4DR5M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr5M02
4X64M 4YY3M 3GPYA 5ITYA 3GPPA 4G4NA 3SAVA 1I94M 1Q3BA 3U6EA 3A46A 4JI8M 3SASA 1Q3CA 4ITQA 4DUYM 1HR0M 4JI7M 4PDIA 2VQEM 1PJIA 4NRWA 1HNZM 3U6CA 5ITUA 3SBJA 4JI1M 3VK7A 4LF7M 1FJGM 4JI2M 4GKKM 4DR2M 3T1HM 2UUCM 4LFAM 3JR4A 3C58A 3GP1A 3U6LA 1TDZA 1N36M 5ITRA 1XMOM 3J7AS 5ITXA 1XMQM 1R2ZA 1PJJA 1J5EM 4B3RM 4G4QA 3U6OA 2HHHM 4X66M 2XZFA 4G4RA 2UUBM 4PDGA 1L1TA 2EA0A 3GO8A 4PCZA 1XC8A 3T1YM 2VQFM 4JI6M 4NRVA 3U6PA 4JI5M 3U6MA 3TWMA 3JR5A 2UXBM 3A45A 2OPFA 2F5OA 3GQ5A 3OTOM 5ITXE 3SATA 4LFCM 4DUZM 2UXDM 5IT9S 4G4OA 4JI4M 4LF9M 1Z5BA 1L2CA 3VK8A 4DV6M 4JV5M 1N33M 4DV4M 1HNXM 5BR8M 2OQ4A 3W0FA 3U6SA 4DV0M 3J81S 4DR7M 5FLXS 4DV5M 1K3WA 4DR4M 4JYAM 4DV3M 2HKJA 4DR3M 1L1ZA 3U6QA 1Z5AA 3SARA 1IBLM 4MB7A 4CISA 2ZM6M 4X65M 1R2YA 4OX9M 2F5PA 3JAMS 3J80S 4DR6M 1Q39A 4AQYM 1EE8A 1KFVA 1IBMM 4LF6M 2F4VM 1N32M 5ITTA 4DV1M 1Z59A 1TDHA 1N34M 1L2BA 2F5QA 2F5SA 4LFBM 3SAWA 3GQ4A 2UUAM 3TWKA 4LF8M 1XNQM 1MU5A 2E5LM 5A2QS 4B3SM 4LF4M 5LMUM 4LF5M 4JI3M 1HNWM 2F5NA 1K3XA 3A42A 5ITQA 1Z5CA 5LMNM 1IBKM 2UXCM 1NNJA 1L2DA 4B3MM 4B3TM 4NXNM 4K0KM 4PD2A 4DV7M 4YHHM 2UU9M 2ZBKB 2Q2EB 4DR1M 4KHPM 3GPUA 4JI0M 1XNRM 4NXMM 2XZUA 5IWAM 1K82A 3TWLA 3GPXA 1MX0A 3DOAA 4DV2M 1PM5A 4X62M 4GKJM 3GQ3A 4DR5M 3U6DA 3SAUA
chains in the Genus database with same CATH superfamily
2O25A 3GPPA 5EQTA 3BOSA 5EXSA 1L8QA 2L7IA 2ZAOA 3FD9A 3ZC7B 4Y28F 5E26A 3W68A 4JI8M 3SASA 3KOWE 1QUTA 5EXPA 1N75A 3SFZA 2VQEM 1HR0M 3U6CA 3QWLA 1FJGM 4ZPXA 3AOEA 2Y21A 1S3SA 4M9XA 4I4LA 4LCBA 2UUCM 2V1UA 4S12A 2CUZA 3JR4A 3C58A 1TDZA 1J09A 3B7NA 3IECA 5IZ7D 1DGHA 4GEWA 5ITXA 3T15A 1PJJA 4B3RM 1IXRC 4L16A 3I4YA 3U5ZA 3B89A 2LHCA 1QUSA 8CATA 1C7YA 4NRWA 2KNAA 3RFWA 1GJSA 3GLIE 1G59A 2EA0A 4EIWA 3D8BA 4LJ7A 2KW0A 3FUVA 1GL6A 1XC8A 4ANRA 4FCTA 4NRVA 3U6PA 1IXSB 1OAIA 3U6MA 2OOBA 3PNYA 3TWMA 1E32A 1E94E 2UXBM 1IN7A 1NHGC 2YR0A 1ZQ9A 3GQ5A 2F5OA 3OTOM 2BJVA 2MROB 4JN6A 1ZMUA 2JP7A 3GLGE 2CHGA 2L2DA 4FCVA 1IFYA 1DV0A 2C9CA 3EIHA 1IBMM 2YNMD 1N33M 2CV2A 1V34A 4KT0F 3GRVA 2VIIA 4KO8A 4L8RC 2V6ZM 2BWEA 2QHOB 4W5WA 3KFUG 3HZJA 2R0IA 4AKGA 3HY5A 4L78A 2DHYA 2ERCA 4KLNA 4B7GA 4DV3M 1OJLA 2HKJA 4KODA 4NSRA 1OTRA 3H4JA 4DR3M 3U6DA 5JI2E 2WSCF 3AFHA 1N77A 1GVNA 2Y0QA 4CISA 2FFJA 2CP8A 3KSXA 3PFIA 1QDRA 1HJPA 1VQ1A 4B08A 2HAKA 4JI7M 1JB0F 2FOIC 2KRKA 4NOOB 3W67A 3JAMS 3J80S 4MGHA 2BNKA 1EE8A 4MGZE 4IJEA 1IN6A 2GNOA 3I4VA 1IY2A 5ITTA 4DV1M 1KFVA 4LF6M 1N34M 4LFBM 2F5SA 4TUWA 3K9OA 2JZ1A 3LMMA 1UFZA 1VG5A 1QQWA 4IBKA 1Z6TA 2KEBA 2EKFA 2DVWB 1YUBA 2DI0A 1QYRA 1PGYA 4LRSA 4LF5M 3KVWA 3LW5F 1QDTA 2R18A 4G6ZA 4JI3M 1R5LA 1WGLA 2MH8A 3A98B 3W0LB 1IBKM 2UXCM 3ZQJA 4B3TM 2JA2A 2Z3XA 2B3TA 7CATA 2CE7A 2FH0A 2AHMA 2RRUA 4HEOA 4GHLA 4YHHM 2LWXA 3GLIB 2MR9A 4LRTA 2X4AA 4L6V6 4QNMA 3B7QA 5FTNA 3U60A 1QANA 1EIJA 3KXEC 2LVNC 1K82A 4LJ4A 4REZA 5KPTA 3GLFA 2K6BA 5C18A 5KPRA 3KSJA 1MX0A 3HHZA 3R8FA 4Q7JA 1D2NA 4OU7A 3TQSA 4GKJM 3GQ3A 4DR5M 3KDSE 4G3OA 4MGKE 3SAUA 2L4EA 1IQPA 4OW0A 4X64M 3QAUA 4YY3M 5IREB 1IN4A 3DFZA 4IBCA 2DNAA 3TPZA 4G4NA 1I94M 1Q3BA 2Y20A 4WP2A 2EKKA 4R71A 1IN5A 1E9RA 1LTMA 3HHYA 2OOAA 2LH0A 4CIZA 1Q3CA 4PDIA 1HNZM 1W5SA 3SBJA 4XGIA 3VK7A 2R4EA 1R6BX 3TE6A 4JI2M 3BBZA 3KW6A 2FE8A 1MJGM 2L7HA 4QOSA 2APLA 3J2PB 4FWGA 2DENA 4GIPA 2JZ0A 3GRYA 3U6LA 1WGNA 2C99A 1R2ZA 2JNHA 1J5EM 3GLGA 2G3QA 4AW4A 4G4QA 2RGOA 3U6OA 2HHHM 2H1RA 2JXNA 3AOEC 4GRIA 1EFUB 4I81A 2L4FA 2UUBM 1NHWC 3GO8A 2O5RA 3C3DA 2JY7A 2ZANA 1NJFA 1VEGA 2VQFM 2QBYA 4F1IA 2HWJA 4JI5M 1KSFX 2RKOA 3KOZE 3AJIB 3E46A 5DYIA 4D80A 2OPFA 1PJTA 3J7BA 3U61A 4LFCM 2A5YB 5EJCA 1TGUA 2JY6B 2M5ZA 4DBGB 2UXDM 3FYCA 5GKNA 2KA6B 3NBIA 4LF9M 4I5SA 4QHSA 2LVAA 1Z5BA 1IXZA 1L2CA 4JV5M 3FUTA 3HWSA 1SXJD 1A5TA 2N35A 1XB2B 3CTWB 4DV4M 2XSZD 5DYGA 3KP1E 3U6SA 4DV0M 3M0EA 3SYKA 1GJTA 3FTDA 2CV0A 2P5TA 3B9PA 3GLFB 3V76A 2DWZB 4IBIA 