4DR5M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr5M02
4DV5M 1HNZM 4DV4M 4PDIA 2UUAM 1HNXM 2UXCM 2HHHM 4LF9M 3U6OA 4DUZM 1XMOM 2ZM6M 1XC8A 3GQ4A 5IT9S 5FLXS 1Q39A 1N34M 5IWAM 3A46A 3DOAA 4KHPM 1R2YA 5LMUM 1Q3BA 3C58A 4JI5M 1IBMM 3TWMA 4DR5M 5A2QS 4B3RM 2HKJA 3SAUA 4JI3M 1MU5A 4GKJM 4JI8M 1FJGM 4DR3M 4LF7M 2EA0A 4JI2M 3GQ3A 3T1YM 2F5NA 1L2BA 3U6SA 4B3MM 3GP1A 3GPYA 5ITQA 1L2DA 4B3SM 1PJJA 3J81S 4YHHM 4LF8M 1IBLM 1I94M 1Z5CA 4PD2A 4YY3M 4DR6M 4LF6M 2OPFA 4K0KM 1N32M 2XZFA 4DV0M 4DR7M 4NRWA 4OX9M 4NXNM 4G4RA 5ITTA 1L1ZA 3VK8A 1NNJA 3GPUA 4DUYM 4DR1M 3J7AS 2OQ4A 1Z5AA 5ITXE 1TDHA 3SATA 3J80S 4JI6M 4LF4M 5LMNM 1IBKM 4GKKM 5ITUA 4LFBM 3JR4A 2ZBKB 3U6CA 1L2CA 4JYAM 3JAMS 4B3TM 4CISA 4DR4M 1TDZA 3TWKA 1HR0M 3U6MA 4DV2M 3SARA 3A42A 4X62M 3JR5A 3SASA 4DV6M 1EE8A 3U6QA 3GPXA 3SAWA 3A45A 4LFAM 4DV1M 1N36M 4G4OA 4AQYM 1XNQM 1PJIA 4G4NA 3U6LA 2F5QA 5ITYA 1XMQM 3VK7A 2VQEM 1Z59A 3U6PA 3SBJA 4PCZA 2UUCM 4DR2M 3GQ5A 4X65M 1Q3CA 2UU9M 3SAVA 4ITQA 1KFVA 5ITRA 3TWLA 1R2ZA 4NRVA 1Z5BA 5ITXA 1L1TA 2F5OA 4LFCM 4PDGA 5BR8M 2VQFM 2UXDM 4JI4M 4DV3M 3U6DA 4LF5M 1HNWM 2UUBM 4G4QA 2E5LM 4JI0M 3OTOM 2UXBM 2F5SA 3U6EA 3T1HM 1PM5A 1XNRM 2XZUA 3W0FA 4X66M 3GPPA 1K3XA 3GO8A 4MB7A 1MX0A 4NXMM 1N33M 1K82A 2Q2EB 4JI7M 4JI1M 4JV5M 1J5EM 4DV7M 2F4VM 2F5PA 1K3WA 4X64M
chains in the Genus database with same CATH superfamily
3SMSA 4GHLA 2OO9A 2L7HA 5EXPA 1QUSA 1DV0A 2XEPA 1NV8A 3L28A 4GMQA 1DO2A 4FCVA 4P17A 2K9DA 2HHHM 4LJ7A 4S12A 3FUUA 2Y20A 3BOSA 4DUZM 1XMOM 3FUTA 3C9PA 3T6PA 2G3QA 1SXJB 2GNOA 3EIEA 5EJCA 2ZTDA 4FWHA 1Q39A 1WGNA 4NOOB 2EKKA 3I51A 4AG6A 3AOEC 3BBZA 3W68A 1QAMA 5IZ7D 1GL7A 1IBMM 1H6UA 2K47A 4B3RM 1E9RA 3R8FA 2LH0A 4JI3M 4GKJM 3TQSA 2Z3XA 2LBCA 2WZJA 4KT0F 1FJGM 1DO0A 3VFDA 2DHRA 2EA0A 4DR3M 1QANA 3GQ3A 2RGOA 1E9SA 1IQPA 1NNUC 2J5YA 4GRIA 1TH2A 3GP1A 3GPYA 2CEAA 4GEWA 4CGYB 4RKUF 4L8RC 4I8OA 2JUJA 4PD2A 2OPFA 1IN4A 3K8ZA 4PT5A 1PRBA 4G6ZA 4MGYE 4DV0M 4WP2A 1TTEA 3RE8A 3PNVA 3VK8A 4GHAA 1NNJA 3LVVA 1MJGM 2WSEF 4DUYM 1IM2A 1X37A 3TL4X 3U60B 2DAKA 3FTEA 1NY5A 1XWIA 2EKFA 3GLIE 5ITXE 4OVZA 1VDDA 2DVWB 3L25A 3UK6A 1E32A 1E94E 4JYAM 3AOGA 2CHGA 4B3TM 3DA1A 3GRYA 3IECA 2I7NA 2BWEA 4LRTA 4L16A 1ZAEA 4XGIA 2K6BA 4HEOA 2MR9A 3HU2A 2X4AA 3ZH9B 4LF6M 4DV6M 1EE8A 3SMPA 3SAWA 1D0MA 3A45A 4WURA 1IY1A 3KS8A 4LFBM 4M0WA 2FOIC 4DBGB 3J27B 3UZUA 4NL4H 4AQYM 3KDSE 1OFIA 2DWZB 4G4NA 2F5QA 3B7ZA 5ITYA 4QNRA 1IN5A 3VK7A 2VQEM 3QYEA 1OAOC 4IBDA 1IXSA 1TH4A 3J2PB 4IBKA 2KRKA 1R4GA 3L29A 2UU9M 1Q3CA 4LJ8A 1QZMA 2VDBB 3SAVA 2YFQA 1SXJE 2DZNB 2V1CA 1VQ1A 3I04M 4LJAA 1FNNA 2DZLA 3I01M 2AHMA 2JWSA 4HLQA 3DFZA 1Q02A 4NRVA 3HU1A 2Z8YM 4B7FA 2FE8A 4JI4M 4W5WA 3U6DA 1QDRA 1WGLA 4I81A 5FTNA 1HNWM 4OU7A 2M60A 1HQCA 4JI0M 4B7HA 3FKEA 2O5RA 3T1HM 1DGFA 3AJIB 1PM5A 2QP9X 5KPTA 3SYLA 3GLGA 3VKHA 1SXJC 4MB7A 3FTDA 2R18A 4JI1M 2FFJA 2CUZA 4FCTA 1IN6A 5FTMA 4R3DA 4DV7M 3QAUA 4MH0E 2F4VM 1OIPA 1IFYA 1J5EM 4KLNA 4X64M 1S3SA 3CGWA 2DAGA 5F3WA 4LGMA 2CHVA 1HNZM 2OOBA 1T3TA 5EXSA 4PDIA 2DWMA 3Q8GA 2XFTA 3LW5F 5DNYA 2L2DA 2LXEA 5H37D 3R9XB 4FWGA 4Y28F 3LVWA 1GO5A 3GLIB 3VDPA 1PJSA 2CV0A 4OW0A 2VF7A 4CJ6A 3GQ4A 5IT9S 1V34A 2QBYB 5IWAM 4KHPM 1R2YA 5LMUM 1ZMVA 3FYCA 1W5SA 3C58A 1ORYB 2KDLA 2KHHA 3CF2A 3GRUA 1J7KA 3ZC7B 3TWMA 3KS4A 4DR5M 4LG2A 2HKJA 3L27A 1SG9A 1MU5A 1TH3A 3AV0A 1TGUA 3KOZE 3D8BA 2N35A 1WR1B 1HT2E 1YE9A 3AKZA 2R45A 4B3MM 1QQWA 2EO2A 1NSFA 1V92A 1NVMA 3J81S 1ZQ9A 4YHHM 4LF8M 2Z4RA 3HJ8A 3TPZA 2ZANA 2XGNA 1Z5CA 1WIVA 2B3TA 2CRUA 2QZ4A 4KODA 4F2LA 2XZFA 1KSFX 3B7NA 3HKPA 7CATA 4IBBA 3AFHA 3KOYE 5ITTA 4D82A 3KSJA 3LQRA 4Q7JA 1L1ZA 2RRUA 2CFOA 1KYIA 1N77A 2OQ4A 5EXTA 3HJSA 2Z4SA 1Z5AA 1JR3A 2LVOC 1D0LA 3A98B 3SHFA 3CF6E 1TDHA 4ANRA 3ZQJA 2R0IA 2QHOB 4GKKM 3L2AA 1OTRA 3RFWA 1YUBA 1RU3A 3F92A 2QPAA 4CHTB 2DXIA 4LJ6A 3K92A 3SYKA 5EP3A 4CISA 1TDZA 2BNKA 2J7NA 1G3IA 1R6BX 4NSOB 4QOSA 3WHKA 4DV2M 