4DR5K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr5K00
3J7AP 4OX9K 3OTOK 4B3MK 2F4VK 4X62K 4JI1K 5AJ3K 3JAMO 4LFBK 1XNRK 5BR8K 2UUBK 4DV5K 4DV6K 2UXDK 4DR4K 2VQEK 4CVNE 4DV3K 1HNZK 4DV7K 4GKKK 5LMUK 4JI4K 1IBLK 4LFAK 4DR3K 4DV4K 4KHPK 3J80O 4K0KK 4DR2K 4X65K 4X66K 4CW7B 1FJGK 4DR5K 4NXNK 4B3RK 1N34K 4DUYK 4JI2K 4JI3K 2UXBK 4DR7K 4B3TK 4NXMK 2VQFK 2E5LK 4LF6K 4LF5K 4DUZK 4DV0K 1HR0K 4JI8K 4JYAK 5IWAK 4JI6K 4AQYK 5IT9O 1IBMK 1HNWK 4GKJK 4DV1K 4LF8K 5A2QO 1N33K 1XMOK 2HHHK 3T1YK 2UUCK 3J7YP 4JV5K 3J81O 4LF4K 4DR6K 1IBKK 4JI7K 4LF9K 2UU9K 2UXCK 1XNQK 5LMNK 3T1HK 4LF7K 4JI5K 4DV2K 5FLXO 4B3SK 4JI0K 4V19S 1J5EK 5LL6Z 4DR1K 1N36K 2UUAK 2ZM6K 4YHHK 4LFCK 1HNXK 1I94K 4X64K 1XMQK 4YY3K 1N32K
chains in the Genus database with same CATH superfamily
3V9XA 4MQ3A 3BF3A 1TYQB 3VETA 4LFBK 3U8XA 3OYEA 2YHXA 2DY4A 4BE2A 4DSEA 4JS5A 2ZE2A 4PA1A 1QZ6A 4FWPA 3HP6A 1U45A 4WE1A 4BRMA 3BF1A 4Z4FA 3EZ5A 1YAGA 2WC9A 2O8BA 3I55N 2KFZA 1NJIO 2Z1JA 3LP2A 3HBTA 4IFEA 4Z4CA 2GELA 5F2RA 1REVA 2Q0UA 1RDUA 1BGXT 3KIOA 2WTUA 4E1NA 4DQSA 1FJGK 3AAPA 1MA9B 2PAVA 3FZFA 4IZ9A 4BROA 2G8VA 3G25A 4DR7K 4CHQA 4H0OA 2VGMA 3TSQA 1Q9YA 4KTWA 3S41A 1NJZA 3D2EB 3BEXA 2YKMA 3PO4A 1KLMA 3OVNA 5AQPA 3ZSOA 4FM0A 4BE1A 2E1ZA 3PX6A 4FWQA 1Q86O 5GAHP 3SBGA 3OHRA 4HCBA 2R7YA 2JWLA 3VTIA 3K9JA 4ILHA 1FKPA 1MWKA 4OLAA 3O4QA 1U48A 4B9MA 4JKBA 4W5NA 5AQTA 1TKZA 4DF4A 4ID1A 2XY8A 3MN9A 3SAGA 3P1GA 1RT7A 3F5TA 4H0TB 5BRFA 4PWDA 2P9SA 2YV0X 3UKUA 3SQ4A 3T1HK 4KKOA 1QQOA 4HUFA 1C0UA 4JNEA 3EE8A 3SZ2A 3ENBA 4BQLA 4JEPA 1TUYA 5FPMA 2IDOA 4BACA 5GAEP 3ZETB 2Q2RA 4J2BA 5FPDA 4FJIA 2D5RA 4LSLA 1D4XA 2F8TA 4IKFA 1GLBG 4IDKA 3THYA 4JI1K 1VQ8N 2AA4A 3VA3A 5BR8K 2G8IA 5DM6L 2OPRA 4IOAL 1BCOA 1CZ9A 4W5TA 3QEIA 3I56N 1SKRA 1DGKN 3DXMB 4NLCA 4IJAA 2A3ZA 4H0XB 3TANA 4DB3A 4KHYA 2WFBA 3NBPA 1BA1A 4H0VB 4LH4A 3WXLA 4FWSA 3HO1A 1WN7A 4R79A 5EY4A 4CJ4A 4AHSA 4CJSA 3CHWA 3D2FB 2DFFA 4JHDA 4HUEA 1DEJA 3O6WA 1LWCA 4K42A 1YJNN 3OYMA 2YNHA 5AFUH 4AHTA 2QWMA 4NXMK 4CZJA 2HBJA 1QQNA 4CJUA 4RG8A 2FBXA 1IKYA 1E4GT 2E88A 1KFSA 4QS7A 3O9SA 3KLGA 1NJYA 1RTHA 4O5BA 1HNWK 4GKJK 3KLIA 1X3NA 1N33K 1OH6A 2FF3B 4DTXA 3A5MC 3VEWA 3VTHA 1LW2A 3M3ZA 1RFQA 1X9MA 4ELUA 2IC3A 2Y1IA 3W3DA 3O8MA 2HBLA 1SL2A 3QMLA 4CK1A 3EEQA 1U2VA 4F3OA 2B4JA 4CJ7A 4B1ZA 4J2EA 2NNWA 4JI0K 4CZHA 4NB4A 1HQEA 1B9DA 4AHCA 3H46O 3ZSWA 1XQSC 4KH6A 4DFPA 3KHYA 3QIOA 1QSYA 1N32K 2CGLA 2HHVA 4DFMA 4PHTX 4MLEA 3KK7A 3LP1A 3U3GA 2OTJN 1T3VA 3NHGA 2A1RA 1KCFA 4B3OA 3O80A 2E2QA 1GLAG 1TK8A 4EIAA 4M3WA 1VSFA 3AVGA 5AQIA 3K59A 1NK9A 1TUUA 3SJHA 4CVNE 3SUQA 3BZKA 2VWJA 3AGKA 5KI6A 3QEPA 4JI4K 3ALYA 1SUQA 2P9SB 5AQYA 5AQJA 1KD1O 3MWPA 3QO9A 2PYLA 3RR8A 3O4WA 4BE0A 3ZSVA 2ITGA 2O8FA 5CYMA 4YDUC 4CJRA 2CGJA 3VGMA 3TABA 3DLGA 4CHYA 4K0KK 1VAZA 4BC5A 1RCHA 2YNGA 3THVA 5AQLA 5AQQA 2OZMA 2QWLA 1VSJA 3L2VA 1SV5A 3MMVA 1IJJA 3VQAA 2HHSA 3CFOA 4F3TA 2PYJA 1OH5A 1OKJA 1NK4A 3ITHA 4C1NI 3IMXA 2O8CB 3TWHA 1J6ZA 3C65A 4GW6A 1KAZA 3FE1A 3MN5A 4GNIA 1VQ7N 1BUPA 3UKRA 3CC4N 3VQ4A 4MDBA 3V9WA 5HLFA 4M7XA 4O0JA 3TSUA 1CZAN 2NRHA 4FJMA 3JS6A 5BN8A 3VQPA 4AHVA 1ATNA 1IKWA 3O9UA 5AQMA 4DSKA 4FXDA 4DTSA 1T6DA 4E1JA 4B3SK 3B8AX 3A0IX 3MX2A 4RW6A 4KB1A 3VENA 5BR9A 1BG3A 2E2NA 4YHHK 2KLAA 4NCGA 5AQZA 3O3HA 3PV8A 4LH5A 3LDQA 5T7BA 4BC4A 4CFBA 1BQNA 1HPZA 1HNVA 5DMRA 3LDSA 4DS4A 4IEIA 3ZX0A 4CESA 4DV5K 1S3XA 4ISGA 2X74A 4H4MA 3PY8A 1NGDA 2FSJA 3OYCA 3PX0A 2VQEK 3SPZA 3G6EN 3FFIA 3P39A 4B8AB 1NK6A 5BPLA 1SKWA 3LDOA 3U9DA 4BRFA 3VQ7A 4FWLA 3OYAA 3NCIA 5LMUK 1K8AO 4CEOA 3VQCA 2WBNA 2Q97A 1BI4B 1NGEA 1VSEA 1LAWA 5AZJA 3MK6A 4FWRA 1U2VB 4CK2A 1KC8O 1HQUA 3RMDA 1W97L 1BIUA 4X65K 2ASMA 2D0CA 1L3VA 2EX3A 2FBYA 3G4SN 1D8YA 1YTAA 1N34K 1KVBA 3CFRA 4CGDA 1TK5A 4JKFA 3CIPA 3OYGA 2VQFK 4JKDA 2E5LK 1BWFO 4LF5K 4FM2A 2B6AA 1KRPA 4JI8K 1JLEA 1RBUA 3VF4A 3M8RA 2G8FA 3K5LA 2V52B 2H3GX 4ZTJA 3KWGA 3ZCMA 1IBMK 1ILYA 3VN5A 3LP0A 4CJ3A 3AV9A 4CECA 3ID8A 1KTQA 1YXQA 3L8BA 3AA4A 2AP1A 3VA0A 3AA5X 1XNQK 5TKYA 3KZBA 2O8FB 4W5RA 1TYQA 4IEEA 1K8KB 3AVFA 4B8CA 1J9AA 3A5LC 2QK9A 3R1XA 2GBZA 4Z0UA 2A6AA 1NJWA 3WQTA 4B9UA 4YDUA 4ICLA 3E9LA 5ADXH 2OPPA 3M8SA 2KKZA 5HROA 2Z1IA 2G8HA 5BREA 1KVCA 2F4VK 2Q31A 4DQQA 4JK7A 4QCLA 2EWSA 2QI2A 1QVGM 2NUBA 5CYQA 3FZMA 2KQ2A 1XNRK 4G9ZA 3CQXA 4GMJB 4DSLA 4FK0A 4NYFA 4B9NA 2VYPA 4BC2A 3ZT2A 4FPBA 3UKRB 2WUSA 1HNZK 3AVJA 3HL8A 1VK0A 3U3YA 4CJWA 5I3UA 4KAZA 2F96A 3ZYYX 2DPNA 3D2EA 3NF9A 4HVJA 1NK0A 1XC9A 1T6CA 4DFKA 3AVMA 3MN6A 1XI1A 3NVMA 3C7NB 4KH4A 3E9OA 4C8NA 4RW8A 4DTOA 1VQLN 4DFJA 4QS9A 1IKVA 1S9EA 4RW7A 4NXNK 3NGIA 4OPKA 4PUOA 3SQ1A 3GL1A 1WB9A 3ULEB 1NGBA 4B3TK 3SYZA 3VQ8A 1P90A 3B6OA 4CEQA 1VSMA 2EHGA 5C10A 4CEZA 3OYKA 3I33A 1KAXA 1RT4A 3V6DA 4I2PA 1HR0K 3OYJA 2HHQA 4CEDA 3SLCA 2JGUA 5JVGL 1ZBUA 3NH0A 1WUAA 4LY7A 1RTDA 1U04A 3IAYA 4FJHA 1S22A 1QQCA 4PKIA 2FF6A 1VQ6N 2NRVA 