA5 X;  3MWP A;  1BU6 O;  4FWN A;  4AQY K;  1B92 A;  1RFQ A;  2QWQ A;  3O9T A;  4CJ7 A;  1DKG D;  4K25 A;  3P4I A;  4LSL A;  3LAK A;  3MEG A;  1JLB A;  1WOQ A;  2HF3 A;  4BC3 A;  4WQ4 A;  3J7Y P;  4U7B A;  1ZC6 A;  5HRO A;  3FZM A;  3SQ0 A;  3VGK A;  3TTD A;  4JEP A;  3H1V X;  3DLE A;  2ITM A;  2P9U A;  3UKR B;  3ZX2 A;  1VQP N;  4G1Q A;  4JI4 K;  2WUS A;  1BIS A;  3QEP A;  3D2E B;  4NB4 A;  4IFV A;  4CCH A;  1JLQ A;  1N34 K;  3LPT A;  4DR1 K;  1KVA A;  2BH1 A;  3LDL A;  3SQ4 A;  5KQ8 A;  2F7T A;  1L5U A;  4ISF A;  3THY A;  4CGJ A;  3D2F A;  1FKO A;  3AO4 A;  3O9S A;  1X3M A;  4Y1D A;  3MN6 A;  1LV5 A;  2VG7 A;  4DU4 A;  2VGM A;  4CGF A;  3AAR A;  3BZK A;  3H3O B;  3UKU A;  3DLL L;  3DM2 A;  2P9K A;  3HK2 A;  4CW7 B;  3QBW A;  4O0J A;  3OYH A;  1L3S A;  3VQB A;  4NXN K;  2O8D B;  3BGR A;  3O9R A;  5ADX H;  4DTP A;  3C7N A;  1HRH A;  3HBT A;  2QM1 A;  3HRG A;  3FR0 A;  3I0S A;  3HP6 A;  2HMI A;  4CJ5 A;  2KZZ A;  2NRV A;  4FJ8 A;  1ZBF A;  5J2P A;  2PFU A;  3THW B;  4FVU A;  3D0P A;  3GG4 A;  4DHY A;  1LWC A;  2A5X A;  2HVI A;  5B8H A;  3L0Q A;  2Q1N A;  1R59 O;  3PX4 A;  3MXJ A;  4DQP A;  3V9U A;  1ZYQ A;  4CK2 A;  1S3X A;  1YJ9 N;  3VQ9 A;  4DCH A;  5SWM A;  2WFB A;  2ZWH A;  2D0C A;  1EX4 A;  2OPS A;  3FZH A;  3CER A;  2HHS A;  2Y1J A;  3I55 N;  3S3N A;  3FGU A;  5AQR A;  4GV9 A;  3DYA A;  4FJX A;  5AQL A;  3DJC A;  1VQN N;  2VYP A;  1VHX A;  1NOZ A;  3ZCM A;  3RMC A;  3ID8 A;  4MDA A;  4CHZ A;  3WQU A;  3QB0 A;  3R3L A;  1L3U A;  1KFS A;  2E2O A;  4PY5 A;  4DV2 K;  2YHB A;  5FPN A;  1VSJ A;  3LZJ A;  1C0U A;  4PKH A;  3KIO A;  4BR4 A;  4GKK K;  4IOC L;  3SV4 A;  3OYE A;  3VTH A;  2BTF A;  4JI6 K;  1JLE A;  3KK3 A;  4E3S A;  5HOO A;  1UOC A;  2F9T A;  4F3T A;  1GLE G;  1T05 A;  3OHR A;  3PIO L;  4WYB A;  2P9L A;  2P1J A;  4C8L A;  4PWD A;  3TTC A;  3T1Y K;  4BY9 C;  2YKM A;  3CCV N;  3BEX A;  5EVZ A;  1S72 N;  4FZZ A;  5GAH P;  5FRN A;  2RHK A;  1BUP A;  4NLC A;  2IGI A;  3VET A;  1TAQ A;  3MMV A;  3QER A;  3LAN A;  