3HX3A 3UMMA 4X62M 3JR5A 3GLGE 2DAEA 3U6QA 3THGA 3KOXE 4FW9A 4DV1M 1XXHA 3PXGA 2C9CA 4GITA 5GKNA 2CV2A 3C3EA 2Y21A 3GLHA 3U61A 1DGHA 4IBGA 1JB0F 2FH0A 1GL6A 3LCVB 3IHPA 1GLNA 1C1KA 2H5XA 2L6OA 4NC6A 4BLCA 2D7EA 2UUCM 2KNAA 4II7A 2L4FA 3GQ5A 2MGWA 4X65M 2JY5A 2XF3A 3FUVA 5DFLA 4LZZA 1R2ZA 4OVZB 3GRRA 1L1TA 2BJWA 2BWBA 1VDLA 2KNZA 3LCUA 2V6ZM 5EP2A 2LWXA 4RF1A 2VQFM 2APLA 2DENA 1UM8A 1G4AE 5KO3A 2QENA 1W5TA 4LZJA 3J7BA 2UUBM 1V33A 4HL4A 1WXQA 2KNVA 4B7GA 2XZUA 3W0FA 1NJFA 4X66M 3GPPA 2DWLA 1MX0A 4QHTA 4QNMA 4L78A 4NXMM 2LVAA 3W67A 1G59A 4QOZC 2C96A 1NJGA 2LHGA 2MH8A 3HY5A 3ZCBB 2X8AA 4L4UA 3KVWA 2ZTCA 1IXSB 2R46A 5KPRA 3AL0C 3ILKA 1G8PA 2QQ8A 2JNHA 4IBJA 3B74A 4I4LA 3D8LA 1G41A 4DV4M 4NSRA 2QSFX 3AOEA 2UXCM 3FD9A 3E9SA 4BBAA 3MJ5A 2L09A 3U5ZA 4LF9M 3HZJA 1XC8A 1VG5A 1N75A 4XBOA 4I5SA 1YLAA 2R6FA 3A46A 4MGKE 1JR3D 1T43A 3DOAA 3HHWA 3B7QA 1Q3BA 1OKSA 4JI5M 2A5YB 3KOWE 2RKOA 2DZOB 3BXWA 1IXZA 2LVQD 2HWJA 4M9SA 4XK8F 3HHYA 3GLGB 2LTUA 4A3VB 2JY6B 3PVSA 3NBIA 4JI8M 2DNAA 4JI2M 2D7GA 2KZUA 1PGYA 2R44A 3SHGB 4AKGA 2F5NA 5ITQA 1DGGA 4B08A 1L2DA 3GLHE 2ZAOA 5EXXA 4B3SM 2D7HA 1IBLM 3GRVA 2EJSA 1ZMUA 4DR6M 1N32M 1GJTA 2LHCA 3FYDA 3K1JA 1I4WA 4OX9M 4NXNM 3L26A 2HAKA 4G4RA 3NBXX 3M6AA 3V76A 1HT1E 1NHWC 4GC5A 3M7GA 1PJQA 3PFIA 2CE7A 2KRUA 1PJTA 4GC9A 1IXRC 3J80S 4JI6M 2DI0A 5LMNM 1QUTA 4BB9A 3QWLA 4M9XA 3MMPA 2CP8A 5ITUA 1OQYA 4D81A 1R5LA 3JR4A 1BVSA 2KXEA 5EQTA 1ZMWA 2DKLA 3JAMS 1L2CA 3I4YA 4LRSA 2V1UA 4DR4M 3QYBA 3TWKA 1HR0M 3B9PA 3B89A 4R7GA 2O01F 3A42A 2JXNA 4AI6A 3GLFA 3KP0E 2KEBA 3SFZA 1VEKA 3SASA 4WW0A 1N36M 4LFAM 4AZFA 2R4EA 1TR8A 2JY7A 3HHXA 3TE6A 2KW0A 2HL7A 1P3QQ 3LMMA 1XNQM 3U6LA 2BJVA 3CTWB 5E26A 1XMQM 2O25A 1Z59A 2R65A 1NHGC 1MN3A 1T6OA 1OFHA 4F1IA 4MGZE 4DR2M 2DAIA 1C7YA 4LCBA 1AUAA 4AW4A 2JZ1A 2YQZA 4ITQA 1JQJC 4FWDA 1EIJA 1NO1A 2YNMD 1N78A 5ITRA 2KA6B 3TWLA 4M9ZA 2XSZD 1IN7A 2F5OA 4LFCM 4PDGA 3KP1E 1SXJA 2LVNC 5BR8M 5KQDA 2W82A 4LF5M 5DYGA 3K9OA 4IBCA 1QAQA 2CV1A 1LTMA 4CIZA 2E5LM 1R7RA 3C3DA 4LJ9A 1GABA 2XH9A 4Z8XA 4FCWA 4AG5A 2F5SA 3U6EA 3DZDA 1XNRM 4FVMA 1XXHB 3FRHA 1K3XA 2C99A 1K82A 4JI7M 1G71A 4L6V6 3U61B 2JP7A 1WJ7A 2C98A 3GLHB 1DGHB 3IG5A 1IY0A 4JV5M 4FD2A 2KZSA 1NV9A 3MHVC 1K3WA 4GH9A 3KSXA 1NY6A 2ZAMA 3T15A 3VLFB 4DV5M 5IREB 2M5ZA 4Z6YA 3MK6A 3K2LA 5JI2E 4AKHA 1XB2B 2UUAM 1HNXM 4D80A 1GJSA 3U6OA 2VIIA 2Y0TA 5BPVA 2ZM6M 2DAMA 2G5GX 3HGIA 4G3OA 2WSCF 3U60A 5FLXS 2EUCA 1N34M 2YR0A 5C18A 4MGIE 3FUXA 4QHSA 4IJEA 3H4MA 2QCUA 5A2QS 2FNAA 3EIHA 4REZA 3SAUA 3PNYA 5DYIA 4R71A 4LJ5A 2Y0QA 2H1RA 2P5TA 4P16A 2DWNA 2JA2A 3GLFE 3IG8A 4LF7M 3T1YM 4M0DA 2JZ0A 2MJ5B 4MM3B 1L2BA 3U6SA 1IN8A 1D0KA 1QVRA 1HQYE 1EFUB 3I4VA 1OJLA 4IBEA 5FTLA 1PJJA 3RGPA 2XSZA 1I94M 4YY3M 3W0LB 3WHLA 4LJ4A 2I7PA 4K0KM 5L8RF 1A5TA 4DR7M 1TF0B 4NRWA 1AIPC 3U5ZB 1OIZA 1JR3E 2Z7JA 1IY2A 5FSWA 3FTCA 2MROB 3GPUA 3HJQA 1OAIA 4DR1M 3J7AS 4GIPA 3H4JA 2LVPC 2QNJA 1GVNA 4UN2B 3SATA 2XFSA 4LF4M 2LNHC 4RF0A 3RGSA 2CHQA 1IBKM 3FUWA 1GKIA 2ZBKB 3E46A 1SXJD 3KW6A 3U6CA 2HCBA 2VF8A 3CF0A 5EP4A 5FTJA 1XXHE 1VEGA 5EP1A 2XLJA 3U6MA 2L4EA 1QAOA 3SARA 4JXJA 4KO8A 4L15A 3T38A 1VEJA 2WSFF 3GPXA 2C9OA 4AKIA 1QZEA 3HWSA 4RNAA 4G4OA 1WHCA 3VKGA 4MGHA 1L8QA 2G8LA 1PJIA 8CATA 1QDTA 2JY8A 3FE3A 1XHBA 2FS1A 2R4JA 1D2NA 3U6PA 1UFZA 2K0BX 2X49A 4IBFA 1HJPA 3SBJA 1J09A 2CWBA 4PCZA 3K9PA 3UJNA 5C1BA 2J7OA 1Z6TA 3KFUG 3FRIA 1KFVA 2OOAA 3NWLA 4IJFA 5E6JA 5JI3E 3GLIA 2GQFA 1YSYA 1Z5BA 5ITXA 1Y8GA 2RGHA 5KQ8A 1CUKA 2UXDM 4DV3M 3Q8XA 2QBYA 4LGYA 2C5RA 3SC3A 3M0EA 4IIWA 2L7IA 4G4QA 2ERCA 1DGBA 3HU3A 3FTFA 1QYRA 3GLFB 2R62A 4ZPXA 4EIWA 3OTOM 2UXBM 3VDUA 3LQQA 5FTKA 3KXEC 1LV7A 3GO8A 5KPZA 1N33M 3UGJA 2Q2EB 1ZV1A 3HHZA 4TUWA 2NQ8C 3E4RA 4JN6A 4IBIA 3E21A 4LY6A 2F5PA 2DHYA 1F4IA
chains in the Genus database with same CATH topology