1ASUA 3SUNA 1N8RO 3DRRA 2GV9A 5LY3A 3RWUA 1LAVA 3WXMB 4CERA 3AARA 1IBKK 3T7ZA 3KD5E 5AZJB 1X1PA 2VG6A 3MEDA 3LM9A 5EOYA 3H1VX 2BUPA 4CBWA 3VQ9A 2GX9A 3TTDA 1J5EK 1HYSA 4AH9A 3THWB 1NKEA 1C1CA 5KPTA 2ZF5O 4GV3A 4O5FA 4M63C 1QHAA 3KKRA 5AQHA 2ZGZA 4EP5A 3QESA 3OTOK 3AO4A 1WNSA 4YOTA 3TAEA 3JYTA 4IO9L 1KXPA 3S3OA 4O55A 3CMAN 1LOTB 5BRHA 4C8OA 2YI1A 3D2FA 4EAHD 4GV6A 4E0DA 4GKKK 1RT1A 3ID6A 4BRNA 5CE3A 4F8RA 4O44A 2KW4A 4IXCA 4K41A 4CJQA 3HJFA 4DV4K 1NOYA 3BY5A 3LZJA 3RR7A 3HRGA 3I8BA 3Q7CA 4RCHA 5I9EB 3GOIA 2QKBA 4NO7A 4CK3A 1EO1A 3V9SA 1ZBLA 3VGLA 3A5NC 1ZC6A 1RT6A 1TAQA 2IVNA 3OYIA 1RT5A 2ZJQL 3DOKA 1IG9A 5AQUA 2P9IA 3SK3A 3MAQA 3H3NO 4CF1A 4NCBA 4CHPA 1Q82O 1J53A 5J2QA 1HPMA 4FOEA 1C0MA 1YIJN 2W40A 3IFRA 4M41A 3CCEN 2RN2A 2RF2A 3S3NA 4BWJA 2E8AA 4Z4IA 3TAFA 3T1AA 5ADXA 4A2AA 4GVMA 1NGAA 3IS9A 3J81O 3PLAA 3LPTA 1YJWN 1ESVA 1UWBA 3CCJN 4BRKA 4JRPA 1KQSM 1WSHA 4KI6A 4LF7K 5H1SQ 1VSIA 4JKEA 4CZEA 2ZM6K 5J1EA 4DG1A 3VEOA 4CEBA 2PBDA 4FJNA 4DMNA 4CF9A 4DSIA 4XH1A 5AQWA 4I9QA 3P4IA 4M45A 4B3MK 2P9LB 2Y1JA 2OCEA 3L2WA 3VEXA 3CQ8A 4A2BA 3M1FA 2E6LA 3K2PA 3T69A 4KPYA 5BN9A 1WLJA 1EETA 3MCPA 4B9TA 1TV6A 2V51B 2F7TA 3HTVA 1L3UA 4KTZA 4J8FA 2HF3A 1Y64A 5HRRA 4AF1A 1C0GA 2VG5A 4Y1CA 2O8CA 2DTUA 5AQFA 4YNQA 1E4FT 4U7BA 3QICA 4DR2K 4Y0WA 4E89A 4CW7B 3TTCA 3SQ2A 4BQZA 3OBWA 1K73O 3WEEB 3SQ0A 3KJVA 4GY2B 3PSFA 1LW0A 2PY5A 3N4QA 4WQ4C 3HK2A 2ZQBA 3V1RA 4BVOA 4FJ8A 4LF6K 4CF2A 3VQQA 4FYDA 1WAJA 1JLBA 1S5JA 1EQYA 1W0HA 3BP8A 3SBTA 3ZSRA 2P9UB 5CY4A 5C25A 3VQBA 5FRMA 3AGRA 3SAFA 4ZHRA 3VERA 3HSCA 3SJJA 1ITGA 1GLEG 2KHOA 2QXFA 4LF8K 4CEFA 4CJKA 5AQGA 5KGXA 3CCUN 2CH6A 4FZYA 4BC3A 3KLEA 2HB5A 3AA3A 1NK8A 4KB0A 4CD1A 2UU9K 1JL2A 2UXCK 4KH5A 1T44A 3OS0A 4O8KA 1EP4A 4B9LA 3QERA 4C8KA 5AQRA 2HNYA 5SWMA 3WXJA 3ZSYA 3M5RA 1HNXK 3NF8A 1ATRA 4CHNA 1Q18A 1HUXA 4N56A 4CEAA 4BRPA 5HRPA 3JSMA 1HLUA 3SMSA 1FKOA 3E9PA 3GBTA 4JKCA 1VQKN 2P9IB 1WBBA 1L5UA 4OKKA 1BI4A 5AJ3K 3O5BA 3OYLA 2E2OA 4CIEA 1BA0A 3D6RA 1GLFO 2F9TA 3MX5A 4BRCA 3DRPA 4CGGA 3AO3A 3QEXA 1OVQA 2GUPA 2P1JA 3OS1A 3BUZB 3SUPA 1HMVA 1HRHA 2GWJA 4H8KA 3NFAA 4FL9A 2W6KA 3LL3A 4FWOA 4DS5A 4FJ5A 3L2QA 2HBKA 3FR0A 3VQ5A 5E41A 3TAPA 3ISNC 2NRXA 1HKBA 4BRAA 1Z25A 1A5XA 3KK1A 1S1UA 1QTMA 1RTIA 3ZLJA 4M3UA 4FLVA 2UXBK 4FWMA 4M3ZA 3DWLA 4FSVA 4N76A 4KI4A 2RPIA 4PL7A 2P5OA 4GVEA 1WSIA 5J2PA 3PIOL 3C95A 5M1NA 4H5RA 3VEVA 3SNNA 1EWRA 1BIZA 1I3AA 4ELVA 3PIPL 4CGHA 1K9MO 3V4IA 1K8KA 3V81A 4FWKA 1SAZA 1C0FA 5AQKA 1C0TA 1ZBFA 1DKGD 2OYQA 2ZGYA 3TAMA 5JMVA 1HX1A 4DV1K 4KHWA 1VSLA 5A2QO 5HP1A 1XMOK 1P8ZA 3AVHA 3CM5A 1Q7YO 3G10A 1KFDA 4DR6K 1JXBA 4DQIA 3L4QA 1NGFA 3SAHA 2V7YA 2HHUA 4H5TA 3VOVA 4BREA 3RTVA 2YJFA 3LALA 3C6UA 2Q1NA 5BRDA 4C8LA 2UUAK 2OTLN 1TL3A 3WXIA 2BH1A 4YY3K 4WCEL 3P31A 4J2DA 3EZWA 3RRGA 2P9PA 4OX9K 3HM9A 4YOVA 1NMDA 3Q7BA 3QB0A 3KWIA 2NRWA 1GOAA 2HHXA 3WT0A 4M3TA 4WQ4A 3DI6A 3V9UA 3C7NA 3HXMA 4JK9A 4EHUA 2QKKA 2X6SA 3OBYA 4OGEA 3P83D 3EN9A 2QWQA 3CJ1A 3CCSN 4DV7K 3NF7A 3DLRA 2KFNA 4K43A 3ULEA 4LFAK 1QE1A 3G0ZA 1GLJO 1YUWA 4FVMA 3IDHA 1LWEA 4DWIA 4Z4HA 2F9WA 4DTRA 4OPJA 4CZGA 3QNNA 3AVCA 4BRIA 1IH7A 3J80O 4E19A 3IKMA 3O9RA 3D7EO 5B8HA 4FLUA 1NG9A 3VF2A 4JI2K 1RDAA 4IO8A 3DLBA 3TAGA 4C1NK 2D0AA 1FW6A 4DLGA 3KLHA 3CC7N 4DTMA 1YF5L 3HYFA 2ETJA 4Q5VA 3KVGA 1L3SA 1JJ2M 4K8ZA 1DTQA 1MWMA 1W7AA 3R9PA 2FC0A 1D9DA 3FZLA 3OYHA 1LV5A 1V4TA 2YJEA 3UE5A 4ELTA 1NBWA 1VHXA 5IT9O 1V4SA 3THWA 4HWIA 4FJJA 4FVUA 1HKCA 3W0LA 1DLOA 4U67L 2ZJPL 2G8WA 3SPYA 2VCPA 3T1YK 1FK9A 5E84A 1GLCG 3CF5L 2OPSA 4O8UA 3CXCM 2QXLA 2Z1HA 4DTJA 4BG8A 4B1VA 4YORA 5FPNA 1NGHA 1WSEA 4IOXA 2QTDA 2YKNA 3ZEUB 4BG9A 2O8DB 2YHAA 4DSFA 4LFCK 2D0BA 1I94K 4FK4A 4I2QA 3H1QA 3ZSQA 1GOCA 3AA2A 2UYTA 2E20A 3J7AP 3KLFA 3EL2A 2NRRA 3RMCA 2JLEA 2ZD1A 4CJ5A 2E4LA 3BDPA 3ZT3A 2YCHA 4YFUA 4Q0BA 4FLXA 4JD2A 2ZJRL 3AVBA 3AVKA 3EKSA 3NMUA 4A5BA 1Z05A 3O1BA 4M3RA 1S72N 2P5GA 4DTPA 4WYBA 1BHLA 1RTJA 1VSHA 3NH2A 2PFUA 4CIFA 3TAQA 2OANA 3BGRA 3O3FA 2ZWHA 2HVIA 1VQ5N 3MECA 1NU0A 3C6HA 1RILA 2E2PA 2RHKA 4JAXA 4A62A 4H5NA 3KTQA 1DT9A 2CGKA 2Q3SA 4H5WA 5KQDA 5GADP 1BL3A 3CM6A 4DR5K 1R59O 3H08A 5CHIA 3TU5A 1T7PA 4FLZA 3VGKA 2QEXN 3CMEN 2P9PB 3RSEA 2O4IA 4CIGA 3VMFB 2NLXA 3DM2A 1W2BM 4HCCA 3DOLA 1OVYA 1TL1A 4CZLA 2B5JA 4PL8A 1UA1A 4CJTA 1QS4A 1SL1A 2E6MA 1E3MA 1DTTA 5J2MA 2XY5A 4JYAK 3IUCA 1U49A 2IVOA 4KHNA 3HSTB 1JLAA 1NMNA 3L3UA 4JI6K 4AQYK 1LCUA 3AVIA 4C23A 2BGGA 4DSJA 3VEZA 1X9SA 2FSKA 4DQ8A 1A5WA 3CI5A 4FWNA 4JLHA 5AQNA 2HVHA 2O8EA 3KKSA 4OVLA 3M8QA 3QBWA 4BY9C 4JI7K 4LF9K 2HHWA 1JCFA 3DRSA 1WSJA 2P9LA 2YX6A 3CJBA 5F0XA 4H5VA 2IS3A 1XHZA 4N41A 1RT2A 4FJ9A 5FDLA 1WAFA 1T05A 1B92A 3TPQA 4W5QA 4WQ5A 2XHBA 4M7YA 4OO1J 3HPGA 1D9FA 3OYBA 4CZKA 4IDHA 3DXKB 2XRIA 3WUHA 1NJXA 2BDPA 1VRTA 4Z4EA 4JKGA 2HOEA 1S1VA 3LAMA 1X3MA 2HSTA 2VGNA 4BR4A 4B9QA 3QLHA 3L0QA 2A1SA 4FJXA 3VQEA 4FLTA 