1WUA A;  4YOY A;  3NF7 A;  3AO1 A;  3HM9 A;  1K6Y A;  3P31 A;  2UU9 K;  4EHT A;  4R79 A;  4JS4 A;  1NK9 A;  4Y0W A;  1R0A A;  3DRR A;  4JN4 A;  3L4Q A;  3TSP A;  3N4Q A;  3K5L A;  1C1B A;  2KHO A;  4DR7 K;  1T03 A;  3AY9 A;  1WSF A;  2VQE K;  3EE8 A;  1T6D A;  4FVM A;  1QHT A;  2P9U B;  1SKS A;  3QIO A;  3DAW A;  1NGB A;  1XWL A;  3CCS N;  4KRE A;  4IDH A;  5EU7 A;  4C8K A;  1L3V A;  4ELV A;  5D3G A;  3CI5 A;  3H3N O;  1XMQ K;  2Y1I A;  3KZB A;  4DFP A;  3OS2 A;  3EEQ A;  4KV8 A;  1P8Z A;  4CED A;  3SV3 A;  4BRL A;  2IVP A;  3FZF A;  3V9W A;  1NK5 A;  4B1U B;  3THY B;  3D2F B;  4GW6 A;  4KB1 A;  4DV6 K;  4IKF A;  2P9P B;  1RTJ A;  4H5T A;  4DSF A;  1TKX A;  4BAC A;  1RGI A;  2QWR A;  4H4M A;  3LDO A;  4YOW A;  2P9K B;  4B3M K;  1GOA A;  4Y1C A;  3VQD A;  3ZSW A;  4B9N A;  1NG9 A;  3MCA B;  4IJA A;  4JRQ A;  3BF1 A;  4O44 A;  2KLA A;  2Q0R A;  1U49 A;  4I6M B;  1F21 A;  3C7N B;  3ZSV A;  2QWP A;  1YJN N;  5AQJ A;  3HOS A;  1DLO A;  4UY8 O;  3A5N C;  3WXI A;  4LY7 A;  4BDZ A;  4FJL A;  3LPU A;  1TL1 A;  3EZ5 A;  5GIN A;  2NNW A;  3NF9 A;  1IBM K;  3NGY A;  1W97 L;  3WEE A;  4PL8 A;  4OGE A;  5KPR A;  4NCA A;  1E4G T;  1JCF A;  2JWL A;  4FCY A;  2IDO A;  4JI7 K;  3I0R A;  1HLU A;  4LF7 K;  4RW8 A;  5C24 A;  3FZL A;  3VEX A;  3NH2 A;  3S41 A;  2NUB A;  4B1Y B;  4J2E A;  3HJF A;  1U48 A;  3AVM A;  2DY4 A;  1N5Y A;  2FBY A;  2PAV A;  4EZ9 A;  3DLK A;  4DTU A;  1S6Q A;  1KVB A;  4IG3 A;  3NHG A;  2VWB A;  1YAG A;  3IFR A;  4CGG A;  1X1P A;  4Z4I A;  3NGI A;  1KQS M;  1ITG A;  3DOK A;  3LAL A;  3C6H A;  4JKA A;  2X6S A;  3AVA A;  1X3N A;  4JKB A;  3LP1 A;  4DSK A;  1VSM A;  1VQO N;  4C8O A;  4IXC A;  3U3G A;  2CGL A;  4B1W B;  1UAX A;  5J2M A;  4A59 A;  2NRZ A;  4FJK A;  3M1F A;  4JNE A;  3MN9 A;  1RBT A;  3VEV A;  3ZSR A;  3K57 A;  3ALY A;  2WC9 A;  3CCM N;  3PSI A;  4KPY A;  1VSD A;  2YI1 A;  1IO2 A;  1KAX A;  1XHX A;  2ITG A;  4B9Q A;  4M3T A;  4KBO A;  3VQP A;  3AGK A;  2Q97 A;  3SUP A;  1S9E A;  3L3U A;  2EWS A;  4BC5 