4DR5M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr5M02
2F5QA 2F5NA 4PCZA 3GQ3A 5BR8M 3GQ5A 5A2QS 4DR7M 2OQ4A 4B3RM 1HNZM 1N36M 5ITQA 1KFVA 1IBLM 4B3TM 2VQFM 3U6QA 4DV4M 2ZBKB 1R2YA 1Q3CA 4LF4M 1N33M 4PDIA 3GPYA 3SAVA 2UXDM 2F5PA 5IT9S 3W0FA 1K3WA 3SASA 4PD2A 4DR3M 1XNQM 4DV1M 4DR2M 1L2BA 3T1YM 3VK8A 4B3SM 3VK7A 3SBJA 1L1TA 4GKKM 4JV5M 1Q39A 3J7AS 4DR4M 4DR6M 4G4OA 4DV2M 1N32M 4LF7M 4LFAM 3GO8A 2HHHM 4LF6M 4B3MM 4K0KM 3U6LA 3SARA 4LF9M 1MX0A 3TWMA 1Q3BA 3U6MA 4JI6M 1IBMM 1EE8A 4DV6M 4JI4M 5LMNM 2F4VM 3GPXA 3T1HM 1Z5AA 4DR1M 2UXBM 4DV5M 2XZFA 1K82A 1Z59A 3C58A 3SAWA 3GPPA 1PJJA 1L2CA 5ITYA 4NRWA 3U6EA 5FLXS 1TDHA 1XC8A 4G4QA 4G4NA 3TWKA 4OX9M 4DR5M 5ITXA 1J5EM 4JI8M 5ITTA 3TWLA 4JYAM 4YY3M 2VQEM 2OPFA 1R2ZA 1PJIA 4JI7M 2UUCM 3JR4A 4DUZM 1L2DA 4CISA 4AQYM 2UXCM 1Z5BA 2E5LM 3A46A 1Z5CA 4X66M 4PDGA 5ITRA 2F5SA 1K3XA 4ITQA 1XNRM 4DV7M 4JI5M 1PM5A 1N34M 2Q2EB 1XMQM 4LF5M 5ITXE 4JI1M 3J80S 2UUBM 3SAUA 3OTOM 1IBKM 2UU9M 5LMUM 4LF8M 4X62M 1XMOM 5IWAM 2HKJA 3GPUA 4JI3M 3U6PA 1HNWM 3A42A 1MU5A 3GQ4A 4X65M 4DV0M 1NNJA 4YHHM 3J81S 3U6DA 4JI0M 5ITUA 3U6OA 3U6SA 3GP1A 3JAMS 3JR5A 3U6CA 2XZUA 4DUYM 4GKJM 1HR0M 4G4RA 1HNXM 4LFBM 4NXNM 1TDZA 4MB7A 2EA0A 3DOAA 4JI2M 4LFCM 3SATA 1I94M 4NXMM 4DV3M 1L1ZA 2F5OA 4X64M 4KHPM 4NRVA 1FJGM 2ZM6M 3A45A 2UUAM
chains in the Genus database with same CATH superfamily
4LGMA 1YUBA 1ZMWA 3J2PB 5E6JA 2JY5A 2QNJA 4B7HA 5BR8M 2ERCA 5A2QS 2WZJA 3ZH9B 3EIEA 4GEWA 5ITQA 2DZLA 2DVWB 2XFTA 3FUTA 4B3TM 1SG9A 4MGHA 4XGIA 4WW0A 4LF4M 1E94E 1WXQA 3PNYA 2F5PA 1QZMA 3L29A 3DFZA 2A5YB 4PD2A 1XNQM 4PT5A 3KS8A 4DR2M 4MGKE 1NSFA 5EXTA 1OAIA 3VK7A 3SBJA 1L8QA 1P3QQ 3C3DA 4L16A 3AV0A 4JV5M 4IJEA 4FCTA 3I4VA 1N32M 3V76A 4LF7M 3SHFA 1QYRA 1KYIA 4B3MM 3FTCA 4FWHA 2RKOA 2EUCA 4BB9A 3GLHB 3FUVA 2EO2A 2L6OA 4CIZA 1AUAA 4WURA 3TWMA 3AL0C 1Q3BA 1R6BX 4OVZA 5DFLA 4LZZA 3SMSA 5KPTA 1OIZA 2BJWA 3KP1E 1C1KA 2H1RA 