1QVFM 2IVPA 5M1PA 3K5MA 5J2NA 3CERA 3CJCA 4CJLA 2VWBA 3ZSXA 4XIUA 4ILGB 4XH5A 2HMPA 3OS2A 4M3XA 3WEEA 1TK0A 1ASVA 5C0YA 1NNEA 1IBLK 3LANA 2AJQA 2D0PA 3GDQA 2HF4A 1B9FA 3O08A 4M3YA 5ELZA 1G99A 2P9UA 4FLYA 2IAJA 4HUGA 4RW9A 3MCAB 4CJVA 2XY7A 1T8EA 2QWRA 1J5OA 3NGZA 3HI0A 4KTQA 4F2SA 4UY8O 4IBNA 3L6QA 2I7PA 4B9SA 1OH7A 4BR7A 4JD2B 1HJOA 4B08A 3FLCO 4E7LA 2I7NA 4B1YB 2YHWA 5IWAK 5EVZA 3CD6N 4CD3A 4CJFA 2YHBA 4UQGA 3SI6A 2FXUA 4J2AA 1NKBA 4LSNA 5EU7A 2V7ZA 3EYZA 4DCHA 1S6PA 2HHHK 4F4KA 4PQUA 3J7YP 3K0SA 5GIPA 4FOIA 1VSDA 4LF4K 1KVAA 3D45A 3DLLL 2PZSA 4FK2A 1XUPO 2XO7A 5AQXA 2FBTA 4DKWA 4Z94A 3OJSA 3HM8A 3IG1A 1XHXA 5M1FA 1RBSA 3EY1A 3H6EA 4BRLA 2P9KA 1WSGA 4EP4A 3SV3A 1JCEA 2F8SA 3NGYA 3RSEB 3L3VA 4NCAA 5C2DA 1RBRA 3VQDA 3C6TA 3O1WA 4E7KA 4KBOA 4X62K 3JAMO 2X6NA 3UIQA 4B1XB 2NRZA 4DV6K 4CZIA 1O1WA 3MXJA 3PSIA 3MWTA 4JKAA 4BRGA 2OPQA 3NDKA 1K6YA 1A5VA 3J8AA 3U9ZA 3AAQA 4O4GA 5M1QA 1UA0A 3CG7A 1GLDG 2O8EB 2CH5A 1R0AA 4W5OA 3QIPA 1KSPA 3SMPA 4YOUA 3WNEA 4CFCA 5JLFA 1OH8A 4I7FA 4HTUA 4AHUA 3CCRN 4FJKA 4BWMA 1GOBA 3WNFA 3MXIA 2A40A 4N47A 3A2FA 3M8PA 4B3RK 3DJCA 1MU2A 3AVNA 3OA9A 3WNGA 4JI3K 1S1TA 4BVPA 2YHYA 2ITMA 3CCQN 3CCMN 2KTQA 3QETA 4JKGB 1NM1A 3F9KA 3ZX2A 3ZT0A 4Y1DA 3BZCA 5HOOA 4BGAA 2FBVA 1X9WA 1O13A 1WSFA 1QZ5A 4FZZA 1S1XA 4N5SA 5K14A 1UAXA 4C8MA 3U4LA 2YNIA 5JVHL 4RTFD 1RDBA 5C15A 3K5NA 2UUCK 4FJGA 1RDCA 3OJUA 3KK2A 3NAEA 4CF0A 1TKXA 4IWVA 5AZIA 4RWTA 1N6QA 4ZTFA 4B9VA 1JLFA 4FJ7A 4G1QA 1MDUB 2QWNA 3NE6A 1N36K 4KFBA 5KGWA 1NOZA 4MO4A 4K8XA 4X64K 4DU3A 2ASOA 5CR4A 1XMQK 1N5YA 5LJWA 3M6GA 5D3GA 1YVUA 2KZMA 1XWLA 1U47A 3QFPA 4WFAL 3LZIA 3B6PA 2A5XA 4BR2A 4O0IA 5JS2A 5DK5A 1Z26A 4A57A 5C42A 4HTLA 2ATQA 1NGJA 4IJNA 4FPAA 1IO2A 2Q0RA 4KREA 3O9QA 3MEEA 2FSNA 3LAKA 1D5AA 2P51A 4WFBL 4R5PA 4HHTA 1IKXA 4EFHA 3EE9A 3D0PA 3G71N 4DR4K 2W41A 1EKEA 3DYAA 4DV3K 2OZSA 3H45C 3HP9A 1JKHA 1NGCA 2JWKA 4JN4A 3L2UA 4F2RA 1XC3A 2GWKA 3DMJA 1QSLA 1JCGA 3PUFA 3UB5A 5CZ2A 3FZHA 4I9LA 4FZXC 3O4NA 4GV9A 3K5OA 4KHPK 2A42A 2IIRA 4QAGA 4DHYA 3K58A 3F9MA 1YVNA 2BTFA 1BO5O 4X66K 3O3GA 4B1UB 1M1KO 2HHTA 1YJ9N 2P9KB 1Q8IA 2WONA 4DUYK 5C2FA 4EZ6A 2O8BB 1RT3A 2RKIA 5AQVA 5TKWA 1BCMA 2HBMA 4E1MA 1G15A 3LPUA 4FLWA 1U4BA 3CCLN 5JS1A 1YT3A 1CLQA 3OY9A 1T03A 1CXQA 4JK8A 3THXA 1HJRA 1SZ2A 2GEMA 3NVKA 1SKSA 3HVRA 4KHUA 1ZYQA 3VQ6A 3ZEUA 4XH4A 2O8DA 3QFUA 2KZZA 3CFPA 4CFAA 5GIOA 4CBUA 3KK3A 1TVRA 2LSNA 4JV5K 3CETA 5JICA 1EXQA 1JXEA 1S9GA 2D0OA 5SZTA 1RGIA 2FLOA 1VQ4N 4I6MA 4DTNA 3QNOA 2W42A 2DFEA 2QWOA 3LP3A 5FLXO 1TAUA 1RNHA 4V19S 3JXUA 3FZKA 5AQSA 1NWKA 5F1XA 2XY6A 3CCVN 1JLGA 1WOQA 5M1KA 3SCXA 3UKUB 4K25A 1YITN 1QSSA 1VSKA 5MLCQ 4WFNL 3L2RA 4KRFA 3DLKA 3C6AA 1VRUA 2UUBK 4DF8A 1YI2N 2GUIA 2A41A 1EX4A 3S9HA 1BISA 1TGOA 5KRSA 3GG4A 3TSPA 2D4WA 3QDKA 4DQPA 4PKHA 1SS6A 5C12A 2P9NA 2J4RA 4CGFA 5HRSA 4OPAA 1IG8A 4F9OA 1NGIA 3THYB 5LJVA 5I42A 3ENHA 5M1OA 5DM7L 5AZIB 4L8RB 3ZT4A 2ASPA 3LWMA 1IV0A 1JLCA 1ZBSA 3J7ZO 2E1YA 4YOYA 3ZT1A 4JS4A 4BDZA 4IFVA 2NRTA 1LWFA 3E1YA 4PY5A 3C94A 3ULDA 4KO0A 5HBMA 3CJ7A 4CCHA 3GE1A 5FRNA 4LD0A 4DV0K 3CJ9A 4OGCA 1S6QA 4E7JA 4WQ5C 3CYMA 4CJPA 3VF6A 1NGGA 4JHDB 5BPMA 4H0PA 4JRQA 3ASMA 2YNFA 3WQUA 3HPOA 1SQKA 2WOMA 5KQ8A 4EHTA 3DLEA 3DXKA 1RBVA 5BPNA 3RMAA 2W6LA 3T19A 3WXKA 3ZX3A 3HT3A 5LMNK 3QBXA 4E3SA 3MDQA 3ATUA 4CHZA 4MDAA 4H03B 3CPEA 4BRDA 1NK7A 4FJLA 2GTDA 5AFUA 3P5JA 1GLLO 1VQ9N 3I0RA 3AO5A 3TR8A 1NLVA 2QA4N 4A59A 3TI0A 3RVCA 3I0SA 4PKGA 3MN7A 3THXB 3E01A 3PX4A 3VESA 5KRTA 1EWQA 5HL7L 5C24A 3SV4A 1L3TA 5AR0A 1ZBIA 3RRHA 4CHOA 3L4IA 4AILC 1BQMA 1TKDA 1HYZA 5AQOA 2Q36A 2QM1A 3I8DA 4NLBA 3U6FA 2O4GA 3HOTA 3CC2N 1QQMA 3A8YA 2OA8A 2D1KA 1CXUA 1TKTA 1U6ZA 5KPZA 3AO1A 3O9TA 4I6MB 4JKHA 5EX5A 4BRQA 3EKUA 1BU6O 1C1AA 1ATSA 1VQON 1VQMN 3C0BA 4CGIA 1CZBA 3K57A 1KAYA 2DFHA 4H0YB 3DAWA 4OPHA 2BE2A 4CE9A 2BANA 3EO3A 1RBTA 4MO5A 3QINA 3CPWM 3R3LA 4ID5A 1HYVA 5GAGP 3TARA 3S3MA 3SUOA 4LC9B 2G8KA 1VQPN 4AM6A 4A5AA 4Z4GA 3WNHA 3ENOA 5KPRA 3LM2A 4MFBA 3NH1A 4TSXA 2RE2A 4CJEA 3KD1E 4EZ9A 4H4OA 3QEWA 5FPEA 4AM7A 4DLEA 3HOSA 3P38A 5FROA 1NKCA 2HW3A 4DU4A 3MEGA 1X9JA 1YTUA 2P9NB 3OYNA 1C1BA 2QWPA 3OW2M 1KLNA 3IRXA 1JL1A 4CZMA 4CEEA 4OKJA 4CI6A 4NYNA 5HRNA 3F73A 4DTUA 4IOCL 4CZFA 3VPZA 3R8EA 4OLBA 3H3OB 4DV2K 2NZTA 1H1VA 3MXMA 4DR1K 3T3FA 3LDNA 5CZ1A 3V1QA 1RDDA 3AVAA 3R6MA 3HZ6A 1NK5A 5E26A 4QOZB 4FO0A 1Q9XA 3ZSZA 4AHRA 4FW2A 3K9KA 3CJAA 3QEVA 1Y97A 4FCYA 5KTQA 1I39A 1SL0A 4CF8A 2IOCA 1W9HA 1Z6RA 2HNDA 3E66A 3OYFA 2UXDK 4OJRA 3NF6A 1ZXOA 4KHSA 5GINA 4CGJA 2Z1GA 1C6VA 1M90O 4A61A 1YHQN 4YOXA 2IGIA 3V9ZA 4MLHA 4DU1A 4DR3K 4BR9A 5JLHA 3RMBA 4BRHA 4BR0A 1BOTO 5EXWA 4CBXA 2G8UA 4DQRA 4QS8A 4RW4A 4BGBA 4WF9L 2HNZA 4E7HA 4KHQA 3CQYA 4FW1A 4BDYA 1FXXA 2VWKA 3AY9A 2VG7A 4XEIA 3VEYA 3ZETA 1BDGA 3AO2A 1RDWX 2QW9A 2X78A 4BDPA 1JLQA 4ISEA 4FM1A 4OKEA 1S1WA 1VQNN 1Q81O 1F21A 1HNIA 1WBDA 3A5OC 3HPHA 4DUZK 4ILJA 4YOWA 3FFKB 3LDLA 1ZBHA 3V1OA 2HMIA 1ASWA 3N4PA 4B1WB 4KV8A 3LWLA 1J54A 3DXMA 1UOCA 3F2KA 3DLHA 2I5JA 3PO5A 4M42A 4L3QA 3TTFA 3FGUA 3HVTA 1QHTA 3ATVA 3LDPA 4IG0A 4ISFA 4CFDA 4JI5K 4IFYA 3AVLA 1HKGA 5LL6Z 4BR5A 3OYDA 4IG3A 4E7IA