3SMSA 4GHLA 2L7HA 5EXPA 2XEPA 3L28A 4GMQA 1DO2A 4FCVA 2HHHM 4LJ7A 4S12A 3FUUA 2Y20A 3BOSA 4DUZM 1XMOM 3FUTA 1SXJB 3EIEA 5EJCA 4FWHA 1Q39A 4NOOB 4AG6A 3I51A 3AOEC 1QAMA 5IZ7D 1GL7A 1IBMM 1H6UA 2K47A 4B3RM 1E9RA 3R8FA 2LH0A 4JI3M 4GKJM 3TQSA 2Z3XA 1FJGM 1DO0A 3VFDA 2DHRA 2EA0A 4DR3M 1QANA 3GQ3A 2RGOA 1E9SA 1IQPA 1NNUC 4GRIA 1TH2A 3GP1A 3GPYA 2CEAA 4CGYB 4L8RC 4I8OA 4PD2A 2OPFA 1IN4A 3K8ZA 4PT5A 4MGYE 4G6ZA 4DV0M 3RE8A 3PNVA 3VK8A 4GHAA 1NNJA 3LVVA 4DUYM 3U60B 1IM2A 1X37A 3TL4X 3FTEA 1NY5A 1XWIA 5ITXE 4OVZA 1VDDA 2DVWB 3L25A 3UK6A 1E32A 1E94E 4JYAM 3AOGA 2CHGA 4B3TM 3DA1A 3GRYA 2I7NA 4LRTA 4L16A 1ZAEA 4XGIA 3HU2A 2X4AA 3ZH9B 4LF6M 4DV6M 1EE8A 3SMPA 3SAWA 3A45A 4WURA 1IY1A 3KS8A 4M0WA 2FOIC 3J27B 3UZUA 4NL4H 4AQYM 3KDSE 1OFIA 2DWZB 4G4NA 2F5QA 5ITYA 4QNRA 1IN5A 3VK7A 2VQEM 4IBDA 1TH4A 3J2PB 4IBKA 2KRKA 3L29A 2UU9M 1Q3CA 4LJ8A 1QZMA 3SAVA 2YFQA 1SXJE 2DZNB 2V1CA 4LJAA 1FNNA 2AHMA 4HLQA 4NRVA 3DFZA 3HU1A 4B7FA 2FE8A 4JI4M 4W5WA 3U6DA 4I81A 5FTNA 1HNWM 4OU7A 2M60A 1HQCA 4JI0M 4B7HA 3FKEA 2O5RA 3T1HM 1DGFA 3AJIB 1PM5A 2QP9X 5KPTA 3SYLA 3GLGA 3VKHA 1SXJC 4MB7A 3FTDA 2R18A 4JI1M 2FFJA 2CUZA 4FCTA 1IN6A 5FTMA 4R3DA 4DV7M 3QAUA 4MH0E 2F4VM 1J5EM 4KLNA 4X64M 1S3SA 5F3WA 1HNZM 4LGMA 2CHVA 1T3TA 5EXSA 4PDIA 2DWMA 2XFTA 5DNYA 5H37D 2LXEA 3R9XB 4FWGA 3LVWA 3GLIB 3VDPA 4OW0A 3GQ4A 5IT9S 2QBYB 5IWAM 4KHPM 1R2YA 5LMUM 3FYCA 3C58A 1W5SA 1ORYB 3GRUA 3CF2A 1J7KA 3ZC7B 3TWMA 3KS4A 4DR5M 4LG2A 2HKJA 3L27A 1MU5A 1TH3A 3AV0A 1TGUA 3KOZE 3D8BA 1HT2E 1YE9A 3AKZA 2R45A 4B3MM 1QQWA 2EO2A 1NSFA 1NVMA 3J81S 1ZQ9A 4YHHM 4LF8M 2Z4RA 3HJ8A 3TPZA 2ZANA 2XGNA 1Z5CA 2QZ4A 4KODA 2XZFA 1KSFX 3HKPA 7CATA 4IBBA 3AFHA 3KOYE 5ITTA 4D82A 3KSJA 3LQRA 1L1ZA 2CFOA 1KYIA 1N77A 2OQ4A 5EXTA 3HJSA 2Z4SA 1Z5AA 1JR3A 3SHFA 3A98B 3CF6E 1TDHA 4GKKM 3L2AA 3RFWA 4CHTB 1YUBA 2QPAA 2DXIA 4LJ6A 3K92A 3SYKA 5EP3A 4CISA 1TDZA 2BNKA 2J7NA 1G3IA 1R6BX 4NSOB 4QOSA 3WHKA 4DV2M 3UMMA 4X62M 3JR5A 3U6QA 3THGA 3KOXE 4FW9A 4DV1M 1XXHA 3PXGA 2C9CA 4GITA 5GKNA 2CV2A 2Y21A 3GLHA 3U61A 1DGHA 4IBGA 1GL6A 1GLNA 1C1KA 2L6OA 4BLCA 2D7EA 2UUCM 4II7A 3GQ5A 4X65M 2XF3A 3FUVA 1R2ZA 4LZZA 4OVZB 3GRRA 1L1TA 2BJWA 5EP2A 2V6ZM 2LWXA 4RF1A 2VQFM 1UM8A 1G4AE 5KO3A 2QENA 1W5TA 4LZJA 3J7BA 2UUBM 4HL4A 1WXQA 4B7GA 2XZUA 3W0FA 1NJFA 4X66M 3GPPA 2DWLA 1MX0A 4QHTA 4QNMA 4L78A 4NXMM 1G59A 4QOZC 2C96A 1NJGA 3ZCBB 2X8AA 4L4UA 3KVWA 1IXSB 2R46A 5KPRA 3AL0C 3ILKA 1G8PA 4IBJA 4I4LA 3D8LA 1G41A 4DV4M 4NSRA 3AOEA 2UXCM 3FD9A 3E9SA 4BBAA 3MJ5A 2L09A 3U5ZA 4LF9M 1XC8A 1N75A 4XBOA 4I5SA 3A46A 4MGKE 1JR3D 3DOAA 3HHWA 1Q3BA 4JI5M 2A5YB 3KOWE 2RKOA 2DZOB 1IXZA 3GLGB 4M9SA 3HHYA 4A3VB 3PVSA 3NBIA 4JI8M 4JI2M 2D7GA 2KZUA 3SHGB 4AKGA 2F5NA 5ITQA 1DGGA 4B08A 1L2DA 5EXXA 2ZAOA 4B3SM 2D7HA 1IBLM 3GRVA 4DR6M 1N32M 3FYDA 3K1JA 1I4WA 4OX9M 4NXNM 3L26A 4G4RA 3M6AA 1HT1E 1NHWC 4GC5A 3M7GA 3PFIA 2CE7A 2KRUA 4GC9A 1IXRC 3J80S 4JI6M 5LMNM 4BB9A 3QWLA 4M9XA 5ITUA 2CV0A 4LFBM 4D81A 3JR4A 5EQTA 2KXEA 1L2CA 2V1UA 3JAMS 3I4YA 4LRSA 4DR4M 3TWKA 1HR0M 3B9PA 4R7GA 3A42A 4AI6A 3GLFA 3KP0E 2KEBA 3SFZA 3SASA 4WW0A 1N36M 4LFAM 4AZFA 2R4EA 3HHXA 3TE6A 2KW0A 2HL7A 3LMMA 1XNQM 3U6LA 2BJVA 3CTWB 5E26A 1XMQM 1Z59A 2R65A 1NHGC 1OFHA 4MGZE 4DR2M 4LCBA 4AW4A 2YQZA 4ITQA 1JQJC 4FWDA 2YNMD 1N78A 5ITRA 2KA6B 3TWLA 4M9ZA 2XSZD 1IN7A 2F5OA 4LFCM 4PDGA 3KP1E 1SXJA 5BR8M 5KQDA 2W82A 4LF5M 5DYGA 4IBCA 1QAQA 2CV1A 2E5LM 1R7RA 4LJ9A 2XH9A 4Z8XA 4FCWA 4AG5A 2F5SA 3U6EA 3DZDA 1XNRM 4FVMA 1XXHB 1K3XA 2C99A 1K82A 4JI7M 3U61B 3GLHB 2C98A 3IG5A 4JV5M 1DGHB 1IY0A 4FD2A 2KZSA 3MHVC 1K3WA 4GH9A 3KSXA 2ZAMA 1NY6A 3T15A 3VLFB 4DV5M 5IREB 2M5ZA 4Z6YA 3MK6A 3K2LA 5JI2E 4AKHA 2UUAM 1HNXM 4D80A 3U6OA 2VIIA 2Y0TA 5BPVA 2ZM6M 2G5GX 3HGIA 3U60A 5FLXS 2EUCA 1N34M 2YR0A 5C18A 4MGIE 3FUXA 4QHSA 4IJEA 3H4MA 2QCUA 5A2QS 2FNAA 3EIHA 4REZA 3SAUA 3PNYA 5DYIA 4LJ5A 2Y0QA 2H1RA 2P5TA 4P16A 2DWNA 2JA2A 3IG8A 4LF7M 3T1YM 4M0DA 4MM3B 1L2BA 3U6SA 1IN8A 1QVRA 1HQYE 3I4VA 4IBEA 1OJLA 5FTLA 