3AV0A 3L26A 3CGWA 3U6QA 2J5YA 1V33A 1GABA 3VKHA 2KDLA 5EXTA 4M0WA 1KYIA 4WW0A 2LVOC 2X8AA 5DFLA 1IY0A 4OX9M 3LVVA 2J7NA 2QENA 3U5ZB 4L4UA 1SG9A 1HT1E 1WJ7A 3GLHB 3QYEA 3FUXA 4II7A 1G3IA 3SAWA 2QPAA 1N32M 1XXHB 3HU3A 3VFDA 3I04M 1GKIA 3GQ4A 2UUAM 4Z6YA 2HL7A 3KS4A 4LGYA 3KP0E 4QHTA 2LTUA 2DZNB 2R45A 1G41A 2E5LM 4LF4M 4R3DA 3GLHA 2R65A 1K3XA 1YSYA 1Z5CA 4B7FA 3K92A 4QOZC 4F2LA 5KO3A 1NNJA 4XK8F 2DKLA 1NV9A 1OIPA 1GLNA 1SXJC 2D7GA 2R44A 3DZDA 3LCVB 4PD2A 4K0KM 1AUAA 5KPZA 1R4GA 4DR1M 2UU9M 4CGYB 2XEPA 3PNVA 4GC9A 4JI0M 1XNRM 4NXMM 5FTKA 1G71A 1WIVA 3TWLA 3U60B 1FNNA 4LJ8A 4MGIE 2R4JA 3DOAA 4BBAA 3GPXA 4DV2M 1PM5A 3L28A 4LJ9A 2QP9X 3TL4X 5JI3E 1OIZA 4GHAA 3VLFB 4IJFA 2DAEA 1T6OA 1ZMWA 2XFSA 4LGMA 2K0BX 5KQ8A 3GPYA 3FRHA 3UGJA 2D7HA 3KOXE 4HL4A 3SAVA 3U6EA 2KHHA 3L29A 3ILKA 4NL4H 1PJSA 1YLAA 2DWLA 4AKHA 2XLJA 1YE9A 2XF3A 4FCWA 2LVQD 3D8LA 4CJ6A 2CWBA 2EJSA 4LJAA 2C9OA 4IBDA 2DAKA 4DUYM 3FUWA 1PJIA 4LZJA 4JI1M 4LF7M 1TR8A 2WZJA 5KQDA 2QBYB 2R62A 3HJQA 3IG5A 4DR2M 3T1HM 4MM3B 3GLFE 2Z8YM 3AOGA 4LZZA 2JY8A 1TH4A 2C98A 2WSFF 3GRRA 3M7GA 1RU3A 3E21A 1R7RA 4WURA 1XMOM 3UJNA 2JY5A 3C9PA 3FUUA 3SYLA 1V92A 2DWMA 3J7AS 4GH9A 1QAOA 1Y8GA 4X66M 4D81A 3SHFA 3VDUA 1DGBA 1H6UA 3HKPA 2K47A 4G4RA 1OQYA 1HQYE 1NY6A 2KXEA 2QZ4A 2XFTA 4PCZA 2KRUA 3UMMA 3T1YM 4BLCA 4JI6M 2BWBA 1WXQA 1BVSA 2CRUA 4UN2B 2G8LA 1NNUC 4IBJA 5EP2A 1XXHA 4IBFA 3JR5A 1DO0A 3A45A 1NV8A 1F4IA 1QVRA 1UM8A 5ITXE 1VDLA 1ZAEA 4FD2A 3SATA 2Y0TA 1LV7A 4DUZM 1GL7A 2DZOB 3FTCA 3VKGA 1JR3E 3WHKA 2CHQA 4OVZB 1OKSA 2HCBA 3VK8A 2DWNA 1DGGA 3MJ5A 5FTMA 5BR8M 2OQ4A 1MN3A 3KS8A 4LJ6A 4DR7M 3K8ZA 4XBOA 2LXEA 5FLXS 1K3WA 1DO2A 3LQRA 4I8OA 1G4AE 4FVMA 1X37A 4PT5A 3VDPA 1T43A 5DNYA 4L15A 1C1KA 3GLIA 1HT2E 1IBLM 2L09A 2G5GX 3K9PA 2ZM6M 2VDBB 2I7NA 1XWIA 1TTEA 3RGPA 2LNHC 3FTFA 1DGHB 4AQYM 1OAOC 1XXHE 4AKIA 3CF0A 2F5QA 3KOYE 1TDHA 4NC6A 4GMQA 3LVWA 1ZMVA 1IM2A 1QZMA 5EXXA 2O01F 1PRBA 2FNAA 5FSWA 1WR1B 2XGNA 4MGYE 3SHGB 3TWKA 4LF8M 3PVSA 1XNQM 2DAGA 4LG2A 1MU5A 1IY1A 5A2QS 2KZSA 3Q8XA 5E6JA 3WHLA 5LMUM 3AL0C 3IHPA 4OVZA 2F5NA 1OFHA 3A42A 1DGFA 2ZTDA 5LMNM 1N78A 3C3EA 2DAIA 1L2DA 3L27A 4P17A 1JQJC 2Z4SA 1ZV1A 5F3WA 2X49A 3B7ZA 4DV7M 4KHPM 2DAMA 2Q2EB 3MMPA 3HJSA 4AI6A 3SMPA 1VEKA 4FW9A 2JWSA 2V1CA 2C5RA 2LVPC 1QAQA 3F92A 4X62M 1SXJB 1D0KA 3HHWA 1IN8A 2GQFA 2DHRA 3GLHE 1PJQA 1Q02A 4AZFA 3SMSA 2XH9A 5ITYA 1P3QQ 4GITA 1NJGA 2FS1A 2C96A 1D0MA 2LHGA 2M60A 3M6AA 4HLQA 3A46A 4IBBA 2W82A 3BXWA 1W5TA 3THGA 4ITQA 2KNZA 3GRUA 4IBGA 3LQQA 1QZEA 2JUJA 5ITUA 2QSFX 3I51A 4P16A 2XSZA 4MH0E 3RE8A 4GKKM 3DA1A 1CUKA 3FTEA 3MHVC 1HQCA 2L6OA 4LFAM 2LBCA 3GP1A 1SXJE 1N36M 5ITRA 2I7PA 4Z8XA 5EP3A 1NVMA 1WHCA 1XMQM 1ORYB 2H5XA 5C1BA 5FTJA 3HU1A 3L2AA 2KZUA 3MK6A 2XZFA 2Z4RA 4NSOB 1JR3D 3CF6E 5EP4A 4IBEA 4PDGA 3UZUA 3IG8A 1L1TA 4RNAA 1XHBA 5L8RF 2RGHA 2CV1A 3HGIA 5FTLA 2WSEF 1J7KA 4RKUF 3HU2A 2KNVA 3K2LA 4IIWA 4A3VB 1T3TA 4QNRA 2QNJA 3CF2A 2CHVA 4R7GA 5IT9S 2QQ8A 4G4OA 4JI4M 2ZAMA 3GLGB 1NO1A 2R6FA 3H4MA 2VF7A 4DV6M 3ZH9B 3PXGA 1HNXM 2EO2A 3W0FA 4CHTB 3FYDA 3J81S 4D82A 4DV5M 4DR4M 2VF8A 2Z7JA 4JYAM 1I4WA 2EUCA 2MJ5B 3RGSA 1VEJA 3T6PA 1Z5AA 1L1ZA 3SARA 2CEAA 3NBXX 4MB7A 2OO9A 4X65M 1R2YA 2R46A 5BPVA 3QYBA 3HJ8A 2F5PA 4FWHA 4DR6M 1Q39A 2F4VM 1JR3A 3B74A 3UK6A 4LY6A 1Z59A 3HHXA 1L2BA 2DXIA 1GO5A 1TH3A 3SC3A 4RF1A 3R9XB 4AG5A 1NSFA 1IXSA 5H37D 3FE3A 2MGWA 2QCUA 2DZLA 4FWDA 3NWLA 3FRIA 4GC5A 3T38A 4B3SM 3K1JA 1TF0B 3I01M 2BJWA 3HX3A 1HNWM 1NY5A 1TH2A 2D7EA 3E4RA 2CFOA 5EP1A 5ITQA 4JXJA 4B3MM 4NXNM 3AKZA 3LCUA 1OFIA 3EIEA 4M9SA 3ZCBB 4RF0A 3U61B 1G8PA 2YFQA 2ZBKB 2YQZA 3L25A 1SXJA 1QAMA 3GPUA 4M0DA 3J27B 4BB9A 2XZUA 5IWAM 2K9DA 4AG6A 1VDDA 4M9ZA 1AIPC 1E9SA 3Q8GA 2J7OA 4LJ5A 1D0LA 2ZTCA 3E9SA 3FKEA 2NQ8C 4B7HA
chains in the Genus database with same CATH topology
