4DR5K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr5K00
4LFBK 4DR1K 4X65K 2UXDK 1N32K 1HNWK 5IWAK 4DR2K 4NXMK 4JI3K 3J81O 1XMQK 4NXNK 5AJ3K 4JI7K 4JI4K 4DV0K 4GKKK 4LF9K 4X62K 4DV3K 2VQEK 4JI1K 1N36K 2UXBK 1N33K 4DR7K 3J7AP 4AQYK 5FLXO 4DUZK 3J80O 4DUYK 4DR4K 4DV1K 4YY3K 2E5LK 4LFAK 2VQFK 4CW7B 4DR3K 1IBLK 5LMNK 1N34K 4LF4K 2UUCK 4B3MK 4JI6K 4DV6K 2HHHK 4DV5K 1I94K 4OX9K 4DV2K 4B3TK 3J7YP 3JAMO 1J5EK 5A2QO 1XMOK 2UXCK 2F4VK 4JV5K 5BR8K 4LF6K 4DV7K 1HNZK 4GKJK 5IT9O 1IBKK 4JI2K 3T1HK 3OTOK 4V19S 2ZM6K 4B3SK 4DR6K 1XNRK 4LF5K 4DV4K 1HR0K 1HNXK 1XNQK 4X64K 4X66K 4CVNE 4LF8K 4JI5K 4DR5K 4KHPK 3T1YK 4B3RK 1FJGK 2UUAK 2UUBK 4K0KK 1IBMK 4YHHK 4JI8K 5LL6Z 2UU9K 4JYAK 4JI0K 4LF7K 4LFCK 5LMUK
chains in the Genus database with same CATH superfamily
4YDUA 3V9XA 4DR1K 3CQYA 3ZX2A 4CGIA 3HJFA 1T03A 4H5TA 4ZTFA 4FOEA 3VEYA 1WSJA 1UA1A 3JSMA 1LW0A 3SMSA 4N41A 1S6QA 1BISA 3LPTA 3PO5A 3QB0A 3UE5A 1TKZA 2ZQBA 3CJ9A 5FPEA 1Z6RA 4PL7A 4MQ3A 3QLHA 3J7AP 5CY4A 5C15A 2JGUA 2CH5A 3AGKA 3CHWA 5AQWA 5AR0A 4A2BA 2E5LK 4F2SA 3CCUN 5HLFA 1E3MA 3LWLA 2E2OA 3VEXA 3WNGA 1RBRA 4A5AA 1RDAA 3KWGA 4O5BA 1VSLA 1NGIA 3ENHA 1NJZA 3OS1A 4IOAL 3O3FA 1D9FA 3HSTB 2KHOA 3WNHA 2KQ2A 3HVRA 4JEPA 3WXLA 3AVKA 4EHUA 2PYLA 3IKMA 1CZAN 2F9TA 1ASUA 4JAXA 5M1PA 4DQQA 1VQ8N 2F4VK 4G9ZA 3OYHA 4DS4A 1BL3A 5B8HA 1VQPN 1V4SA 1K9MO 3HM8A 4FWRA 4BACA 2Q0UA 3D2EA 4YNQA 1NKBA 4V19S 3UKUA 1QZ5A 4F3TA 3VF6A 1VQNN 4KB1A 4BRMA 4E19A 2NRRA 2G8VA 2V51B 3AVHA 3KLIA 4FWLA 3CYMA 4CHYA 1NK6A 1LOTB 2E6LA 4FPAA 2RN2A 4B8AB 2HNDA 1SV5A 3SCXA 1B9DA 3R9PA 1REVA 1NNEA 4K0KK 3HVTA 4FJLA 3C6HA 3HOSA 3VQ5A 4WQ5C 3MN6A 2Q0RA 4FJNA 3WQUA 4N5SA 2YKNA 5MLCQ 3OJSA 1IG8A 2RKIA 2FSKA 3BGRA 4ELTA 4PUOA 1S1UA 3NGIA 3DRRA 5BRHA 3RTVA 3CCMN 4AILC 3FZKA 4B1VA 1KQSM 4NXNK 5AQRA 2OPQA 2P9LA 4DTXA 2X78A 1BA0A 3TAMA 4MO4A 1QQOA 4FCYA 3WXJA 5FPMA 1U47A 4UY8O 1Q9YA 1B9FA 4ELUA 3E9PA 5HRRA 3RR8A 4YOUA 4FJGA 3QIOA 4BR7A 4DTUA 4BR4A 3O3HA 1QSLA 3BEXA 2CGKA 3A5LC 5HBMA 1EWRA 2E8AA 4BQZA 4W5NA 1WBDA 1S6PA 1Z05A 1RILA 3C7NB 3QIPA 1L3UA 4KH5A 1DGKN 3LWMA 4CK3A 1D9DA 2OA8A 1KVAA 1QS4A 4HCCA 2DFHA 4ILGB 3GDQA 4CIFA 4CZMA 2X6NA 3SV3A 5A2QO 1KVCA 3R6MA 4JKAA 4RW8A 4N47A 4CEFA 3NH1A 2OTJN 1WAFA 3UIQA 3OS2A 4LF6K 4IJAA 2P9KA 3OYLA 1C1AA 1TL3A 1JLFA 2YNHA 1N6QA 1NOZA 3O80A 3CPWM 2DY4A 4BR5A 4FK2A 4KRFA 4FWOA 4KTQA 3WEEB 4XH1A 3J7ZO 3I0SA 3ENOA 3TSQA 5K14A 3ULDA 4Z4GA 4ICLA 4E7LA 3SBTA 4WF9L 3R1XA 3CJ7A 1LWEA 3Q7BA 3VTIA 5EU7A 1JLCA 5HRPA 2NRTA 3M8QA 3SQ0A 1HNIA 2HF4A 2DFFA 2Y1IA 2UUBK 3H3NO 5C25A 3CCSN 2E1YA 1WUAA 1NMDA 1VQLN 1HUXA 1KAXA 2E6MA 4H4MA 4M3UA 4J8FA 2IAJA 5E41A 3EZ5A 1O1WA 4KBOA 1OKJA 3L2QA 2Z1GA 4O0IA 3SPYA 4WYBA 3D7EO 4PWDA 4AM6A 4EP4A 3VQDA 1UAXA 1HNWK 1GLJO 3CFOA 3AVGA 1SQKA 1HRHA 2OTLN 2HBLA 4Z4IA 1HQEA 3CD6N 1G99A 1NGCA 1QHAA 4BRLA 3SQ4A 4AHTA 1VRUA 4AM7A 4DCHA 4I2PA 4X62K 4BRDA 3IG1A 3NVMA 3U3GA 2G8FA 4BC2A 4FWPA 5FPDA 1J6ZA 4DR4K 2P1JA 1P90A 3AARA 3ISNC 4WE1A 3EO3A 3SUNA 2FLOA 4GV9A 3A5OC 2QM1A 3ZETB 3QEIA 1NK8A 5GINA 3KK3A 3QBWA 3E9OA 4DV2K 4IKFA 3TTCA 3QETA 1WOQA 4OKEA 1RCHA 3TABA 5AQFA 2Y1JA 1KAZA 3SV4A 5JS2A 3HXMA 1YI2N 2A6AA 3SUOA 4IFVA 3ATUA 1HNZK 2F7TA 3LAMA 1BIZA 3TSUA 5M1KA 4CHNA 3MECA 2V7ZA 3LP0A 4DQ8A 3CXCM 4RW9A 4R5PA 1HYVA 4I6MA 3AVBA 1XNQK 1HKGA 4E1MA 3DWLA 4LH4A 4BVOA 1TYQA 3DJCA 5AQGA 4FVUA 3NGYA 3CCVN 1ZXOA 5AQHA 4BG9A 1VSMA 5C12A 4FLXA 4AHCA 1ATNA 3E1YA 5D3GA 4JKBA 1Y97A 4B3OA 1UWBA 1YVUA 3DLGA 3O08A 4FPBA 1OH5A 4I2QA 1TAQA 3SUQA 4B9QA 4Z4EA 4CJLA 1WSHA 2JWLA 4O5FA 4HHTA 2Z1HA 1ATSA 3NF6A 1KSPA 1ASVA 3HK2A 5F1XA 5J1EA 3PIPL 3D2FB 4IBNA 1GOBA 3J8AA 4ID1A 3MWTA 1EXQA 2OZSA 3EL2A 4U67L 3ZT3A 4JI7K 1Q9XA 2GTDA 3RMDA 2VWJA 4JNEA 4BREA 4KHQA 4JD2A 4CBWA 2G8HA 1JKHA 2HHWA 3SMPA 4DSKA 4DV1K 1OH7A 4J2AA 2D0PA 3OYEA 2Q36A 5AQNA 2P9NB 3NF9A 2B5JA 3THYA 1NGGA 5LMNK 1NK7A 4B9UA 5AFUH 1DLOA 1J54A 4KHYA 1GLCG 2W42A 2HHHK 3PSIA 1YT3A 3WXIA 4CEQA 3LL3A 3JS6A 3D0PA 4E0DA 1MWKA 1GLEG 3OYBA 2OCEA 3NCIA 1RGIA 2YI1A 5AQPA 3L6QA 4KI6A 5IT9O 1FW6A 4RG8A 4CJ7A 1LWFA 5KQ8A 2O8DB 3MN7A 3P31A 4DR6K 2F8TA 4DB3A 1K8KA 4DFPA 2KZZA 4CK1A 1HYZA 4K8ZA 2FC0A 4MLEA 3AY9A 3C94A 1VQ4N 1TVRA 4ZHRA 2O8FA 4MDBA 1QSSA 1U6ZA 4A57A 5H1SQ 1NGBA 1FK9A 3SK3A 4PKHA 4PQUA 2YKMA 3DAWA 2HHVA 2FF6A 5GAEP 4RW6A 3L8BA 1D5AA 3O9SA 4CECA 3MXIA 3AO2A 1KLNA 2CH6A 3DXMB 5I42A 3PSFA 4OO1J 4X65K 1TK8A 4BRHA 4OKJA 4DTMA 4C8MA 4FJJA 4WFBL 4JKFA 1Q8IA 4CJVA 3KVGA 2HHUA 1BO5O 3L4IA 1ITGA 2FBTA 4DV0K 4A61A 3QEPA 4JRQA 5KGWA 3TTDA 3IUCA 4DF8A 4DR7K 4AQYK 1WSIA 1GOAA 2RPIA 3L3VA 3P1GA 4EP5A 1GLFO 2P9UA 3W3DA 4NCBA 1IG9A 2P9PB 3B6PA 1BG3A 4JLHA 1C0TA 4FO0A 3KTQA 5SZTA 3FZMA 4O8KA 1I3AA 4NCGA 3DLKA 3OYGA 4QCLA 3ZEUA 3SJJA 1TV6A 3G4SN 4JN4A 3PUFA 4QS7A 1RT7A 4HWIA 3WXMB 4QS8A 2WTUA 1Q81O 3WNEA 4FLZA 5BR8K 4B9LA 2Q1NA 4DWIA 3TANA 3QFPA 4JI2K 1NJXA 1HKCA 1YTAA 5AQZA 