1PJJA 3RGPA 2XSZA 1I94M 4YY3M 3W0LB 3WHLA 4LJ4A 2I7PA 4K0KM 4DR7M 4NRWA 3U5ZB 2Z7JA 1IY2A 5FSWA 3FTCA 3GPUA 3HJQA 4DR1M 3J7AS 4GIPA 1GVNA 3SATA 2XFSA 4LF4M 2LNHC 4RF0A 3RGSA 2CHQA 1IBKM 3FUWA 1GKIA 2ZBKB 3U6CA 1SXJD 3KW6A 2HCBA 3CF0A 5EP4A 5FTJA 2XLJA 5EP1A 3U6MA 1QAOA 3SARA 4JXJA 4KO8A 4L15A 3T38A 3GPXA 2C9OA 4AKIA 3HWSA 4RNAA 4G4OA 3VKGA 4MGHA 1L8QA 2G8LA 1PJIA 8CATA 1XHBA 2R4JA 1D2NA 3U6PA 2X49A 4IBFA 3SBJA 1J09A 4PCZA 3UJNA 5C1BA 2J7OA 1Z6TA 3KFUG 1KFVA 4IJFA 3NWLA 5E6JA 5JI3E 3GLIA 1YSYA 1Z5BA 5ITXA 2RGHA 5KQ8A 2UXDM 4DV3M 3Q8XA 2QBYA 4LGYA 2C5RA 3SC3A 3M0EA 4IIWA 2L7IA 4G4QA 2ERCA 1DGBA 3HU3A 3FTFA 1QYRA 3GLFB 2R62A 4ZPXA 4EIWA 3OTOM 2UXBM 3VDUA 3LQQA 5FTKA 3KXEC 1LV7A 3GO8A 5KPZA 1N33M 3UGJA 2Q2EB 3HHZA 4TUWA 2NQ8C 3E4RA 4JN6A 4IBIA 4LY6A 2F5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 M;  1HNZ M;  4DV4 M;  4PDI A;  2UUA M;  1HNX M;  2UXC M;  2HHH M;  4LF9 M;  3U6O A;  4DUZ M;  1XMO M;  2ZM6 M;  1XC8 A;  3GQ4 A;  5IT9 S;  5FLX S;  1Q39 A;  1N34 M;  5IWA M;  3A46 A;  3DOA A;  4KHP M;  1R2Y A;  5LMU M;  1Q3B A;  3C58 A;  4JI5 M;  1IBM M;  3TWM A;  4DR5 M;  5A2Q S;  4B3R M;  2HKJ A;  3SAU A;  4JI3 M;  1MU5 A;  4GKJ M;  4JI8 M;  1FJG M;  4DR3 M;  4LF7 M;  2EA0 A;  4JI2 M;  3GQ3 A;  3T1Y M;  2F5N A;  1L2B A;  3U6S A;  4B3M M;  3GP1 A;  3GPY A;  5ITQ A;  1L2D A;  4B3S M;  1PJJ A;  3J81 S;  4YHH M;  4LF8 M;  1IBL M;  1I94 M;  1Z5C A;  4PD2 A;  4YY3 M;  4DR6 M;  4LF6 M;  2OPF A;  4K0K M;  1N32 M;  2XZF A;  4DV0 M;  4DR7 M;  4NRW A;  4OX9 M;  4NXN M;  4G4R A;  5ITT A;  1L1Z A;  3VK8 A;  1NNJ A;  3GPU A;  4DUY M;  4DR1 M;  3J7A S;  2OQ4 A;  1Z5A A;  5ITX E;  1TDH A;  3SAT A;  3J80 S;  4JI6 M;  4LF4 M;  5LMN M;  1IBK M;  4GKK M;  5ITU A;  4LFB M;  3JR4 A;  2ZBK B;  3U6C A;  1L2C A;  4JYA M;  3JAM S;  4B3T M;  4CIS A;  4DR4 M;  1TDZ A;  3TWK A;  1HR0 M;  3U6M A;  4DV2 M;  3SAR A;  3A42 A;  4X62 M;  3JR5 A;  3SAS A;  4DV6 M;  1EE8 A;  3U6Q A;  3GPX A;  3SAW A;  3A45 A;  4LFA M;  4DV1 M;  1N36 M;  4G4O A;  4AQY M;  1XNQ M;  1PJI A;  4G4N A;  3U6L A;  2F5Q A;  5ITY A;  1XMQ M;  3VK7 A;  2VQE M;  1Z59 A;  3U6P A;  3SBJ A;  4PCZ A;  2UUC M;  4DR2 M;  3GQ5 A;  4X65 M;  1Q3C A;  2UU9 M;  3SAV A;  4ITQ A;  1KFV A;  5ITR A;  3TWL A;  1R2Z A;  4NRV A;  1Z5B A;  5ITX A;  1L1T A;  2F5O A;  4LFC M;  4PDG A;  5BR8 M;  2VQF M;  2UXD M;  4JI4 M;  4DV3 M;  3U6D A;  4LF5 M;  1HNW M;  2UUB M;  4G4Q A;  2E5L M;  4JI0 M;  3OTO M;  2UXB M;  2F5S A;  3U6E A;  3T1H M;  1PM5 A;  1XNR M;  2XZU A;  3W0F A;  4X66 M;  3GPP A;  1K3X A;  3GO8 A;  4MB7 A;  1MX0 A;  4NXM M;  1N33 M;  1K82 A;  2Q2E B;  4JI7 M;  4JI1 M;  4JV5 M;  1J5E M;  4DV7 M;  2F4V M;  2F5P A;  1K3W A;  4X64 M; 
#chains in the Genus database with same CATH topology
 3SMS A;  4GHL A;  2OO9 A;  2L7H A;  5EXP A;  1QUS A;  1DV0 A;  2XEP A;  1NV8 A;  3L28 A;  4GMQ A;  1DO2 A;  4FCV A;  4P17 A;  2K9D A;  2HHH M;  4LJ7 A;  4S12 A;  3FUU A;  2Y20 A;  3BOS A;  4DUZ M;  1XMO M;  3FUT A;  3C9P A;  3T6P A;  2G3Q A;  1SXJ B;  2GNO A;  3EIE A;  5EJC A;  2ZTD A;  4FWH A;  1Q39 A;  1WGN A;  4NOO B;  2EKK A;  3I51 A;  4AG6 A;  3AOE C;  3BBZ A;  3W68 A;  1QAM A;  5IZ7 D;  1GL7 A;  1IBM M;  1H6U A;  2K47 A;  4B3R M;  1E9R A;  3R8F A;  2LH0 A;  4JI3 M;  4GKJ M;  3TQS A;  2Z3X A;  2LBC A;  2WZJ A;  4KT0 F;  1FJG M;  1DO0 A;  3VFD A;  2DHR A;  2EA0 A;  4DR3 M;  1QAN A;  3GQ3 A;  2RGO A;  1E9S A;  1IQP A;  1NNU C;  2J5Y A;  4GRI A;  1TH2 A;  3GP1 A;  3GPY A;  2CEA A;  4GEW A;  4CGY B;  4RKU F;  4L8R C;  4I8O A;  2JUJ A;  4PD2 A;  2OPF A;  1IN4 A;  3K8Z A;  4PT5 A;  1PRB A;  4G6Z A;  4MGY E;  4DV0 M;  4WP2 A;  1TTE A;  3RE8 A;  3PNV A;  3VK8 A;  4GHA A;  1NNJ A;  3LVV A;  1MJG M;  2WSE F;  4DUY M;  1IM2 A;  1X37 A;  3TL4 X;  3U60 B;  2DAK A;  3FTE A;  1NY5 A;  1XWI A;  2EKF A;  3GLI E;  5ITX E;  4OVZ A;  1VDD A;  