3GPPA 5EQTA 3BOSA 5EXSA 1L8QA 2L7IA 2ZAOA 3FD9A 3ZC7B 5E26A 4JI8M 3SASA 3KOWE 5EXPA 3SFZA 1N75A 2VQEM 1HR0M 3U6CA 3QWLA 1FJGM 4ZPXA 3AOEA 2Y21A 1S3SA 4M9XA 4I4LA 4LCBA 2UUCM 2V1UA 4S12A 2CUZA 3JR4A 3C58A 1TDZA 1J09A 5IZ7D 1DGHA 5ITXA 3T15A 1PJJA 4B3RM 1IXRC 4L16A 3I4YA 3U5ZA 8CATA 3RFWA 1G59A 2EA0A 4EIWA 3D8BA 4LJ7A 2KW0A 3FUVA 1GL6A 1XC8A 4FCTA 4NRVA 3U6PA 1IXSB 3U6MA 3PNYA 3TWMA 1E32A 1E94E 2UXBM 1IN7A 1NHGC 2YR0A 1ZQ9A 3GQ5A 2F5OA 3OTOM 2BJVA 4JN6A 2CHGA 4FCVA 2C9CA 3EIHA 2YNMD 1N33M 2CV2A 4L8RC 3GRVA 2VIIA 4KO8A 3KFUG 2V6ZM 4AKGA 4W5WA 4L78A 2ERCA 4KLNA 4B7GA 4DV3M 1OJLA 2HKJA 4KODA 4NSRA 1N77A 4DR3M 5JI2E 3AFHA 1GVNA 2Y0QA 4CISA 2FFJA 3PFIA 3KSXA 4B08A 2KRKA 2FOIC 4NOOB 3JAMS 3J80S 4MGHA 2BNKA 1EE8A 4MGZE 4IJEA 1IN6A 1KFVA 3I4VA 1IY2A 5ITTA 4DV1M 1IBMM 4LF6M 1N34M 4LFBM 2F5SA 4TUWA 3LMMA 1QQWA 4IBKA 1Z6TA 2KEBA 2DVWB 1YUBA 1QYRA 4LRSA 4LF5M 3KVWA 4G6ZA 3W0LB 2R18A 4JI3M 3A98B 1IBKM 2UXCM 4B3TM 2JA2A 2Z3XA 7CATA 2CE7A 2AHMA 4GHLA 4YHHM 2LWXA 3GLIB 4LRTA 2X4AA 4QNMA 5FTNA 3U60A 1QANA 3KXEC 1K82A 4LJ4A 4REZA 5KPTA 3GLFA 5C18A 3HHZA 5KPRA 3KSJA 1MX0A 3R8FA 1D2NA 4OU7A 3TQSA 4GKJM 3GQ3A 4DR5M 3KDSE 4MGKE 3SAUA 4OW0A 1IQPA 4X64M 3QAUA 4YY3M 5IREB 1IN4A 3DFZA 4IBCA 3TPZA 4G4NA 1I94M 1Q3BA 2Y20A 1IN5A 1E9RA 3HHYA 2LH0A 1Q3CA 4PDIA 1HNZM 1W5SA 3SBJA 4XGIA 3VK7A 2R4EA 1R6BX 3TE6A 4JI2M 3KW6A 2FE8A 2L7HA 4QOSA 3J2PB 4FWGA 4GIPA 3GRYA 3U6LA 2C99A 1R2ZA 1J5EM 3GLGA 4AW4A 4G4QA 2RGOA 3U6OA 2HHHM 2H1RA 3AOEC 4GRIA 4I81A 2UUBM 1NHWC 3GO8A 2O5RA 2ZANA 1NJFA 2QBYA 2VQFM 4JI5M 1KSFX 2RKOA 3KOZE 3AJIB 4D80A 5DYIA 2OPFA 3J7BA 3U61A 4LFCM 2A5YB 5EJCA 1TGUA 2M5ZA 2UXDM 3FYCA 5GKNA 2KA6B 3NBIA 4LF9M 4I5SA 4QHSA 1Z5BA 1IXZA 1L2CA 4JV5M 3FUTA 3HWSA 1SXJD 4DV4M 3CTWB 2XSZD 5DYGA 3KP1E 3U6SA 4DV0M 3M0EA 3SYKA 3FTDA 2CV0A 2P5TA 3B9PA 3GLFB 2DWZB 4IBIA 3AV0A 3L26A 3U6QA 3VKHA 5EXTA 4M0WA 1KYIA 4WW0A 2X8AA 1IY0A 4OX9M 3LVVA 2J7NA 2QENA 3U5ZB 4L4UA 1HT1E 3GLHB 3FUXA 4II7A 1G3IA 3SAWA 2QPAA 1N32M 1XXHB 3HU3A 3VFDA 1GKIA 3GQ4A 2UUAM 4Z6YA 2HL7A 3KS4A 4LGYA 3KP0E 4QHTA 2DZNB 2R45A 1G41A 2E5LM 4LF4M 4R3DA 3GLHA 2R65A 1K3XA 1YSYA 1Z5CA 4B7FA 3K92A 4QOZC 1NNJA 5KO3A 1SXJC 2D7GA 1GLNA 4K0KM 3DZDA 4PD2A 5KPZA 2UU9M 4DR1M 4CGYB 2XEPA 3PNVA 4GC9A 4JI0M 1XNRM 4NXMM 5FTKA 3TWLA 3U60B 1FNNA 4LJ8A 4MGIE 2R4JA 3DOAA 4BBAA 3GPXA 4DV2M 1PM5A 3L28A 4LJ9A 2QP9X 3TL4X 5JI3E 4GHAA 3VLFB 4IJFA 2XFSA 4LGMA 5KQ8A 3GPYA 3UGJA 2D7HA 3KOXE 4HL4A 3SAVA 3U6EA 3L29A 3ILKA 4NL4H 4AKHA 2DWLA 2XLJA 1YE9A 2XF3A 4FCWA 3D8LA 4DUYM 4JI7M 4NRWA 1PJIA 4LJAA 2C9OA 4IBDA 4LF7M 3FUWA 4LZJA 4JI1M 5KQDA 2QBYB 2R62A 3HJQA 3IG5A 4DR2M 3T1HM 4MM3B 3AOGA 4LZZA 1TH4A 2C98A 3GRRA 3M7GA 4WURA 1R7RA 1XMOM 3UJNA 3FUUA 3SYLA 2DWMA 3J7AS 4GH9A 1QAOA 4X66M 4D81A 3SHFA 3VDUA 1DGBA 1H6UA 3HKPA 2K47A 4G4RA 1HQYE 1NY6A 2KXEA 2QZ4A 2XFTA 4PCZA 2KRUA 3UMMA 3T1YM 4BLCA 4JI6M 1WXQA 2G8LA 1NNUC 4IBJA 5EP2A 1XXHA 4IBFA 3JR5A 1DO0A 3A45A 1QVRA 1UM8A 5ITXE 3SATA 1ZAEA 4FD2A 2Y0TA 1LV7A 4DUZM 1GL7A 2DZOB 3FTCA 3VKGA 3WHKA 2CHQA 4OVZB 2HCBA 3VK8A 2DWNA 1DGGA 3MJ5A 5FTMA 5BR8M 2OQ4A 3KS8A 4LJ6A 4DR7M 3K8ZA 4XBOA 2LXEA 5FLXS 1K3WA 1DO2A 3LQRA 4I8OA 1G4AE 4FVMA 1X37A 4PT5A 3VDPA 5DNYA 4L15A 1C1KA 3GLIA 1HT2E 1IBLM 2L09A 2G5GX 2ZM6M 2I7NA 1XWIA 3RGPA 2LNHC 3FTFA 1DGHB 4AQYM 4AKIA 3CF0A 2F5QA 3KOYE 1TDHA 4GMQA 3LVWA 1IM2A 1QZMA 5EXXA 2FNAA 5FSWA 2XGNA 4MGYE 3SHGB 3TWKA 4LF8M 3PVSA 1XNQM 4LG2A 1MU5A 1IY1A 5A2QS 2KZSA 3Q8XA 5E6JA 3WHLA 5LMUM 3AL0C 4OVZA 2F5NA 1OFHA 3A42A 1DGFA 5LMNM 1N78A 1L2DA 3L27A 1JQJC 2Z4SA 5F3WA 2X49A 4DV7M 4KHPM 2Q2EB 3HJSA 4AI6A 3SMPA 4FW9A 2V1CA 2C5RA 1QAQA 4X62M 1SXJB 3HHWA 1IN8A 2DHRA 4AZFA 3SMSA 2XH9A 5ITYA 4GITA 1NJGA 2C96A 2M60A 3M6AA 4HLQA 3A46A 4IBBA 2W82A 3THGA 1W5TA 4ITQA 3GRUA 4IBGA 3LQQA 5ITUA 3I51A 4P16A 2XSZA 4MH0E 3RE8A 4GKKM 3DA1A 3FTEA 3MHVC 1HQCA 2L6OA 4LFAM 3GP1A 1SXJE 1N36M 5ITRA 2I7PA 4Z8XA 5EP3A 1NVMA 1XMQM 1ORYB 5C1BA 5FTJA 3HU1A 3L2AA 2KZUA 3MK6A 2XZFA 2Z4RA 