4E7JA 3RMCA 1K6YA 1B92A 3R8EA 2NRVA 4KTWA 3FR0A 1RBVA 1VQMN 3LDSA 2VGNA 3AVMA 3ZCMA 4B1YB 3AVNA 3CCJN 1KFSA 3UKRB 4NO7A 5TKYA 1FJGK 4FWKA 4DU3A 5HP1A 3AA2A 4BGBA 3L2WA 3SAGA 2HVHA 1QTMA 4CZLA 4Y1CA 5F0XA 3QERA 1YVNA 4MLHA 5AQYA 3AVFA 3HT3A 3V9SA 5GAGP 4BWJA 5LJWA 4FXDA 4C8LA 4NYNA 3LP2A 1N8RO 4Z4FA 1VQ6N 5M1OA 1VK0A 3M5RA 2IC3A 5I9EB 4BC4A 4NXMK 4WQ4A 4KREA 1YJWN 1JLAA 3F9KA 4CEOA 2OPSA 2D0AA 1TL1A 3SI6A 3A8YA 3NBPA 2A3ZA 4CHPA 4CEDA 2E1ZA 5JLFA 3ZSOA 1RTDA 2PYJA 4HTUA 3ZT1A 1VQ5N 4F4KA 1GLAG 2P9IB 1YAGA 2Q31A 3C6TA 4CEBA 3QNOA 2NZTA 3RVCA 3RRHA 4DR3K 2YNGA 5GAHP 1RBTA 4DS5A 3H08A 3L0QA 5HROA 3VEWA 4FJ9A 4M45A 3QMLA 4JI6K 1XC3A 4C1NI 3OYCA 1FKOA 2QI2A 4A62A 1U48A 3PX4A 2KKZA 1QZ6A 3P83D 3CFPA 3GG4A 1RT5A 2O4GA 4RTFD 2PZSA 1XHXA 4CF0A 3BF3A 3QFUA 4IOXA 3OTOK 3WNFA 1Q86O 1S3XA 4BRAA 3WEEA 3B8AX 3V9UA 4L8RB 1IO2A 4PKIA 4E89A 1A5XA 2DPNA 2QWRA 4OJRA 2PAVA 1I39A 2YCHA 2EX3A 3O9QA 2YNFA 3N4PA 1C1BA 5FRMA 5I3UA 3U9DA 4QOZB 1RDDA 4CEAA 1IKYA 5AQLA 2HF3A 2EHGA 4JYAK 5J2PA 1T8EA 1NKCA 4CK2A 3HTVA 4FW1A 3HI0A 5M1FA 3H3OB 4WFAL 4B08A 3WXKA 5KRSA 3ZSQA 4DMNA 3G6EN 2GWKA 2ZD1A 2O8BA 4CBXA 1U2VA 3SZ2A 1CZBA 1Y64A 4I9QA 1U4BA 3A5NC 3KKSA 1C0FA 3K5MA 3LDOA 4H0VB 1TUUA 3IFRA 1C0MA 4A2AA 4EIAA 1SL1A 2W40A 2ZE2A 3MCPA 4CFCA 3FLCO 5EOYA 3FZHA 3VQ4A 3EE9A 3VERA 4DFJA 3CERA 3DOLA 4E1NA 3VQQA 1J9AA 3ASMA 3FZFA 1NJYA 2D1KA 4CHOA 4OLBA 3HZ6A 3VN5A 1WSFA 4LFAK 1G15A 4ISEA 3O9TA 4JHDB 4F3OA 4AHRA 4DF4A 3ULEA 3CJCA 4CJRA 2ETJA 2AA4A 4JKHA 4CIGA 2HHTA 2XO7A 1UA0A 4LD0A 3TARA 3J7YP 1A5WA 4B9TA 2HMIA 5BN9A 5AQUA 3KHYA 4FK0A 3OY9A 2VWBA 4WFNL 1CLQA 1SL0A 1W0HA 2UXCK 2RF2A 4DTNA 5AQKA 4CHQA 4DQIA 1JXEA 4CGHA 4M3XA 1BU6O 1RTJA 2WOMA 1TGOA 4CGDA 1RDWX 2P5OA 1T6DA 3CIPA 4A5BA 4Z94A 4Z4CA 3I56N 2V7YA 3M6GA 5AQOA 4JKDA 3CG7A 2QXLA 5DM6L 2D0BA 3EKSA 4IZ9A 3U6FA 1M90O 3CQXA 1KAYA 2O8CB 5AZJB 5ADXH 1CXUA 1IV0A 5KPRA 4DR5K 3D6RA 2Z1JA 1TK0A 3CCEN 1KC8O 4OGCA 3S3OA 2HHSA 2HBMA 3L2VA 4FJ7A 1KTQA 3WQTA 4KV8A 3ZT4A 3MWPA 2HNYA 3M8SA 5CR4A 4Q5VA 3AO1A 4DTJA 4CEZA 4FLTA 3M8PA 1GLDG 2IIRA 4B1UB 1ZYQA 2VG6A 1XHZA 3OJUA 1X9SA 4IWVA 2VWKA 1T3VA 4CJKA 3EZWA 2OPRA 3L4QA 1SUQA 4BRPA 3CMEN 4H5RA 1KD1O 3RR7A 1S22A 3HPOA 5JVHL 2XY7A 3U9ZA 3CCQN 1P8ZA 3KKRA 2HBJA 3TI0A 4IG0A 1GOCA 4FZYA 5GIOA 4KPYA 1RTHA 3OS0A 2YHBA 1N33K 5C42A 4GV6A 4OLAA 3EY1A 2Z1IA 4CHZA 3CJAA 1RT6A 3VQPA 3AA4A 2FSNA 4ILJA 4E1JA 3VQBA 5JVGL 3NGZA 4K42A 1YJ9N 3MMVA 1RBSA 4KHNA 4BRIA 1YIJN 3F2KA 4L3QA 3LM2A 1ZC6A 1QVFM 1IJJA 3RSEB 4CJ3A 1EETA 4BRGA 2ZJQL 3C95A 3ID6A 4HCBA 4FZXC 3JAMO 3L3UA 1S9EA 2E2NA 4FJ5A 1SL2A 1S1WA 4C1NK 3HPGA 4FL9A 2QXFA 2I7NA 4LH5A 3V1OA 1NK4A 3T1HK 4PA1A 1RNHA 3TWHA 1U45A 1RT3A 3OYJA 2GBZA 1S72N 4RCHA 4KHWA 1W2BM 4HVJA 1ZBHA 4JRPA 1RBUA 3DYAA 3SYZA 2O8EA 5CYMA 5LJVA 3C6AA 3NAEA 3AVAA 1WAJA 4X64K 1HJOA 4CD1A 2A5XA 4CJUA 3KK2A 4J2DA 2FBXA 2P9LB 3OVNA 5DM7L 1VQ7N 4CE9A 2UUAK 3QEXA 1BUPA 1EX4A 1NGAA 4WQ5A 1GLLO 3O1BA 4BY9C 2D5RA 3ZT0A 2NUBA 3HRGA 3ZT2A 4JI0K 4LFCK 1BI4A 2QWMA 1JL1A 4CF8A 4EHTA 1RT2A 4FZZA 3O3GA 4KHSA 4U7BA 4BRKA 3J81O 2B6AA 3CQ8A 4JKGB 4DSIA 4H03B 4M63C 5BRFA 2RHKA 4BC5A 4I7FA 3CMAN 3MEGA 2NNWA 1VQON 2PBDA 5ELZA 1KVBA 4DV3K 4IEEA 2XRIA 2ZF5O 1N36K 1OVYA 2CGJA 2CGLA 2V52B 4DUZK 4M7YA 4LSLA 1MWMA 2XY6A 4IJNA 3S41A 3PX0A 2P9KB 4F8RA 1E4FT 2YV0X 4DFKA 3ZSXA 1IBLK 4KHUA 4CF1A 1QVGM 1BQNA 4IEIA 5AQQA 1J5OA 2HBKA 4B9NA 1NU0A 3T19A 1X9JA 1KCFA 1KXPA 1VQ9N 1I94K 3FFKB 3EKUA 1T05A 4FWMA 3VQEA 3O4NA 2E2QA 5EX5A 3AAQA 1E4GT 3SQ2A 1TUYA 3NVKA 3KIOA 1VSJA 2DTUA 1DTQA 2DFEA 3AVLA 1IBKK 5DK5A 3ZYYX 2E88A 2FBYA 1IKVA 1EKEA 1M1KO 5AQTA 4B9SA 1LCUA 4CFBA 3LDLA 4CGGA 1XNRK 4LF5K 2IVOA 3NF7A 5C24A 4AF1A 1ILYA 1QQNA 4BE2A 1WLJA 3MAQA 4JKCA 3U3YA 2FBVA 4FM2A 4KKOA 3AO4A 2VCPA 3T1YK 2G8IA 1KFDA 4R79A 2KFNA 4AH9A 1IH7A 5E26A 3ZLJA 4OPKA 4NYFA 3OW2M 2WONA 2YHYA 4M7XA 3FFIA 5DMRA 3QO9A 1TKDA 3LP3A 5AZIA 1SS6A 2OANA 1FXXA 2JLEA 3DI6A 5EY4A 4BDPA 4FVMA 1VAZA 4DG1A 2HSTA 1XI1A 3SBGA 1RFQA 3OHRA 4KO0A 2QWNA 3NMUA 3M1FA 4YOYA 3EYZA 4LF9K 4FK4A 3FZLA 3QBXA 3V1QA 1ASWA 3K9JA 1BOTO 5FLXO 5CE3A 1BIUA 1LV5A 4BRNA 2NRZA 4DUYK 3DXKB 4DTOA 2BUPA 3MEDA 3OBWA 1X9MA 3TSPA 2GV9A 4H8KA 4H0TB 2HHQA 2HMPA 1S1VA 3BF1A 3DRSA 3Q7CA 2UUCK 4ISGA 1JJ2M 4B3MK 4FJ8A 1VSEA 5JICA 5LMUK 1U04A 4DV5K 4I6MB 3LP1A 3O9RA 5BPMA 5E84A 3L2RA 4CI6A 1J5EK 3ITHA 1TYQB 2WC9A 3ENBA 1ZBLA 5KTQA 3H1QA 4CJFA 4E7IA 3DLBA 4B9VA 2A40A 4DV7K 2A1RA 1EP4A 3BP8A 4H5WA 3WUHA 3HP9A 3NDKA 4ILHA 3SQ1A 4YOVA 1JCEA 1LW2A 1MU2A 5J2MA 2YHAA 4KAZA 3NF8A 1KLMA 1JLGA 2HVIA 2BGGA 3MXMA 3HBTA 3I55N 1T44A 4LSNA 3ZX0A 3THXB 4JS5A 4DFMA 4CF2A 4YOTA 4CBUA 4BROA 1NGEA 3RMBA 4M3ZA 4GNIA 2ZJPL 4IFYA 2VYPA 2ZWHA 4OPAA 5JLHA 4JI8K 4XEIA 3F9MA 4FJMA 2IGIA 2ZGYA 5BPNA 2BH1A 2B4JA 4BRCA 2IOCA 4BRQA 4J2EA 5BREA 1YXQA 1GLBG 2ASMA 4PY5A 4AHSA 4FJHA 2ATQA 4BG8A 3THYB 2H3GX 4W5TA 3T7ZA 2XY5A 