2DVW B;  3L25 A;  3UK6 A;  1E32 A;  1E94 E;  4JYA M;  3AOG A;  2CHG A;  4B3T M;  3DA1 A;  3GRY A;  3IEC A;  2I7N A;  2BWE A;  4LRT A;  4L16 A;  1ZAE A;  4XGI A;  2K6B A;  4HEO A;  2MR9 A;  3HU2 A;  2X4A A;  3ZH9 B;  4LF6 M;  4DV6 M;  1EE8 A;  3SMP A;  3SAW A;  1D0M A;  3A45 A;  4WUR A;  1IY1 A;  3KS8 A;  4LFB M;  4M0W A;  2FOI C;  4DBG B;  3J27 B;  3UZU A;  4NL4 H;  4AQY M;  3KDS E;  1OFI A;  2DWZ B;  4G4N A;  2F5Q A;  3B7Z A;  5ITY A;  4QNR A;  1IN5 A;  3VK7 A;  2VQE M;  3QYE A;  1OAO C;  4IBD A;  1IXS A;  1TH4 A;  3J2P B;  4IBK A;  2KRK A;  1R4G A;  3L29 A;  2UU9 M;  1Q3C A;  4LJ8 A;  1QZM A;  2VDB B;  3SAV A;  2YFQ A;  1SXJ E;  2DZN B;  2V1C A;  1VQ1 A;  3I04 M;  4LJA A;  1FNN A;  2DZL A;  3I01 M;  2AHM A;  2JWS A;  4HLQ A;  3DFZ A;  1Q02 A;  4NRV A;  3HU1 A;  2Z8Y M;  4B7F A;  2FE8 A;  4JI4 M;  4W5W A;  3U6D A;  1QDR A;  1WGL A;  4I81 A;  5FTN A;  1HNW M;  4OU7 A;  2M60 A;  1HQC A;  4JI0 M;  4B7H A;  3FKE A;  2O5R A;  3T1H M;  1DGF A;  3AJI B;  1PM5 A;  2QP9 X;  5KPT A;  3SYL A;  3GLG A;  3VKH A;  1SXJ C;  4MB7 A;  3FTD A;  2R18 A;  4JI1 M;  2FFJ A;  2CUZ A;  4FCT A;  1IN6 A;  5FTM A;  4R3D A;  4DV7 M;  3QAU A;  4MH0 E;  2F4V M;  1OIP A;  1IFY A;  1J5E M;  4KLN A;  4X64 M;  1S3S A;  3CGW A;  2DAG A;  5F3W A;  4LGM A;  2CHV A;  1HNZ M;  2OOB A;  1T3T A;  5EXS A;  4PDI A;  2DWM A;  3Q8G A;  2XFT A;  3LW5 F;  5DNY A;  2L2D A;  2LXE A;  5H37 D;  3R9X B;  4FWG A;  4Y28 F;  3LVW A;  1GO5 A;  3GLI B;  3VDP A;  1PJS A;  2CV0 A;  4OW0 A;  2VF7 A;  4CJ6 A;  3GQ4 A;  5IT9 S;  1V34 A;  2QBY B;  5IWA M;  4KHP M;  1R2Y A;  5LMU M;  1ZMV A;  3FYC A;  1W5S A;  3C58 A;  1ORY B;  2KDL A;  2KHH A;  3CF2 A;  3GRU A;  1J7K A;  3ZC7 B;  3TWM A;  3KS4 A;  4DR5 M;  4LG2 A;  2HKJ A;  3L27 A;  1SG9 A;  1MU5 A;  1TH3 A;  3AV0 A;  1TGU A;  3KOZ E;  3D8B A;  2N35 A;  1WR1 B;  1HT2 E;  1YE9 A;  3AKZ A;  2R45 A;  4B3M M;  1QQW A;  2EO2 A;  1NSF A;  1V92 A;  1NVM A;  3J81 S;  1ZQ9 A;  4YHH M;  4LF8 M;  2Z4R A;  3HJ8 A;  3TPZ A;  2ZAN A;  2XGN A;  1Z5C A;  1WIV A;  2B3T A;  2CRU A;  2QZ4 A;  4KOD A;  4F2L A;  2XZF A;  1KSF X;  3B7N A;  3HKP A;  7CAT A;  4IBB A;  3AFH A;  3KOY E;  5ITT A;  4D82 A;  3KSJ A;  3LQR A;  4Q7J A;  1L1Z A;  2RRU A;  2CFO A;  1KYI A;  1N77 A;  2OQ4 A;  5EXT A;  3HJS A;  2Z4S A;  1Z5A A;  1JR3 A;  2LVO C;  1D0L A;  3A98 B;  3SHF A;  3CF6 E;  1TDH A;  4ANR A;  3ZQJ A;  2R0I A;  2QHO B;  4GKK M;  3L2A A;  1OTR A;  3RFW A;  1YUB A;  1RU3 A;  3F92 A;  2QPA A;  4CHT B;  2DXI A;  4LJ6 A;  3K92 A;  3SYK A;  5EP3 A;  4CIS A;  1TDZ A;  2BNK A;  2J7N A;  1G3I A;  1R6B X;  4NSO B;  4QOS A;  3WHK A;  4DV2 M;  3HX3 A;  3UMM A;  4X62 M;  3JR5 A;  3GLG E;  2DAE A;  3U6Q A;  3THG A;  3KOX E;  4FW9 A;  4DV1 M;  1XXH A;  3PXG A;  2C9C A;  4GIT A;  5GKN A;  2CV2 A;  3C3E A;  2Y21 A;  3GLH A;  3U61 A;  1DGH A;  4IBG A;  1JB0 F;  2FH0 A;  1GL6 A;  3LCV B;  3IHP A;  1GLN A;  1C1K A;  2H5X A;  2L6O A;  4NC6 A;  4BLC A;  2D7E A;  2UUC M;  2KNA A;  4II7 A;  2L4F A;  3GQ5 A;  2MGW A;  4X65 M;  2JY5 A;  2XF3 A;  3FUV A;  5DFL A;  4LZZ A;  1R2Z A;  4OVZ B;  3GRR A;  1L1T A;  2BJW A;  2BWB A;  1VDL A;  2KNZ A;  3LCU A;  2V6Z M;  5EP2 A;  2LWX A;  4RF1 A;  2VQF M;  2APL A;  2DEN A;  1UM8 A;  1G4A E;  5KO3 A;  2QEN A;  1W5T A;  4LZJ A;  3J7B A;  2UUB M;  1V33 A;  4HL4 A;  1WXQ A;  2KNV A;  4B7G A;  2XZU A;  3W0F A;  1NJF A;  4X66 M;  3GPP A;  2DWL A;  1MX0 A;  4QHT A;  4QNM A;  4L78 A;  4NXM M;  2LVA A;  3W67 A;  1G59 A;  4QOZ C;  2C96 A;  1NJG A;  2LHG A;  2MH8 A;  3HY5 A;  3ZCB B;  2X8A A;  4L4U A;  3KVW A;  2ZTC A;  1IXS B;  2R46 A;  5KPR A;  3AL0 C;  3ILK A;  1G8P A;  2QQ8 A;  2JNH A;  4IBJ A;  3B74 A;  4I4L A;  3D8L A;  1G41 A;  4DV4 M;  4NSR A;  2QSF X;  3AOE A;  2UXC M;  3FD9 A;  3E9S A;  4BBA A;  3MJ5 A;  2L09 A;  3U5Z A;  4LF9 M;  3HZJ A;  1XC8 A;  1VG5 A;  1N75 