4NSOB 1JR3D 3CF6E 5EP4A 4IBEA 4PDGA 3UZUA 3IG8A 1L1TA 4RNAA 1XHBA 2RGHA 2CV1A 3HGIA 5FTLA 1J7KA 3HU2A 3K2LA 4IIWA 4A3VB 1T3TA 4QNRA 3CF2A 2CHVA 4R7GA 5IT9S 4G4OA 4JI4M 2ZAMA 3GLGB 3H4MA 4DV6M 3ZH9B 3PXGA 1HNXM 2EO2A 3W0FA 4CHTB 3FYDA 3J81S 4D82A 4DV5M 4DR4M 2Z7JA 4JYAM 1I4WA 2EUCA 3RGSA 1L1ZA 1Z5AA 3SARA 2CEAA 4MB7A 4X65M 1R2YA 2R46A 5BPVA 2F5PA 3HJ8A 4FWHA 4DR6M 1Q39A 2F4VM 1JR3A 3UK6A 4LY6A 1Z59A 3HHXA 1L2BA 2DXIA 1TH3A 3SC3A 4RF1A 3R9XB 4AG5A 1NSFA 5H37D 2QCUA 4FWDA 3NWLA 4GC5A 3T38A 4B3SM 3K1JA 2BJWA 1HNWM 1NY5A 1TH2A 2D7EA 3E4RA 2CFOA 5EP1A 5ITQA 4JXJA 4B3MM 4NXNM 3AKZA 1OFIA 3EIEA 4M9SA 3ZCBB 4RF0A 3U61B 1G8PA 2YFQA 2ZBKB 2YQZA 3L25A 1SXJA 1QAMA 3GPUA 4M0DA 3J27B 4BB9A 2XZUA 5IWAM 4AG6A 1VDDA 4M9ZA 1E9SA 2J7OA 4LJ5A 3U6DA 3E9SA 3FKEA 2NQ8C 4B7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 M;  4YY3 M;  3GPY A;  5ITY A;  3GPP A;  4G4N A;  3SAV A;  1I94 M;  1Q3B A;  3U6E A;  3A46 A;  4JI8 M;  3SAS A;  1Q3C A;  4ITQ A;  4DUY M;  1HR0 M;  4JI7 M;  4PDI A;  2VQE M;  1PJI A;  4NRW A;  1HNZ M;  3U6C A;  5ITU A;  3SBJ A;  4JI1 M;  3VK7 A;  4LF7 M;  1FJG M;  4JI2 M;  4GKK M;  4DR2 M;  3T1H M;  2UUC M;  4LFA M;  3JR4 A;  3C58 A;  3GP1 A;  3U6L A;  1TDZ A;  1N36 M;  5ITR A;  1XMO M;  3J7A S;  5ITX A;  1XMQ M;  1R2Z A;  1PJJ A;  1J5E M;  4B3R M;  4G4Q A;  3U6O A;  2HHH M;  4X66 M;  2XZF A;  4G4R A;  2UUB M;  4PDG A;  1L1T A;  2EA0 A;  3GO8 A;  4PCZ A;  1XC8 A;  3T1Y M;  2VQF M;  4JI6 M;  4NRV A;  3U6P A;  4JI5 M;  3U6M A;  3TWM A;  3JR5 A;  2UXB M;  3A45 A;  2OPF A;  2F5O A;  3GQ5 A;  3OTO M;  5ITX E;  3SAT A;  4LFC M;  4DUZ M;  2UXD M;  5IT9 S;  4G4O A;  4JI4 M;  4LF9 M;  1Z5B A;  1L2C A;  3VK8 A;  4DV6 M;  4JV5 M;  1N33 M;  4DV4 M;  1HNX M;  5BR8 M;  2OQ4 A;  3W0F A;  3U6S A;  4DV0 M;  3J81 S;  4DR7 M;  5FLX S;  4DV5 M;  1K3W A;  4DR4 M;  4JYA M;  4DV3 M;  2HKJ A;  4DR3 M;  1L1Z A;  3U6Q A;  1Z5A A;  3SAR A;  1IBL M;  4MB7 A;  4CIS A;  2ZM6 M;  4X65 M;  1R2Y A;  4OX9 M;  2F5P A;  3JAM S;  3J80 S;  4DR6 M;  1Q39 A;  4AQY M;  1EE8 A;  1KFV A;  1IBM M;  4LF6 M;  2F4V M;  1N32 M;  5ITT A;  4DV1 M;  1Z59 A;  1TDH A;  1N34 M;  1L2B A;  2F5Q A;  2F5S A;  4LFB M;  3SAW A;  3GQ4 A;  2UUA M;  3TWK A;  4LF8 M;  1XNQ M;  1MU5 A;  2E5L M;  5A2Q S;  4B3S M;  4LF4 M;  5LMU M;  4LF5 M;  4JI3 M;  1HNW M;  2F5N A;  1K3X A;  3A42 A;  5ITQ A;  1Z5C A;  5LMN M;  1IBK M;  2UXC M;  1NNJ A;  1L2D A;  4B3M M;  4B3T M;  4NXN M;  4K0K M;  4PD2 A;  4DV7 M;  4YHH M;  2UU9 M;  2ZBK B;  2Q2E B;  4DR1 M;  4KHP M;  3GPU A;  4JI0 M;  1XNR M;  4NXM M;  2XZU A;  5IWA M;  1K82 A;  3TWL A;  3GPX A;  1MX0 A;  3DOA A;  4DV2 M;  1PM5 A;  4X62 M;  4GKJ M;  3GQ3 A;  4DR5 M;  3U6D A;  3SAU A; 
#chains in the Genus database with same CATH topology
 2O25 A;  3GPP A;  5EQT A;  3BOS A;  5EXS A;  1L8Q A;  2L7I A;  2ZAO A;  3FD9 A;  3ZC7 B;  4Y28 F;  5E26 A;  3W68 A;  4JI8 M;  3SAS A;  3KOW E;  1QUT A;  5EXP A;  1N75 A;  3SFZ A;  2VQE M;  1HR0 M;  3U6C A;  3QWL A;  1FJG M;  4ZPX A;  3AOE A;  2Y21 A;  1S3S A;  4M9X A;  4I4L A;  4LCB A;  2UUC M;  2V1U A;  4S12 A;  2CUZ A;  3JR4 A;  3C58 A;  1TDZ A;  1J09 A;  3B7N A;  3IEC A;  5IZ7 D;  1DGH A;  4GEW A;  5ITX A;  3T15 A;  1PJJ A;  4B3R M;  1IXR C;  4L16 A;  3I4Y A;  3U5Z A;  3B89 A;  2LHC A;  1QUS A;  8CAT A;  1C7Y A;  4NRW A;  2KNA A;  3RFW A;  1GJS A;  3GLI E;  1G59 A;  2EA0 A;  4EIW A;  3D8B A;  4LJ7 A;  2KW0 A;  3FUV A;  1GL6 A;  1XC8 A;  4ANR A;  4FCT A;  4NRV A;  3U6P A;  1IXS B;  1OAI A;  3U6M A;  2OOB A;  3PNY A;  3TWM A;  1E32 A;  1E94 E;  2UXB M;  1IN7 A;  1NHG C;  2YR0 A;  1ZQ9 A;  3GQ5 A;  2F5O A;  3OTO M;  2BJV A;  2MRO B;  4JN6 A;  1ZMU A;  2JP7 A;  3GLG E;  2CHG A;  2L2D A;  4FCV A;  1IFY A;  1DV0 A;  2C9C A;  3EIH A;  1IBM M;  2YNM D;  1N33 M;  2CV2 A;  1V34 A;  4KT0 F;  3GRV A;  2VII A;  4KO8 A;  4L8R C;  2V6Z M;  