3V6DA 2F96A 4FM0A 1R59O 3PLAA 3NFAA 4KI4A 4BR0A 5KGXA 1X1PA 4FYDA 4H0YB 3TTFA 4FJIA 4GKKK 3ZSRA 2VG7A 3KK1A 3QNNA 4KTZA 2PFUA 4RW7A 2VGMA 4DQRA 3HP6A 4AHUA 4DLGA 3U4LA 3J80O 2OPPA 2BTFA 3VENA 4H0PA 4MO5A 3AVCA 2D4WA 4CZKA 3BY5A 2VQFK 4CW7B 4JKEA 2BDPA 3OYDA 4CF9A 3T3FA 2QK9A 1YHQN 3THWB 1N34K 4CGFA 4H0XB 4UQGA 4ZTJA 3PY8A 4NLCA 4OX9K 1QHTA 1TKTA 1T6CA 4BE0A 3F73A 2W41A 1C6VA 1LAWA 5C10A 4JK9A 2IVPA 4RW4A 4CD3A 2QA4N 3VQAA 3VGKA 3P38A 4XIUA 4E7HA 1BDGA 5FPNA 4CJWA 1S1XA 1UOCA 2ZM6K 3C7NA 4C8NA 3KD5E 4C23A 4IXCA 4DTRA 2NLXA 3ZX3A 1W97L 1HPMA 1T7PA 3CETA 3K58A 1RDBA 1S5JA 2UYTA 3RRGA 1ZBIA 2HHXA 4FLUA 5CYQA 4CVNE 1ZBUA 2O8CA 3OYIA 3PO4A 5AZJA 3K0SA 2YX6A 3NE6A 4FM1A 2YNIA 4N76A 1NWKA 3AO3A 3K2PA 3CC2N 3OYNA 4IOCL 3PIOL 3O6WA 3OYFA 4H0OA 2A42A 4BDYA 4LF7K 1X9WA 2QEXN 4F9OA 3K59A 3AA5X 3SAHA 5BRDA 2P9UB 3T1AA 3ZSYA 1N32K 3CPEA 5CHIA 2QKBA 3VOVA 5AQSA 2AP1A 2HW3A 1NGHA 4K43A 3EE8A 2G8WA 3ZEUB 3HOTA 3F5TA 3AO5A 4BE1A 2OYQA 5FRNA 4H4OA 1BCOA 3O4WA 4BQLA 2LSNA 5AFUA 4H5VA 4O44A 3G0ZA 4CFDA 4FSVA 1TAUA 4CZEA 1QE1A 1JXBA 4KH6A 4BWMA 2O4IA 1NK0A 3I33A 4CJ5A 3TPQA 5HOOA 2I5JA 4CJSA 4DU1A 5TKWA 1SZ2A 1VSFA 1WSGA 1HX1A 2WBNA 1BHLA 4YORA 1C0GA 3RSEA 2P9SB 5GIPA 5EVZA 1DTTA 4ID5A 4K25A 1VSIA 3M8RA 3CCLN 2QW9A 4ELVA 4XH4A 1BWFO 4IO8A 4JV5K 4XH5A 4Y1DA 4B8CA 4CJ4A 2AJQA 4O0JA 4FJKA 2OZMA 5FDLA 1NGFA 5AQJA 4OPJA 4NCAA 2WUSA 2J4RA 1ZBSA 2FXUA 2P51A 3K5OA 5M1QA 3A0IX 1Q7YO 1JLBA 5F2RA 3ZETA 1NLVA 4QAGA 3BZCA 2A41A 3ATVA 3MN5A 3R3LA 3LPUA 1HR0K 3KD1E 1X3NA 4KFBA 4Q0BA 4CIEA 4X66K 2WFBA 3QICA 4JK7A 4CESA 4OKKA 5BPLA 2NRWA 1EO1A 2QWOA 1SKRA 4LC9B 1DKGD 2GX9A 1QQMA 2UU9K 1X3MA 1H1VA 2FF3B 4DSFA 4PL8A 4IO9L 1F21A 3V9WA 4OVLA 4C8OA 3QEWA 2Q3SA 4DTSA 2UXDK 4BVPA 2XY8A 4FWSA 1OH8A 3CI5A 1IKWA 1LAVA 2JWKA 4JI3K 4M41A 1O13A 5AJ3K 4FWNA 3QESA 4JKGA 3MCAB 1OVQA 3FGUA 4JI4K 2BANA 4LY7A 2I7PA 4EZ9A 4JI1K 4Y0WA 1S9GA 3T69A 5HL7L 1C1CA 3ID8A 3QEVA 4BC3A 4MDAA 2KZMA 3L2UA 3S3NA 2YHWA 4F2RA 3U8XA 3RMAA 4HUGA 3B6OA 3D2FA 3AV9A 4YOWA 3TAFA 3KLGA 4E3SA 1NMNA 2IS3A 3K5LA 2ITGA 3LDQA 4BRFA 1WBBA 3TAPA 1HNVA 4B9MA 3V81A 1RT1A 3E01A 5BN8A 2XHBA 1LWCA 1RT4A 4WCEL 5C2FA 1VSHA 3S3MA 1XMOK 3KK7A 3ZSVA 3DOKA 4DU4A 4FW2A 3CC4N 1NBWA 3VEOA 4DSEA 3D2EB 3UKUB 4KB0A 1YUWA 2E20A 5J2QA 4M3WA 2P9NA 3MK6A 3P4IA 3VA3A 1VQKN 2QWLA 4N56A 4RWTA 5KPTA 1HNXK 2O8BB 3H45C 1U2VB 3IS9A 1L3VA 5SWMA 3SPZA 1BCMA 1XWLA 1HKBA 1JLQA 4IG3A 3KLHA 5GADP 2E4LA 5HRSA 3I8BA 3CJ1A 3LDNA 3MX5A 5LL6Z 2ZJRL 3DMJA 3SNNA 1JL2A 2O8DA 4M3YA 3OBYA 5J2NA 3DLRA 4LFBK 4B1WB 1SKWA 3VGLA 2E2PA 2R7YA 1RDCA 3VQ7A 4IDKA 4GV3A 2GEMA 5EXWA 3EEQA 4GW6A 1QQCA 3ULEB 4CJQA 2IVNA 3NH2A 3KLEA 3IDHA 4TSXA 3CM5A 3I8DA 3W0LA 1HJRA 1VSDA 2BE2A 1Q82O 1D4XA 5AQVA 1VSKA 1EQYA 4I9LA 3CCRN 3C0BA 1S1TA 2Q2RA 1CXQA 3VEVA 3TU5A 4GVMA 1L3TA 4PHTX 3DXMA 5CZ2A 1NG9A 1HQUA 1NM1A 3DXKA 1Q18A 1HYSA 3IMXA 3A5MC 2ASPA 3K9KA 1BA1A 4GY2B 4FLVA 3H6EA 5KI6A 1WSEA 1K73O 1HLUA 5HRNA 3H46O 5CZ1A 4LF4K 3GL1A 2G8KA 4GVEA 1YITN 2ZGZA 3P5JA 1U49A 1Z26A 4FOIA 4NLBA 1YJNN 4CZJA 5T7BA 1IKXA 3N4QA 1NJIO 4CZHA 4FLWA 1JCFA 3IAYA 4BR9A 2HB5A 3E66A 3O9UA 1V4TA 1D8YA 3G10A 3AAPA 4GKJK 3GE1A 2P9PA 2QWPA 3OYMA 3K5NA 3VA0A 3THVA 3OYKA 3DLLL 1DEJA 4CERA 4DLEA 2P5GA 3VQCA 4ISFA 4FWQA 4BR2A 2QWQA 5KPZA 4DV4K 3LZIA 3I0RA 2KLAA 3WT0A 3QINA 3O5BA 4NB4A 2RE2A 4KH4A 3THXA 3TR8A 2D0OA 5FROA 4KHPK 1TK5A 1IBMK 3LALA 1VHXA 3G71N 2NRHA 3M3ZA 4A59A 2GUIA 3O8MA 3VF2A 3QDKA 3BUZB 1RDUA 4HTLA 1N5YA 1CZ9A 3SAFA 3HSCA 3DRPA 3VF4A 1XMQK 3UKRA 2GUPA 1A5VA 3LANA 3VQ8A 4WQ4C 3DLEA 3VESA 4DTPA 1MA9B 5LY3A 2YHXA 4QS9A 4CZFA 2YJFA 2UXBK 1VRTA 3CF5L 1RTIA 3SUPA 4FLYA 1ATRA 3DM2A 3P39A 5M1NA 1L3SA 1KRPA 3AVJA 1JCGA 3AA3A 4YDUC 2EWSA 3CJBA 1NOYA 3FE1A 3IRXA 1ESVA 3V4IA 4DQPA 4M42A 3MEEA 4M3RA 3RWUA 4CJTA 1NJWA 3MX2A 2ITMA 2O8EB 3VGMA 3THWA 4W5OA 3VTHA 4DSJA 2W6LA 4HUEA 4B3TK 4BGAA 2HOEA 3C6UA 1OH6A 3MXJA 3KLFA 3GOIA 2A1SA 2FSJA 1NGJA 1NK5A 2P9IA 1SKSA 3O1WA 1C0UA 3JYTA 1HMVA 4O55A 4Z4HA 1W7AA 1NGDA 4O8UA 2KFZA 5C2DA 5BR9A 3MDQA 3O4QA 5ADXA 3VQ6A 2NRXA 4EZ6A 4CCHA 4B3SK 3ZSZA 1BI4B 4GMJB 4CZGA 2QKKA 3VPZA 4B1XB 1XUPO 1Z25A 3LM9A 1R0AA 2Q97A 1FKPA 1HPZA 1WN7A 3BDPA 4LF8K 3SJHA 1YTUA 4JI5K 1BQMA 2KTQA 5C0YA 4J2BA 4G1QA 3PX6A 3VEZA 3AVIA 4CGJA 1SAZA 3KWIA 4O4GA 3C65A 4B3RK 2X74A 5AQIA 2GWJA 1WNSA 1BGXT 1NK9A 1ZBFA 3D45A 4AHVA 3VMFB 1QSYA 5IWAK 4W5QA 3TAEA 1L5UA 4DR2K 2G8UA 3VETA 4CEEA 4B1ZA 3KJVA 3V1RA 4CJEA 3BZKA 4CJPA 4PKGA 3TAGA 4W5RA 3NHGA 4EAHD 2W6KA 4EFHA 4IFEA 4JD2B 3VQ9A 3G25A 3TAQA 2VQEK 3HL8A 3GBTA 2HNZA 4K41A 3A2FA 2ASOA 3NH0A 5AQXA 4YY3K 4DHYA 1DT9A 3KZBA 5AQMA 1MDUB 4YOXA 4DQSA 3DLHA 5JMVA 4JK8A 4YFUA 2D0CA 3S9HA 3ZSWA 1J53A 3EN9A 4DV6K 1XQSC 3V9ZA 5KQDA 2P9SA 3SLCA 4CZIA 3OYAA 1NKEA 3E9LA 2F8SA 1YF5L 3LZJA 3ALYA 3K57A 1XC9A 4Z0UA 4DKWA 4IDHA 1JLEA 1WB9A 2IDOA 5JS1A 2F9WA 2PY5A 4JHDA 3JXUA 3HYFA 1K8KB 3H1VX 2QTDA 4M3TA 3OA9A 4HUFA 5KRTA 5AZIB 4DSLA 3PV8A 2X6SA 1K8AO 4OGEA 1EWQA 3HPHA 4JS4A 2O8FB 2VG5A 3CFRA 4FJXA 3CC7N 2YJEA 3HM9A 4E7KA 4CFAA 4K8XA 3UB5A 4H5NA 1TKXA 2GELA 4OPHA 4YHHK 1W9HA 3HO1A 3CM6A 4BDZA 3LDPA 3AGRA 3LAKA 4C8KA 2KW4A 4MFBA 3MN9A