A;  1SL2 A;  2CH5 A;  2P9L B;  4CVN E;  4K43 A;  3TTF A;  5E84 A;  4ID1 A;  1JLA A;  3CCL N;  4MLE A;  5CR4 A;  1Q7Y O;  1RTD A;  4FJ7 A;  1V4S A;  3ZSQ A;  4CJ3 A;  4ISE A;  4G9Z A;  3ENO A;  3LP3 A;  4XH1 A;  1BO5 O;  4EZ6 A;  1ZBS A;  4A62 A;  3HT3 A;  1SL0 A;  5JS1 A;  4FO0 A;  1HNI A;  3O08 A;  4FYD A;  1NWK A;  1VSK A;  3CME N;  4KHW A;  3AVB A;  1BL3 A;  4BE1 A;  4FLU A;  4QOZ B;  2QWO A;  3CM6 A;  1P90 A;  1HJO A;  3K5O A;  3NAE A;  2FXU A;  3V6D A;  2PZS A;  3U6F A;  3TAN A;  3CF5 L;  2VCP A;  2QI2 A;  2V51 B;  3MCP A;  3QFP A;  2KKZ A;  1LWE A;  1U2V A;  4YFU A;  3EZW A;  3MDQ A;  1XHZ A;  3VOV A;  1HKB A;  1CXQ A;  2E4L A;  4K0K K;  1W7A A;  3SZ2 A;  4HUF A;  3ZSZ A;  2E1Y A;  1BHL A;  1K73 O;  2HBK A;  3OBY A;  4PL7 A;  4OPH A;  2GWJ A;  4LH4 A;  4J2B A;  4DUY K;  2ZGZ A;  3IAY A;  3G4S N;  2VWK A;  3PV8 A;  4ZTJ A;  4DFM A;  1J9A A;  2O4G A;  1J6Z A;  4IG0 A;  2Q2R A;  4PKG A;  1S1X A;  4DLG A;  2P5O A;  4BRK A;  4OPA A;  3HXM A;  4CFA A;  5HRN A;  1VQ4 N;  3R1X A;  2A42 A;  4CF9 A;  2O8B B;  4DR5 K;  1VQM N;  4H4O A;  3A5M C;  3QO9 A;  4FW1 A;  1TK5 A;  4GVM A;  1KD1 O;  4FM0 A;  4KO0 A;  3L2V A;  2E2P A;  3THX A;  4RW7 A;  1HKC A;  3CPW M;  4LFB K;  1RBV A;  4ELT A;  4RCH A;  5AQU A;  2OA8 A;  2OPQ A;  2XY8 A;  5K14 A;  3VGM A;  1YIJ N;  3F9K A;  2YHY A;  4CIF A;  1QE1 A;  4X66 K;  5M1K A;  4H8K A;  1RDC A;  2HHH K;  3V4I A;  4AHV A;  4CEE A;  3OYC A;  1WAF A;  2GEM A;  4F2S A;  5JLF A;  2OTJ N;  4CFD A;  5KRT A;  4JI3 K;  3AO5 A;  3PX0 A;  3WXK A;  2XY5 A;  4EAH D;  4XH5 A;  2OAN A;  1QQO A;  4CGI A;  2WTU A;  1RDU A;  3TAP A;  3OVN A;  5BPL A;  1BQN A;  2RF2 A;  2A3Z A;  4DR2 K;  1UWB A;  1RT4 A;  3TR8 A;  4U67 L;  3J81 O;  2G8W A;  4RW6 A;  4BR2 A;  2E2N A;  1KC8 O;  4JAX A;  4MFB A;  4O8U A;  3CFP A;  1TUU A;  2CH6 A;  2F8S A;  4KHP K;  1XC3 A;  3BP8 A;  3K2P A;  4CJ4 A;  1NLV A;  1NGG A;  3U8X A;  1SKW A;  4DMN A;  2F96 A;  3S3M A;  1KLM A;  1RBU A;  1RT6 A;  2IC3 A;  3O4N A;  4AH9 A;  4DQS A;  5LY3 