4DR5M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr5M02
4PD2A 4JI7M 2XZUA 4G4QA 1J5EM 2UUCM 4DV6M 4DR6M 2UXBM 1L1TA 4LF6M 4B3RM 4LF8M 3U6MA 4JI2M 5LMNM 2Q2EB 5BR8M 4G4NA 3A42A 1XC8A 3TWLA 4X66M 5ITTA 3A45A 3U6PA 1N34M 4K0KM 2HKJA 2F5SA 1HNWM 3JAMS 3SAWA 4JI3M 3GP1A 3T1HM 1KFVA 4G4OA 4DR1M 4DR4M 4DV0M 3J7AS 1HNXM 3C58A 1HR0M 4LFBM 1Z59A 2OPFA 1R2YA 2HHHM 1N32M 4JI0M 1HNZM 2UXDM 5ITXE 1L1ZA 2F5PA 3GQ4A 4NXMM 4DV4M 3SAUA 3VK8A 4DR5M 1IBLM 1TDHA 1XMQM 1XNRM 4LFAM 2F5QA 3GPYA 3U6CA 1N33M 1XMOM 4NXNM 3SASA 4JI4M 1Z5AA 5LMUM 4B3SM 4AQYM 4JI6M 2F4VM 5IT9S 1MX0A 3J81S 3T1YM 3A46A 2UU9M 4DV7M 1IBKM 1K3WA 4KHPM 3JR4A 2EA0A 2XZFA 4G4RA 1Z5BA 4DV2M 3GQ3A 4JI5M 3TWKA 4DR2M 4LFCM 1MU5A 1Q39A 4OX9M 4CISA 4NRWA 3GQ5A 5FLXS 4DR3M 1Q3BA 2UUAM 3SATA 4NRVA 3SBJA 2UXCM 1I94M 1L2DA 3W0FA 1IBMM 3SAVA 4X62M 2F5NA 5A2QS 2ZBKB 4X65M 4MB7A 4YY3M 4GKKM 3U6DA 1PJJA 4JI1M 2UUBM 3DOAA 5IWAM 1K82A 5ITYA 5ITXA 4B3TM 3GPXA 4PCZA 3U6LA 2F5OA 3OTOM 4PDGA 4JV5M 1K3XA 3GPUA 2VQFM 3U6EA 1TDZA 4DR7M 1PJIA 3GO8A 1EE8A 5ITRA 4YHHM 3J80S 3SARA 4DV1M 2OQ4A 4LF7M 1L2CA 5ITUA 2ZM6M 3U6SA 4DUYM 4LF9M 1L2BA 4GKJM 3JR5A 4PDIA 4JI8M 1R2ZA 5ITQA 4LF4M 2VQEM 1Z5CA 3TWMA 2E5LM 1N36M 4X64M 4LF5M 3VK7A 3U6QA 3GPPA 4B3MM 4DV5M 1FJGM 4JYAM 1Q3CA 1PM5A 3U6OA 1XNQM 1NNJA 4ITQA 4DV3M 4DUZM
chains in the Genus database with same CATH superfamily
4L6V6 3THGA 4G4QA 2Y0TA 1J5EM 1ZMUA 2FS1A 4W5WA 2LWXA 2X8AA 3U60A 4LF6M 4IBJA 5EP1A 3U6MA 4MGKE 2XSZA 4CHTB 2CUZA 1RU3A 1ZAEA 1CUKA 4M0DA 1NHWC 4NSRA 3NBIA 3TWLA 3B7NA 5ITTA 2ZANA 3FD9A 3CF0A 3E4RA 4R71A 3M0EA 5GKNA 4HEOA 2UXDM 3JAMS 3CTWB 1IY2A 4MM3B 4JI3M 3LMMA 4A3VB 3SAWA 3D8BA 4FD2A 4LJ8A 2DZLA 3GRVA 4LFBM 3TPZA 3R8FA 3IG5A 1QQWA 4NC6A 1DGHB 3SMSA 2WSEF 2QBYB 3FUVA 1JR3D 3FTCA 3LW5F 2F5PA 4BB9A 2CHVA 3SAUA 2R18A 2CFOA 3GLHB 4ZPXA 3VLFB 5FTJA 1TDHA 1W5TA 2JXNA 3LCUA 4Z8XA 1QANA 3L2AA 3KOWE 3MHVC 2F5QA 2WZJA 3U6CA 1N33M 4NXNM 2FH0A 2MGWA 4I4LA 3SASA 4JI4M 1Z5AA 5IT9S 1XXHA 1NY5A 4AQYM 4JI6M 2LVNC 2Z7JA 3IECA 2DHRA 3B9PA 3J81S 1G71A 3FKEA 3FRHA 4Y28F 3SMPA 2C99A 1HQYE 2L09A 4KHPM 1DGHA 3E46A 2C9CA 3FUUA 3HHXA 3QWLA 4LRTA 1VDLA 4LJ7A 4JXJA 3IHPA 3ZCBB 4DR2M 3B74A 3RGSA 4R7GA 1WR1B 3AOEA 1OJLA 2CV0A 4FWHA 5FSWA 1Q39A 1HQCA 4OX9M 4NRWA 3GLFE 4DR3M 3C3EA 3T6PA 2AHMA 3KSXA 1GL6A 4HLQA 3B7QA 4RNAA 1DGFA 4L16A 3W0FA 1NO1A 1NV8A 5E26A 2LVOC 1QZMA 1ZMWA 2XFTA 2YNMD 5E6JA 2KW0A 4DBGB 1FNNA 2CV1A 3FTEA 4GKKM 2LTUA 2KEBA 3Q8XA 2J7OA 3U6DA 1PJJA 5EXSA 4NL4H 5IWAM 4D80A 2L4FA 3KOXE 2LVAA 5ITXA 4LJ6A 3U6LA 4IJEA 1K3XA 3I04M 3DFZA 3U61A 2KRKA 1PJIA 2GQFA 1EE8A 5ITRA 4RF0A 4YHHM 3J80S 2JUJA 3M6AA 1NJGA 2OQ4A 2I7NA 1WHCA 2XSZD 3ZQJA 5ITUA 4AZFA 4QNRA 3DZDA 1L2BA 4GKJM 3UMMA 3UZUA 3PXGA 3GLGB 1OIPA 1GL7A 2FE8A 4LF4M 2E5LM 2QPAA 2P5TA 2LBCA 5FTKA 3RE8A 4QOSA 1VDDA 3AOEC 3U6QA 3L28A 2O5RA 4LJ9A 2ERCA 1Q3CA 2DHYA 4GC5A 1PM5A 1QZEA 2M60A 4QOZC 1ORYB 1NNJA 2EUCA 4PD2A 1C7YA 1KYIA 2UUCM 1J7KA 4FW9A 4DV6M 1N77A 4DR6M 4B3RM 1SXJA 3KS4A 3HHYA 1VEJA 4IIWA 4WURA 5KPZA 4XK8F 3EIHA 1MJGM 4P16A 2LHGA 3MMPA 1UFZA 3H4MA 2FNAA 4JI2M 4LJ4A 1OQYA 5BR8M 3U60B 4RKUF 3CGWA 3K9PA 2N35A 2YQZA 4AW4A 2XH9A 3FUXA 2VF7A 2EKKA 2VF8A 1N34M 4CJ6A 2ZTCA 5JI3E 1HNWM 1AUAA 3GP1A 1KFVA 4FVMA 2DVWB 4LGMA 1PGYA 3BBZA 2R65A 4DR4M 4M9XA 2XGNA 3C58A 2L7IA 1YUBA 3J27B 4IBCA 1TH2A 2WSFF 1IM2A 2RGOA 4JI0M 3I4VA 3KP1E 4WP2A 1IN4A 3L29A 4LGYA 1HNZM 2V1UA 1D0KA 4NXMM 3FTFA 4DR5M 3HU3A 3AKZA 2JZ0A 1XB2B 2DAIA 2JA2A 3MK6A 4AG6A 1OFHA 1IQPA 2DAGA 4LZJA 2XEPA 4BBAA 1WIVA 4GC9A 5EXXA 1OAIA 4OU7A 1NVMA 3IG8A 3W0LB 5LMUM 5F3WA 4B3SM 2MR9A 1JQJC 1GABA 2K0BX 1DV0A 3V76A 2BWBA 2J5YA 1XXHB 2QQ8A 1NHGC 1SXJC 2XFSA 4G4RA 1YSYA 3KFUG 1Z5BA 4GHLA 3AV0A 3BOSA 5FTMA 2DWZB 1ZMVA 3A98B 4LCBA 4AG5A 2XF3A 2MROB 3CF6E 1AIPC 1MU5A 3NBXX 3J7BA 2DXIA 1GVNA 4F2LA 2CWBA 2OO9A 1PRBA 3C9PA 5EP4A 3FRIA 3GQ5A 3EIEA 1Q3BA 2LNHC 1VEKA 2QSFX 