2BWE A;  2QHO B;  4W5W A;  3KFU G;  3HZJ A;  2R0I A;  4AKG A;  3HY5 A;  4L78 A;  2DHY A;  2ERC A;  4KLN A;  4B7G A;  4DV3 M;  1OJL A;  2HKJ A;  4KOD A;  4NSR A;  1OTR A;  3H4J A;  4DR3 M;  3U6D A;  5JI2 E;  2WSC F;  3AFH A;  1N77 A;  1GVN A;  2Y0Q A;  4CIS A;  2FFJ A;  2CP8 A;  3KSX A;  3PFI A;  1QDR A;  1HJP A;  1VQ1 A;  4B08 A;  2HAK A;  4JI7 M;  1JB0 F;  2FOI C;  2KRK A;  4NOO B;  3W67 A;  3JAM S;  3J80 S;  4MGH A;  2BNK A;  1EE8 A;  4MGZ E;  4IJE A;  1IN6 A;  2GNO A;  3I4V A;  1IY2 A;  5ITT A;  4DV1 M;  1KFV A;  4LF6 M;  1N34 M;  4LFB M;  2F5S A;  4TUW A;  3K9O A;  2JZ1 A;  3LMM A;  1UFZ A;  1VG5 A;  1QQW A;  4IBK A;  1Z6T A;  2KEB A;  2EKF A;  2DVW B;  1YUB A;  2DI0 A;  1QYR A;  1PGY A;  4LRS A;  4LF5 M;  3KVW A;  3LW5 F;  1QDT A;  2R18 A;  4G6Z A;  4JI3 M;  1R5L A;  1WGL A;  2MH8 A;  3A98 B;  3W0L B;  1IBK M;  2UXC M;  3ZQJ A;  4B3T M;  2JA2 A;  2Z3X A;  2B3T A;  7CAT A;  2CE7 A;  2FH0 A;  2AHM A;  2RRU A;  4HEO A;  4GHL A;  4YHH M;  2LWX A;  3GLI B;  2MR9 A;  4LRT A;  2X4A A;  4L6V 6;  4QNM A;  3B7Q A;  5FTN A;  3U60 A;  1QAN A;  1EIJ A;  3KXE C;  2LVN C;  1K82 A;  4LJ4 A;  4REZ A;  5KPT A;  3GLF A;  2K6B A;  5C18 A;  5KPR A;  3KSJ A;  1MX0 A;  3HHZ A;  3R8F A;  4Q7J A;  1D2N A;  4OU7 A;  3TQS A;  4GKJ M;  3GQ3 A;  4DR5 M;  3KDS E;  4G3O A;  4MGK E;  3SAU A;  2L4E A;  1IQP A;  4OW0 A;  4X64 M;  3QAU A;  4YY3 M;  5IRE B;  1IN4 A;  3DFZ A;  4IBC A;  2DNA A;  3TPZ A;  4G4N A;  1I94 M;  1Q3B A;  2Y20 A;  4WP2 A;  2EKK A;  4R71 A;  1IN5 A;  1E9R A;  1LTM A;  3HHY A;  2OOA A;  2LH0 A;  4CIZ A;  1Q3C A;  4PDI A;  1HNZ M;  1W5S A;  3SBJ A;  4XGI A;  3VK7 A;  2R4E A;  1R6B X;  3TE6 A;  4JI2 M;  3BBZ A;  3KW6 A;  2FE8 A;  1MJG M;  2L7H A;  4QOS A;  2APL A;  3J2P B;  4FWG A;  2DEN A;  4GIP A;  2JZ0 A;  3GRY A;  3U6L A;  1WGN A;  2C99 A;  1R2Z A;  2JNH A;  1J5E M;  3GLG A;  2G3Q A;  4AW4 A;  4G4Q A;  2RGO A;  3U6O A;  2HHH M;  2H1R A;  2JXN A;  3AOE C;  4GRI A;  1EFU B;  4I81 A;  2L4F A;  2UUB M;  1NHW C;  3GO8 A;  2O5R A;  3C3D A;  2JY7 A;  2ZAN A;  1NJF A;  1VEG A;  2VQF M;  2QBY A;  4F1I A;  2HWJ A;  4JI5 M;  1KSF X;  2RKO A;  3KOZ E;  3AJI B;  3E46 A;  5DYI A;  4D80 A;  2OPF A;  1PJT A;  3J7B A;  3U61 A;  4LFC M;  2A5Y B;  5EJC A;  1TGU A;  2JY6 B;  2M5Z A;  4DBG B;  2UXD M;  3FYC A;  5GKN A;  2KA6 B;  3NBI A;  4LF9 M;  4I5S A;  4QHS A;  2LVA A;  1Z5B A;  1IXZ A;  1L2C A;  4JV5 M;  3FUT A;  3HWS A;  1SXJ D;  1A5T A;  2N35 A;  1XB2 B;  3CTW B;  4DV4 M;  2XSZ D;  5DYG A;  3KP1 E;  3U6S A;  4DV0 M;  3M0E A;  3SYK A;  1GJT A;  3FTD A;  2CV0 A;  2P5T A;  3B9P A;  3GLF B;  3V76 A;  2DWZ B;  4IBI A;  3AV0 A;  3L26 A;  3CGW A;  3U6Q A;  2J5Y A;  1V33 A;  1GAB A;  3VKH A;  2KDL A;  5EXT A;  4M0W A;  1KYI A;  4WW0 A;  2LVO C;  2X8A A;  5DFL A;  1IY0 A;  4OX9 M;  3LVV A;  2J7N A;  2QEN A;  3U5Z B;  4L4U A;  1SG9 A;  1HT1 E;  1WJ7 A;  3GLH B;  3QYE A;  3FUX A;  4II7 A;  1G3I A;  3SAW A;  2QPA A;  1N32 M;  1XXH B;  3HU3 A;  3VFD A;  3I04 M;  1GKI A;  3GQ4 A;  2UUA M;  4Z6Y A;  2HL7 A;  3KS4 A;  4LGY A;  3KP0 E;  4QHT A;  2LTU A;  2DZN B;  2R45 A;  1G41 A;  2E5L M;  4LF4 M;  4R3D A;  3GLH A;  2R65 A;  1K3X A;  1YSY A;  1Z5C A;  4B7F A;  3K92 A;  4QOZ C;  4F2L A;  5KO3 A;  1NNJ A;  4XK8 F;  2DKL A;  1NV9 A;  1OIP A;  1GLN A;  1SXJ C;  2D7G A;  2R44 A;  3DZD A;  3LCV B;  4PD2 A;  4K0K M;  1AUA A;  5KPZ A;  1R4G A;  4DR1 M;  2UU9 M;  4CGY B;  2XEP A;  3PNV A;  4GC9 A;  4JI0 M;  1XNR M;  4NXM M;  5FTK A;  1G71 A;  1WIV A;  3TWL A;  3U60 B;  1FNN A;  4LJ8 A;  4MGI E;  2R4J A;  3DOA A;  4BBA A;  3GPX A;  4DV2 M;  1PM5 A;  3L28 A;  4LJ9 A;  2QP9 X;  3TL4 X;  5JI3 E;  1OIZ A;  4GHA A;  3VLF B;  4IJF A;  2DAE A;  1T6O A;  1ZMW A;  2XFS A;  4LGM A;  2K0B X;  5KQ8 A;  3GPY A;  3FRH A;  3UGJ A;  2D7H A;  3KOX E;  4HL4 A;  3SAV A;  3U6E A;  2KHH A;  3L29 A;  3ILK