chains in the Genus database with same CATH topology
4LFBK 4DR1K 4X65K 2UXDK 1N32K 1HNWK 5IWAK 4DR2K 4NXMK 4JI3K 3J81O 1XMQK 4NXNK 5AJ3K 4JI7K 4JI4K 4DV0K 4GKKK 4LF9K 4X62K 4DV3K 2VQEK 4JI1K 1N36K 2UXBK 1N33K 4DR7K 3J7AP 4AQYK 5FLXO 4DUZK 3J80O 4DUYK 4DR4K 4DV1K 4YY3K 2E5LK 4LFAK 2VQFK 4CW7B 4DR3K 1IBLK 5LMNK 1N34K 4LF4K 2UUCK 4B3MK 4JI6K 4DV6K 2HHHK 4DV5K 1I94K 4OX9K 4DV2K 4B3TK 3J7YP 3JAMO 1J5EK 5A2QO 1XMOK 2UXCK 2F4VK 4JV5K 5BR8K 4LF6K 4DV7K 1HNZK 4GKJK 5IT9O 1IBKK 4JI2K 3T1HK 3OTOK 4V19S 2ZM6K 4B3SK 4DR6K 1XNRK 4LF5K 4DV4K 1HR0K 1HNXK 1XNQK 4X64K 4X66K 4CVNE 4LF8K 4JI5K 4DR5K 4KHPK 3T1YK 4B3RK 1FJGK 2UUAK 2UUBK 4K0KK 1IBMK 4YHHK 4JI8K 5LL6Z 2UU9K 4JYAK 4JI0K 4LF7K 4LFCK 5LMUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB K;  4DR1 K;  4X65 K;  2UXD K;  1N32 K;  1HNW K;  5IWA K;  4DR2 K;  4NXM K;  4JI3 K;  3J81 O;  1XMQ K;  4NXN K;  5AJ3 K;  4JI7 K;  4JI4 K;  4DV0 K;  4GKK K;  4LF9 K;  4X62 K;  4DV3 K;  2VQE K;  4JI1 K;  1N36 K;  2UXB K;  1N33 K;  4DR7 K;  3J7A P;  4AQY K;  5FLX O;  4DUZ K;  3J80 O;  4DUY K;  4DR4 K;  4DV1 K;  4YY3 K;  2E5L K;  4LFA K;  2VQF K;  4CW7 B;  4DR3 K;  1IBL K;  5LMN K;  1N34 K;  4LF4 K;  2UUC K;  4B3M K;  4JI6 K;  4DV6 K;  2HHH K;  4DV5 K;  1I94 K;  4OX9 K;  4DV2 K;  4B3T K;  3J7Y P;  3JAM O;  1J5E K;  5A2Q O;  1XMO K;  2UXC K;  2F4V K;  4JV5 K;  5BR8 K;  4LF6 K;  4DV7 K;  1HNZ K;  4GKJ K;  5IT9 O;  1IBK K;  4JI2 K;  3T1H K;  3OTO K;  4V19 S;  2ZM6 K;  4B3S K;  4DR6 K;  1XNR K;  4LF5 K;  4DV4 K;  1HR0 K;  1HNX K;  1XNQ K;  4X64 K;  4X66 K;  4CVN E;  4LF8 K;  4JI5 K;  4DR5 K;  4KHP K;  3T1Y K;  4B3R K;  1FJG K;  2UUA K;  2UUB K;  4K0K K;  1IBM K;  4YHH K;  4JI8 K;  5LL6 Z;  2UU9 K;  4JYA K;  4JI0 K;  4LF7 K;  4LFC K;  5LMU K; 
#chains in the Genus database with same CATH topology
 4YDU A;  3V9X A;  4DR1 K;  3CQY A;  3ZX2 A;  4CGI A;  3HJF A;  1T03 A;  4H5T A;  4ZTF A;  4FOE A;  3VEY A;  1WSJ A;  1UA1 A;  3JSM A;  1LW0 A;  3SMS A;  4N41 A;  1S6Q A;  1BIS A;  3LPT A;  3PO5 A;  3QB0 A;  3UE5 A;  1TKZ A;  2ZQB A;  3CJ9 A;  5FPE A;  1Z6R A;  4PL7 A;  4MQ3 A;  3QLH A;  3J7A P;  5CY4 A;  5C15 A;  2JGU A;  2CH5 A;  3AGK A;  3CHW A;  5AQW A;  5AR0 A;  4A2B A;  2E5L K;  4F2S A;  3CCU N;  5HLF A;  1E3M A;  3LWL A;  2E2O A;  3VEX A;  3WNG A;  1RBR A;  4A5A A;  1RDA A;  3KWG A;  4O5B A;  1VSL A;  1NGI A;  3ENH A;  1NJZ A;  3OS1 A;  4IOA L;  3O3F A;  1D9F A;  3HST B;  2KHO A;  3WNH A;  2KQ2 A;  3HVR A;  4JEP A;  3WXL A;  3AVK A;  4EHU A;  2PYL A;  3IKM A;  1CZA N;  2F9T A;  1ASU A;  4JAX A;  5M1P A;  4DQQ A;  1VQ8 N;  2F4V K;  4G9Z A;  3OYH A;  4DS4 A;  1BL3 A;  5B8H A;  1VQP N;  1V4S A;  1K9M O;  3HM8 A;  4FWR A;  4BAC A;  2Q0U A;  3D2E A;  4YNQ A;  1NKB A;  4V19 S;  3UKU A;  1QZ5 A;  4F3T A;  3VF6 A;  1VQN N;  4KB1 A;  4BRM A;  4E19 A;  2NRR A;  2G8V A;  2V51 B;  3AVH A;  3KLI A;  4FWL A;  3CYM A;  4CHY A;  1NK6 A;  1LOT B;  2E6L A;  4FPA A;  2RN2 A;  4B8A B;  2HND A;  1SV5 A;  3SCX A;  1B9D A;  3R9P A;  1REV A;  1NNE A;  4K0K K;  3HVT A;  4FJL A;  3C6H A;  3HOS A;  3VQ5 A;  4WQ5 C;  3MN6 A;  2Q0R A;  4FJN A;  3WQU A;  4N5S A;  2YKN A;  5MLC Q;  3OJS A;  1IG8 A;  2RKI A;  2FSK A;  3BGR A;  4ELT A;  4PUO A;  1S1U A;  3NGI A;  3DRR A;  5BRH A;  3RTV A;  3CCM N;  4AIL C;  3FZK A;  4B1V A;  1KQS M;  4NXN K;  5AQR A;  2OPQ A;  2P9L A;  4DTX A;  2X78 A;  1BA0 A;  3TAM A;  4MO4 A;  1QQO A;  4FCY A;  3WXJ A;  5FPM A;  1U47 A;  4UY8 O;  1Q9Y A;  1B9F A;  4ELU A;  3E9P A;  5HRR A;  3RR8 A;  4YOU A;  4FJG A;  3QIO A;  4BR7 A;  4DTU A;  4BR4 A;  3O3H A;  1QSL A;  3BEX A;  2CGK A;  3A5L C;  5HBM A;  1EWR A;  2E8A A;  4BQZ A;  4W5N A;  1WBD A;  1S6P A;  1Z05 A;  1RIL A;  3C7N B;  3QIP A;  1L3U A;  4KH5 A;  1DGK N;  3LWM A;  4CK3 A;  1D9D A;  2OA8 A;  1KVA A;  1QS4 A;  4HCC A;  2DFH A;  4ILG B;  3GDQ A;  4CIF A;  4CZM A;  2X6N A;  3SV3 A;  5A2Q O;  1KVC A;  3R6M A;  4JKA A;  4RW8 A;  4N47 A;  4CEF A;  3NH1 A;  2OTJ N;  1WAF A;  3UIQ A;  3OS2 A;  4LF6 K;  4IJA A;  2P9K A;  3OYL A;  1C1A A;  1TL3 A;  1JLF A;  2YNH A;  1N6Q A;  1NOZ A;  3O80 A;  3CPW M;  2DY4 A;  4BR5 A;  4FK2 A;  4KRF A;  4FWO A;  4KTQ A;  3WEE B;  4XH1 A;  3J7Z O;  3I0S A;  3ENO A;  3TSQ A;  5K14 A;  3ULD A;  4Z4G A;  4ICL A;  4E7L A;  3SBT A;  4WF9 L;  3R1X A;  3CJ7 A;  1LWE A;  3Q7B A;  3VTI A;  5EU7 A;  1JLC A;  5HRP A;  2NRT A;  3M8Q A;  3SQ0 A;  1HNI A;  2HF4 A;  2DFF A;  2Y1I A;  2UUB K;  3H3N O;  5C25 A;  3CCS N;  2E1Y A;  1WUA A;  1NMD A;  1VQL N;  1HUX A;  1KAX A;  2E6M A;  4H4M A;  4M3U A;  4J8F