2DENA 2JWSA 3PVSA 1QUSA 1G8PA 1L2DA 3SC3A 3FE3A 1IBMM 2V6ZM 3KOYE 4FCWA 2X4AA 2ZBKB 2O01F 2DNAA 3SFZA 1E32A 4F1IA 2JP7A 3SYKA 5KPTA 2K6BA 2DWMA 1J09A 2G8LA 2LHCA 1Y8GA 2Y0QA 1MN3A 4B08A 5EXPA 2RKOA 1V33A 1D0LA 2F5OA 3HHWA 4LZZA 4PDGA 3GPUA 3GLHE 2HWJA 3LQQA 4JN6A 2VQFM 3U6EA 2Y20A 4IBEA 2DAEA 2LVQD 1HT1E 4EIWA 2KNVA 3K8ZA 4IBGA 5DFLA 4HL4A 1YLAA 3SARA 2DI0A 4XBOA 3L27A 1TTEA 3U61B 3U6SA 2QCUA 2R4EA 3I4YA 3HHZA 4NSOB 3JR5A 4PDIA 1R2ZA 4B7HA 5ITQA 3HY5A 3VKHA 3TWMA 2CHQA 4X64M 4LF5M 2HL7A 2RGHA 5EXTA 3VK7A 2QNJA 3VFDA 4B3MM 2DZNB 3HJQA 4P17A 1EIJA 1FJGM 5DYGA 3K1JA 2RRUA 1TR8A 3U6OA 3HGIA 4II7A 2Z4SA 5FTNA 2Y21A 1DO0A 4JI7M 2XZUA 3HX3A 5EP3A 1JR3E 3E9SA 3GLFA 1IFYA 2UXBM 1T3TA 1L1TA 1D2NA 1IN8A 1V34A 4FWDA 1BVSA 3W67A 1LV7A 4LF8M 3HU1A 2K9DA 5LMNM 1IXRC 1SXJB 3KP0E 4G4NA 1G41A 3K92A 3A42A 2R0IA 1XC8A 1LTMA 3E21A 2ZAOA 2BWEA 3U6PA 1Q02A 2HKJA 3KVWA 5C1BA 4M9ZA 3T1HM 1QAOA 3WHKA 1OFIA 4G4OA 3F92A 3VDPA 1HT2E 1HR0M 4QNMA 1IN7A 1IN6A 2D7GA 4GMQA 1JR3A 1Z59A 4WW0A 1R2YA 4LRSA 5KQDA 2QZ4A 4M0WA 1WGNA 1L1ZA 5EP2A 4DV4M 3VK8A 4ANRA 1QUTA 3PNYA 1G59A 1IBLM 4AKGA 5EJCA 5H37D 1H6UA 2CE7A 2YR0A 3HWSA 3AOGA 2W82A 2Z3XA 2R45A 4IBFA 3WHLA 3GLGE 1QDTA 2L6OA 3U5ZB 2F4VM 1MX0A 1TF0B 3HJ8A 3AJIB 5BPVA 2HAKA 5DNYA 1G3IA 2UU9M 2B3TA 4G6ZA 2OOBA 3M7GA 4PT5A 3D8LA 2MH8A 1S3SA 2R44A 3DA1A 1NY6A 2EA0A 4OVZA 2FFJA 4IBIA 2YFQA 3LVVA 4IBKA 4UN2B 5L8RF 4JI5M 3AL0C 3FYDA 4GHAA 4TUWA 1QVRA 2CV2A 1E94E 1DO2A 2C98A 3K9OA 2EKFA 2BJWA 4CISA 1WJ7A 4KT0F 1NJFA 3AFHA 3U5ZA 3HKPA 3SATA 3I51A 4LJAA 4D82A 1ZV1A 1I94M 1D0MA 1OKSA 1TH3A 4AKIA 1P3QQ 1WXQA 2CEAA 1R6BX 3FTDA 4X62M 3SYLA 2DWLA 4X65M 2QP9X 4YY3M 1PJQA 4L78A 3W68A 5JI2E 1DGBA 2XLJA 2X49A 2C96A 2NQ8C 4FWGA 4L4UA 3RGPA 5KO3A 3GLIE 1GO5A 4IJFA 4PCZA 3GPXA 2HCBA 4JV5M 1SG9A 3GRUA 1GJTA 4DR7M 1N32M 1IXSA 4DV1M 1YE9A 4LF7M 1L2CA 2ZM6M 4DUYM 1C1KA 1GKIA 4FCTA 3ZH9B 7CATA 4LF9M 4LJ5A 3T15A 1QAMA 2APLA 4JI8M 4B7GA 4GRIA 4GIPA 1XXHE 2DAMA 4AKHA 1N36M 2G3QA 4R3DA 2KHHA 3UK6A 8CATA 4L15A 3GLIA 4DV5M 1W5SA 1VEGA 2EO2A 1IN5A 3GRRA 2LVPC 2VDBB 4I81A 2BNKA 2DZOB 4CIZA 2L7HA 1XWIA 1WGLA 2OOAA 1OTRA 2Z4RA 2KRUA 3J2PB 3LQRA 4DV3M 4KO8A 4DUZM 1L8QA 2QENA 1QAQA 1QYRA 5FTLA 4AI6A 2KA6B 2R4JA 3L25A 2JY5A 4GITA 1T43A 2KNAA 2J7NA 1SXJD 3SHGB 2ZAMA 4REZA 4NOOB 3GRYA 3GLFB 2Q2EB 1TH4A 4GH9A 2JY6B 2JZ1A 2KNZA 3TQSA 4RF1A 1F4IA 2BJVA 4X66M 3A45A 2H1RA 4I8OA 2LXEA 4K0KM 4M9SA 2F5SA 3QYBA 3C3DA 4IBDA 2C5RA 3HZJA 1T6OA 2GNOA 1IXZA 1X37A 4DR1M 3B89A 5KPRA 4DV0M 2QBYA 3J7AS 1HNXM 1UM8A 2DKLA 2R6FA 4B7FA 1N78A 1JB0F 3MJ5A 4FCVA 2MJ5B 3TL4X 3GLHA 2OPFA 3R9XB 2HHHM 2G5GX 3B7ZA 5C18A 4MGYE 5ITXE 3GQ4A 4KLNA 1A5TA 3LCVB 5KQ8A 1XMQM 1XNRM 2QHOB 3PFIA 4Z6YA 4LFAM 4LG2A 4MGHA 3GPYA 1XMOM 1HJPA 4QHSA 3ZC7B 1V92A 2CP8A 1PJTA 1G4AE 4I5SA 3VDUA 1QDRA 3HJSA 3RFWA 3A46A 3T38A 2JY7A 1ZQ9A 4DV7M 3T1YM 1IBKM 5IZ7D 1XHBA 4OW0A 2CRUA 1K3WA 3JR4A 2XZFA 1OAOC 2JNHA 3KXEC 2Z8YM 3KDSE 2KZSA 3UGJA 4DV2M 3GQ3A 2K47A 3TWKA 3HU2A 3QAUA 4OVZB 4LFCM 3KSJA 2KXEA 3I01M 4MH0E 5IREB 4KODA 2DAKA 5FLXS 3BXWA 1SXJE 1EFUB 4NRVA 3SBJA 2KZUA 1R5LA 2DWNA 2UXCM 2D7HA 1E9RA 1NSFA 1IY1A 2R46A 3PNVA 3SHFA 2A5YB 2L4EA 1R4GA 1DGGA 3SAVA 2F5NA 4BLCA 5A2QS 2WSCF 2ZTDA 1OIZA 3ILKA 4MB7A 2I7PA 2KDLA 2H5XA 4XGIA 4GEWA 4JI1M 2UUBM 3DOAA 4L8RC 3KS8A 3UJNA 2VIIA 4D81A 3TE6A 5ITYA 4QHTA 1K82A 4B3TM 3OTOM 2D7EA 1Z6TA 3Q8GA 3L26A 2M5ZA 1TDZA 3GO8A 1E9SA 4LY6A 4G3OA 3FYCA 5EQTA 2CHGA 3LVWA 2FOIC 3CF2A 1PJSA 2V1CA 3GLGA 1NNUC 1GLNA 4CGYB 4Q7JA 2LH0A 1IXSB 2O25A 3FUWA 1N75A 1KSFX 2EJSA 3KW6A 5DYIA 1I4WA 4MGIE 1VG5A 3VKGA 2VQEM 1Z5CA 4IBBA 1GJSA 3NWLA 3GPPA 1IY0A 1VQ1A 3KOZE 2JY8A 3H4JA 1NV9A 4JYAM 1R7RA 3K2LA 2C9OA 3FUTA 1XNQM 3QYEA 4MGZE 3GLIB 4ITQA 2UUAM 1TGUA 2L2DA 2R62A 4S12A
chains in the Genus database with same CATH topology