A;  3ZSX A;  5HL7 L;  2RKI A;  1NJZ A;  5DK5 A;  1RDD A;  3WNG A;  1LAV A;  1JKH A;  3DXM B;  1X9W A;  5KRS A;  5ELZ A;  3KK7 A;  4CZF A;  1NMN A;  2Q36 A;  4W5Q A;  3PX6 A;  3ZET A;  2PYL A;  4NLB A;  4N41 A;  1C1A A;  1RDB A;  3C6T A;  2YNI A;  1WLJ A;  3OJS A;  3E66 A;  3SJH A;  1XC9 A;  4CER A;  1HJR A;  3CQY A;  3DXK A;  2QTD A;  3L2W A;  1M1K O;  2E1Z A;  4CD1 A;  1VSL A;  4F2R A;  3BZC A;  1BQM A;  5AQW A;  4LH5 A;  1VQ9 N;  3SYZ A;  3WXM B;  3OW2 M;  5AQZ A;  4IWV A;  3V81 A;  5ADX A;  2X74 A;  2G8U A;  3A2F A;  4GV3 A;  1A5V A;  4IOX A;  1NKC A;  2FSN A;  4FWK A;  5AQH A;  2NRX A;  3CCE N;  4RWT A;  1RIL A;  1U6Z A;  2XY7 A;  3QLH A;  1QQM A;  2KW4 A;  1U2V B;  1Q9X A;  4N5S A;  5BRE A;  5SZT A;  1HYZ A;  5C10 A;  1T44 A;  3ATV A;  3MN7 A;  2ASO A;  4OLB A;  1VAZ A;  2D0O A;  3ZX3 A;  4BRM A;  2E8A A;  2V7Y A;  4O4G A;  1LW2 A;  4L8R B;  1U4B A;  4DTS A;  4R5P A;  5M1P A;  5HP1 A;  4M3R A;  2Z1H A;  1TKT A;  3C6U A;  3QNN A;  4EIA A;  3ULE B;  4O8K A;  2ASP A;  3SQ1 A;  2X78 A;  4W5T A;  4DQ8 A;  3DI6 A;  4Z4H A;  5BPM A;  4UQG A;  2OPR A;  4CBX A;  4BC2 A;  5EXW A;  3L2U A;  4GNI A;  3PUF A;  4JS5 A;  3ENB A;  4FOI A;  1WSJ A;  2YX6 A;  1NJY A;  1L3T A;  2QK9 A;  4QS9 A;  2OYQ A;  2P9N A;  2P9P A;  3EY1 A;  3THX B;  2PYJ A;  3K9J A;  5DM6 L;  4CZE A;  4KB0 A;  4CEZ A;  4L3Q A;  3M3Z A;  3BUZ B;  3T1A A;  4B1V A;  4CJR A;  3TAE A;  1NGD A;  3CM5 A;  4FZX C;  1WAJ A;  2IOC A;  1NKB A;  3CCJ N;  5FRM A;  4BR7 A;  2OPP A;  1HNV A;  1WSG A;  1NGF A;  4I6M A;  4YOV A;  4FWP A;  1FKP A;  3M5R A;  3G71 N;  5LJV A;  3MN5 A;  3MAQ A;  3CJC A;  5FRO A;  1OKJ A;  3AVK A;  4LF9 K;  2KTQ A;  3O3F A;  3VTI A;  2V52 B;  4E7K A;  5AQT A;  4CEO A;  3K0S A;  1QVG M;  3LDQ A;  4A57 A;  2VGN A;  3SUN A;  1OVY A;  1Q8I A;  1RCH A;  3T19 A;  4CEC A;  5AFU A;  2GUI A;  4M3Z A;  3V9Z A;  4HCC A;  1XNQ K;  3AO2 A;  4DF4 A;  4N47 A;  2ETJ A;  4KHS A;  1GOC A;  4IDK A;  1Z05 A;  1B9F A;  4RW4 A;  5JVH L;  4NCB A;  4J2A A;  5HBM A;  