chains in the Genus database with same CATH topology
3J7AP 4OX9K 3OTOK 4B3MK 2F4VK 4X62K 4JI1K 5AJ3K 3JAMO 4LFBK 1XNRK 5BR8K 2UUBK 4DV5K 4DV6K 2UXDK 4DR4K 2VQEK 4CVNE 4DV3K 1HNZK 4DV7K 4GKKK 5LMUK 4JI4K 1IBLK 4LFAK 4DR3K 4DV4K 4KHPK 3J80O 4K0KK 4DR2K 4X65K 4X66K 4CW7B 1FJGK 4DR5K 4NXNK 4B3RK 1N34K 4DUYK 4JI2K 4JI3K 2UXBK 4DR7K 4B3TK 4NXMK 2VQFK 2E5LK 4LF6K 4LF5K 4DUZK 4DV0K 1HR0K 4JI8K 4JYAK 5IWAK 4JI6K 4AQYK 5IT9O 1IBMK 1HNWK 4GKJK 4DV1K 4LF8K 5A2QO 1N33K 1XMOK 2HHHK 3T1YK 2UUCK 3J7YP 4JV5K 3J81O 4LF4K 4DR6K 1IBKK 4JI7K 4LF9K 2UU9K 2UXCK 1XNQK 5LMNK 3T1HK 4LF7K 4JI5K 4DV2K 5FLXO 4B3SK 4JI0K 4V19S 1J5EK 5LL6Z 4DR1K 1N36K 2UUAK 2ZM6K 4YHHK 4LFCK 1HNXK 1I94K 4X64K 1XMQK 4YY3K 1N32K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A P;  4OX9 K;  3OTO K;  4B3M K;  2F4V K;  4X62 K;  4JI1 K;  5AJ3 K;  3JAM O;  4LFB K;  1XNR K;  5BR8 K;  2UUB K;  4DV5 K;  4DV6 K;  2UXD K;  4DR4 K;  2VQE K;  4CVN E;  4DV3 K;  1HNZ K;  4DV7 K;  4GKK K;  5LMU K;  4JI4 K;  1IBL K;  4LFA K;  4DR3 K;  4DV4 K;  4KHP K;  3J80 O;  4K0K K;  4DR2 K;  4X65 K;  4X66 K;  4CW7 B;  1FJG K;  4DR5 K;  4NXN K;  4B3R K;  1N34 K;  4DUY K;  4JI2 K;  4JI3 K;  2UXB K;  4DR7 K;  4B3T K;  4NXM K;  2VQF K;  2E5L K;  4LF6 K;  4LF5 K;  4DUZ K;  4DV0 K;  1HR0 K;  4JI8 K;  4JYA K;  5IWA K;  4JI6 K;  4AQY K;  5IT9 O;  1IBM K;  1HNW K;  4GKJ K;  4DV1 K;  4LF8 K;  5A2Q O;  1N33 K;  1XMO K;  2HHH K;  3T1Y K;  2UUC K;  3J7Y P;  4JV5 K;  3J81 O;  4LF4 K;  4DR6 K;  1IBK K;  4JI7 K;  4LF9 K;  2UU9 K;  2UXC K;  1XNQ K;  5LMN K;  3T1H K;  4LF7 K;  4JI5 K;  4DV2 K;  5FLX O;  4B3S K;  4JI0 K;  4V19 S;  1J5E K;  5LL6 Z;  4DR1 K;  1N36 K;  2UUA K;  2ZM6 K;  4YHH K;  4LFC K;  1HNX K;  1I94 K;  4X64 K;  1XMQ K;  4YY3 K;  1N32 K; 
#chains in the Genus database with same CATH topology
 3V9X A;  4MQ3 A;  3BF3 A;  1TYQ B;  3VET A;  4LFB K;  3U8X A;  3OYE A;  2YHX A;  2DY4 A;  4BE2 A;  4DSE A;  4JS5 A;  2ZE2 A;  4PA1 A;  1QZ6 A;  4FWP A;  3HP6 A;  1U45 A;  4WE1 A;  4BRM A;  3BF1 A;  4Z4F A;  3EZ5 A;  1YAG A;  2WC9 A;  2O8B A;  3I55 N;  2KFZ A;  1NJI O;  2Z1J A;  3LP2 A;  3HBT A;  4IFE A;  4Z4C A;  2GEL A;  5F2R A;  1REV A;  2Q0U A;  1RDU A;  1BGX T;  3KIO A;  2WTU A;  4E1N A;  4DQS A;  1FJG K;  3AAP A;  1MA9 B;  2PAV A;  3FZF A;  4IZ9 A;  4BRO A;  2G8V A;  3G25 A;  4DR7 K;  4CHQ A;  4H0O A;  2VGM A;  3TSQ A;  1Q9Y A;  4KTW A;  3S41 A;  1NJZ A;  3D2E B;  3BEX A;  2YKM A;  3PO4 A;  1KLM A;  3OVN A;  5AQP A;  3ZSO A;  4FM0 A;  4BE1 A;  2E1Z A;  3PX6 A;  4FWQ A;  1Q86 O;  5GAH P;  3SBG A;  3OHR A;  4HCB A;  2R7Y A;  2JWL A;  3VTI A;  3K9J A;  4ILH A;  1FKP A;  1MWK A;  4OLA A;  3O4Q A;  1U48 A;  4B9M A;  4JKB A;  4W5N A;  5AQT A;  1TKZ A;  4DF4 A;  4ID1 A;  2XY8 A;  3MN9 A;  3SAG A;  3P1G A;  1RT7 A;  3F5T A;  4H0T B;  5BRF A;  4PWD A;  2P9S A;  2YV0 X;  3UKU A;  3SQ4 A;  3T1H K;  4KKO A;  1QQO A;  4HUF A;  1C0U A;  4JNE A;  3EE8 A;  3SZ2 A;  3ENB A;  4BQL A;  4JEP A;  1TUY A;  5FPM A;  2IDO A;  4BAC A;  5GAE P;  3ZET B;  2Q2R A;  4J2B A;  5FPD A;  4FJI A;  2D5R A;  4LSL A;  1D4X A;  2F8T A;  4IKF A;  1GLB G;  4IDK A;  3THY A;  4JI1 K;  1VQ8 N;  2AA4 A;  3VA3 A;  5BR8 K;  2G8I A;  5DM6 L;  2OPR A;  4IOA L;  1BCO A;  1CZ9 A;  4W5T A;  3QEI A;  3I56 N;  1SKR A;  1DGK N;  3DXM B;  4NLC A;  4IJA A;  2A3Z A;  4H0X B;  3TAN A;  4DB3 A;  4KHY A;  2WFB A;  3NBP A;  1BA1 A;  4H0V B;  4LH4 A;  3WXL A;  4FWS A;  3HO1 A;  1WN7 A;  4R79 A;  5EY4 A;  4CJ4 A;  4AHS A;  4CJS A;  3CHW A;  3D2F B;  2DFF A;  4JHD A;  4HUE A;  1DEJ A;  3O6W A;  1LWC A;  4K42 A;  1YJN N;  3OYM A;  2YNH A;  5AFU H;  4AHT A;  2QWM A;  4NXM K;  4CZJ A;  2HBJ A;  1QQN A;  4CJU A;  4RG8 A;  2FBX A;  1IKY A;  1E4G T;  2E88 A;  1KFS A;  4QS7 A;  3O9S A;  3KLG A;  1NJY A;  1RTH A;  4O5B A;  1HNW K;  4GKJ K;  3KLI A;  1X3N A;  1N33 K;  1OH6 A;  2FF3 B;  4DTX A;  3A5M C;  3VEW A;  3VTH A;  1LW2 A;  3M3Z A;  1RFQ A;  1X9M A;  4ELU A;  2IC3 A;  2Y1I A;  3W3D A;  3O8M A;  2HBL A;  1SL2 A;  3QML A;  4CK1 A;  3EEQ A;  1U2V A;  4F3O A;  2B4J A;  4CJ7 A;  4B1Z A;  4J2E A;  2NNW A;  4JI0 K;  4CZH A;  4NB4 A;  1HQE A;  1B9D A;  4AHC A;  3H46 O;  3ZSW A;  1XQS C;  4KH6 A;  4DFP A;  3KHY A;  3QIO A;  1QSY A;  1N32 K;  2CGL A;  2HHV A;  4DFM A;  4PHT X;  4MLE A;  3KK7 A;  3LP1 A;  3U3G A;  2OTJ N;  1T3V A;  3NHG A;  2A1R A;  1KCF A;  4B3O A;  3O80 A;  2E2Q A;  1GLA G;  1TK8 A;  4EIA A;  4M3W A;  1VSF A;  3AVG A;  5AQI A;  3K59 A;  1NK9 A;  1TUU A;  3SJH A;  4CVN E;  3SUQ A;  3BZK A;  2VWJ A;  3AGK A;  5KI6 A;  3QEP