3THGA 4G4QA 2Y0TA 1J5EM 4W5WA 2LWXA 2X8AA 3U60A 4LF6M 4IBJA 5EP1A 3U6MA 4MGKE 2XSZA 4CHTB 2CUZA 1ZAEA 4M0DA 1NHWC 4NSRA 3NBIA 3TWLA 5ITTA 2ZANA 3FD9A 3CF0A 3E4RA 3M0EA 5GKNA 2UXDM 3JAMS 3CTWB 1IY2A 4MM3B 4JI3M 3LMMA 4A3VB 3SAWA 3D8BA 4FD2A 4LJ8A 3GRVA 4LFBM 3TPZA 3R8FA 3IG5A 1QQWA 1DGHB 3SMSA 2QBYB 3FUVA 1JR3D 3FTCA 2F5PA 4BB9A 2CHVA 3SAUA 2R18A 2CFOA 3GLHB 4ZPXA 3VLFB 5FTJA 1TDHA 1W5TA 4Z8XA 1QANA 3L2AA 3KOWE 3MHVC 2F5QA 1N33M 3U6CA 4NXNM 4I4LA 3SASA 4JI4M 1Z5AA 5IT9S 1XXHA 1NY5A 4AQYM 4JI6M 2Z7JA 2DHRA 3B9PA 3J81S 3FKEA 3SMPA 2C99A 1HQYE 2L09A 4KHPM 1DGHA 2C9CA 3FUUA 3HHXA 3QWLA 4LRTA 4LJ7A 4JXJA 3ZCBB 4DR2M 3RGSA 4R7GA 3AOEA 1OJLA 2CV0A 4FWHA 5FSWA 1Q39A 1HQCA 4OX9M 4NRWA 4DR3M 2AHMA 3KSXA 1GL6A 4HLQA 4RNAA 1DGFA 4L16A 3W0FA 5E26A 1QZMA 2XFTA 2YNMD 5E6JA 2KW0A 1FNNA 2CV1A 3FTEA 4GKKM 2KEBA 3Q8XA 2J7OA 3U6DA 1PJJA 5EXSA 4NL4H 5IWAM 4D80A 3KOXE 5ITXA 4LJ6A 3U6LA 4IJEA 1K3XA 3DFZA 3U61A 2KRKA 1PJIA 1EE8A 5ITRA 4RF0A 4YHHM 3J80S 3M6AA 1NJGA 2OQ4A 2I7NA 2XSZD 5ITUA 4AZFA 4QNRA 3DZDA 1L2BA 4GKJM 3UMMA 3UZUA 3PXGA 3GLGB 1GL7A 2FE8A 4LF4M 2E5LM 2QPAA 2P5TA 5FTKA 3RE8A 4QOSA 1VDDA 3AOEC 3U6QA 3L28A 2O5RA 4LJ9A 2ERCA 1Q3CA 4GC5A 1PM5A 2M60A 4QOZC 1ORYB 1NNJA 2EUCA 4PD2A 1KYIA 2UUCM 1J7KA 4FW9A 4DV6M 1N77A 4DR6M 4B3RM 1SXJA 3KS4A 3HHYA 4IIWA 4WURA 5KPZA 3EIHA 4P16A 4JI2M 3H4MA 2FNAA 4LJ4A 5BR8M 3U60B 4AW4A 2YQZA 2XH9A 3FUXA 1N34M 5JI3E 1HNWM 3GP1A 1KFVA 4FVMA 2DVWB 4LGMA 2R65A 4DR4M 4M9XA 2XGNA 3C58A 2L7IA 1YUBA 3J27B 4IBCA 1TH2A 1IM2A 2RGOA 4JI0M 3I4VA 3KP1E 1HNZM 1IN4A 3L29A 4LGYA 2V1UA 4NXMM 3FTFA 4DR5M 3HU3A 3AKZA 3MK6A 2JA2A 4AG6A 1OFHA 1IQPA 4LZJA 2XEPA 4BBAA 5EXXA 4GC9A 4OU7A 5LMUM 1NVMA 3IG8A 3W0LB 5F3WA 4B3SM 1JQJC 1XXHB 1NHGC 1SXJC 2XFSA 4G4RA 1YSYA 3KFUG 1Z5BA 4GHLA 3AV0A 3BOSA 5FTMA 2DWZB 3A98B 4AG5A 4LCBA 2XF3A 3CF6E 1MU5A 3J7BA 2DXIA 1GVNA 5EP4A 3GQ5A 3EIEA 1Q3BA 2LNHC 3PVSA 1G8PA 1L2DA 3SC3A 1IBMM 2V6ZM 3KOYE 4FCWA 2X4AA 2ZBKB 3SFZA 1E32A 3SYKA 5KPTA 2DWMA 1J09A 2G8LA 2Y0QA 4B08A 5EXPA 2RKOA 2F5OA 3HHWA 4LZZA 4PDGA 3GPUA 4JN6A 2VQFM 3LQQA 3U6EA 2Y20A 4IBEA 1HT1E 4EIWA 3K8ZA 4IBGA 3SARA 4HL4A 4XBOA 3L27A 3U61B 3U6SA 2QCUA 2R4EA 3I4YA 3HHZA 4NSOB 3JR5A 4PDIA 1R2ZA 4B7HA 5ITQA 3VKHA 3TWMA 2CHQA 4X64M 4LF5M 2HL7A 2RGHA 5EXTA 3VK7A 3VFDA 4B3MM 2DZNB 3HJQA 1FJGM 5DYGA 3K1JA 3U6OA 3HGIA 4II7A 2Z4SA 5FTNA 2Y21A 1DO0A 4JI7M 2XZUA 5EP3A 3E9SA 3GLFA 2UXBM 1T3TA 1L1TA 1D2NA 1IN8A 4FWDA 4LF8M 1LV7A 3HU1A 5LMNM 1IXRC 1SXJB 3KP0E 4G4NA 1G41A 3K92A 3A42A 1XC8A 2ZAOA 3U6PA 2HKJA 3KVWA 5C1BA 4M9ZA 3T1HM 1QAOA 3WHKA 1OFIA 4G4OA 3VDPA 1HT2E 1HR0M 4QNMA 1IN7A 1IN6A 2D7GA 4GMQA 1JR3A 1Z59A 4WW0A 1R2YA 4LRSA 5KQDA 2QZ4A 4M0WA 1L1ZA 5EP2A 4DV4M 3VK8A 3PNYA 1G59A 1IBLM 4AKGA 5EJCA 5H37D 1H6UA 2CE7A 2YR0A 3HWSA 3AOGA 2W82A 2Z3XA 2R45A 4IBFA 3WHLA 2L6OA 3U5ZB 2F4VM 1MX0A 3HJ8A 3AJIB 5BPVA 5DNYA 1G3IA 2UU9M 4G6ZA 3M7GA 4PT5A 3D8LA 3DA1A 1S3SA 2EA0A 1NY6A 4OVZA 2FFJA 4IBIA 2YFQA 3LVVA 4IBKA 4JI5M 3AL0C 3FYDA 4GHAA 4TUWA 1QVRA 2CV2A 1E94E 1DO2A 2C98A 4CISA 2BJWA 1NJFA 3AFHA 3U5ZA 3HKPA 3SATA 3I51A 4LJAA 4D82A 1I94M 1TH3A 4AKIA 1WXQA 2CEAA 1R6BX 3FTDA 4X62M 3SYLA 2DWLA 4X65M 2QP9X 4YY3M 4L78A 5JI2E 1DGBA 2XLJA 2X49A 2C96A 2NQ8C 4FWGA 4L4UA 3RGPA 5KO3A 4IJFA 4PCZA 3GPXA 2HCBA 4JV5M 3GRUA 4DR7M 1N32M 4DV1M 1YE9A 4LF7M 1L2CA 2ZM6M 4DUYM 1C1KA 1GKIA 4FCTA 3ZH9B 7CATA 4LF9M 4LJ5A 3T15A 1QAMA 4JI8M 4B7GA 4GRIA 4GIPA 4AKHA 1N36M 4R3DA 3UK6A 8CATA 4L15A 3GLIA 4DV5M 1W5SA 2EO2A 1IN5A 3GRRA 4I81A 2BNKA 2DZOB 2L7HA 1XWIA 2Z4RA 2KRUA 3J2PB 3LQRA 4DV3M 4KO8A 4DUZM 1L8QA 2QENA 1QAQA 1QYRA 5FTLA 4AI6A 2KA6B 2R4JA 3L25A 4GITA 2J7NA 1SXJD 3SHGB 2ZAMA 4REZA 4NOOB 3GRYA 3GLFB 2Q2EB 1TH4A 4GH9A 3TQSA 4RF1A 2BJVA 4X66M 3A45A 2H1RA 4I8OA 2LXEA 4K0KM 4M9SA 2F5SA 4IBDA 2C5RA 1IXZA 1X37A 4DR1M 5KPRA 2QBYA 4DV0M 3J7AS 1HNXM 1UM8A 4B7FA 1N78A 3MJ5A 4FCVA 3TL4X 3GLHA 2OPFA 3R9XB 2HHHM 2G5GX 5C18A 4MGYE 5ITXE 3GQ4A 4KLNA 5KQ8A 1XMQM 1XNRM 3PFIA 4Z6YA 4LFAM 