A;  2IAJ A;  5E41 A;  3EZ5 A;  1O1W A;  4KBO A;  1OKJ A;  3L2Q A;  2Z1G A;  4O0I A;  3SPY A;  4WYB A;  3D7E O;  4PWD A;  4AM6 A;  4EP4 A;  3VQD A;  1UAX A;  1HNW K;  1GLJ O;  3CFO A;  3AVG A;  1SQK A;  1HRH A;  2OTL N;  2HBL A;  4Z4I A;  1HQE A;  3CD6 N;  1G99 A;  1NGC A;  1QHA A;  4BRL A;  3SQ4 A;  4AHT A;  1VRU A;  4AM7 A;  4DCH A;  4I2P A;  4X62 K;  4BRD A;  3IG1 A;  3NVM A;  3U3G A;  2G8F A;  4BC2 A;  4FWP A;  5FPD A;  1J6Z A;  4DR4 K;  2P1J A;  1P90 A;  3AAR A;  3ISN C;  4WE1 A;  3EO3 A;  3SUN A;  2FLO A;  4GV9 A;  3A5O C;  2QM1 A;  3ZET B;  3QEI A;  1NK8 A;  5GIN A;  3KK3 A;  3QBW A;  3E9O A;  4DV2 K;  4IKF A;  3TTC A;  3QET A;  1WOQ A;  4OKE A;  1RCH A;  3TAB A;  5AQF A;  2Y1J A;  1KAZ A;  3SV4 A;  5JS2 A;  3HXM A;  1YI2 N;  2A6A A;  3SUO A;  4IFV A;  3ATU A;  1HNZ K;  2F7T A;  3LAM A;  1BIZ A;  3TSU A;  5M1K A;  4CHN A;  3MEC A;  2V7Z A;  3LP0 A;  4DQ8 A;  3CXC M;  4RW9 A;  4R5P A;  1HYV A;  4I6M A;  3AVB A;  1XNQ K;  1HKG A;  4E1M A;  3DWL A;  4LH4 A;  4BVO A;  1TYQ A;  3DJC A;  5AQG A;  4FVU A;  3NGY A;  3CCV N;  1ZXO A;  5AQH A;  4BG9 A;  1VSM A;  5C12 A;  4FLX A;  4AHC A;  1ATN A;  3E1Y A;  5D3G A;  4JKB A;  1Y97 A;  4B3O A;  1UWB A;  1YVU A;  3DLG A;  3O08 A;  4FPB A;  1OH5 A;  4I2Q A;  1TAQ A;  3SUQ A;  4B9Q A;  4Z4E A;  4CJL A;  1WSH A;  2JWL A;  4O5F A;  4HHT A;  2Z1H A;  1ATS A;  3NF6 A;  1KSP A;  1ASV A;  3HK2 A;  5F1X A;  5J1E A;  3PIP L;  3D2F B;  4IBN A;  1GOB A;  3J8A A;  4ID1 A;  3MWT A;  1EXQ A;  2OZS A;  3EL2 A;  4U67 L;  3ZT3 A;  4JI7 K;  1Q9X A;  2GTD A;  3RMD A;  2VWJ A;  4JNE A;  4BRE A;  4KHQ A;  4JD2 A;  4CBW A;  2G8H A;  1JKH A;  2HHW A;  3SMP A;  4DSK A;  4DV1 K;  1OH7 A;  4J2A A;  2D0P A;  3OYE A;  2Q36 A;  5AQN A;  2P9N B;  3NF9 A;  2B5J A;  3THY A;  1NGG A;  5LMN K;  1NK7 A;  4B9U A;  5AFU H;  1DLO A;  1J54 A;  4KHY A;  1GLC G;  2W42 A;  2HHH K;  3PSI A;  1YT3 A;  3WXI A;  4CEQ A;  3LL3 A;  3JS6 A;  3D0P A;  4E0D A;  1MWK A;  1GLE G;  3OYB A;  2OCE A;  3NCI A;  1RGI A;  2YI1 A;  5AQP A;  3L6Q A;  4KI6 A;  5IT9 O;  1FW6 A;  4RG8 A;  4CJ7 A;  1LWF A;  5KQ8 A;  2O8D B;  3MN7 A;  3P31 A;  4DR6 K;  2F8T A;  4DB3 A;  1K8K A;  4DFP A;  2KZZ A;  4CK1 A;  1HYZ A;  4K8Z A;  2FC0 A;  4MLE A;  3AY9 A;  3C94 A;  1VQ4 N;  1TVR A;  4ZHR A;  2O8F A;  4MDB A;  1QSS A;  1U6Z A;  4A57 A;  5H1S Q;  1NGB A;  1FK9 A;  3SK3 A;  4PKH A;  4PQU A;  2YKM A;  3DAW A;  2HHV A;  2FF6 A;  5GAE P;  4RW6 A;  3L8B A;  1D5A A;  3O9S A;  4CEC A;  3MXI A;  3AO2 A;  1KLN A;  2CH6 A;  3DXM B;  5I42 A;  3PSF A;  4OO1 J;  4X65 K;  1TK8 A;  4BRH A;  4OKJ A;  4DTM A;  4C8M A;  4FJJ A;  4WFB L;  4JKF A;  1Q8I A;  4CJV A;  3KVG A;  2HHU A;  1BO5 O;  3L4I A;  1ITG A;  2FBT A;  4DV0 K;  4A61 A;  3QEP A;  4JRQ A;  5KGW A;  3TTD A;  3IUC A;  4DF8 A;  4DR7 K;  4AQY K;  1WSI A;  1GOA A;  2RPI A;  3L3V A;  3P1G A;  4EP5 A;  1GLF O;  2P9U A;  3W3D A;  4NCB A;  1IG9 A;  2P9P B;  3B6P A;  1BG3 A;  4JLH A;  1C0T A;  4FO0 A;  3KTQ A;  5SZT A;  3FZM A;  4O8K A;  1I3A A;  4NCG A;  3DLK A;  3OYG A;  4QCL A;  3ZEU A;  3SJJ A;  1TV6 A;  3G4S N;  4JN4 A;  3PUF A;  4QS7 A;  1RT7 A;  4HWI A;  3WXM B;  4QS8 A;  2WTU A;  1Q81 O;  3WNE A;  4FLZ A;  5BR8 K;  4B9L A;  2Q1N A;  4DWI A;  3TAN A;  3QFP A;  4JI2 K;  1NJX A;  1HKC A;  1YTA A;  5AQZ A;  4E7J A;  3RMC A;  1K6Y A;  1B92 A;  3R8E A;  2NRV A;  4KTW A;  3FR0 A;  1RBV A;  1VQM N;  3LDS A;  2VGN A;  3AVM A;  3ZCM A;  4B1Y B;  3AVN A;  3CCJ N;  1KFS A;  3UKR B;  4NO7 A;  5TKY A;  1FJG K;  4FWK A;  4DU3 A;  5HP1 A;  3AA2 A;  4BGB A;  3L2W A;  3SAG A;  2HVH A;  1QTM A;  4CZL A;  4Y1C A;  5F0X A;  3QER A;  1YVN A;  4MLH A;  5AQY A;  3AVF A;  3HT3 A;  3V9S A;  5GAG P;  4BWJ A;  5LJW A;  4FXD A;  4C8L A;  4NYN A;  3LP2 A;  1N8R O;  4Z4F A;  1VQ6 N;  5M1O A;  1VK0 A;  3M5R A;  2IC3 A;  5I9E B;  4BC4 A;  4NXM K;  4WQ4 A;  4KRE A;  1YJW N;  1JLA A;  3F9K A;  4CEO A;  2OPS A;  2D0A A;  1TL1 A;  3SI6 A;  3A8Y A;  3NBP A;  2A3Z A;  4CHP A;  4CED A;  2E1Z A;  5JLF A;  3ZSO A;  1RTD A;  2PYJ A;  4HTU A;  3ZT1 A;  1VQ5 N;  4F4K A;  1GLA G;  2P9I B;  1YAG A;  2Q31 A;  3C6T A;  4CEB A;  3QNO A;  2NZT A;  3RVC A;  3RRH A;  4DR3 K;  2YNG A;  5GAH P;  1RBT A;  4DS5 A;  3H08 A;  3L0Q A;  5HRO A;  3VEW A;  4FJ9 A;  4M45 A;  3QML A;  4JI6 K;  1XC3 A;  4C1N I;  3OYC A;  1FKO A;  2QI2 A;  4A62 A;  1U48 A;  3PX4 A;  2KKZ A;  1QZ6 A;  3P83 D;  3CFP A;  3GG4 A;  1RT5 A;  2O4G A;  4RTF D;  2PZS A;  1XHX A;  4CF0 A;  3BF3 A;  3QFU A;  4IOX A;  3OTO K;  3WNF A;  1Q86 O;  1S3X A;  4BRA A;  3WEE A;  3B8A X;  3V9U A;  4L8R B;  1IO2 A;  4PKI A;  4E89 A;  1A5X A;  2DPN A;  2QWR A;  4OJR A;  2PAV A;  1I39 A;  2YCH A;  2EX3 A;  3O9Q A;  2YNF A;  3N4P A;  1C1B A;  5FRM A;  5I3U A;  3U9D A;  4QOZ B;  1RDD A;  4CEA A;  1IKY A;  5AQL A;  2HF3 A;  2EHG