A;  4JI4 K;  3ALY A;  1SUQ A;  2P9S B;  5AQY A;  5AQJ A;  1KD1 O;  3MWP A;  3QO9 A;  2PYL A;  3RR8 A;  3O4W A;  4BE0 A;  3ZSV A;  2ITG A;  2O8F A;  5CYM A;  4YDU C;  4CJR A;  2CGJ A;  3VGM A;  3TAB A;  3DLG A;  4CHY A;  4K0K K;  1VAZ A;  4BC5 A;  1RCH A;  2YNG A;  3THV A;  5AQL A;  5AQQ A;  2OZM A;  2QWL A;  1VSJ A;  3L2V A;  1SV5 A;  3MMV A;  1IJJ A;  3VQA A;  2HHS A;  3CFO A;  4F3T A;  2PYJ A;  1OH5 A;  1OKJ A;  1NK4 A;  3ITH A;  4C1N I;  3IMX A;  2O8C B;  3TWH A;  1J6Z A;  3C65 A;  4GW6 A;  1KAZ A;  3FE1 A;  3MN5 A;  4GNI A;  1VQ7 N;  1BUP A;  3UKR A;  3CC4 N;  3VQ4 A;  4MDB A;  3V9W A;  5HLF A;  4M7X A;  4O0J A;  3TSU A;  1CZA N;  2NRH A;  4FJM A;  3JS6 A;  5BN8 A;  3VQP A;  4AHV A;  1ATN A;  1IKW A;  3O9U A;  5AQM A;  4DSK A;  4FXD A;  4DTS A;  1T6D A;  4E1J A;  4B3S K;  3B8A X;  3A0I X;  3MX2 A;  4RW6 A;  4KB1 A;  3VEN A;  5BR9 A;  1BG3 A;  2E2N A;  4YHH K;  2KLA A;  4NCG A;  5AQZ A;  3O3H A;  3PV8 A;  4LH5 A;  3LDQ A;  5T7B A;  4BC4 A;  4CFB A;  1BQN A;  1HPZ A;  1HNV A;  5DMR A;  3LDS A;  4DS4 A;  4IEI A;  3ZX0 A;  4CES A;  4DV5 K;  1S3X A;  4ISG A;  2X74 A;  4H4M A;  3PY8 A;  1NGD A;  2FSJ A;  3OYC A;  3PX0 A;  2VQE K;  3SPZ A;  3G6E N;  3FFI A;  3P39 A;  4B8A B;  1NK6 A;  5BPL A;  1SKW A;  3LDO A;  3U9D A;  4BRF A;  3VQ7 A;  4FWL A;  3OYA A;  3NCI A;  5LMU K;  1K8A O;  4CEO A;  3VQC A;  2WBN A;  2Q97 A;  1BI4 B;  1NGE A;  1VSE A;  1LAW A;  5AZJ A;  3MK6 A;  4FWR A;  1U2V B;  4CK2 A;  1KC8 O;  1HQU A;  3RMD A;  1W97 L;  1BIU A;  4X65 K;  2ASM A;  2D0C A;  1L3V A;  2EX3 A;  2FBY A;  3G4S N;  1D8Y A;  1YTA A;  1N34 K;  1KVB A;  3CFR A;  4CGD A;  1TK5 A;  4JKF A;  3CIP A;  3OYG A;  2VQF K;  4JKD A;  2E5L K;  1BWF O;  4LF5 K;  4FM2 A;  2B6A A;  1KRP A;  4JI8 K;  1JLE A;  1RBU A;  3VF4 A;  3M8R A;  2G8F A;  3K5L A;  2V52 B;  2H3G X;  4ZTJ A;  3KWG A;  3ZCM A;  1IBM K;  1ILY A;  3VN5 A;  3LP0 A;  4CJ3 A;  3AV9 A;  4CEC A;  3ID8 A;  1KTQ A;  1YXQ A;  3L8B A;  3AA4 A;  2AP1 A;  3VA0 A;  3AA5 X;  1XNQ K;  5TKY A;  3KZB A;  2O8F B;  4W5R A;  1TYQ A;  4IEE A;  1K8K B;  3AVF A;  4B8C A;  1J9A A;  3A5L C;  2QK9 A;  3R1X A;  2GBZ A;  4Z0U A;  2A6A A;  1NJW A;  3WQT A;  4B9U A;  4YDU A;  4ICL A;  3E9L A;  5ADX H;  2OPP A;  3M8S A;  2KKZ A;  5HRO A;  2Z1I A;  2G8H A;  5BRE A;  1KVC A;  2F4V K;  2Q31 A;  4DQQ A;  4JK7 A;  4QCL A;  2EWS A;  2QI2 A;  1QVG M;  2NUB A;  5CYQ A;  3FZM A;  2KQ2 A;  1XNR K;  4G9Z A;  3CQX A;  4GMJ B;  4DSL A;  4FK0 A;  4NYF A;  4B9N A;  2VYP A;  4BC2 A;  3ZT2 A;  4FPB A;  3UKR B;  2WUS A;  1HNZ K;  3AVJ A;  3HL8 A;  1VK0 A;  3U3Y A;  4CJW A;  5I3U A;  4KAZ A;  2F96 A;  3ZYY X;  2DPN A;  3D2E A;  3NF9 A;  4HVJ A;  1NK0 A;  1XC9 A;  1T6C A;  4DFK A;  3AVM A;  3MN6 A;  1XI1 A;  3NVM A;  3C7N B;  4KH4 A;  3E9O A;  4C8N A;  4RW8 A;  4DTO A;  1VQL N;  4DFJ A;  4QS9 A;  1IKV A;  1S9E A;  4RW7 A;  4NXN K;  3NGI A;  4OPK A;  4PUO A;  3SQ1 A;  3GL1 A;  1WB9 A;  3ULE B;  1NGB A;  4B3T K;  3SYZ A;  3VQ8 A;  1P90 A;  3B6O A;  4CEQ A;  1VSM A;  2EHG A;  5C10 A;  4CEZ A;  3OYK A;  3I33 A;  1KAX A;  1RT4 A;  3V6D A;  4I2P A;  1HR0 K;  3OYJ A;  2HHQ A;  4CED A;  3SLC A;  2JGU A;  5JVG L;  1ZBU A;  3NH0 A;  1WUA A;  4LY7 A;  1RTD A;  1U04 A;  3IAY A;  4FJH A;  1S22 A;  1QQC A;  4PKI A;  2FF6 A;  1VQ6 N;  2NRV A;  1ASU A;  3SUN A;  1N8R O;  3DRR A;  2GV9 A;  5LY3 A;  3RWU A;  1LAV A;  3WXM B;  4CER A;  3AAR A;  1IBK K;  3T7Z A;  3KD5 E;  5AZJ B;  1X1P A;  2VG6 A;  3MED A;  3LM9 A;  5EOY A;  3H1V X;  2BUP A;  4CBW A;  3VQ9 A;  2GX9 A;  3TTD A;  1J5E K;  1HYS A;  4AH9 A;  3THW B;  1NKE A;  1C1C A;  5KPT A;  2ZF5 O;  4GV3 A;  4O5F A;  4M63 C;  1QHA A;  3KKR A;  5AQH A;  2ZGZ A;  4EP5 A;  3QES A;  3OTO K;  3AO4 A;  1WNS A;  4YOT A;  3TAE A;  3JYT A;  4IO9 L;  1KXP A;  3S3O A;  4O55 A;  3CMA N;  1LOT B;  5BRH A;  4C8O A;  2YI1 A;  3D2F A;  4EAH D;  4GV6 A;  4E0D A;  4GKK K;  1RT1 A;  3ID6 A;  4BRN A;  5CE3 A;  4F8R A;  4O44 A;  2KW4 A;  4IXC A;  4K41 A;  4CJQ A;  3HJF A;  4DV4 K;  1NOY A;  3BY5 A;  3LZJ A;  3RR7 A;  3HRG A;  3I8B A;  3Q7C A;  4RCH A;  5I9E B;  3GOI A;  2QKB A;  4NO7 A;  4CK3 A;  1EO1 A;  3V9S A;  1ZBL A;  3VGL A;  3A5N C;  1ZC6 A;  1RT6 A;  1TAQ A;  2IVN A;  3OYI A;  1RT5 A;  2ZJQ L;  3DOK A;  1IG9 A;  5AQU A;  2P9I A;  3SK3 A;  3MAQ A;  3H3N O;  4CF1 A;  4NCB A;  4CHP A;  1Q82 O;  1J53 A;  5J2Q A;  1HPM A;  4FOE A;  1C0M A;  1YIJ N;  2W40 A;  3IFR A;  4M41 A;  3CCE N;  2RN2 A;  2RF2 A;  3S3N A;  4BWJ A;  2E8A A;  4Z4I A;  3TAF A;  3T1A A;  5ADX A;  4A2A A;  4GVM A;  1NGA A;  3IS9 A;  3J81 O;  3PLA A;  3LPT A;  1YJW N;  1ESV A;  1UWB A;  3CCJ N;  4BRK A;  4JRP A;  1KQS M;  1WSH A;  4KI6 A;  4LF7 K;  5H1S Q;  1VSI A;  4JKE A;  4CZE A;  2ZM6 K;  5J1E A;  4DG1 A;  3VEO A;  4CEB A;  2PBD A;  4FJN A;  4DMN A;  4CF9 A;  4DSI