4LG2A 4MGHA 3GPYA 1XMOM 4QHSA 3ZC7B 1G4AE 4I5SA 3VDUA 3HJSA 3RFWA 3A46A 3T38A 3T1YM 1ZQ9A 4DV7M 1IBKM 5IZ7D 1XHBA 4OW0A 1K3WA 3JR4A 2XZFA 3KXEC 3KDSE 2KZSA 3UGJA 4DV2M 3GQ3A 2K47A 3TWKA 3HU2A 3QAUA 4OVZB 4LFCM 3KSJA 2KXEA 4MH0E 5IREB 4KODA 5FLXS 1SXJE 4NRVA 3SBJA 2KZUA 2UXCM 2DWNA 2D7HA 1E9RA 1NSFA 1IY1A 2R46A 3PNVA 3SHFA 2A5YB 1DGGA 3SAVA 2F5NA 4BLCA 5A2QS 3ILKA 4MB7A 2I7PA 4XGIA 4L8RC 4JI1M 2UUBM 3DOAA 3KS8A 3UJNA 2VIIA 4D81A 3TE6A 5ITYA 4QHTA 1K82A 4B3TM 3OTOM 2D7EA 1Z6TA 3L26A 2M5ZA 1TDZA 3GO8A 1E9SA 4LY6A 3FYCA 5EQTA 2CHGA 3LVWA 2FOIC 3CF2A 2V1CA 3GLGA 1NNUC 1GLNA 4CGYB 2LH0A 1IXSB 3FUWA 1N75A 1KSFX 3KW6A 5DYIA 1I4WA 4MGIE 3VKGA 2VQEM 1Z5CA 4IBBA 3NWLA 3GPPA 1IY0A 3KOZE 4JYAM 1R7RA 3K2LA 2C9OA 3FUTA 1XNQM 4MGZE 4ITQA 3GLIB 2UUAM 1TGUA 2R62A 4S12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD2 A;  4JI7 M;  2XZU A;  4G4Q A;  1J5E M;  2UUC M;  4DV6 M;  4DR6 M;  2UXB M;  1L1T A;  4LF6 M;  4B3R M;  4LF8 M;  3U6M A;  4JI2 M;  5LMN M;  2Q2E B;  5BR8 M;  4G4N A;  3A42 A;  1XC8 A;  3TWL A;  4X66 M;  5ITT A;  3A45 A;  3U6P A;  1N34 M;  4K0K M;  2HKJ A;  2F5S A;  1HNW M;  3JAM S;  3SAW A;  4JI3 M;  3GP1 A;  3T1H M;  1KFV A;  4G4O A;  4DR1 M;  4DR4 M;  4DV0 M;  3J7A S;  1HNX M;  3C58 A;  1HR0 M;  4LFB M;  1Z59 A;  2OPF A;  1R2Y A;  2HHH M;  1N32 M;  4JI0 M;  1HNZ M;  2UXD M;  5ITX E;  1L1Z A;  2F5P A;  3GQ4 A;  4NXM M;  4DV4 M;  3SAU A;  3VK8 A;  4DR5 M;  1IBL M;  1TDH A;  1XMQ M;  1XNR M;  4LFA M;  2F5Q A;  3GPY A;  3U6C A;  1N33 M;  1XMO M;  4NXN M;  3SAS A;  4JI4 M;  1Z5A A;  5LMU M;  4B3S M;  4AQY M;  4JI6 M;  2F4V M;  5IT9 S;  1MX0 A;  3J81 S;  3T1Y M;  3A46 A;  2UU9 M;  4DV7 M;  1IBK M;  1K3W A;  4KHP M;  3JR4 A;  2EA0 A;  2XZF A;  4G4R A;  1Z5B A;  4DV2 M;  3GQ3 A;  4JI5 M;  3TWK A;  4DR2 M;  4LFC M;  1MU5 A;  1Q39 A;  4OX9 M;  4CIS A;  4NRW A;  3GQ5 A;  5FLX S;  4DR3 M;  1Q3B A;  2UUA M;  3SAT A;  4NRV A;  3SBJ A;  2UXC M;  1I94 M;  1L2D A;  3W0F A;  1IBM M;  3SAV A;  4X62 M;  2F5N A;  5A2Q S;  2ZBK B;  4X65 M;  4MB7 A;  4YY3 M;  4GKK M;  3U6D A;  1PJJ A;  4JI1 M;  2UUB M;  3DOA A;  5IWA M;  1K82 A;  5ITY A;  5ITX A;  4B3T M;  3GPX A;  4PCZ A;  3U6L A;  2F5O A;  3OTO M;  4PDG A;  4JV5 M;  1K3X A;  3GPU A;  2VQF M;  3U6E A;  1TDZ A;  4DR7 M;  1PJI A;  3GO8 A;  1EE8 A;  5ITR A;  4YHH M;  3J80 S;  3SAR A;  4DV1 M;  2OQ4 A;  4LF7 M;  1L2C A;  5ITU A;  2ZM6 M;  3U6S A;  4DUY M;  4LF9 M;  1L2B A;  4GKJ M;  3JR5 A;  4PDI A;  4JI8 M;  1R2Z A;  5ITQ A;  4LF4 M;  2VQE M;  1Z5C A;  3TWM A;  2E5L M;  1N36 M;  4X64 M;  4LF5 M;  3VK7 A;  3U6Q A;  3GPP A;  4B3M M;  4DV5 M;  1FJG M;  4JYA M;  1Q3C A;  1PM5 A;  3U6O A;  1XNQ M;  1NNJ A;  4ITQ A;  4DV3 M;  4DUZ M; 
#chains in the Genus database with same CATH topology
 4L6V 6;  3THG A;  4G4Q A;  2Y0T A;  1J5E M;  1ZMU A;  2FS1 A;  4W5W A;  2LWX A;  2X8A A;  3U60 A;  4LF6 M;  4IBJ A;  5EP1 A;  3U6M A;  4MGK E;  2XSZ A;  4CHT B;  2CUZ A;  1RU3 A;  1ZAE A;  1CUK A;  4M0D A;  1NHW C;  4NSR A;  3NBI A;  3TWL A;  3B7N A;  5ITT A;  2ZAN A;  3FD9 A;  3CF0 A;  3E4R A;  4R71 A;  3M0E A;  5GKN A;  4HEO A;  2UXD M;  3JAM S;  3CTW B;  1IY2 A;  4MM3 B;  4JI3 M;  3LMM A;  4A3V B;  3SAW A;  3D8B A;  4FD2 A;  4LJ8 A;  2DZL A;  3GRV A;  4LFB M;  3TPZ A;  3R8F A;  3IG5 A;  1QQW A;  4NC6 A;  1DGH B;  3SMS A;  2WSE F;  2QBY B;  3FUV A;  1JR3 D;  3FTC A;  3LW5 F;  2F5P A;  4BB9 A;  2CHV A;  3SAU A;  2R18 A;  2CFO A;  3GLH B;  4ZPX A;  3VLF B;  5FTJ A;  1TDH A;  1W5T A;  2JXN A;  3LCU A;  4Z8X A;  1QAN A;  3L2A A;  3KOW E;  3MHV C;  2F5Q A;  2WZJ A;  3U6C A;  1N33 M;  4NXN M;  2FH0 A;  2MGW A;  4I4L A;  3SAS A;  4JI4 M;  1Z5A A;  5IT9 S;  1XXH A;  1NY5 A;  4AQY M;  4JI6 M;  2LVN C;  2Z7J A;  3IEC A;  2DHR A;  3B9P A;  3J81 S;  1G71 A;  3FKE A;  3FRH A;  4Y28 F;  3SMP A;  2C99 A;  1HQY E;  2L09 A;  4KHP M;  1DGH A;  