A;  4XBO A;  4I5S A;  1YLA A;  2R6F A;  3A46 A;  4MGK E;  1JR3 D;  1T43 A;  3DOA A;  3HHW A;  3B7Q A;  1Q3B A;  1OKS A;  4JI5 M;  2A5Y B;  3KOW E;  2RKO A;  2DZO B;  3BXW A;  1IXZ A;  2LVQ D;  2HWJ A;  4M9S A;  4XK8 F;  3HHY A;  3GLG B;  2LTU A;  4A3V B;  2JY6 B;  3PVS A;  3NBI A;  4JI8 M;  2DNA A;  4JI2 M;  2D7G A;  2KZU A;  1PGY A;  2R44 A;  3SHG B;  4AKG A;  2F5N A;  5ITQ A;  1DGG A;  4B08 A;  1L2D A;  3GLH E;  2ZAO A;  5EXX A;  4B3S M;  2D7H A;  1IBL M;  3GRV A;  2EJS A;  1ZMU A;  4DR6 M;  1N32 M;  1GJT A;  2LHC A;  3FYD A;  3K1J A;  1I4W A;  4OX9 M;  4NXN M;  3L26 A;  2HAK A;  4G4R A;  3NBX X;  3M6A A;  3V76 A;  1HT1 E;  1NHW C;  4GC5 A;  3M7G A;  1PJQ A;  3PFI A;  2CE7 A;  2KRU A;  1PJT A;  4GC9 A;  1IXR C;  3J80 S;  4JI6 M;  2DI0 A;  5LMN M;  1QUT A;  4BB9 A;  3QWL A;  4M9X A;  3MMP A;  2CP8 A;  5ITU A;  1OQY A;  4D81 A;  1R5L A;  3JR4 A;  1BVS A;  2KXE A;  5EQT A;  1ZMW A;  2DKL A;  3JAM S;  1L2C A;  3I4Y A;  4LRS A;  2V1U A;  4DR4 M;  3QYB A;  3TWK A;  1HR0 M;  3B9P A;  3B89 A;  4R7G A;  2O01 F;  3A42 A;  2JXN A;  4AI6 A;  3GLF A;  3KP0 E;  2KEB A;  3SFZ A;  1VEK A;  3SAS A;  4WW0 A;  1N36 M;  4LFA M;  4AZF A;  2R4E A;  1TR8 A;  2JY7 A;  3HHX A;  3TE6 A;  2KW0 A;  2HL7 A;  1P3Q Q;  3LMM A;  1XNQ M;  3U6L A;  2BJV A;  3CTW B;  5E26 A;  1XMQ M;  2O25 A;  1Z59 A;  2R65 A;  1NHG C;  1MN3 A;  1T6O A;  1OFH A;  4F1I A;  4MGZ E;  4DR2 M;  2DAI A;  1C7Y A;  4LCB A;  1AUA A;  4AW4 A;  2JZ1 A;  2YQZ A;  4ITQ A;  1JQJ C;  4FWD A;  1EIJ A;  1NO1 A;  2YNM D;  1N78 A;  5ITR A;  2KA6 B;  3TWL A;  4M9Z A;  2XSZ D;  1IN7 A;  2F5O A;  4LFC M;  4PDG A;  3KP1 E;  1SXJ A;  2LVN C;  5BR8 M;  5KQD A;  2W82 A;  4LF5 M;  5DYG A;  3K9O A;  4IBC A;  1QAQ A;  2CV1 A;  1LTM A;  4CIZ A;  2E5L M;  1R7R A;  3C3D A;  4LJ9 A;  1GAB A;  2XH9 A;  4Z8X A;  4FCW A;  4AG5 A;  2F5S A;  3U6E A;  3DZD A;  1XNR M;  4FVM A;  1XXH B;  3FRH A;  1K3X A;  2C99 A;  1K82 A;  4JI7 M;  1G71 A;  4L6V 6;  3U61 B;  2JP7 A;  1WJ7 A;  2C98 A;  3GLH B;  1DGH B;  3IG5 A;  1IY0 A;  4JV5 M;  4FD2 A;  2KZS A;  1NV9 A;  3MHV C;  1K3W A;  4GH9 A;  3KSX A;  1NY6 A;  2ZAM A;  3T15 A;  3VLF B;  4DV5 M;  5IRE B;  2M5Z A;  4Z6Y A;  3MK6 A;  3K2L A;  5JI2 E;  4AKH A;  1XB2 B;  2UUA M;  1HNX M;  4D80 A;  1GJS A;  3U6O A;  2VII A;  2Y0T A;  5BPV A;  2ZM6 M;  2DAM A;  2G5G X;  3HGI A;  4G3O A;  2WSC F;  3U60 A;  5FLX S;  2EUC A;  1N34 M;  2YR0 A;  5C18 A;  4MGI E;  3FUX A;  4QHS A;  4IJE A;  3H4M A;  2QCU A;  5A2Q S;  2FNA A;  3EIH A;  4REZ A;  3SAU A;  3PNY A;  5DYI A;  4R71 A;  4LJ5 A;  2Y0Q A;  2H1R A;  2P5T A;  4P16 A;  2DWN A;  2JA2 A;  3GLF E;  3IG8 A;  4LF7 M;  3T1Y M;  4M0D A;  2JZ0 A;  2MJ5 B;  4MM3 B;  1L2B A;  3U6S A;  1IN8 A;  1D0K A;  1QVR A;  1HQY E;  1EFU B;  3I4V A;  1OJL A;  4IBE A;  5FTL A;  1PJJ A;  3RGP A;  2XSZ A;  1I94 M;  4YY3 M;  3W0L B;  3WHL A;  4LJ4 A;  2I7P A;  4K0K M;  5L8R F;  1A5T A;  4DR7 M;  1TF0 B;  4NRW A;  1AIP C;  3U5Z B;  1OIZ A;  1JR3 E;  2Z7J A;  1IY2 A;  5FSW A;  3FTC A;  2MRO B;  3GPU A;  3HJQ A;  1OAI A;  4DR1 M;  3J7A S;  4GIP A;  3H4J A;  2LVP C;  2QNJ A;  1GVN A;  4UN2 B;  3SAT A;  2XFS A;  4LF4 M;  2LNH C;  4RF0 A;  3RGS A;  2CHQ A;  1IBK M;  3FUW A;  1GKI A;  2ZBK B;  3E46 A;  1SXJ D;  3KW6 A;  3U6C A;  2HCB A;  2VF8 A;  3CF0 A;  5EP4 A;  5FTJ A;  1XXH E;  1VEG A;  5EP1 A;  2XLJ A;  3U6M A;  2L4E A;  1QAO A;  3SAR A;  4JXJ A;  4KO8 A;  4L15 A;  3T38 A;  1VEJ A;  2WSF F;  3GPX A;  2C9O A;  4AKI A;  1QZE A;  3HWS A;  4RNA A;  4G4O A;  1WHC A;  3VKG A;  4MGH A;  1L8Q A;  2G8L A;  1PJI A;  8CAT A;  1QDT A;  2JY8 A;  3FE3 A;  1XHB A;  2FS1 A;  2R4J A;  1D2N A;  3U6P A;  1UFZ A;  2K0B X;  2X49 A;  4IBF A;  1HJP A;  3SBJ A;  1J09 A;  2CWB A;  4PCZ A;  3K9P A;  3UJN A;  5C1B A;  2J7O A;  1Z6T A;  3KFU G;  3FRI A;  1KFV A;  2OOA A;  3NWL A;  4IJF A;  5E6J A;  5JI3 E;  3GLI A;  2GQF A;  1YSY A;  1Z5B A;  5ITX A;  1Y8G A;  2RGH A;  5KQ8 A;  1CUK A;  2UXD M;  4DV3 M;  3Q8X A;  2QBY A;  4LGY A;  2C5R A;  3SC3 A;  3M0E A;  4IIW A;  2L7I A;  4G4Q A;  2ERC A;  1DGB A;  3HU3 A;  3FTF A;  1QYR A;  3GLF B;  2R62 A;  4ZPX A;  4EIW A;  3OTO M;  2UXB M;  3VDU A;  3LQQ A;  5FTK A;  3KXE C;  1LV7 A;  3GO8 A;  5KPZ A;  1N33 M;  3UGJ A;  2Q2E B;  1ZV1 A;  3HHZ A;  4TUW A;  2NQ8 C;  3E4R A;  4JN6 A;  4IBI A;  3E21 A;  4LY6 A;  2F5P A;  2DHY A;  1F4I A; 