A;  4JYA K;  5J2P A;  1T8E A;  1NKC A;  4CK2 A;  3HTV A;  4FW1 A;  3HI0 A;  5M1F A;  3H3O B;  4WFA L;  4B08 A;  3WXK A;  5KRS A;  3ZSQ A;  4DMN A;  3G6E N;  2GWK A;  2ZD1 A;  2O8B A;  4CBX A;  1U2V A;  3SZ2 A;  1CZB A;  1Y64 A;  4I9Q A;  1U4B A;  3A5N C;  3KKS A;  1C0F A;  3K5M A;  3LDO A;  4H0V B;  1TUU A;  3IFR A;  1C0M A;  4A2A A;  4EIA A;  1SL1 A;  2W40 A;  2ZE2 A;  3MCP A;  4CFC A;  3FLC O;  5EOY A;  3FZH A;  3VQ4 A;  3EE9 A;  3VER A;  4DFJ A;  3CER A;  3DOL A;  4E1N A;  3VQQ A;  1J9A A;  3ASM A;  3FZF A;  1NJY A;  2D1K A;  4CHO A;  4OLB A;  3HZ6 A;  3VN5 A;  1WSF A;  4LFA K;  1G15 A;  4ISE A;  3O9T A;  4JHD B;  4F3O A;  4AHR A;  4DF4 A;  3ULE A;  3CJC A;  4CJR A;  2ETJ A;  2AA4 A;  4JKH A;  4CIG A;  2HHT A;  2XO7 A;  1UA0 A;  4LD0 A;  3TAR A;  3J7Y P;  1A5W A;  4B9T A;  2HMI A;  5BN9 A;  5AQU A;  3KHY A;  4FK0 A;  3OY9 A;  2VWB A;  4WFN L;  1CLQ A;  1SL0 A;  1W0H A;  2UXC K;  2RF2 A;  4DTN A;  5AQK A;  4CHQ A;  4DQI A;  1JXE A;  4CGH A;  4M3X A;  1BU6 O;  1RTJ A;  2WOM A;  1TGO A;  4CGD A;  1RDW X;  2P5O A;  1T6D A;  3CIP A;  4A5B A;  4Z94 A;  4Z4C A;  3I56 N;  2V7Y A;  3M6G A;  5AQO A;  4JKD A;  3CG7 A;  2QXL A;  5DM6 L;  2D0B A;  3EKS A;  4IZ9 A;  3U6F A;  1M90 O;  3CQX A;  1KAY A;  2O8C B;  5AZJ B;  5ADX H;  1CXU A;  1IV0 A;  5KPR A;  4DR5 K;  3D6R A;  2Z1J A;  1TK0 A;  3CCE N;  1KC8 O;  4OGC A;  3S3O A;  2HHS A;  2HBM A;  3L2V A;  4FJ7 A;  1KTQ A;  3WQT A;  4KV8 A;  3ZT4 A;  3MWP A;  2HNY A;  3M8S A;  5CR4 A;  4Q5V A;  3AO1 A;  4DTJ A;  4CEZ A;  4FLT A;  3M8P A;  1GLD G;  2IIR A;  4B1U B;  1ZYQ A;  2VG6 A;  1XHZ A;  3OJU A;  1X9S A;  4IWV A;  2VWK A;  1T3V A;  4CJK A;  3EZW A;  2OPR A;  3L4Q A;  1SUQ A;  4BRP A;  3CME N;  4H5R A;  1KD1 O;  3RR7 A;  1S22 A;  3HPO A;  5JVH L;  2XY7 A;  3U9Z A;  3CCQ N;  1P8Z A;  3KKR A;  2HBJ A;  3TI0 A;  4IG0 A;  1GOC A;  4FZY A;  5GIO A;  4KPY A;  1RTH A;  3OS0 A;  2YHB A;  1N33 K;  5C42 A;  4GV6 A;  4OLA A;  3EY1 A;  2Z1I A;  4CHZ A;  3CJA A;  1RT6 A;  3VQP A;  3AA4 A;  2FSN A;  4ILJ A;  4E1J A;  3VQB A;  5JVG L;  3NGZ A;  4K42 A;  1YJ9 N;  3MMV A;  1RBS A;  4KHN A;  4BRI A;  1YIJ N;  3F2K A;  4L3Q A;  3LM2 A;  1ZC6 A;  1QVF M;  1IJJ A;  3RSE B;  4CJ3 A;  1EET A;  4BRG A;  2ZJQ L;  3C95 A;  3ID6 A;  4HCB A;  4FZX C;  3JAM O;  3L3U A;  1S9E A;  2E2N A;  4FJ5 A;  1SL2 A;  1S1W A;  4C1N K;  3HPG A;  4FL9 A;  2QXF A;  2I7N A;  4LH5 A;  3V1O A;  1NK4 A;  3T1H K;  4PA1 A;  1RNH A;  3TWH A;  1U45 A;  1RT3 A;  3OYJ A;  2GBZ A;  1S72 N;  4RCH A;  4KHW A;  1W2B M;  4HVJ A;  1ZBH A;  4JRP A;  1RBU A;  3DYA A;  3SYZ A;  2O8E A;  5CYM A;  5LJV A;  3C6A A;  3NAE A;  3AVA A;  1WAJ A;  4X64 K;  1HJO A;  4CD1 A;  2A5X A;  4CJU A;  3KK2 A;  4J2D A;  2FBX A;  2P9L B;  3OVN A;  5DM7 L;  1VQ7 N;  4CE9 A;  2UUA K;  3QEX A;  1BUP A;  1EX4 A;  1NGA A;  4WQ5 A;  1GLL O;  3O1B A;  4BY9 C;  2D5R A;  3ZT0 A;  2NUB A;  3HRG A;  3ZT2 A;  4JI0 K;  4LFC K;  1BI4 A;  2QWM A;  1JL1 A;  4CF8 A;  4EHT A;  1RT2 A;  4FZZ A;  3O3G A;  4KHS A;  4U7B A;  4BRK A;  3J81 O;  2B6A A;  3CQ8 A;  4JKG B;  4DSI A;  4H03 B;  4M63 C;  5BRF A;  2RHK A;  4BC5 A;  4I7F A;  3CMA N;  3MEG A;  2NNW A;  1VQO N;  2PBD A;  5ELZ A;  1KVB A;  4DV3 K;  4IEE A;  2XRI A;  2ZF5 O;  1N36 K;  1OVY A;  2CGJ A;  2CGL A;  2V52 B;  4DUZ K;  4M7Y A;  4LSL A;  1MWM A;  2XY6 A;  4IJN A;  3S41 A;  3PX0 A;  2P9K B;  4F8R A;  1E4F T;  2YV0 X;  4DFK A;  3ZSX A;  1IBL K;  4KHU A;  4CF1 A;  1QVG M;  1BQN A;  4IEI A;  5AQQ A;  1J5O A;  2HBK A;  4B9N A;  1NU0 A;  3T19 A;  1X9J A;  1KCF A;  1KXP A;  1VQ9 N;  1I94 K;  3FFK B;  3EKU A;  1T05 A;  4FWM A;  3VQE A;  3O4N A;  2E2Q A;  5EX5 A;  3AAQ A;  1E4G T;  3SQ2 A;  1TUY A;  3NVK A;  3KIO A;  1VSJ A;  2DTU A;  1DTQ A;  2DFE A;  3AVL A;  1IBK K;  5DK5 A;  3ZYY X;  2E88 A;  2FBY A;  1IKV A;  1EKE A;  1M1K O;  5AQT A;  4B9S A;  1LCU A;  4CFB A;  3LDL A;  4CGG A;  1XNR K;  4LF5 K;  2IVO A;  3NF7 A;  5C24 A;  4AF1 A;  1ILY A;  1QQN A;  4BE2 A;  1WLJ A;  3MAQ A;  4JKC A;  3U3Y A;  2FBV A;  4FM2 A;  4KKO A;  3AO4 A;  2VCP A;  3T1Y K;  2G8I A;  1KFD A;  4R79 A;  2KFN A;  4AH9 A;  1IH7 A;  5E26 A;  3ZLJ A;  4OPK A;  4NYF A;  3OW2 M;  2WON A;  2YHY A;  4M7X A;  3FFI A;  5DMR A;  3QO9 A;  1TKD A;  3LP3 A;  5AZI A;  1SS6 A;  2OAN A;  1FXX A;  2JLE A;  3DI6 A;  5EY4 A;  4BDP A;  4FVM A;  1VAZ A;  4DG1 A;  2HST A;  1XI1 A;  3SBG A;  1RFQ A;  3OHR A;  4KO0 A;  2QWN A;  3NMU A;  3M1F A;  4YOY A;  3EYZ A;  4LF9 K;  4FK4 A;  3FZL A;  3QBX A;  3V1Q A;  1ASW A;  3K9J A;  1BOT O;  5FLX O;  5CE3 A;  1BIU A;  1LV5 A;  4BRN A;  2NRZ A;  4DUY K;  3DXK B;  4DTO A;  2BUP A;  3MED A;  3OBW A;  1X9M A;  3TSP A;  2GV9 A;  4H8K A;  4H0T B;  2HHQ A;  2HMP A;  1S1V A;  3BF1 A;  3DRS A;  3Q7C A;  2UUC K;  4ISG A;  1JJ2 M;  4B3M K;  4FJ8 A;  1VSE A;  