3E46 A;  2C9C A;  3FUU A;  3HHX A;  3QWL A;  4LRT A;  1VDL A;  4LJ7 A;  4JXJ A;  3IHP A;  3ZCB B;  4DR2 M;  3B74 A;  3RGS A;  4R7G A;  1WR1 B;  3AOE A;  1OJL A;  2CV0 A;  4FWH A;  5FSW A;  1Q39 A;  1HQC A;  4OX9 M;  4NRW A;  3GLF E;  4DR3 M;  3C3E A;  3T6P A;  2AHM A;  3KSX A;  1GL6 A;  4HLQ A;  3B7Q A;  4RNA A;  1DGF A;  4L16 A;  3W0F A;  1NO1 A;  1NV8 A;  5E26 A;  2LVO C;  1QZM A;  1ZMW A;  2XFT A;  2YNM D;  5E6J A;  2KW0 A;  4DBG B;  1FNN A;  2CV1 A;  3FTE A;  4GKK M;  2LTU A;  2KEB A;  3Q8X A;  2J7O A;  3U6D A;  1PJJ A;  5EXS A;  4NL4 H;  5IWA M;  4D80 A;  2L4F A;  3KOX E;  2LVA A;  5ITX A;  4LJ6 A;  3U6L A;  4IJE A;  1K3X A;  3I04 M;  3DFZ A;  3U61 A;  2KRK A;  1PJI A;  2GQF A;  1EE8 A;  5ITR A;  4RF0 A;  4YHH M;  3J80 S;  2JUJ A;  3M6A A;  1NJG A;  2OQ4 A;  2I7N A;  1WHC A;  2XSZ D;  3ZQJ A;  5ITU A;  4AZF A;  4QNR A;  3DZD A;  1L2B A;  4GKJ M;  3UMM A;  3UZU A;  3PXG A;  3GLG B;  1OIP A;  1GL7 A;  2FE8 A;  4LF4 M;  2E5L M;  2QPA A;  2P5T A;  2LBC A;  5FTK A;  3RE8 A;  4QOS A;  1VDD A;  3AOE C;  3U6Q A;  3L28 A;  2O5R A;  4LJ9 A;  2ERC A;  1Q3C A;  2DHY A;  4GC5 A;  1PM5 A;  1QZE A;  2M60 A;  4QOZ C;  1ORY B;  1NNJ A;  2EUC A;  4PD2 A;  1C7Y A;  1KYI A;  2UUC M;  1J7K A;  4FW9 A;  4DV6 M;  1N77 A;  4DR6 M;  4B3R M;  1SXJ A;  3KS4 A;  3HHY A;  1VEJ A;  4IIW A;  4WUR A;  5KPZ A;  4XK8 F;  3EIH A;  1MJG M;  4P16 A;  2LHG A;  3MMP A;  1UFZ A;  3H4M A;  2FNA A;  4JI2 M;  4LJ4 A;  1OQY A;  5BR8 M;  3U60 B;  4RKU F;  3CGW A;  3K9P A;  2N35 A;  2YQZ A;  4AW4 A;  2XH9 A;  3FUX A;  2VF7 A;  2EKK A;  2VF8 A;  1N34 M;  4CJ6 A;  2ZTC A;  5JI3 E;  1HNW M;  1AUA A;  3GP1 A;  1KFV A;  4FVM A;  2DVW B;  4LGM A;  1PGY A;  3BBZ A;  2R65 A;  4DR4 M;  4M9X A;  2XGN A;  3C58 A;  2L7I A;  1YUB A;  3J27 B;  4IBC A;  1TH2 A;  2WSF F;  1IM2 A;  2RGO A;  4JI0 M;  3I4V A;  3KP1 E;  4WP2 A;  1IN4 A;  3L29 A;  4LGY A;  1HNZ M;  2V1U A;  1D0K A;  4NXM M;  3FTF A;  4DR5 M;  3HU3 A;  3AKZ A;  2JZ0 A;  1XB2 B;  2DAI A;  2JA2 A;  3MK6 A;  4AG6 A;  1OFH A;  1IQP A;  2DAG A;  4LZJ A;  2XEP A;  4BBA A;  1WIV A;  4GC9 A;  5EXX A;  1OAI A;  4OU7 A;  1NVM A;  3IG8 A;  3W0L B;  5LMU M;  5F3W A;  4B3S M;  2MR9 A;  1JQJ C;  1GAB A;  2K0B X;  1DV0 A;  3V76 A;  2BWB A;  2J5Y A;  1XXH B;  2QQ8 A;  1NHG C;  1SXJ C;  2XFS A;  4G4R A;  1YSY A;  3KFU G;  1Z5B A;  4GHL A;  3AV0 A;  3BOS A;  5FTM A;  2DWZ B;  1ZMV A;  3A98 B;  4LCB A;  4AG5 A;  2XF3 A;  2MRO B;  3CF6 E;  1AIP C;  1MU5 A;  3NBX X;  3J7B A;  2DXI A;  1GVN A;  4F2L A;  2CWB A;  2OO9 A;  1PRB A;  3C9P A;  5EP4 A;  3FRI A;  3GQ5 A;  3EIE A;  1Q3B A;  2LNH C;  1VEK A;  2QSF X;  2DEN A;  2JWS A;  3PVS A;  1QUS A;  1G8P A;  1L2D A;  3SC3 A;  3FE3 A;  1IBM M;  2V6Z M;  3KOY E;  4FCW A;  2X4A A;  2ZBK B;  2O01 F;  2DNA A;  3SFZ A;  1E32 A;  4F1I A;  2JP7 A;  3SYK A;  5KPT A;  2K6B A;  2DWM A;  1J09 A;  2G8L A;  2LHC A;  1Y8G A;  2Y0Q A;  1MN3 A;  4B08 A;  5EXP A;  2RKO A;  1V33 A;  1D0L A;  2F5O A;  3HHW A;  4LZZ A;  4PDG A;  3GPU A;  3GLH E;  2HWJ A;  3LQQ A;  4JN6 A;  2VQF M;  3U6E A;  2Y20 A;  4IBE A;  2DAE A;  2LVQ D;  1HT1 E;  4EIW A;  2KNV A;  3K8Z A;  4IBG A;  5DFL A;  4HL4 A;  1YLA A;  3SAR A;  2DI0 A;  4XBO A;  3L27 A;  1TTE A;  3U61 B;  3U6S A;  2QCU A;  2R4E A;  3I4Y A;  3HHZ A;  4NSO B;  3JR5 A;  4PDI A;  1R2Z A;  4B7H A;  5ITQ A;  3HY5 A;  3VKH A;  3TWM A;  2CHQ A;  4X64 M;  4LF5 M;  2HL7 A;  2RGH A;  5EXT A;  3VK7 A;  2QNJ A;  3VFD A;  4B3M M;  2DZN B;  3HJQ A;  4P17 A;  1EIJ A;  1FJG M;  5DYG A;  3K1J A;  2RRU A;  1TR8 A;  3U6O A;  3HGI A;  4II7 A;  2Z4S A;  5FTN A;  2Y21 A;  1DO0 A;  4JI7 M;  2XZU A;  3HX3 A;  5EP3 A;  1JR3 E;  3E9S A;  3GLF A;  1IFY A;  2UXB M;  1T3T A;  1L1T A;  1D2N A;  1IN8 A;  1V34 A;  4FWD A;  1BVS A;  3W67 A;  1LV7 A;  4LF8 M;  3HU1 A;  2K9D A;  5LMN M;  1IXR C;  1SXJ B;  3KP0 E;  4G4N