#chains in the Genus database with same CATH homology
 3SMS A;  4GHL A;  2L7H A;  5EXP A;  2XEP A;  3L28 A;  4GMQ A;  1DO2 A;  4FCV A;  2HHH M;  4LJ7 A;  4S12 A;  3FUU A;  2Y20 A;  3BOS A;  4DUZ M;  1XMO M;  3FUT A;  1SXJ B;  3EIE A;  5EJC A;  4FWH A;  1Q39 A;  4NOO B;  4AG6 A;  3I51 A;  3AOE C;  1QAM A;  5IZ7 D;  1GL7 A;  1IBM M;  1H6U A;  2K47 A;  4B3R M;  1E9R A;  3R8F A;  2LH0 A;  4JI3 M;  4GKJ M;  3TQS A;  2Z3X A;  1FJG M;  1DO0 A;  3VFD A;  2DHR A;  2EA0 A;  4DR3 M;  1QAN A;  3GQ3 A;  2RGO A;  1E9S A;  1IQP A;  1NNU C;  4GRI A;  1TH2 A;  3GP1 A;  3GPY A;  2CEA A;  4CGY B;  4L8R C;  4I8O A;  4PD2 A;  2OPF A;  1IN4 A;  3K8Z A;  4PT5 A;  4MGY E;  4G6Z A;  4DV0 M;  3RE8 A;  3PNV A;  3VK8 A;  4GHA A;  1NNJ A;  3LVV A;  4DUY M;  3U60 B;  1IM2 A;  1X37 A;  3TL4 X;  3FTE A;  1NY5 A;  1XWI A;  5ITX E;  4OVZ A;  1VDD A;  2DVW B;  3L25 A;  3UK6 A;  1E32 A;  1E94 E;  4JYA M;  3AOG A;  2CHG A;  4B3T M;  3DA1 A;  3GRY A;  2I7N A;  4LRT A;  4L16 A;  1ZAE A;  4XGI A;  3HU2 A;  2X4A A;  3ZH9 B;  4LF6 M;  4DV6 M;  1EE8 A;  3SMP A;  3SAW A;  3A45 A;  4WUR A;  1IY1 A;  3KS8 A;  4M0W A;  2FOI C;  3J27 B;  3UZU A;  4NL4 H;  4AQY M;  3KDS E;  1OFI A;  2DWZ B;  4G4N A;  2F5Q A;  5ITY A;  4QNR A;  1IN5 A;  3VK7 A;  2VQE M;  4IBD A;  1TH4 A;  3J2P B;  4IBK A;  2KRK A;  3L29 A;  2UU9 M;  1Q3C A;  4LJ8 A;  1QZM A;  3SAV A;  2YFQ A;  1SXJ E;  2DZN B;  2V1C A;  4LJA A;  1FNN A;  2AHM A;  4HLQ A;  4NRV A;  3DFZ A;  3HU1 A;  4B7F A;  2FE8 A;  4JI4 M;  4W5W A;  3U6D A;  4I81 A;  5FTN A;  1HNW M;  4OU7 A;  2M60 A;  1HQC A;  4JI0 M;  4B7H A;  3FKE A;  2O5R A;  3T1H M;  1DGF A;  3AJI B;  1PM5 A;  2QP9 X;  5KPT A;  3SYL A;  3GLG A;  3VKH A;  1SXJ C;  4MB7 A;  3FTD A;  2R18 A;  4JI1 M;  2FFJ A;  2CUZ A;  4FCT A;  1IN6 A;  5FTM A;  4R3D A;  4DV7 M;  3QAU A;  4MH0 E;  2F4V M;  1J5E M;  4KLN A;  4X64 M;  1S3S A;  5F3W A;  1HNZ M;  4LGM A;  2CHV A;  1T3T A;  5EXS A;  4PDI A;  2DWM A;  2XFT A;  5DNY A;  5H37 D;  2LXE A;  3R9X B;  4FWG A;  3LVW A;  3GLI B;  3VDP A;  4OW0 A;  3GQ4 A;  5IT9 S;  2QBY B;  5IWA M;  4KHP M;  1R2Y A;  5LMU M;  3FYC A;  3C58 A;  1W5S A;  1ORY B;  3GRU A;  3CF2 A;  1J7K A;  3ZC7 B;  3TWM A;  3KS4 A;  4DR5 M;  4LG2 A;  2HKJ A;  3L27 A;  1MU5 A;  1TH3 A;  3AV0 A;  1TGU A;  3KOZ E;  3D8B A;  1HT2 E;  1YE9 A;  3AKZ A;  2R45 A;  4B3M M;  1QQW A;  2EO2 A;  1NSF A;  1NVM A;  3J81 S;  1ZQ9 A;  4YHH M;  4LF8 M;  2Z4R A;  3HJ8 A;  3TPZ A;  2ZAN A;  2XGN A;  1Z5C A;  2QZ4 A;  4KOD A;  2XZF A;  1KSF X;  3HKP A;  7CAT A;  4IBB A;  3AFH A;  3KOY E;  5ITT A;  4D82 A;  3KSJ A;  3LQR A;  1L1Z A;  2CFO A;  1KYI A;  1N77 A;  2OQ4 A;  5EXT A;  3HJS A;  2Z4S A;  1Z5A A;  1JR3 A;  3SHF A;  3A98 B;  3CF6 E;  1TDH A;  4GKK M;  3L2A A;  3RFW A;  4CHT B;  1YUB A;  2QPA A;  2DXI A;  4LJ6 A;  3K92 A;  3SYK A;  5EP3 A;  4CIS A;  1TDZ A;  2BNK A;  2J7N A;  1G3I A;  1R6B X;  4NSO B;  4QOS A;  3WHK A;  4DV2 M;  3UMM A;  4X62 M;  3JR5 A;  3U6Q A;  3THG A;  3KOX E;  4FW9 A;  4DV1 M;  1XXH A;  3PXG A;  2C9C A;  4GIT A;  5GKN A;  2CV2 A;  2Y21 A;  3GLH A;  3U61 A;  1DGH A;  4IBG A;  1GL6 A;  1GLN A;  1C1K A;  2L6O A;  4BLC A;  2D7E A;  2UUC M;  4II7 A;  3GQ5 A;  4X65 M;  2XF3 A;  3FUV A;  1R2Z A;  4LZZ A;  4OVZ B;  3GRR A;  1L1T A;  2BJW A;  5EP2 A;  2V6Z M;  2LWX A;  4RF1 A;  2VQF M;  1UM8 A;  1G4A