A;  4NL4 H;  1PJS A;  1YLA A;  2DWL A;  4AKH A;  2XLJ A;  1YE9 A;  2XF3 A;  4FCW A;  2LVQ D;  3D8L A;  4CJ6 A;  2CWB A;  2EJS A;  4LJA A;  2C9O A;  4IBD A;  2DAK A;  4DUY M;  3FUW A;  1PJI A;  4LZJ A;  4JI1 M;  4LF7 M;  1TR8 A;  2WZJ A;  5KQD A;  2QBY B;  2R62 A;  3HJQ A;  3IG5 A;  4DR2 M;  3T1H M;  4MM3 B;  3GLF E;  2Z8Y M;  3AOG A;  4LZZ A;  2JY8 A;  1TH4 A;  2C98 A;  2WSF F;  3GRR A;  3M7G A;  1RU3 A;  3E21 A;  1R7R A;  4WUR A;  1XMO M;  3UJN A;  2JY5 A;  3C9P A;  3FUU A;  3SYL A;  1V92 A;  2DWM A;  3J7A S;  4GH9 A;  1QAO A;  1Y8G A;  4X66 M;  4D81 A;  3SHF A;  3VDU A;  1DGB A;  1H6U A;  3HKP A;  2K47 A;  4G4R A;  1OQY A;  1HQY E;  1NY6 A;  2KXE A;  2QZ4 A;  2XFT A;  4PCZ A;  2KRU A;  3UMM A;  3T1Y M;  4BLC A;  4JI6 M;  2BWB A;  1WXQ A;  1BVS A;  2CRU A;  4UN2 B;  2G8L A;  1NNU C;  4IBJ A;  5EP2 A;  1XXH A;  4IBF A;  3JR5 A;  1DO0 A;  3A45 A;  1NV8 A;  1F4I A;  1QVR A;  1UM8 A;  5ITX E;  1VDL A;  1ZAE A;  4FD2 A;  3SAT A;  2Y0T A;  1LV7 A;  4DUZ M;  1GL7 A;  2DZO B;  3FTC A;  3VKG A;  1JR3 E;  3WHK A;  2CHQ A;  4OVZ B;  1OKS A;  2HCB A;  3VK8 A;  2DWN A;  1DGG A;  3MJ5 A;  5FTM A;  5BR8 M;  2OQ4 A;  1MN3 A;  3KS8 A;  4LJ6 A;  4DR7 M;  3K8Z A;  4XBO A;  2LXE A;  5FLX S;  1K3W A;  1DO2 A;  3LQR A;  4I8O A;  1G4A E;  4FVM A;  1X37 A;  4PT5 A;  3VDP A;  1T43 A;  5DNY A;  4L15 A;  1C1K A;  3GLI A;  1HT2 E;  1IBL M;  2L09 A;  2G5G X;  3K9P A;  2ZM6 M;  2VDB B;  2I7N A;  1XWI A;  1TTE A;  3RGP A;  2LNH C;  3FTF A;  1DGH B;  4AQY M;  1OAO C;  1XXH E;  4AKI A;  3CF0 A;  2F5Q A;  3KOY E;  1TDH A;  4NC6 A;  4GMQ A;  3LVW A;  1ZMV A;  1IM2 A;  1QZM A;  5EXX A;  2O01 F;  1PRB A;  2FNA A;  5FSW A;  1WR1 B;  2XGN A;  4MGY E;  3SHG B;  3TWK A;  4LF8 M;  3PVS A;  1XNQ M;  2DAG A;  4LG2 A;  1MU5 A;  1IY1 A;  5A2Q S;  2KZS A;  3Q8X A;  5E6J A;  3WHL A;  5LMU M;  3AL0 C;  3IHP A;  4OVZ A;  2F5N A;  1OFH A;  3A42 A;  1DGF A;  2ZTD A;  5LMN M;  1N78 A;  3C3E A;  2DAI A;  1L2D A;  3L27 A;  4P17 A;  1JQJ C;  2Z4S A;  1ZV1 A;  5F3W A;  2X49 A;  3B7Z A;  4DV7 M;  4KHP M;  2DAM A;  2Q2E B;  3MMP A;  3HJS A;  4AI6 A;  3SMP A;  1VEK A;  4FW9 A;  2JWS A;  2V1C A;  2C5R A;  2LVP C;  1QAQ A;  3F92 A;  4X62 M;  1SXJ B;  1D0K A;  3HHW A;  1IN8 A;  2GQF A;  2DHR A;  3GLH E;  1PJQ A;  1Q02 A;  4AZF A;  3SMS A;  2XH9 A;  5ITY A;  1P3Q Q;  4GIT A;  1NJG A;  2FS1 A;  2C96 A;  1D0M A;  2LHG A;  2M60 A;  3M6A A;  4HLQ A;  3A46 A;  4IBB A;  2W82 A;  3BXW A;  1W5T A;  3THG A;  4ITQ A;  2KNZ A;  3GRU A;  4IBG A;  3LQQ A;  1QZE A;  2JUJ A;  5ITU A;  2QSF X;  3I51 A;  4P16 A;  2XSZ A;  4MH0 E;  3RE8 A;  4GKK M;  3DA1 A;  1CUK A;  3FTE A;  3MHV C;  1HQC A;  2L6O A;  4LFA M;  2LBC A;  3GP1 A;  1SXJ E;  1N36 M;  5ITR A;  2I7P A;  4Z8X A;  5EP3 A;  1NVM A;  1WHC A;  1XMQ M;  1ORY B;  2H5X A;  5C1B A;  5FTJ A;  3HU1 A;  3L2A A;  2KZU A;  3MK6 A;  2XZF A;  2Z4R A;  4NSO B;  1JR3 D;  3CF6 E;  5EP4 A;  4IBE A;  4PDG A;  3UZU A;  3IG8 A;  1L1T A;  4RNA A;  1XHB A;  5L8R F;  2RGH A;  2CV1 A;  3HGI A;  5FTL A;  2WSE F;  1J7K A;  4RKU F;  3HU2 A;  2KNV A;  3K2L A;  4IIW A;  4A3V B;  1T3T A;  4QNR A;  2QNJ A;  3CF2 A;  2CHV A;  4R7G A;  5IT9 S;  2QQ8 A;  4G4O A;  4JI4 M;  2ZAM A;  3GLG B;  1NO1 A;  2R6F A;  3H4M A;  2VF7 A;  4DV6 M;  3ZH9 B;  3PXG A;  1HNX M;  2EO2 A;  3W0F A;  4CHT B;  3FYD A;  3J81 S;  4D82 A;  4DV5 M;  4DR4 M;  2VF8 A;  2Z7J A;  4JYA M;  1I4W A;  2EUC A;  2MJ5 B;  3RGS A;  1VEJ A;  3T6P A;  1Z5A A;  1L1Z A;  3SAR A;  2CEA A;  3NBX X;  4MB7 A;  2OO9 A;  4X65 M;  1R2Y A;  2R46 A;  5BPV A;  3QYB A;  3HJ8 A;  2F5P A;  4FWH A;  4DR6 M;  1Q39 A;  2F4V M;  1JR3 A;  3B74 A;  3UK6 A;  4LY6 A;  1Z59 A;  3HHX A;  1L2B A;  2DXI A;  1GO5 A;  1TH3 A;  3SC3 A;  4RF1 A;  3R9X B;  4AG5 A;  1NSF A;  1IXS A;  5H37 D;  3FE3 A;  2MGW A;  2QCU A;  2DZL A;  4FWD A;  3NWL A;  3FRI A;  4GC5 A;  3T38 A;  4B3S M;  3K1J A;  1TF0 B;  3I01 M;  2BJW A;  3HX3 A;  1HNW M;  1NY5 A;  1TH2 A;  2D7E A;  3E4R A;  2CFO A;  5EP1 A;  5ITQ A;  4JXJ A;  4B3M M;  4NXN M;  3AKZ A;  3LCU A;  1OFI A;  3EIE A;  4M9S A;  3ZCB B;  4RF0 A;  3U61 B;  1G8P A;  2YFQ A;  2ZBK B;  2YQZ A;  3L25 A;  1SXJ A;  1QAM A;  3GPU A;  4M0D A;  3J27 B;  4BB9 A;  2XZU A;  5IWA M;  2K9D A;  4AG6 A;  1VDD A;  4M9Z A;  1AIP C;  1E9S A;  3Q8G A;  2J7O A;  4LJ5 A;  1D0L A;  2ZTC A;  3E9S A;  3FKE A;  2NQ8 C;  4B7H A; 