A;  1G41 A;  3K92 A;  3A42 A;  2R0I A;  1XC8 A;  1LTM A;  3E21 A;  2ZAO A;  2BWE A;  3U6P A;  1Q02 A;  2HKJ A;  3KVW A;  5C1B A;  4M9Z A;  3T1H M;  1QAO A;  3WHK A;  1OFI A;  4G4O A;  3F92 A;  3VDP A;  1HT2 E;  1HR0 M;  4QNM A;  1IN7 A;  1IN6 A;  2D7G A;  4GMQ A;  1JR3 A;  1Z59 A;  4WW0 A;  1R2Y A;  4LRS A;  5KQD A;  2QZ4 A;  4M0W A;  1WGN A;  1L1Z A;  5EP2 A;  4DV4 M;  3VK8 A;  4ANR A;  1QUT A;  3PNY A;  1G59 A;  1IBL M;  4AKG A;  5EJC A;  5H37 D;  1H6U A;  2CE7 A;  2YR0 A;  3HWS A;  3AOG A;  2W82 A;  2Z3X A;  2R45 A;  4IBF A;  3WHL A;  3GLG E;  1QDT A;  2L6O A;  3U5Z B;  2F4V M;  1MX0 A;  1TF0 B;  3HJ8 A;  3AJI B;  5BPV A;  2HAK A;  5DNY A;  1G3I A;  2UU9 M;  2B3T A;  4G6Z A;  2OOB A;  3M7G A;  4PT5 A;  3D8L A;  2MH8 A;  1S3S A;  2R44 A;  3DA1 A;  1NY6 A;  2EA0 A;  4OVZ A;  2FFJ A;  4IBI A;  2YFQ A;  3LVV A;  4IBK A;  4UN2 B;  5L8R F;  4JI5 M;  3AL0 C;  3FYD A;  4GHA A;  4TUW A;  1QVR A;  2CV2 A;  1E94 E;  1DO2 A;  2C98 A;  3K9O A;  2EKF A;  2BJW A;  4CIS A;  1WJ7 A;  4KT0 F;  1NJF A;  3AFH A;  3U5Z A;  3HKP A;  3SAT A;  3I51 A;  4LJA A;  4D82 A;  1ZV1 A;  1I94 M;  1D0M A;  1OKS A;  1TH3 A;  4AKI A;  1P3Q Q;  1WXQ A;  2CEA A;  1R6B X;  3FTD A;  4X62 M;  3SYL A;  2DWL A;  4X65 M;  2QP9 X;  4YY3 M;  1PJQ A;  4L78 A;  3W68 A;  5JI2 E;  1DGB A;  2XLJ A;  2X49 A;  2C96 A;  2NQ8 C;  4FWG A;  4L4U A;  3RGP A;  5KO3 A;  3GLI E;  1GO5 A;  4IJF A;  4PCZ A;  3GPX A;  2HCB A;  4JV5 M;  1SG9 A;  3GRU A;  1GJT A;  4DR7 M;  1N32 M;  1IXS A;  4DV1 M;  1YE9 A;  4LF7 M;  1L2C A;  2ZM6 M;  4DUY M;  1C1K A;  1GKI A;  4FCT A;  3ZH9 B;  7CAT A;  4LF9 M;  4LJ5 A;  3T15 A;  1QAM A;  2APL A;  4JI8 M;  4B7G A;  4GRI A;  4GIP A;  1XXH E;  2DAM A;  4AKH A;  1N36 M;  2G3Q A;  4R3D A;  2KHH A;  3UK6 A;  8CAT A;  4L15 A;  3GLI A;  4DV5 M;  1W5S A;  1VEG A;  2EO2 A;  1IN5 A;  3GRR A;  2LVP C;  2VDB B;  4I81 A;  2BNK A;  2DZO B;  4CIZ A;  2L7H A;  1XWI A;  1WGL A;  2OOA A;  1OTR A;  2Z4R A;  2KRU A;  3J2P B;  3LQR A;  4DV3 M;  4KO8 A;  4DUZ M;  1L8Q A;  2QEN A;  1QAQ A;  1QYR A;  5FTL A;  4AI6 A;  2KA6 B;  2R4J A;  3L25 A;  2JY5 A;  4GIT A;  1T43 A;  2KNA A;  2J7N A;  1SXJ D;  3SHG B;  2ZAM A;  4REZ A;  4NOO B;  3GRY A;  3GLF B;  2Q2E B;  1TH4 A;  4GH9 A;  2JY6 B;  2JZ1 A;  2KNZ A;  3TQS A;  4RF1 A;  1F4I A;  2BJV A;  4X66 M;  3A45 A;  2H1R A;  4I8O A;  2LXE A;  4K0K M;  4M9S A;  2F5S A;  3QYB A;  3C3D A;  4IBD A;  2C5R A;  3HZJ A;  1T6O A;  2GNO A;  1IXZ A;  1X37 A;  4DR1 M;  3B89 A;  5KPR A;  4DV0 M;  2QBY A;  3J7A S;  1HNX M;  1UM8 A;  2DKL A;  2R6F A;  4B7F A;  1N78 A;  1JB0 F;  3MJ5 A;  4FCV A;  2MJ5 B;  3TL4 X;  3GLH A;  2OPF A;  3R9X B;  2HHH M;  2G5G X;  3B7Z A;  5C18 A;  4MGY E;  5ITX E;  3GQ4 A;  4KLN A;  1A5T A;  3LCV B;  5KQ8 A;  1XMQ M;  1XNR M;  2QHO B;  3PFI A;  4Z6Y A;  4LFA M;  4LG2 A;  4MGH A;  3GPY A;  1XMO M;  1HJP A;  4QHS A;  3ZC7 B;  1V92 A;  2CP8 A;  1PJT A;  1G4A E;  4I5S A;  3VDU A;  1QDR A;  3HJS A;  3RFW A;  3A46 A;  3T38 A;  2JY7 A;  1ZQ9 A;  4DV7 M;  3T1Y M;  1IBK M;  5IZ7 D;  1XHB A;  4OW0 A;  2CRU A;  1K3W A;  3JR4 A;  2XZF A;  1OAO C;  2JNH A;  3KXE C;  2Z8Y M;  3KDS E;  2KZS A;  3UGJ A;  4DV2 M;  3GQ3 A;  2K47 A;  3TWK A;  3HU2 A;  3QAU A;  4OVZ B;  4LFC M;  3KSJ A;  2KXE A;  3I01 M;  4MH0 E;  5IRE B;  4KOD A;  2DAK A;  5FLX S;  3BXW A;  1SXJ E;  1EFU B;  4NRV A;  3SBJ A;  2KZU A;  1R5L A;  2DWN A;  2UXC M;  2D7H A;  1E9R A;  1NSF A;  1IY1 A;  2R46 A;  3PNV A;  3SHF A;  2A5Y B;  2L4E A;  1R4G A;  1DGG A;  3SAV A;  2F5N A;  4BLC A;  5A2Q S;  2WSC F;  2ZTD A;  1OIZ A;  3ILK A;  4MB7 A;  2I7P A;  2KDL A;  2H5X A;  4XGI A;  4GEW A;  4JI1 M;  2UUB M;  3DOA A;  4L8R C;  3KS8 A;  3UJN A;  2VII A;  4D81 A;  3TE6 A;  5ITY A;  4QHT A;  1K82 A;  4B3T M;  3OTO M;  2D7E A;  1Z6T A;  3Q8G A;  3L26 A;  2M5Z A;  1TDZ A;  3GO8 A;  1E9S A;  4LY6 A;  4G3O A;  3FYC A;  5EQT A;  2CHG A;  3LVW A;  2FOI C;  3CF2 A;  1PJS A;  2V1C A;  3GLG A;  1NNU C;  1GLN A;  4CGY B;  4Q7J A;  2LH0 A;  1IXS B;  2O25 A;  3FUW A;  1N75 A;  1KSF X;  2EJS A;  3KW6 A;  5DYI A;  1I4W A;  4MGI E;  1VG5 A;  3VKG A;  2VQE M;  1Z5C A;  4IBB A;  1GJS A;  3NWL A;  3GPP A;  1IY0 A;  1VQ1 A;  3KOZ E;  2JY8 A;  3H4J A;  1NV9 A;  4JYA M;  1R7R A;  3K2L A;  2C9O A;  3FUT A;  1XNQ M;  3QYE A;  4MGZ E;  3GLI B;  4ITQ A;  2UUA M;  1TGU A;  2L2D A;  2R62 A;  4S12 A; 