5JIC A;  5LMU K;  1U04 A;  4DV5 K;  4I6M B;  3LP1 A;  3O9R A;  5BPM A;  5E84 A;  3L2R A;  4CI6 A;  1J5E K;  3ITH A;  1TYQ B;  2WC9 A;  3ENB A;  1ZBL A;  5KTQ A;  3H1Q A;  4CJF A;  4E7I A;  3DLB A;  4B9V A;  2A40 A;  4DV7 K;  2A1R A;  1EP4 A;  3BP8 A;  4H5W A;  3WUH A;  3HP9 A;  3NDK A;  4ILH A;  3SQ1 A;  4YOV A;  1JCE A;  1LW2 A;  1MU2 A;  5J2M A;  2YHA A;  4KAZ A;  3NF8 A;  1KLM A;  1JLG A;  2HVI A;  2BGG A;  3MXM A;  3HBT A;  3I55 N;  1T44 A;  4LSN A;  3ZX0 A;  3THX B;  4JS5 A;  4DFM A;  4CF2 A;  4YOT A;  4CBU A;  4BRO A;  1NGE A;  3RMB A;  4M3Z A;  4GNI A;  2ZJP L;  4IFY A;  2VYP A;  2ZWH A;  4OPA A;  5JLH A;  4JI8 K;  4XEI A;  3F9M A;  4FJM A;  2IGI A;  2ZGY A;  5BPN A;  2BH1 A;  2B4J A;  4BRC A;  2IOC A;  4BRQ A;  4J2E A;  5BRE A;  1YXQ A;  1GLB G;  2ASM A;  4PY5 A;  4AHS A;  4FJH A;  2ATQ A;  4BG8 A;  3THY B;  2H3G X;  4W5T A;  3T7Z A;  2XY5 A;  3V6D A;  2F96 A;  4FM0 A;  1R59 O;  3PLA A;  3NFA A;  4KI4 A;  4BR0 A;  5KGX A;  1X1P A;  4FYD A;  4H0Y B;  3TTF A;  4FJI A;  4GKK K;  3ZSR A;  2VG7 A;  3KK1 A;  3QNN A;  4KTZ A;  2PFU A;  4RW7 A;  2VGM A;  4DQR A;  3HP6 A;  4AHU A;  4DLG A;  3U4L A;  3J80 O;  2OPP A;  2BTF A;  3VEN A;  4H0P A;  4MO5 A;  3AVC A;  2D4W A;  4CZK A;  3BY5 A;  2VQF K;  4CW7 B;  4JKE A;  2BDP A;  3OYD A;  4CF9 A;  3T3F A;  2QK9 A;  1YHQ N;  3THW B;  1N34 K;  4CGF A;  4H0X B;  4UQG A;  4ZTJ A;  3PY8 A;  4NLC A;  4OX9 K;  1QHT A;  1TKT A;  1T6C A;  4BE0 A;  3F73 A;  2W41 A;  1C6V A;  1LAW A;  5C10 A;  4JK9 A;  2IVP A;  4RW4 A;  4CD3 A;  2QA4 N;  3VQA A;  3VGK A;  3P38 A;  4XIU A;  4E7H A;  1BDG A;  5FPN A;  4CJW A;  1S1X A;  1UOC A;  2ZM6 K;  3C7N A;  4C8N A;  3KD5 E;  4C23 A;  4IXC A;  4DTR A;  2NLX A;  3ZX3 A;  1W97 L;  1HPM A;  1T7P A;  3CET A;  3K58 A;  1RDB A;  1S5J A;  2UYT A;  3RRG A;  1ZBI A;  2HHX A;  4FLU A;  5CYQ A;  4CVN E;  1ZBU A;  2O8C A;  3OYI A;  3PO4 A;  5AZJ A;  3K0S A;  2YX6 A;  3NE6 A;  4FM1 A;  2YNI A;  4N76 A;  1NWK A;  3AO3 A;  3K2P A;  3CC2 N;  3OYN A;  4IOC L;  3PIO L;  3O6W A;  3OYF A;  4H0O A;  2A42 A;  4BDY A;  4LF7 K;  1X9W A;  2QEX N;  4F9O A;  3K59 A;  3AA5 X;  3SAH A;  5BRD A;  2P9U B;  3T1A A;  3ZSY A;  1N32 K;  3CPE A;  5CHI A;  2QKB A;  3VOV A;  5AQS A;  2AP1 A;  2HW3 A;  1NGH A;  4K43 A;  3EE8 A;  2G8W A;  3ZEU B;  3HOT A;  3F5T A;  3AO5 A;  4BE1 A;  2OYQ A;  5FRN A;  4H4O A;  1BCO A;  3O4W A;  4BQL A;  2LSN A;  5AFU A;  4H5V A;  4O44 A;  3G0Z A;  4CFD A;  4FSV A;  1TAU A;  4CZE A;  1QE1 A;  1JXB A;  4KH6 A;  4BWM A;  2O4I A;  1NK0 A;  3I33 A;  4CJ5 A;  3TPQ A;  5HOO A;  2I5J A;  4CJS A;  4DU1 A;  5TKW A;  1SZ2 A;  1VSF A;  1WSG A;  1HX1 A;  2WBN A;  1BHL A;  4YOR A;  1C0G A;  3RSE A;  2P9S B;  5GIP A;  5EVZ A;  1DTT A;  4ID5 A;  4K25 A;  1VSI A;  3M8R A;  3CCL N;  2QW9 A;  4ELV A;  4XH4 A;  1BWF O;  4IO8 A;  4JV5 K;  4XH5 A;  4Y1D A;  4B8C A;  4CJ4 A;  2AJQ A;  4O0J A;  4FJK A;  2OZM A;  5FDL A;  1NGF A;  5AQJ A;  4OPJ A;  4NCA A;  2WUS A;  2J4R A;  1ZBS A;  2FXU A;  2P51 A;  3K5O A;  5M1Q A;  3A0I X;  1Q7Y O;  1JLB A;  5F2R A;  3ZET A;  1NLV A;  4QAG A;  3BZC A;  2A41 A;  3ATV A;  3MN5 A;  3R3L A;  3LPU A;  1HR0 K;  3KD1 E;  1X3N A;  4KFB A;  4Q0B A;  4CIE A;  4X66 K;  2WFB A;  3QIC A;  4JK7 A;  4CES A;  4OKK A;  5BPL A;  2NRW A;  1EO1 A;  2QWO A;  1SKR A;  4LC9 B;  1DKG D;  2GX9 A;  1QQM A;  2UU9 K;  1X3M A;  1H1V A;  2FF3 B;  4DSF A;  4PL8 A;  4IO9 L;  1F21 A;  3V9W A;  4OVL A;  4C8O A;  3QEW A;  2Q3S A;  4DTS A;  2UXD K;  4BVP A;  2XY8 A;  4FWS A;  1OH8 A;  3CI5 A;  1IKW A;  1LAV A;  2JWK A;  4JI3 K;  4M41 A;  1O13 A;  5AJ3 K;  4FWN A;  3QES A;  4JKG A;  3MCA B;  1OVQ A;  3FGU A;  4JI4 K;  2BAN A;  4LY7 A;  2I7P A;  4EZ9 A;  4JI1 K;  4Y0W A;  1S9G A;  3T69 A;  5HL7 L;  1C1C A;  3ID8 A;  3QEV A;  4BC3 A;  4MDA A;  2KZM A;  3L2U A;  3S3N A;  2YHW A;  4F2R A;  3U8X A;  3RMA A;  4HUG A;  3B6O A;  3D2F A;  3AV9 A;  4YOW A;  3TAF A;  3KLG A;  4E3S A;  1NMN A;  2IS3 A;  3K5L A;  2ITG A;  3LDQ A;  4BRF A;  1WBB A;  3TAP A;  1HNV A;  4B9M A;  3V81 A;  1RT1 A;  3E01 A;  5BN8 A;  2XHB A;  1LWC A;  1RT4 A;  4WCE L;  5C2F A;  1VSH A;  3S3M A;  1XMO K;  3KK7 A;  3ZSV A;  3DOK A;  4DU4 A;  4FW2 A;  3CC4 N;  1NBW A;  3VEO A;  4DSE A;  3D2E B;  3UKU B;  4KB0 A;  1YUW A;  2E20 A;  5J2Q A;  4M3W A;  2P9N A;  3MK6 A;  3P4I A;  3VA3 A;  1VQK N;  2QWL A;  4N56 A;  4RWT A;  5KPT A;  1HNX K;  2O8B B;  3H45 C;  1U2V B;  3IS9 A;  1L3V A;  5SWM A;  3SPZ A;  1BCM A;  1XWL A;  1HKB A;  1JLQ A;  4IG3 A;  3KLH A;  5GAD P;  2E4L A;  5HRS A;  3I8B A;  3CJ1 A;  3LDN A;  3MX5 A;  5LL6 Z;  2ZJR L;  3DMJ A;  3SNN A;  1JL2 A;  2O8D A;  4M3Y A;  3OBY A;  5J2N A;  3DLR A;  4LFB K;  4B1W B;  1SKW A;  3VGL A;  2E2P A;  2R7Y A;  1RDC A;  3VQ7 A;  4IDK A;  4GV3 A;  2GEM A;  5EXW A;  3EEQ A;  4GW6 A;  1QQC A;  