1Z26 A;  1C0F A;  5CHI A;  4DTJ A;  4BRF A;  3S3O A;  5BRH A;  1KAZ A;  4JI2 K;  3G0Z A;  3S9H A;  4NYF A;  4GV6 A;  3WNH A;  3VF4 A;  1RT7 A;  5CE3 A;  3OS1 A;  3D45 A;  3P38 A;  4FLV A;  2UXB K;  3GOI A;  3OYB A;  4DTN A;  2HF4 A;  1EWQ A;  3C6A A;  4Z4C A;  1J5O A;  4DFK A;  5CZ1 A;  3HO1 A;  4OO1 J;  4BRQ A;  4FWO A;  1SS6 A;  3ZET B;  1VQ7 N;  3HVT A;  3AVC A;  4HVJ A;  2RPI A;  4DSJ A;  3NVK A;  3OYG A;  5C2F A;  4OKK A;  1NOY A;  4BRD A;  5FPM A;  4YNQ A;  3RVC A;  2YHW A;  4X64 K;  2KFN A;  1QQC A;  1KVC A;  1HMV A;  3LDP A;  3ZEU A;  3DXK B;  3ZSO A;  3FFK B;  3QNO A;  3CC4 N;  3K59 A;  1TUY A;  2HBJ A;  2ZE2 A;  2NLX A;  4QAG A;  3JXU A;  4YDU C;  2W42 A;  4FM2 A;  4K8Z A;  4FJ5 A;  4Z4F A;  4B3O A;  1YVU A;  1ATN A;  3P83 D;  5AFU H;  3T7Z A;  1X9S A;  1IV0 A;  3U9Z A;  4DQR A;  1BI4 A;  3H45 C;  3UIQ A;  4RW9 A;  1NK6 A;  4BWJ A;  3RMA A;  4M3Y A;  5LL6 Z;  3NVM A;  1T8E A;  1N8R O;  3OYN A;  3SBG A;  4BVO A;  3V1O A;  3UB5 A;  2YKN A;  4F4K A;  3TAQ A;  4OKJ A;  4YDU A;  3BDP A;  3SK3 A;  4M3X A;  4B9M A;  4DUZ K;  1J53 A;  3OBW A;  1GLA G;  1TK8 A;  1LOT B;  4FWQ A;  2G8K A;  1JXB A;  1RTH A;  5C25 A;  1TKZ A;  3C65 A;  3O80 A;  3NF8 A;  3NBP A;  2FC0 A;  2G8V A;  4MO4 A;  2VWJ A;  4FW2 A;  3I33 A;  5AZI A;  2FBT A;  3JYT A;  1TV6 A;  3PSF A;  4ILJ A;  3DMJ A;  1HNX K;  3QEW A;  3GL1 A;  2GWK A;  2WBN A;  3CIP A;  1ZXO A;  1KSP A;  4DSI A;  3HL8 A;  2OZS A;  2UXD K;  4OX9 K;  1C0M A;  2P9N B;  3TI0 A;  4GMJ B;  2UUA K;  1XUP O;  1ASU A;  1IJJ A;  3SUO A;  5IWA K;  2Q31 A;  4JD2 B;  5F0X A;  4PQU A;  4H0X B;  2IIR A;  5AQS A;  5A2Q O;  4LF8 K;  1CZA N;  2O8B A;  3M8S A;  4LF5 K;  1K8K B;  4CHY A;  3HTV A;  3EN9 A;  4B08 A;  4OGC A;  3F5T A;  2CGK A;  4KH4 A;  4B8C A;  1XNR K;  4HWI A;  3HPO A;  3H08 A;  2VQF K;  4FXD A;  1EWR A;  3VQC A;  1GLD G;  4W5R A;  1JJ2 M;  1Y97 A;  4FLW A;  3LWM A;  3SLC A;  4BVP A;  1JLF A;  3V1Q A;  3KD5 E;  1NJW A;  3VEN A;  1Q86 O;  2HBM A;  4CEF A;  3MXM A;  4CZG A;  3AO3 A;  