#chains in the Genus database with same CATH homology
 3THG A;  4G4Q A;  2Y0T A;  1J5E M;  4W5W A;  2LWX A;  2X8A A;  3U60 A;  4LF6 M;  4IBJ A;  5EP1 A;  3U6M A;  4MGK E;  2XSZ A;  4CHT B;  2CUZ A;  1ZAE A;  4M0D A;  1NHW C;  4NSR A;  3NBI A;  3TWL A;  5ITT A;  2ZAN A;  3FD9 A;  3CF0 A;  3E4R A;  3M0E A;  5GKN A;  2UXD M;  3JAM S;  3CTW B;  1IY2 A;  4MM3 B;  4JI3 M;  3LMM A;  4A3V B;  3SAW A;  3D8B A;  4FD2 A;  4LJ8 A;  3GRV A;  4LFB M;  3TPZ A;  3R8F A;  3IG5 A;  1QQW A;  1DGH B;  3SMS A;  2QBY B;  3FUV A;  1JR3 D;  3FTC A;  2F5P A;  4BB9 A;  2CHV A;  3SAU A;  2R18 A;  2CFO A;  3GLH B;  4ZPX A;  3VLF B;  5FTJ A;  1TDH A;  1W5T A;  4Z8X A;  1QAN A;  3L2A A;  3KOW E;  3MHV C;  2F5Q A;  1N33 M;  3U6C A;  4NXN M;  4I4L A;  3SAS A;  4JI4 M;  1Z5A A;  5IT9 S;  1XXH A;  1NY5 A;  4AQY M;  4JI6 M;  2Z7J A;  2DHR A;  3B9P A;  3J81 S;  3FKE A;  3SMP A;  2C99 A;  1HQY E;  2L09 A;  4KHP M;  1DGH A;  2C9C A;  3FUU A;  3HHX A;  3QWL A;  4LRT A;  4LJ7 A;  4JXJ A;  3ZCB B;  4DR2 M;  3RGS A;  4R7G A;  3AOE A;  1OJL A;  2CV0 A;  4FWH A;  5FSW A;  1Q39 A;  1HQC A;  4OX9 M;  4NRW A;  4DR3 M;  2AHM A;  3KSX A;  1GL6 A;  4HLQ A;  4RNA A;  1DGF A;  4L16 A;  3W0F A;  5E26 A;  1QZM A;  2XFT A;  2YNM D;  5E6J A;  2KW0 A;  1FNN A;  2CV1 A;  3FTE A;  4GKK M;  2KEB A;  3Q8X A;  2J7O A;  3U6D A;  1PJJ A;  5EXS A;  4NL4 H;  5IWA M;  4D80 A;  3KOX E;  5ITX A;  4LJ6 A;  3U6L A;  4IJE A;  1K3X A;  3DFZ A;  3U61 A;  2KRK A;  1PJI A;  1EE8 A;  5ITR A;  4RF0 A;  4YHH M;  3J80 S;  3M6A A;  1NJG A;  2OQ4 A;  2I7N A;  2XSZ D;  5ITU A;  4AZF A;  4QNR A;  3DZD A;  1L2B A;  4GKJ M;  3UMM A;  3UZU A;  3PXG A;  3GLG B;  1GL7 A;  2FE8 A;  4LF4 M;  2E5L M;  2QPA A;  2P5T A;  5FTK A;  3RE8 A;  4QOS A;  1VDD A;  3AOE C;  3U6Q A;  3L28 A;  2O5R A;  4LJ9 A;  2ERC A;  1Q3C A;  4GC5 A;  1PM5 A;  2M60 A;  4QOZ C;  1ORY B;  1NNJ A;  2EUC A;  4PD2 A;  1KYI A;  2UUC M;  1J7K A;  4FW9 A;  4DV6 M;  1N77 A;  4DR6 M;  4B3R M;  1SXJ A;  3KS4 A;  3HHY A;  4IIW A;  4WUR A;  5KPZ A;  3EIH A;  4P16 A;  4JI2 M;  3H4M A;  2FNA A;  4LJ4 A;  5BR8 M;  3U60 B;  4AW4 A;  2YQZ A;  2XH9 A;  3FUX A;  1N34 M;  5JI3 E;  1HNW M;  3GP1 A;  1KFV A;  4FVM A;  2DVW B;  4LGM A;  2R65 A;  4DR4 M;  4M9X A;  2XGN A;  3C58 A;  2L7I A;  1YUB A;  3J27 B;  4IBC A;  1TH2 A;  1IM2 A;  2RGO A;  4JI0 M;  3I4V A;  3KP1 E;  1HNZ M;  1IN4 A;  3L29 A;  4LGY A;  2V1U A;  4NXM M;  3FTF A;  4DR5 M;  3HU3 A;  3AKZ A;  3MK6 A;  2JA2 A;  4AG6 A;  1OFH A;  1IQP A;  4LZJ A;  2XEP A;  4BBA A;  5EXX A;  4GC9 A;  4OU7 A;  5LMU M;  1NVM A;  3IG8 A;  3W0L B;  5F3W A;  4B3S M;  1JQJ C;  1XXH B;  1NHG C;  1SXJ C;  2XFS A;  4G4R A;  1YSY A;  3KFU G;  1Z5B A;  4GHL A;  3AV0 A;  3BOS A;  5FTM A;  2DWZ B;  3A98 B;  4AG5 A;  4LCB A;  2XF3 A;  3CF6 E;  1MU5 A;  3J7B A;  2DXI A;  1GVN A;  5EP4 A;  3GQ5 A;  3EIE A;  1Q3B A;  2LNH C;  3PVS A;  1G8P A;  1L2D A;  3SC3 A;  1IBM M;  2V6Z M;  3KOY E;  4FCW A;  2X4A A;  2ZBK B;  3SFZ A;  1E32 A;  3SYK A;  5KPT A;  2DWM A;  1J09 A;  2G8L A;  2Y0Q A;  4B08 A;  5EXP A;  2RKO A;  2F5O A;  3HHW A;  4LZZ A;  4PDG A;  3GPU A;  4JN6 A;  2VQF M;  3LQQ A;  3U6E A;  2Y20 A;  4IBE A;  1HT1 E;  4EIW A;  3K8Z A;  4IBG A;  3SAR A;  4HL4 A;  4XBO A;  3L27 A;  3U61 B;  3U6S A;  2QCU A;  2R4E A;  3I4Y A;  3HHZ A;  4NSO B;  3JR5 A;  4PDI A;  1R2Z