A;  4XH1 A;  5AQW A;  4I9Q A;  3P4I A;  4M45 A;  4B3M K;  2P9L B;  2Y1J A;  2OCE A;  3L2W A;  3VEX A;  3CQ8 A;  4A2B A;  3M1F A;  2E6L A;  3K2P A;  3T69 A;  4KPY A;  5BN9 A;  1WLJ A;  1EET A;  3MCP A;  4B9T A;  1TV6 A;  2V51 B;  2F7T A;  3HTV A;  1L3U A;  4KTZ A;  4J8F A;  2HF3 A;  1Y64 A;  5HRR A;  4AF1 A;  1C0G A;  2VG5 A;  4Y1C A;  2O8C A;  2DTU A;  5AQF A;  4YNQ A;  1E4F T;  4U7B A;  3QIC A;  4DR2 K;  4Y0W A;  4E89 A;  4CW7 B;  3TTC A;  3SQ2 A;  4BQZ A;  3OBW A;  1K73 O;  3WEE B;  3SQ0 A;  3KJV A;  4GY2 B;  3PSF A;  1LW0 A;  2PY5 A;  3N4Q A;  4WQ4 C;  3HK2 A;  2ZQB A;  3V1R A;  4BVO A;  4FJ8 A;  4LF6 K;  4CF2 A;  3VQQ A;  4FYD A;  1WAJ A;  1JLB A;  1S5J A;  1EQY A;  1W0H A;  3BP8 A;  3SBT A;  3ZSR A;  2P9U B;  5CY4 A;  5C25 A;  3VQB A;  5FRM A;  3AGR A;  3SAF A;  4ZHR A;  3VER A;  3HSC A;  3SJJ A;  1ITG A;  1GLE G;  2KHO A;  2QXF A;  4LF8 K;  4CEF A;  4CJK A;  5AQG A;  5KGX A;  3CCU N;  2CH6 A;  4FZY A;  4BC3 A;  3KLE A;  2HB5 A;  3AA3 A;  1NK8 A;  4KB0 A;  4CD1 A;  2UU9 K;  1JL2 A;  2UXC K;  4KH5 A;  1T44 A;  3OS0 A;  4O8K A;  1EP4 A;  4B9L A;  3QER A;  4C8K A;  5AQR A;  2HNY A;  5SWM A;  3WXJ A;  3ZSY A;  3M5R A;  1HNX K;  3NF8 A;  1ATR A;  4CHN A;  1Q18 A;  1HUX A;  4N56 A;  4CEA A;  4BRP A;  5HRP A;  3JSM A;  1HLU A;  3SMS A;  1FKO A;  3E9P A;  3GBT A;  4JKC A;  1VQK N;  2P9I B;  1WBB A;  1L5U A;  4OKK A;  1BI4 A;  5AJ3 K;  3O5B A;  3OYL A;  2E2O A;  4CIE A;  1BA0 A;  3D6R A;  1GLF O;  2F9T A;  3MX5 A;  4BRC A;  3DRP A;  4CGG A;  3AO3 A;  3QEX A;  1OVQ A;  2GUP A;  2P1J A;  3OS1 A;  3BUZ B;  3SUP A;  1HMV A;  1HRH A;  2GWJ A;  4H8K A;  3NFA A;  4FL9 A;  2W6K A;  3LL3 A;  4FWO A;  4DS5 A;  4FJ5 A;  3L2Q A;  2HBK A;  3FR0 A;  3VQ5 A;  5E41 A;  3TAP A;  3ISN C;  2NRX A;  1HKB A;  4BRA A;  1Z25 A;  1A5X A;  3KK1 A;  1S1U A;  1QTM A;  1RTI A;  3ZLJ A;  4M3U A;  4FLV A;  2UXB K;  4FWM A;  4M3Z A;  3DWL A;  4FSV A;  4N76 A;  4KI4 A;  2RPI A;  4PL7 A;  2P5O A;  4GVE A;  1WSI A;  5J2P A;  3PIO L;  3C95 A;  5M1N A;  4H5R A;  3VEV A;  3SNN A;  1EWR A;  1BIZ A;  1I3A A;  4ELV A;  3PIP L;  4CGH A;  1K9M O;  3V4I A;  1K8K A;  3V81 A;  4FWK A;  1SAZ A;  1C0F A;  5AQK A;  1C0T A;  1ZBF A;  1DKG D;  2OYQ A;  2ZGY A;  3TAM A;  5JMV A;  1HX1 A;  4DV1 K;  4KHW A;  1VSL A;  5A2Q O;  5HP1 A;  1XMO K;  1P8Z A;  3AVH A;  3CM5 A;  1Q7Y O;  3G10 A;  1KFD A;  4DR6 K;  1JXB A;  4DQI A;  3L4Q A;  1NGF A;  3SAH A;  2V7Y A;  2HHU A;  4H5T A;  3VOV A;  4BRE A;  3RTV A;  2YJF A;  3LAL A;  3C6U A;  2Q1N A;  5BRD A;  4C8L A;  2UUA K;  2OTL N;  1TL3 A;  3WXI A;  2BH1 A;  4YY3 K;  4WCE L;  3P31 A;  4J2D A;  3EZW A;  3RRG A;  2P9P A;  4OX9 K;  3HM9 A;  4YOV A;  1NMD A;  3Q7B A;  3QB0 A;  3KWI A;  2NRW A;  1GOA A;  2HHX A;  3WT0 A;  4M3T A;  4WQ4 A;  3DI6 A;  3V9U A;  3C7N A;  3HXM A;  4JK9 A;  4EHU A;  2QKK A;  2X6S A;  3OBY A;  4OGE A;  3P83 D;  3EN9 A;  2QWQ A;  3CJ1 A;  3CCS N;  4DV7 K;  3NF7 A;  3DLR A;  2KFN A;  4K43 A;  3ULE A;  4LFA K;  1QE1 A;  3G0Z A;  1GLJ O;  1YUW A;  4FVM A;  3IDH A;  1LWE A;  4DWI A;  4Z4H A;  2F9W A;  4DTR A;  4OPJ A;  4CZG A;  3QNN A;  3AVC A;  4BRI A;  1IH7 A;  3J80 O;  4E19 A;  3IKM A;  3O9R A;  3D7E O;  5B8H A;  4FLU A;  1NG9 A;  3VF2 A;  4JI2 K;  1RDA A;  4IO8 A;  3DLB A;  3TAG A;  4C1N K;  2D0A A;  1FW6 A;  4DLG A;  3KLH A;  3CC7 N;  4DTM A;  1YF5 L;  3HYF A;  2ETJ A;  4Q5V A;  3KVG A;  1L3S A;  1JJ2 M;  4K8Z A;  1DTQ A;  1MWM A;  1W7A A;  3R9P A;  2FC0 A;  1D9D A;  3FZL A;  3OYH A;  1LV5 A;  1V4T A;  2YJE A;  3UE5 A;  4ELT A;  1NBW A;  1VHX A;  5IT9 O;  1V4S A;  3THW A;  4HWI A;  4FJJ A;  4FVU A;  1HKC A;  3W0L A;  1DLO A;  4U67 L;  2ZJP L;  2G8W A;  3SPY A;  2VCP A;  3T1Y K;  1FK9 A;  5E84 A;  1GLC G;  3CF5 L;  2OPS A;  4O8U A;  3CXC M;  2QXL A;  2Z1H A;  4DTJ A;  4BG8 A;  4B1V A;  4YOR A;  5FPN A;  1NGH A;  1WSE A;  4IOX A;  2QTD A;  2YKN A;  3ZEU B;  4BG9 A;  2O8D B;  2YHA A;  4DSF A;  4LFC K;  2D0B A;  1I94 K;  4FK4 A;  4I2Q A;  3H1Q A;  3ZSQ A;  1GOC A;  3AA2 A;  2UYT A;  2E20 A;  3J7A P;  3KLF A;  3EL2 A;  2NRR A;  3RMC A;  2JLE A;  2ZD1 A;  4CJ5 A;  2E4L A;  3BDP A;  3ZT3 A;  2YCH A;  4YFU A;  4Q0B A;  4FLX A;  4JD2 A;  2ZJR L;  3AVB A;  3AVK A;  3EKS A;  3NMU A;  4A5B A;  1Z05 A;  3O1B A;  4M3R A;  1S72 N;  2P5G A;  4DTP A;  4WYB A;  1BHL A;  1RTJ A;  1VSH A;  3NH2 A;  2PFU A;  4CIF A;  3TAQ A;  2OAN A;  3BGR A;  3O3F A;  2ZWH A;  2HVI A;  1VQ5 N;  3MEC A;  1NU0 A;  3C6H A;  1RIL A;  2E2P A;  2RHK A;  4JAX A;  4A62 A;  4H5N A;  3KTQ A;  1DT9 A;  2CGK A;  2Q3S A;  4H5W A;  5KQD A;  5GAD P;  1BL3 A;  3CM6 A;  4DR5 K;  1R59 O;  3H08 A;  5CHI A;  3TU5 A;  1T7P A;  4FLZ A;  3VGK A;  2QEX N;  3CME N;  2P9P B;  3RSE A;  2O4I A;  4CIG A;  3VMF B;  2NLX A;  3DM2 A;  1W2B M;  4HCC A;  3DOL A;  1OVY A;  1TL1 A;  4CZL A;  