3ULE B;  4CJQ A;  2IVN A;  3NH2 A;  3KLE A;  3IDH A;  4TSX A;  3CM5 A;  3I8D A;  3W0L A;  1HJR A;  1VSD A;  2BE2 A;  1Q82 O;  1D4X A;  5AQV A;  1VSK A;  1EQY A;  4I9L A;  3CCR N;  3C0B A;  1S1T A;  2Q2R A;  1CXQ A;  3VEV A;  3TU5 A;  4GVM A;  1L3T A;  4PHT X;  3DXM A;  5CZ2 A;  1NG9 A;  1HQU A;  1NM1 A;  3DXK A;  1Q18 A;  1HYS A;  3IMX A;  3A5M C;  2ASP A;  3K9K A;  1BA1 A;  4GY2 B;  4FLV A;  3H6E A;  5KI6 A;  1WSE A;  1K73 O;  1HLU A;  5HRN A;  3H46 O;  5CZ1 A;  4LF4 K;  3GL1 A;  2G8K A;  4GVE A;  1YIT N;  2ZGZ A;  3P5J A;  1U49 A;  1Z26 A;  4FOI A;  4NLB A;  1YJN N;  4CZJ A;  5T7B A;  1IKX A;  3N4Q A;  1NJI O;  4CZH A;  4FLW A;  1JCF A;  3IAY A;  4BR9 A;  2HB5 A;  3E66 A;  3O9U A;  1V4T A;  1D8Y A;  3G10 A;  3AAP A;  4GKJ K;  3GE1 A;  2P9P A;  2QWP A;  3OYM A;  3K5N A;  3VA0 A;  3THV A;  3OYK A;  3DLL L;  1DEJ A;  4CER A;  4DLE A;  2P5G A;  3VQC A;  4ISF A;  4FWQ A;  4BR2 A;  2QWQ A;  5KPZ A;  4DV4 K;  3LZI A;  3I0R A;  2KLA A;  3WT0 A;  3QIN A;  3O5B A;  4NB4 A;  2RE2 A;  4KH4 A;  3THX A;  3TR8 A;  2D0O A;  5FRO A;  4KHP K;  1TK5 A;  1IBM K;  3LAL A;  1VHX A;  3G71 N;  2NRH A;  3M3Z A;  4A59 A;  2GUI A;  3O8M A;  3VF2 A;  3QDK A;  3BUZ B;  1RDU A;  4HTL A;  1N5Y A;  1CZ9 A;  3SAF A;  3HSC A;  3DRP A;  3VF4 A;  1XMQ K;  3UKR A;  2GUP A;  1A5V A;  3LAN A;  3VQ8 A;  4WQ4 C;  3DLE A;  3VES A;  4DTP A;  1MA9 B;  5LY3 A;  2YHX A;  4QS9 A;  4CZF A;  2YJF A;  2UXB K;  1VRT A;  3CF5 L;  1RTI A;  3SUP A;  4FLY A;  1ATR A;  3DM2 A;  3P39 A;  5M1N A;  1L3S A;  1KRP A;  3AVJ A;  1JCG A;  3AA3 A;  4YDU C;  2EWS A;  3CJB A;  1NOY A;  3FE1 A;  3IRX A;  1ESV A;  3V4I A;  4DQP A;  4M42 A;  3MEE A;  4M3R A;  3RWU A;  4CJT A;  1NJW A;  3MX2 A;  2ITM A;  2O8E B;  3VGM A;  3THW A;  4W5O A;  3VTH A;  4DSJ A;  2W6L A;  4HUE A;  4B3T K;  4BGA A;  2HOE A;  3C6U A;  1OH6 A;  3MXJ A;  3KLF A;  3GOI A;  2A1S A;  2FSJ A;  1NGJ A;  1NK5 A;  2P9I A;  1SKS A;  3O1W A;  1C0U A;  3JYT A;  1HMV A;  4O55 A;  4Z4H A;  1W7A A;  1NGD A;  4O8U A;  2KFZ A;  5C2D A;  5BR9 A;  3MDQ A;  3O4Q A;  5ADX A;  3VQ6 A;  2NRX A;  4EZ6 A;  4CCH A;  4B3S K;  3ZSZ A;  1BI4 B;  4GMJ B;  4CZG A;  2QKK A;  3VPZ A;  4B1X B;  1XUP O;  1Z25 A;  3LM9 A;  1R0A A;  2Q97 A;  1FKP A;  1HPZ A;  1WN7 A;  3BDP A;  4LF8 K;  3SJH A;  1YTU A;  4JI5 K;  1BQM A;  2KTQ A;  5C0Y A;  4J2B A;  4G1Q A;  3PX6 A;  3VEZ A;  3AVI A;  4CGJ A;  1SAZ A;  3KWI A;  4O4G A;  3C65 A;  4B3R K;  2X74 A;  5AQI A;  2GWJ A;  1WNS A;  1BGX T;  1NK9 A;  1ZBF A;  3D45 A;  4AHV A;  3VMF B;  1QSY A;  5IWA K;  4W5Q A;  3TAE A;  1L5U A;  4DR2 K;  2G8U A;  3VET A;  4CEE A;  4B1Z A;  3KJV A;  3V1R A;  4CJE A;  3BZK A;  4CJP A;  4PKG A;  3TAG A;  4W5R A;  3NHG A;  4EAH D;  2W6K A;  4EFH A;  4IFE A;  4JD2 B;  3VQ9 A;  3G25 A;  3TAQ A;  2VQE K;  3HL8 A;  3GBT A;  2HNZ A;  4K41 A;  3A2F A;  2ASO A;  3NH0 A;  5AQX A;  4YY3 K;  4DHY A;  1DT9 A;  3KZB A;  5AQM A;  1MDU B;  4YOX A;  4DQS A;  3DLH A;  5JMV A;  4JK8 A;  4YFU A;  2D0C A;  3S9H A;  3ZSW A;  1J53 A;  3EN9 A;  4DV6 K;  1XQS C;  3V9Z A;  5KQD A;  2P9S A;  3SLC A;  4CZI A;  3OYA A;  1NKE A;  3E9L A;  2F8S A;  1YF5 L;  3LZJ A;  3ALY A;  3K57 A;  1XC9 A;  4Z0U A;  4DKW A;  4IDH A;  1JLE A;  1WB9 A;  2IDO A;  5JS1 A;  2F9W A;  2PY5 A;  4JHD A;  3JXU A;  3HYF A;  1K8K B;  3H1V X;  2QTD A;  4M3T A;  3OA9 A;  4HUF A;  5KRT A;  5AZI B;  4DSL A;  3PV8 A;  2X6S A;  1K8A O;  4OGE A;  1EWQ A;  3HPH A;  4JS4 A;  2O8F B;  2VG5 A;  3CFR A;  4FJX A;  3CC7 N;  2YJE A;  3HM9 A;  4E7K A;  4CFA A;  4K8X A;  3UB5 A;  4H5N A;  1TKX A;  2GEL A;  4OPH A;  4YHH K;  1W9H A;  3HO1 A;  3CM6 A;  4BDZ A;  3LDP A;  3AGR A;  3LAK A;  4C8K A;  2KW4 A;  4MFB A;  3MN9 A; 
#chains in the Genus database with same CATH homology
 4LFB K;  4DR1 K;  4X65 K;  2UXD K;  1N32 K;  1HNW K;  5IWA K;  4DR2 K;  4NXM K;  4JI3 K;  3J81 O;  1XMQ K;  4NXN K;  5AJ3 K;  4JI7 K;  4JI4 K;  4DV0 K;  4GKK K;  4LF9 K;  4X62 K;  4DV3 K;  2VQE K;  4JI1 K;  1N36 K;  2UXB K;  1N33 K;  4DR7 K;  3J7A P;  4AQY K;  5FLX O;  4DUZ K;  3J80 O;  4DUY K;  4DR4 K;  4DV1 K;  4YY3 K;  2E5L K;  4LFA K;  2VQF K;  4CW7 B;  4DR3 K;  1IBL K;  5LMN K;  1N34 K;  4LF4 K;  2UUC K;  4B3M K;  4JI6 K;  4DV6 K;  2HHH K;  4DV5 K;  1I94 K;  4OX9 K;  4DV2 K;  4B3T K;  3J7Y P;  3JAM O;  1J5E K;  5A2Q O;  1XMO K;  2UXC K;  2F4V K;  4JV5 K;  5BR8 K;  4LF6 K;  4DV7 K;  1HNZ K;  4GKJ K;  5IT9 O;  1IBK K;  4JI2 K;  3T1H K;  3OTO K;  4V19 S;  2ZM6 K;  4B3S K;  4DR6 K;  1XNR K;  4LF5 K;  4DV4 K;  1HR0 K;  1HNX K;  1XNQ K;  4X64 K;  4X66 K;  4CVN E;  4LF8 K;  4JI5 K;  4DR5 K;  4KHP K;  3T1Y K;  4B3R K;  1FJG K;  2UUA K;  2UUB K;  4K0K K;  1IBM K;  4YHH K;  4JI8 K;  5LL6 Z;  2UU9 K;  4JYA K;  4JI0 K;  4LF7 K;  4LFC K;  5LMU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...