1GLC G;  1EET A;  3HZ6 A;  1HYS A;  3QES A;  3PO4 A;  3WT0 A;  1RTI A;  4KHY A;  4M41 A;  2D0B A;  3DOL A;  1IKV A;  2YV0 X;  4JKG A;  3QET A;  3AVJ A;  4IEI A;  1NM1 A;  1YIT N;  3ZT3 A;  4FWS A;  5HRR A;  4LFC K;  3AGR A;  1KCF A;  1S9G A;  5MLC Q;  2B6A A;  3F73 A;  4JV5 K;  1NJX A;  1NGH A;  3HVR A;  2ZD1 A;  4F9O A;  3TSU A;  4CHQ A;  5AQF A;  5JMV A;  4M3W A;  2DPN A;  1D9F A;  2I5J A;  4DQI A;  4DTO A;  1M90 O;  4A2A A;  5BRF A;  4ZTF A;  2GTD A;  4DU3 A;  1Q18 A;  1KLN A;  4BRI A;  3GBT A;  2G8H A;  4KTW A;  3G25 A;  4BWM A;  4DQQ A;  2FSK A;  3MEC A;  3PLA A;  4RG8 A;  1TAU A;  1YJW N;  3ZEU B;  1N36 K;  5C12 A;  3E9L A;  2X6N A;  2OZM A;  2Z1G A;  3VA3 A;  4OJR A;  1TYQ A;  1BOT O;  4YY3 K;  1V4T A;  4A2B A;  3E9O A;  2Q3S A;  3T69 A;  3OYI A;  3DXM A;  2W40 A;  2B5J A;  2O8F A;  3HPH A;  3J80 O;  4DV5 K;  3LDN A;  1TVR A;  2YHX A;  3NGZ A;  2VG5 A;  4WE1 A;  1BI4 B; 
#chains in the Genus database with same CATH homology
 2ZM6 K;  4LF5 K;  4B3T K;  4LF7 K;  4KHP K;  1FJG K;  4NXN K;  4X64 K;  4DV0 K;  1HR0 K;  1XMO K;  1XNR K;  3JAM O;  5FLX O;  2VQF K;  4JI1 K;  1N33 K;  4K0K K;  4NXM K;  4DV7 K;  2UU9 K;  1N32 K;  4GKJ K;  1IBL K;  4CW7 B;  2UXC K;  4DR6 K;  4DUY K;  4YHH K;  1HNW K;  4DR7 K;  4DV1 K;  4B3S K;  1J5E K;  2VQE K;  2UUC K;  4DR4 K;  4LFA K;  4JYA K;  4DR5 K;  4B3R K;  5LL6 Z;  4LF9 K;  3J7A P;  1XMQ K;  2E5L K;  4LFC K;  1I94 K;  4AQY K;  4JI5 K;  4JV5 K;  4DUZ K;  4LFB K;  4LF6 K;  1XNQ K;  4DV6 K;  4DR3 K;  1HNZ K;  3J7Y P;  4CVN E;  1IBK K;  4B3M K;  4X65 K;  4X66 K;  4V19 S;  3T1H K;  4DV2 K;  4X62 K;  4JI4 K;  2HHH K;  4GKK K;  1HNX K;  1N36 K;  4JI2 K;  4JI0 K;  4JI3 K;  4JI6 K;  4DV3 K;  5LMN K;  1N34 K;  4DR1 K;  2UXD K;  4OX9 K;  4YY3 K;  2UUB K;  5IT9 O;  5LMU K;  1IBM K;  2UUA K;  2UXB K;  2F4V K;  4DR2 K;  5IWA K;  3J80 O;  3J81 O;  3OTO K;  4DV5 K;  5BR8 K;  4LF4 K;  4DV4 K;  5AJ3 K;  5A2Q O;  4LF8 K;  4JI7 K;  3T1Y K;  4JI8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...