2B5J A;  4PL8 A;  1UA1 A;  4CJT A;  1QS4 A;  1SL1 A;  2E6M A;  1E3M A;  1DTT A;  5J2M A;  2XY5 A;  4JYA K;  3IUC A;  1U49 A;  2IVO A;  4KHN A;  3HST B;  1JLA A;  1NMN A;  3L3U A;  4JI6 K;  4AQY K;  1LCU A;  3AVI A;  4C23 A;  2BGG A;  4DSJ A;  3VEZ A;  1X9S A;  2FSK A;  4DQ8 A;  1A5W A;  3CI5 A;  4FWN A;  4JLH A;  5AQN A;  2HVH A;  2O8E A;  3KKS A;  4OVL A;  3M8Q A;  3QBW A;  4BY9 C;  4JI7 K;  4LF9 K;  2HHW A;  1JCF A;  3DRS A;  1WSJ A;  2P9L A;  2YX6 A;  3CJB A;  5F0X A;  4H5V A;  2IS3 A;  1XHZ A;  4N41 A;  1RT2 A;  4FJ9 A;  5FDL A;  1WAF A;  1T05 A;  1B92 A;  3TPQ A;  4W5Q A;  4WQ5 A;  2XHB A;  4M7Y A;  4OO1 J;  3HPG A;  1D9F A;  3OYB A;  4CZK A;  4IDH A;  3DXK B;  2XRI A;  3WUH A;  1NJX A;  2BDP A;  1VRT A;  4Z4E A;  4JKG A;  2HOE A;  1S1V A;  3LAM A;  1X3M A;  2HST A;  2VGN A;  4BR4 A;  4B9Q A;  3QLH A;  3L0Q A;  2A1S A;  4FJX A;  3VQE A;  4FLT A;  1QVF M;  2IVP A;  5M1P A;  3K5M A;  5J2N A;  3CER A;  3CJC A;  4CJL A;  2VWB A;  3ZSX A;  4XIU A;  4ILG B;  4XH5 A;  2HMP A;  3OS2 A;  4M3X A;  3WEE A;  1TK0 A;  1ASV A;  5C0Y A;  1NNE A;  1IBL K;  3LAN A;  2AJQ A;  2D0P A;  3GDQ A;  2HF4 A;  1B9F A;  3O08 A;  4M3Y A;  5ELZ A;  1G99 A;  2P9U A;  4FLY A;  2IAJ A;  4HUG A;  4RW9 A;  3MCA B;  4CJV A;  2XY7 A;  1T8E A;  2QWR A;  1J5O A;  3NGZ A;  3HI0 A;  4KTQ A;  4F2S A;  4UY8 O;  4IBN A;  3L6Q A;  2I7P A;  4B9S A;  1OH7 A;  4BR7 A;  4JD2 B;  1HJO A;  4B08 A;  3FLC O;  4E7L A;  2I7N A;  4B1Y B;  2YHW A;  5IWA K;  5EVZ A;  3CD6 N;  4CD3 A;  4CJF A;  2YHB A;  4UQG A;  3SI6 A;  2FXU A;  4J2A A;  1NKB A;  4LSN A;  5EU7 A;  2V7Z A;  3EYZ A;  4DCH A;  1S6P A;  2HHH K;  4F4K A;  4PQU A;  3J7Y P;  3K0S A;  5GIP A;  4FOI A;  1VSD A;  4LF4 K;  1KVA A;  3D45 A;  3DLL L;  2PZS A;  4FK2 A;  1XUP O;  2XO7 A;  5AQX A;  2FBT A;  4DKW A;  4Z94 A;  3OJS A;  3HM8 A;  3IG1 A;  1XHX A;  5M1F A;  1RBS A;  3EY1 A;  3H6E A;  4BRL A;  2P9K A;  1WSG A;  4EP4 A;  3SV3 A;  1JCE A;  2F8S A;  3NGY A;  3RSE B;  3L3V A;  4NCA A;  5C2D A;  1RBR A;  3VQD A;  3C6T A;  3O1W A;  4E7K A;  4KBO A;  4X62 K;  3JAM O;  2X6N A;  3UIQ A;  4B1X B;  2NRZ A;  4DV6 K;  4CZI A;  1O1W A;  3MXJ A;  3PSI A;  3MWT A;  4JKA A;  4BRG A;  2OPQ A;  3NDK A;  1K6Y A;  1A5V A;  3J8A A;  3U9Z A;  3AAQ A;  4O4G A;  5M1Q A;  1UA0 A;  3CG7 A;  1GLD G;  2O8E B;  2CH5 A;  1R0A A;  4W5O A;  3QIP A;  1KSP A;  3SMP A;  4YOU A;  3WNE A;  4CFC A;  5JLF A;  1OH8 A;  4I7F A;  4HTU A;  4AHU A;  3CCR N;  4FJK A;  4BWM A;  1GOB A;  3WNF A;  3MXI A;  2A40 A;  4N47 A;  3A2F A;  3M8P A;  4B3R K;  3DJC A;  1MU2 A;  3AVN A;  3OA9 A;  3WNG A;  4JI3 K;  1S1T A;  4BVP A;  2YHY A;  2ITM A;  3CCQ N;  3CCM N;  2KTQ A;  3QET A;  4JKG B;  1NM1 A;  3F9K A;  3ZX2 A;  3ZT0 A;  4Y1D A;  3BZC A;  5HOO A;  4BGA A;  2FBV A;  1X9W A;  1O13 A;  1WSF A;  1QZ5 A;  4FZZ A;  1S1X A;  4N5S A;  5K14 A;  1UAX A;  4C8M A;  3U4L A;  2YNI A;  5JVH L;  4RTF D;  1RDB A;  5C15 A;  3K5N A;  2UUC K;  4FJG A;  1RDC A;  3OJU A;  3KK2 A;  3NAE A;  4CF0 A;  1TKX A;  4IWV A;  5AZI A;  4RWT A;  1N6Q A;  4ZTF A;  4B9V A;  1JLF A;  4FJ7 A;  4G1Q A;  1MDU B;  2QWN A;  3NE6 A;  1N36 K;  4KFB A;  5KGW A;  1NOZ A;  4MO4 A;  4K8X A;  4X64 K;  4DU3 A;  2ASO A;  5CR4 A;  1XMQ K;  1N5Y A;  5LJW A;  3M6G A;  5D3G A;  1YVU A;  2KZM A;  1XWL A;  1U47 A;  3QFP A;  4WFA L;  3LZI A;  3B6P A;  2A5X A;  4BR2 A;  4O0I A;  5JS2 A;  5DK5 A;  1Z26 A;  4A57 A;  5C42 A;  4HTL A;  2ATQ A;  1NGJ A;  4IJN A;  4FPA A;  1IO2 A;  2Q0R A;  4KRE A;  3O9Q A;  3MEE A;  2FSN A;  3LAK A;  1D5A A;  2P51 A;  4WFB L;  4R5P A;  4HHT A;  1IKX A;  4EFH A;  3EE9 A;  3D0P A;  3G71 N;  4DR4 K;  2W41 A;  1EKE A;  3DYA A;  4DV3 K;  2OZS A;  3H45 C;  3HP9 A;  1JKH A;  1NGC A;  2JWK A;  4JN4 A;  3L2U A;  4F2R A;  1XC3 A;  2GWK A;  3DMJ A;  1QSL A;  1JCG A;  3PUF A;  3UB5 A;  5CZ2 A;  3FZH A;  4I9L A;  4FZX C;  3O4N A;  4GV9 A;  3K5O A;  4KHP K;  2A42 A;  2IIR A;  4QAG A;  4DHY A;  3K58 A;  3F9M A;  1YVN A;  2BTF A;  1BO5 O;  4X66 K;  3O3G A;  4B1U B;  1M1K O;  2HHT A;  1YJ9 N;  2P9K B;  1Q8I A;  2WON A;  4DUY K;  5C2F A;  4EZ6 A;  2O8B B;  1RT3 A;  2RKI A;  5AQV A;  5TKW A;  1BCM A;  2HBM A;  4E1M A;  1G15 A;  3LPU A;  4FLW A;  1U4B A;  3CCL N;  5JS1 A;  1YT3 A;  1CLQ A;  3OY9 A;  1T03 A;  1CXQ A;  4JK8 A;  3THX A;  1HJR A;  1SZ2 A;  2GEM A;  3NVK A;  1SKS A;  3HVR A;  4KHU A;  1ZYQ A;  3VQ6 A;  3ZEU A;  4XH4 A;  2O8D A;  3QFU A;  2KZZ A;  3CFP A;  4CFA A;  5GIO A;  4CBU A;  3KK3 A;  1TVR A;  2LSN A;  4JV5 K;  3CET A;  5JIC A;  1EXQ A;  1JXE A;  1S9G A;  2D0O A;  5SZT A;  1RGI A;  2FLO A;  1VQ4 N;  4I6M A;  4DTN A;  3QNO A;  2W42 A;  2DFE A;  2QWO A;  3LP3 A;  5FLX O;  1TAU A;  1RNH A;  4V19 S;  3JXU A;  3FZK A;  5AQS A;  1NWK A;  5F1X A;  2XY6 A;  3CCV N;  1JLG A;  1WOQ A;  5M1K A;  3SCX A;  3UKU B;  