A;  4B7H A;  5ITQ A;  3VKH A;  3TWM A;  2CHQ A;  4X64 M;  4LF5 M;  2HL7 A;  2RGH A;  5EXT A;  3VK7 A;  3VFD A;  4B3M M;  2DZN B;  3HJQ A;  1FJG M;  5DYG A;  3K1J A;  3U6O A;  3HGI A;  4II7 A;  2Z4S A;  5FTN A;  2Y21 A;  1DO0 A;  4JI7 M;  2XZU A;  5EP3 A;  3E9S A;  3GLF A;  2UXB M;  1T3T A;  1L1T A;  1D2N A;  1IN8 A;  4FWD A;  4LF8 M;  1LV7 A;  3HU1 A;  5LMN M;  1IXR C;  1SXJ B;  3KP0 E;  4G4N A;  1G41 A;  3K92 A;  3A42 A;  1XC8 A;  2ZAO A;  3U6P A;  2HKJ A;  3KVW A;  5C1B A;  4M9Z A;  3T1H M;  1QAO A;  3WHK A;  1OFI A;  4G4O A;  3VDP A;  1HT2 E;  1HR0 M;  4QNM A;  1IN7 A;  1IN6 A;  2D7G A;  4GMQ A;  1JR3 A;  1Z59 A;  4WW0 A;  1R2Y A;  4LRS A;  5KQD A;  2QZ4 A;  4M0W A;  1L1Z A;  5EP2 A;  4DV4 M;  3VK8 A;  3PNY A;  1G59 A;  1IBL M;  4AKG A;  5EJC A;  5H37 D;  1H6U A;  2CE7 A;  2YR0 A;  3HWS A;  3AOG A;  2W82 A;  2Z3X A;  2R45 A;  4IBF A;  3WHL A;  2L6O A;  3U5Z B;  2F4V M;  1MX0 A;  3HJ8 A;  3AJI B;  5BPV A;  5DNY A;  1G3I A;  2UU9 M;  4G6Z A;  3M7G A;  4PT5 A;  3D8L A;  3DA1 A;  1S3S A;  2EA0 A;  1NY6 A;  4OVZ A;  2FFJ A;  4IBI A;  2YFQ A;  3LVV A;  4IBK A;  4JI5 M;  3AL0 C;  3FYD A;  4GHA A;  4TUW A;  1QVR A;  2CV2 A;  1E94 E;  1DO2 A;  2C98 A;  4CIS A;  2BJW A;  1NJF A;  3AFH A;  3U5Z A;  3HKP A;  3SAT A;  3I51 A;  4LJA A;  4D82 A;  1I94 M;  1TH3 A;  4AKI A;  1WXQ A;  2CEA A;  1R6B X;  3FTD A;  4X62 M;  3SYL A;  2DWL A;  4X65 M;  2QP9 X;  4YY3 M;  4L78 A;  5JI2 E;  1DGB A;  2XLJ A;  2X49 A;  2C96 A;  2NQ8 C;  4FWG A;  4L4U A;  3RGP A;  5KO3 A;  4IJF A;  4PCZ A;  3GPX A;  2HCB A;  4JV5 M;  3GRU A;  4DR7 M;  1N32 M;  4DV1 M;  1YE9 A;  4LF7 M;  1L2C A;  2ZM6 M;  4DUY M;  1C1K A;  1GKI A;  4FCT A;  3ZH9 B;  7CAT A;  4LF9 M;  4LJ5 A;  3T15 A;  1QAM A;  4JI8 M;  4B7G A;  4GRI A;  4GIP A;  4AKH A;  1N36 M;  4R3D A;  3UK6 A;  8CAT A;  4L15 A;  3GLI A;  4DV5 M;  1W5S A;  2EO2 A;  1IN5 A;  3GRR A;  4I81 A;  2BNK A;  2DZO B;  2L7H A;  1XWI A;  2Z4R A;  2KRU A;  3J2P B;  3LQR A;  4DV3 M;  4KO8 A;  4DUZ M;  1L8Q A;  2QEN A;  1QAQ A;  1QYR A;  5FTL A;  4AI6 A;  2KA6 B;  2R4J A;  3L25 A;  4GIT A;  2J7N A;  1SXJ D;  3SHG B;  2ZAM A;  4REZ A;  4NOO B;  3GRY A;  3GLF B;  2Q2E B;  1TH4 A;  4GH9 A;  3TQS A;  4RF1 A;  2BJV A;  4X66 M;  3A45 A;  2H1R A;  4I8O A;  2LXE A;  4K0K M;  4M9S A;  2F5S A;  4IBD A;  2C5R A;  1IXZ A;  1X37 A;  4DR1 M;  5KPR A;  2QBY A;  4DV0 M;  3J7A S;  1HNX M;  1UM8 A;  4B7F A;  1N78 A;  3MJ5 A;  4FCV A;  3TL4 X;  3GLH A;  2OPF A;  3R9X B;  2HHH M;  2G5G X;  5C18 A;  4MGY E;  5ITX E;  3GQ4 A;  4KLN A;  5KQ8 A;  1XMQ M;  1XNR M;  3PFI A;  4Z6Y A;  4LFA M;  4LG2 A;  4MGH A;  3GPY A;  1XMO M;  4QHS A;  3ZC7 B;  1G4A E;  4I5S A;  3VDU A;  3HJS A;  3RFW A;  3A46 A;  3T38 A;  3T1Y M;  1ZQ9 A;  4DV7 M;  1IBK M;  5IZ7 D;  1XHB A;  4OW0 A;  1K3W A;  3JR4 A;  2XZF A;  3KXE C;  3KDS E;  2KZS A;  3UGJ A;  4DV2 M;  3GQ3 A;  2K47 A;  3TWK A;  3HU2 A;  3QAU A;  4OVZ B;  4LFC M;  3KSJ A;  2KXE A;  4MH0 E;  5IRE B;  4KOD A;  5FLX S;  1SXJ E;  4NRV A;  3SBJ A;  2KZU A;  2UXC M;  2DWN A;  2D7H A;  1E9R A;  1NSF A;  1IY1 A;  2R46 A;  3PNV A;  3SHF A;  2A5Y B;  1DGG A;  3SAV A;  2F5N A;  4BLC A;  5A2Q S;  3ILK A;  4MB7 A;  2I7P A;  4XGI A;  4L8R C;  4JI1 M;  2UUB M;  3DOA A;  3KS8 A;  3UJN A;  2VII A;  4D81 A;  3TE6 A;  5ITY A;  4QHT A;  1K82 A;  4B3T M;  3OTO M;  2D7E A;  1Z6T A;  3L26 A;  2M5Z A;  1TDZ A;  3GO8 A;  1E9S A;  4LY6 A;  3FYC A;  5EQT A;  2CHG A;  3LVW A;  2FOI C;  3CF2 A;  2V1C A;  3GLG A;  1NNU C;  1GLN A;  4CGY B;  2LH0 A;  1IXS B;  3FUW A;  1N75 A;  1KSF X;  3KW6 A;  5DYI A;  1I4W A;  4MGI E;  3VKG A;  2VQE M;  1Z5C A;  4IBB A;  3NWL A;  3GPP A;  1IY0 A;  3KOZ E;  4JYA M;  1R7R A;  3K2L A;  2C9O A;  3FUT A;  1XNQ M;  4MGZ E;  4ITQ A;  3GLI B;  2UUA M;  1TGU A;  2R62 A;  4S12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...