#chains in the Genus database with same CATH homology
 3GPP A;  5EQT A;  3BOS A;  5EXS A;  1L8Q A;  2L7I A;  2ZAO A;  3FD9 A;  3ZC7 B;  5E26 A;  4JI8 M;  3SAS A;  3KOW E;  5EXP A;  3SFZ A;  1N75 A;  2VQE M;  1HR0 M;  3U6C A;  3QWL A;  1FJG M;  4ZPX A;  3AOE A;  2Y21 A;  1S3S A;  4M9X A;  4I4L A;  4LCB A;  2UUC M;  2V1U A;  4S12 A;  2CUZ A;  3JR4 A;  3C58 A;  1TDZ A;  1J09 A;  5IZ7 D;  1DGH A;  5ITX A;  3T15 A;  1PJJ A;  4B3R M;  1IXR C;  4L16 A;  3I4Y A;  3U5Z A;  8CAT A;  3RFW A;  1G59 A;  2EA0 A;  4EIW A;  3D8B A;  4LJ7 A;  2KW0 A;  3FUV A;  1GL6 A;  1XC8 A;  4FCT A;  4NRV A;  3U6P A;  1IXS B;  3U6M A;  3PNY A;  3TWM A;  1E32 A;  1E94 E;  2UXB M;  1IN7 A;  1NHG C;  2YR0 A;  1ZQ9 A;  3GQ5 A;  2F5O A;  3OTO M;  2BJV A;  4JN6 A;  2CHG A;  4FCV A;  2C9C A;  3EIH A;  2YNM D;  1N33 M;  2CV2 A;  4L8R C;  3GRV A;  2VII A;  4KO8 A;  3KFU G;  2V6Z M;  4AKG A;  4W5W A;  4L78 A;  2ERC A;  4KLN A;  4B7G A;  4DV3 M;  1OJL A;  2HKJ A;  4KOD A;  4NSR A;  1N77 A;  4DR3 M;  5JI2 E;  3AFH A;  1GVN A;  2Y0Q A;  4CIS A;  2FFJ A;  3PFI A;  3KSX A;  4B08 A;  2KRK A;  2FOI C;  4NOO B;  3JAM S;  3J80 S;  4MGH A;  2BNK A;  1EE8 A;  4MGZ E;  4IJE A;  1IN6 A;  1KFV A;  3I4V A;  1IY2 A;  5ITT A;  4DV1 M;  1IBM M;  4LF6 M;  1N34 M;  4LFB M;  2F5S A;  4TUW A;  3LMM A;  1QQW A;  4IBK A;  1Z6T A;  2KEB A;  2DVW B;  1YUB A;  1QYR A;  4LRS A;  4LF5 M;  3KVW A;  4G6Z A;  3W0L B;  2R18 A;  4JI3 M;  3A98 B;  1IBK M;  2UXC M;  4B3T M;  2JA2 A;  2Z3X A;  7CAT A;  2CE7 A;  2AHM A;  4GHL A;  4YHH M;  2LWX A;  3GLI B;  4LRT A;  2X4A A;  4QNM A;  5FTN A;  3U60 A;  1QAN A;  3KXE C;  1K82 A;  4LJ4 A;  4REZ A;  5KPT A;  3GLF A;  5C18 A;  3HHZ A;  5KPR A;  3KSJ A;  1MX0 A;  3R8F A;  1D2N A;  4OU7 A;  3TQS A;  4GKJ M;  3GQ3 A;  4DR5 M;  3KDS E;  4MGK E;  3SAU A;  4OW0 A;  1IQP A;  4X64 M;  3QAU A;  4YY3 M;  5IRE B;  1IN4 A;  3DFZ A;  4IBC A;  3TPZ A;  4G4N A;  1I94 M;  1Q3B A;  2Y20 A;  1IN5 A;  1E9R A;  3HHY A;  2LH0 A;  1Q3C A;  4PDI A;  1HNZ M;  1W5S A;  3SBJ A;  4XGI A;  3VK7 A;  2R4E A;  1R6B X;  3TE6 A;  4JI2 M;  3KW6 A;  2FE8 A;  2L7H A;  4QOS A;  3J2P B;  4FWG A;  4GIP A;  3GRY A;  3U6L A;  2C99 A;  1R2Z A;  1J5E M;  3GLG A;  4AW4 A;  4G4Q A;  2RGO A;  3U6O A;  2HHH M;  2H1R A;  3AOE C;  4GRI A;  4I81 A;  2UUB M;  1NHW C;  3GO8 A;  2O5R A;  2ZAN A;  1NJF A;  2QBY A;  2VQF M;  4JI5 M;  1KSF X;  2RKO A;  3KOZ E;  3AJI B;  4D80 A;  5DYI A;  2OPF A;  3J7B A;  3U61 A;  4LFC M;  2A5Y B;  5EJC A;  1TGU A;  2M5Z A;  2UXD M;  3FYC A;  5GKN A;  2KA6 B;  3NBI A;  4LF9 M;  4I5S A;  4QHS A;  1Z5B A;  1IXZ A;  1L2C A;  4JV5 M;  3FUT A;  3HWS A;  1SXJ D;  4DV4 M;  3CTW B;  2XSZ D;  5DYG A;  3KP1 E;  3U6S A;  4DV0 M;  3M0E A;  3SYK A;  3FTD A;  2CV0 A;  2P5T A;  3B9P A;  3GLF B;  2DWZ B;  4IBI A;  3AV0 A;  3L26 A;  3U6Q A;  3VKH A;  5EXT A;  4M0W A;  1KYI A;  4WW0 A;  2X8A A;  1IY0 A;  4OX9 M;  3LVV A;  2J7N A;  2QEN A;  3U5Z B;  4L4U A;  1HT1 E;  3GLH B;  3FUX A;  4II7 A;  1G3I A;  3SAW A;  2QPA A;  1N32 M;  1XXH B;  3HU3 A;  3VFD A;  1GKI A;  3GQ4 A;  2UUA M;  4Z6Y A;  2HL7 A;  3KS4 A;  4LGY A;  3KP0 E;  4QHT A;  2DZN B;  2R45 A;  1G41 A;  2E5L M;  4LF4 M;  4R3D A;  3GLH A;  2R65 A;  1K3X A;  1YSY A;  1Z5C A;  4B7F A;  3K92 A;  4QOZ C;  1NNJ A;  5KO3 A;  1SXJ C;  2D7G A;  1GLN A;  4K0K M;  3DZD A;  4PD2 