4K25 A;  1YIT N;  1QSS A;  1VSK A;  5MLC Q;  4WFN L;  3L2R A;  4KRF A;  3DLK A;  3C6A A;  1VRU A;  2UUB K;  4DF8 A;  1YI2 N;  2GUI A;  2A41 A;  1EX4 A;  3S9H A;  1BIS A;  1TGO A;  5KRS A;  3GG4 A;  3TSP A;  2D4W A;  3QDK A;  4DQP A;  4PKH A;  1SS6 A;  5C12 A;  2P9N A;  2J4R A;  4CGF A;  5HRS A;  4OPA A;  1IG8 A;  4F9O A;  1NGI A;  3THY B;  5LJV A;  5I42 A;  3ENH A;  5M1O A;  5DM7 L;  5AZI B;  4L8R B;  3ZT4 A;  2ASP A;  3LWM A;  1IV0 A;  1JLC A;  1ZBS A;  3J7Z O;  2E1Y A;  4YOY A;  3ZT1 A;  4JS4 A;  4BDZ A;  4IFV A;  2NRT A;  1LWF A;  3E1Y A;  4PY5 A;  3C94 A;  3ULD A;  4KO0 A;  5HBM A;  3CJ7 A;  4CCH A;  3GE1 A;  5FRN A;  4LD0 A;  4DV0 K;  3CJ9 A;  4OGC A;  1S6Q A;  4E7J A;  4WQ5 C;  3CYM A;  4CJP A;  3VF6 A;  1NGG A;  4JHD B;  5BPM A;  4H0P A;  4JRQ A;  3ASM A;  2YNF A;  3WQU A;  3HPO A;  1SQK A;  2WOM A;  5KQ8 A;  4EHT A;  3DLE A;  3DXK A;  1RBV A;  5BPN A;  3RMA A;  2W6L A;  3T19 A;  3WXK A;  3ZX3 A;  3HT3 A;  5LMN K;  3QBX A;  4E3S A;  3MDQ A;  3ATU A;  4CHZ A;  4MDA A;  4H03 B;  3CPE A;  4BRD A;  1NK7 A;  4FJL A;  2GTD A;  5AFU A;  3P5J A;  1GLL O;  1VQ9 N;  3I0R A;  3AO5 A;  3TR8 A;  1NLV A;  2QA4 N;  4A59 A;  3TI0 A;  3RVC A;  3I0S A;  4PKG A;  3MN7 A;  3THX B;  3E01 A;  3PX4 A;  3VES A;  5KRT A;  1EWQ A;  5HL7 L;  5C24 A;  3SV4 A;  1L3T A;  5AR0 A;  1ZBI A;  3RRH A;  4CHO A;  3L4I A;  4AIL C;  1BQM A;  1TKD A;  1HYZ A;  5AQO A;  2Q36 A;  2QM1 A;  3I8D A;  4NLB A;  3U6F A;  2O4G A;  3HOT A;  3CC2 N;  1QQM A;  3A8Y A;  2OA8 A;  2D1K A;  1CXU A;  1TKT A;  1U6Z A;  5KPZ A;  3AO1 A;  3O9T A;  4I6M B;  4JKH A;  5EX5 A;  4BRQ A;  3EKU A;  1BU6 O;  1C1A A;  1ATS A;  1VQO N;  1VQM N;  3C0B A;  4CGI A;  1CZB A;  3K57 A;  1KAY A;  2DFH A;  4H0Y B;  3DAW A;  4OPH A;  2BE2 A;  4CE9 A;  2BAN A;  3EO3 A;  1RBT A;  4MO5 A;  3QIN A;  3CPW M;  3R3L A;  4ID5 A;  1HYV A;  5GAG P;  3TAR A;  3S3M A;  3SUO A;  4LC9 B;  2G8K A;  1VQP N;  4AM6 A;  4A5A A;  4Z4G A;  3WNH A;  3ENO A;  5KPR A;  3LM2 A;  4MFB A;  3NH1 A;  4TSX A;  2RE2 A;  4CJE A;  3KD1 E;  4EZ9 A;  4H4O A;  3QEW A;  5FPE A;  4AM7 A;  4DLE A;  3HOS A;  3P38 A;  5FRO A;  1NKC A;  2HW3 A;  4DU4 A;  3MEG A;  1X9J A;  1YTU A;  2P9N B;  3OYN A;  1C1B A;  2QWP A;  3OW2 M;  1KLN A;  3IRX A;  1JL1 A;  4CZM A;  4CEE A;  4OKJ A;  4CI6 A;  4NYN A;  5HRN A;  3F73 A;  4DTU A;  4IOC L;  4CZF A;  3VPZ A;  3R8E A;  4OLB A;  3H3O B;  4DV2 K;  2NZT A;  1H1V A;  3MXM A;  4DR1 K;  3T3F A;  3LDN A;  5CZ1 A;  3V1Q A;  1RDD A;  3AVA A;  3R6M A;  3HZ6 A;  1NK5 A;  5E26 A;  4QOZ B;  4FO0 A;  1Q9X A;  3ZSZ A;  4AHR A;  4FW2 A;  3K9K A;  3CJA A;  3QEV A;  1Y97 A;  4FCY A;  5KTQ A;  1I39 A;  1SL0 A;  4CF8 A;  2IOC A;  1W9H A;  1Z6R A;  2HND A;  3E66 A;  3OYF A;  2UXD K;  4OJR A;  3NF6 A;  1ZXO A;  4KHS A;  5GIN A;  4CGJ A;  2Z1G A;  1C6V A;  1M90 O;  4A61 A;  1YHQ N;  4YOX A;  2IGI A;  3V9Z A;  4MLH A;  4DU1 A;  4DR3 K;  4BR9 A;  5JLH A;  3RMB A;  4BRH A;  4BR0 A;  1BOT O;  5EXW A;  4CBX A;  2G8U A;  4DQR A;  4QS8 A;  4RW4 A;  4BGB A;  4WF9 L;  2HNZ A;  4E7H A;  4KHQ A;  3CQY A;  4FW1 A;  4BDY A;  1FXX A;  2VWK A;  3AY9 A;  2VG7 A;  4XEI A;  3VEY A;  3ZET A;  1BDG A;  3AO2 A;  1RDW X;  2QW9 A;  2X78 A;  4BDP A;  1JLQ A;  4ISE A;  4FM1 A;  4OKE A;  1S1W A;  1VQN N;  1Q81 O;  1F21 A;  1HNI A;  1WBD A;  3A5O C;  3HPH A;  4DUZ K;  4ILJ A;  4YOW A;  3FFK B;  3LDL A;  1ZBH A;  3V1O A;  2HMI A;  1ASW A;  3N4P A;  4B1W B;  4KV8 A;  3LWL A;  1J54 A;  3DXM A;  1UOC A;  3F2K A;  3DLH A;  2I5J A;  3PO5 A;  4M42 A;  4L3Q A;  3TTF A;  3FGU A;  3HVT A;  1QHT A;  3ATV A;  3LDP A;  4IG0 A;  4ISF A;  4CFD A;  4JI5 K;  4IFY A;  3AVL A;  1HKG A;  5LL6 Z;  4BR5 A;  3OYD A;  4IG3 A;  4E7I A; 
#chains in the Genus database with same CATH homology
 3J7A P;  4OX9 K;  3OTO K;  4B3M K;  2F4V K;  4X62 K;  4JI1 K;  5AJ3 K;  3JAM O;  4LFB K;  1XNR K;  5BR8 K;  2UUB K;  4DV5 K;  4DV6 K;  2UXD K;  4DR4 K;  2VQE K;  4CVN E;  4DV3 K;  1HNZ K;  4DV7 K;  4GKK K;  5LMU K;  4JI4 K;  1IBL K;  4LFA K;  4DR3 K;  4DV4 K;  4KHP K;  3J80 O;  4K0K K;  4DR2 K;  4X65 K;  4X66 K;  4CW7 B;  1FJG K;  4DR5 K;  4NXN K;  4B3R K;  1N34 K;  4DUY K;  4JI2 K;  4JI3 K;  2UXB K;  4DR7 K;  4B3T K;  4NXM K;  2VQF K;  2E5L K;  4LF6 K;  4LF5 K;  4DUZ K;  4DV0 K;  1HR0 K;  4JI8 K;  4JYA K;  5IWA K;  4JI6 K;  4AQY K;  5IT9 O;  1IBM K;  1HNW K;  4GKJ K;  4DV1 K;  4LF8 K;  5A2Q O;  1N33 K;  1XMO K;  2HHH K;  3T1Y K;  2UUC K;  3J7Y P;  4JV5 K;  3J81 O;  4LF4 K;  4DR6 K;  1IBK K;  4JI7 K;  4LF9 K;  2UU9 K;  2UXC K;  1XNQ K;  5LMN K;  3T1H K;  4LF7 K;  4JI5 K;  4DV2 K;  5FLX O;  4B3S K;  4JI0 K;  4V19 S;  1J5E K;  5LL6 Z;  4DR1 K;  1N36 K;  2UUA K;  2ZM6 K;  4YHH K;  4LFC K;  1HNX K;  1I94 K;  4X64 K;  1XMQ K;  4YY3 K;  1N32 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...