E;  5KO3 A;  2QEN A;  1W5T A;  4LZJ A;  3J7B A;  2UUB M;  4HL4 A;  1WXQ A;  4B7G A;  2XZU A;  3W0F A;  1NJF A;  4X66 M;  3GPP A;  2DWL A;  1MX0 A;  4QHT A;  4QNM A;  4L78 A;  4NXM M;  1G59 A;  4QOZ C;  2C96 A;  1NJG A;  3ZCB B;  2X8A A;  4L4U A;  3KVW A;  1IXS B;  2R46 A;  5KPR A;  3AL0 C;  3ILK A;  1G8P A;  4IBJ A;  4I4L A;  3D8L A;  1G41 A;  4DV4 M;  4NSR A;  3AOE A;  2UXC M;  3FD9 A;  3E9S A;  4BBA A;  3MJ5 A;  2L09 A;  3U5Z A;  4LF9 M;  1XC8 A;  1N75 A;  4XBO A;  4I5S A;  3A46 A;  4MGK E;  1JR3 D;  3DOA A;  3HHW A;  1Q3B A;  4JI5 M;  2A5Y B;  3KOW E;  2RKO A;  2DZO B;  1IXZ A;  3GLG B;  4M9S A;  3HHY A;  4A3V B;  3PVS A;  3NBI A;  4JI8 M;  4JI2 M;  2D7G A;  2KZU A;  3SHG B;  4AKG A;  2F5N A;  5ITQ A;  1DGG A;  4B08 A;  1L2D A;  5EXX A;  2ZAO A;  4B3S M;  2D7H A;  1IBL M;  3GRV A;  4DR6 M;  1N32 M;  3FYD A;  3K1J A;  1I4W A;  4OX9 M;  4NXN M;  3L26 A;  4G4R A;  3M6A A;  1HT1 E;  1NHW C;  4GC5 A;  3M7G A;  3PFI A;  2CE7 A;  2KRU A;  4GC9 A;  1IXR C;  3J80 S;  4JI6 M;  5LMN M;  4BB9 A;  3QWL A;  4M9X A;  5ITU A;  2CV0 A;  4LFB M;  4D81 A;  3JR4 A;  5EQT A;  2KXE A;  1L2C A;  2V1U A;  3JAM S;  3I4Y A;  4LRS A;  4DR4 M;  3TWK A;  1HR0 M;  3B9P A;  4R7G A;  3A42 A;  4AI6 A;  3GLF A;  3KP0 E;  2KEB A;  3SFZ A;  3SAS A;  4WW0 A;  1N36 M;  4LFA M;  4AZF A;  2R4E A;  3HHX A;  3TE6 A;  2KW0 A;  2HL7 A;  3LMM A;  1XNQ M;  3U6L A;  2BJV A;  3CTW B;  5E26 A;  1XMQ M;  1Z59 A;  2R65 A;  1NHG C;  1OFH A;  4MGZ E;  4DR2 M;  4LCB A;  4AW4 A;  2YQZ A;  4ITQ A;  1JQJ C;  4FWD A;  2YNM D;  1N78 A;  5ITR A;  2KA6 B;  3TWL A;  4M9Z A;  2XSZ D;  1IN7 A;  2F5O A;  4LFC M;  4PDG A;  3KP1 E;  1SXJ A;  5BR8 M;  5KQD A;  2W82 A;  4LF5 M;  5DYG A;  4IBC A;  1QAQ A;  2CV1 A;  2E5L M;  1R7R A;  4LJ9 A;  2XH9 A;  4Z8X A;  4FCW A;  4AG5 A;  2F5S A;  3U6E A;  3DZD A;  1XNR M;  4FVM A;  1XXH B;  1K3X A;  2C99 A;  1K82 A;  4JI7 M;  3U61 B;  3GLH B;  2C98 A;  3IG5 A;  4JV5 M;  1DGH B;  1IY0 A;  4FD2 A;  2KZS A;  3MHV C;  1K3W A;  4GH9 A;  3KSX A;  2ZAM A;  1NY6 A;  3T15 A;  3VLF B;  4DV5 M;  5IRE B;  2M5Z A;  4Z6Y A;  3MK6 A;  3K2L A;  5JI2 E;  4AKH A;  2UUA M;  1HNX M;  4D80 A;  3U6O A;  2VII A;  2Y0T A;  5BPV A;  2ZM6 M;  2G5G X;  3HGI A;  3U60 A;  5FLX S;  2EUC A;  1N34 M;  2YR0 A;  5C18 A;  4MGI E;  3FUX A;  4QHS A;  4IJE A;  3H4M A;  2QCU A;  5A2Q S;  2FNA A;  3EIH A;  4REZ A;  3SAU A;  3PNY A;  5DYI A;  4LJ5 A;  2Y0Q A;  2H1R A;  2P5T A;  4P16 A;  2DWN A;  2JA2 A;  3IG8 A;  4LF7 M;  3T1Y M;  4M0D A;  4MM3 B;  1L2B A;  3U6S A;  1IN8 A;  1QVR A;  1HQY E;  3I4V A;  4IBE A;  1OJL A;  5FTL A;  1PJJ A;  3RGP A;  2XSZ A;  1I94 M;  4YY3 M;  3W0L B;  3WHL A;  4LJ4 A;  2I7P A;  4K0K M;  4DR7 M;  4NRW A;  3U5Z B;  2Z7J A;  1IY2 A;  5FSW A;  3FTC A;  3GPU A;  3HJQ A;  4DR1 M;  3J7A S;  4GIP A;  1GVN A;  3SAT A;  2XFS A;  4LF4 M;  2LNH C;  4RF0 A;  3RGS A;  2CHQ A;  1IBK M;  3FUW A;  1GKI A;  2ZBK B;  3U6C A;  1SXJ D;  3KW6 A;  2HCB A;  3CF0 A;  5EP4 A;  5FTJ A;  2XLJ A;  5EP1 A;  3U6M A;  1QAO A;  3SAR A;  4JXJ A;  4KO8 A;  4L15 A;  3T38 A;  3GPX A;  2C9O A;  4AKI A;  3HWS A;  4RNA A;  4G4O A;  3VKG A;  4MGH A;  1L8Q A;  2G8L A;  1PJI A;  8CAT A;  1XHB A;  2R4J A;  1D2N A;  3U6P A;  2X49 A;  4IBF A;  3SBJ A;  1J09 A;  4PCZ A;  3UJN A;  5C1B A;  2J7O A;  1Z6T A;  3KFU G;  1KFV A;  4IJF A;  3NWL A;  5E6J A;  5JI3 E;  3GLI A;  1YSY A;  1Z5B A;  5ITX A;  2RGH A;  5KQ8 A;  2UXD M;  4DV3 M;  3Q8X A;  2QBY A;  4LGY A;  2C5R A;  3SC3 A;  3M0E A;  4IIW A;  2L7I A;  4G4Q A;  2ERC A;  1DGB A;  3HU3 A;  3FTF A;  1QYR A;  3GLF B;  2R62 A;  4ZPX A;  4EIW A;  3OTO M;  2UXB M;  3VDU A;  3LQQ A;  5FTK A;  3KXE C;  1LV7 A;  3GO8 A;  5KPZ A;  1N33 M;  3UGJ A;  2Q2E B;  3HHZ A;  4TUW A;  2NQ8 C;  3E4R A;  4JN6 A;  4IBI A;  4LY6 A;  2F5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...