A;  5KPZ A;  2UU9 M;  4DR1 M;  4CGY B;  2XEP A;  3PNV A;  4GC9 A;  4JI0 M;  1XNR M;  4NXM M;  5FTK A;  3TWL A;  3U60 B;  1FNN A;  4LJ8 A;  4MGI E;  2R4J A;  3DOA A;  4BBA A;  3GPX A;  4DV2 M;  1PM5 A;  3L28 A;  4LJ9 A;  2QP9 X;  3TL4 X;  5JI3 E;  4GHA A;  3VLF B;  4IJF A;  2XFS A;  4LGM A;  5KQ8 A;  3GPY A;  3UGJ A;  2D7H A;  3KOX E;  4HL4 A;  3SAV A;  3U6E A;  3L29 A;  3ILK A;  4NL4 H;  4AKH A;  2DWL A;  2XLJ A;  1YE9 A;  2XF3 A;  4FCW A;  3D8L A;  4DUY M;  4JI7 M;  4NRW A;  1PJI A;  4LJA A;  2C9O A;  4IBD A;  4LF7 M;  3FUW A;  4LZJ A;  4JI1 M;  5KQD A;  2QBY B;  2R62 A;  3HJQ A;  3IG5 A;  4DR2 M;  3T1H M;  4MM3 B;  3AOG A;  4LZZ A;  1TH4 A;  2C98 A;  3GRR A;  3M7G A;  4WUR A;  1R7R A;  1XMO M;  3UJN A;  3FUU A;  3SYL A;  2DWM A;  3J7A S;  4GH9 A;  1QAO A;  4X66 M;  4D81 A;  3SHF A;  3VDU A;  1DGB A;  1H6U A;  3HKP A;  2K47 A;  4G4R A;  1HQY E;  1NY6 A;  2KXE A;  2QZ4 A;  2XFT A;  4PCZ A;  2KRU A;  3UMM A;  3T1Y M;  4BLC A;  4JI6 M;  1WXQ A;  2G8L A;  1NNU C;  4IBJ A;  5EP2 A;  1XXH A;  4IBF A;  3JR5 A;  1DO0 A;  3A45 A;  1QVR A;  1UM8 A;  5ITX E;  3SAT A;  1ZAE A;  4FD2 A;  2Y0T A;  1LV7 A;  4DUZ M;  1GL7 A;  2DZO B;  3FTC A;  3VKG A;  3WHK A;  2CHQ A;  4OVZ B;  2HCB A;  3VK8 A;  2DWN A;  1DGG A;  3MJ5 A;  5FTM A;  5BR8 M;  2OQ4 A;  3KS8 A;  4LJ6 A;  4DR7 M;  3K8Z A;  4XBO A;  2LXE A;  5FLX S;  1K3W A;  1DO2 A;  3LQR A;  4I8O A;  1G4A E;  4FVM A;  1X37 A;  4PT5 A;  3VDP A;  5DNY A;  4L15 A;  1C1K A;  3GLI A;  1HT2 E;  1IBL M;  2L09 A;  2G5G X;  2ZM6 M;  2I7N A;  1XWI A;  3RGP A;  2LNH C;  3FTF A;  1DGH B;  4AQY M;  4AKI A;  3CF0 A;  2F5Q A;  3KOY E;  1TDH A;  4GMQ A;  3LVW A;  1IM2 A;  1QZM A;  5EXX A;  2FNA A;  5FSW A;  2XGN A;  4MGY E;  3SHG B;  3TWK A;  4LF8 M;  3PVS A;  1XNQ M;  4LG2 A;  1MU5 A;  1IY1 A;  5A2Q S;  2KZS A;  3Q8X A;  5E6J A;  3WHL A;  5LMU M;  3AL0 C;  4OVZ A;  2F5N A;  1OFH A;  3A42 A;  1DGF A;  5LMN M;  1N78 A;  1L2D A;  3L27 A;  1JQJ C;  2Z4S A;  5F3W A;  2X49 A;  4DV7 M;  4KHP M;  2Q2E B;  3HJS A;  4AI6 A;  3SMP A;  4FW9 A;  2V1C A;  2C5R A;  1QAQ A;  4X62 M;  1SXJ B;  3HHW A;  1IN8 A;  2DHR A;  4AZF A;  3SMS A;  2XH9 A;  5ITY A;  4GIT A;  1NJG A;  2C96 A;  2M60 A;  3M6A A;  4HLQ A;  3A46 A;  4IBB A;  2W82 A;  3THG A;  1W5T A;  4ITQ A;  3GRU A;  4IBG A;  3LQQ A;  5ITU A;  3I51 A;  4P16 A;  2XSZ A;  4MH0 E;  3RE8 A;  4GKK M;  3DA1 A;  3FTE A;  3MHV C;  1HQC A;  2L6O A;  4LFA M;  3GP1 A;  1SXJ E;  1N36 M;  5ITR A;  2I7P A;  4Z8X A;  5EP3 A;  1NVM A;  1XMQ M;  1ORY B;  5C1B A;  5FTJ A;  3HU1 A;  3L2A A;  2KZU A;  3MK6 A;  2XZF A;  2Z4R A;  4NSO B;  1JR3 D;  3CF6 E;  5EP4 A;  4IBE A;  4PDG A;  3UZU A;  3IG8 A;  1L1T A;  4RNA A;  1XHB A;  2RGH A;  2CV1 A;  3HGI A;  5FTL A;  1J7K A;  3HU2 A;  3K2L A;  4IIW A;  4A3V B;  1T3T A;  4QNR A;  3CF2 A;  2CHV A;  4R7G A;  5IT9 S;  4G4O A;  4JI4 M;  2ZAM A;  3GLG B;  3H4M A;  4DV6 M;  3ZH9 B;  3PXG A;  1HNX M;  2EO2 A;  3W0F A;  4CHT B;  3FYD A;  3J81 S;  4D82 A;  4DV5 M;  4DR4 M;  2Z7J A;  4JYA M;  1I4W A;  2EUC A;  3RGS A;  1L1Z A;  1Z5A A;  3SAR A;  2CEA A;  4MB7 A;  4X65 M;  1R2Y A;  2R46 A;  5BPV A;  2F5P A;  3HJ8 A;  4FWH A;  4DR6 M;  1Q39 A;  2F4V M;  1JR3 A;  3UK6 A;  4LY6 A;  1Z59 A;  3HHX A;  1L2B A;  2DXI A;  1TH3 A;  3SC3 A;  4RF1 A;  3R9X B;  4AG5 A;  1NSF A;  5H37 D;  2QCU A;  4FWD A;  3NWL A;  4GC5 A;  3T38 A;  4B3S M;  3K1J A;  2BJW A;  1HNW M;  1NY5 A;  1TH2 A;  2D7E A;  3E4R A;  2CFO A;  5EP1 A;  5ITQ A;  4JXJ A;  4B3M M;  4NXN M;  3AKZ A;  1OFI A;  3EIE A;  4M9S A;  3ZCB B;  4RF0 A;  3U61 B;  1G8P A;  2YFQ A;  2ZBK B;  2YQZ A;  3L25 A;  1SXJ A;  1QAM A;  3GPU A;  4M0D A;  3J27 B;  4BB9 A;  2XZU A;  5IWA M;  4AG6 A;  1VDD A;  4M9Z A;  1E9S A;  2J7O A;  4LJ5 A;  3U6D A;  3E9S A;  3FKE A;  2NQ8 C;  4B7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...