2F4VM 3GPXA 3T1HM 1DGHA 3I01M 3LCVB 4IJFA 4Z6YA 4DR1M 2XZFA 2JZ0A 3SHGB 1OFHA 1PJJA 1L2CA 4W5WA 1JQJC 1PJSA 3HHYA 5ITYA 1OTRA 2LXEA 2Y0QA 1NO1A 4L15A 5DYGA 2JZ1A 3VFDA 2I7PA 5IZ7D 5JI3E 3AKZA 4G4QA 1C7YA 4RF1A 2LNHC 5ITXA 3VLFB 3BXWA 3GLIE 3PNVA 1DGGA 2Y0TA 1XXHE 4LCBA 3L26A 2OPFA 1JR3E 2LVQD 2VDBB 3GLGB 1TH2A 1YSYA 2XGNA 1IXZA 2WSCF 4DUZM 1KSFX 4RKUF 1IXRC 2DAIA 3U5ZA 1G8PA 1HT1E 1ZMVA 2GNOA 3QWLA 1Z5BA 2UXCM 2E5LM 2F5SA 4PDGA 1GABA 3FE3A 4QHTA 3KVWA 1K3XA 3KS4A 4AW4A 3GLHA 4LZJA 3VDUA 5H37D 2LWXA 4AG5A 2R44A 1N34M 1IN7A 4NOOB 3FYCA 1WR1B 2Z7JA 1NHGC 4OVZB 5EXSA 3HWSA 2X49A 3FRIA 2MJ5B 3FRHA 2V1UA 1DGHB 1GJSA 2CEAA 4LJ7A 3H4JA 3HGIA 2X8AA 1QVRA 4X62M 4FD2A 1XMOM 3A42A 3B7ZA 3FYDA 3GRYA 3GQ4A 4AKIA 1FNNA 1SXJD 1UM8A 4GHLA 4GITA 3W67A 1Y8GA 2YR0A 2JA2A 3K1JA 3PFIA 3RFWA 4CGYB 3HU3A 3GLGA 2L2DA 2OOBA 1J09A 1A5TA 2QZ4A 1JR3D 3DZDA 4IBFA 1OKSA 1GLNA 2MR9A 2QSFX 3B89A 3U5ZB 4L8RC 3GRUA 1TDZA 3HJSA 4MB7A 2LVAA 2EA0A 2X4AA 1W5TA 1VDDA 2I7NA 3MMPA 1VG5A 4M9SA 2DAMA 2KXEA 1QUTA 5FTNA 1FJGM 2BWEA 4GRIA 2CWBA 4MGZE 2F5QA 3LVWA 3UGJA 2FOIC 1NY5A 1TF0B 2JUJA 2CE7A 2DKLA 2JY6B 2KW0A 3KW6A 4MM3B 3Q8XA 2DWLA 4PCZA 3GQ3A 4I5SA 1QDTA 3E21A 3K8ZA 1WIVA 2Z3XA 2R0IA 2WSEF 1GO5A 5EJCA 2O01F 1T3TA 2DAGA 1IBLM 1IFYA 2O25A 3NBIA 5GKNA 2VQFM 4OU7A 4I8OA 2ZBKB 4R7GA 4F1IA 3QAUA 2CP8A 4IBJA 2R65A 1GJTA 5IT9S 3W0FA 1D0KA 3W0LB 3MK6A 4FCVA 1K3WA 1IM2A 7CATA 4DV1M 3SASA 2B3TA 1VEJA 1OAOC 2HCBA 2LHCA 3U60B 3K2LA 1ORYB 2YQZA 1R5LA 3J7AS 4DR4M 4XBOA 2CHGA 4CJ6A 3VDPA 3E46A 1HQCA 3FKEA 3UMMA 2NQ8C 3E9SA 4AI6A 3HU1A 2YFQA 4G3OA 2LBCA 3GLFB 3LQQA 3TQSA 4LF9M 4HLQA 4GC9A 2M60A 3SMPA 2XSZA 3M0EA 1PRBA 3B7QA 3I51A 1OFIA 1SXJE 4LJAA 1AIPC 4KODA 1EE8A 1G71A 5BPVA 3QYBA 4LJ8A 2CFOA 2DAKA 2RRUA 2UXBM 1Z59A 3E4RA 2FNAA 1OQYA 1VEGA 4IIWA 2JWSA 1QDRA 1T6OA 2M5ZA 3F92A 4JN6A 4OX9M 4ZPXA 1GL6A 2R62A 3B74A 4DR5M 1J5EM 1X37A 4IBBA 3U60A 2QQ8A 2EKKA 3TWLA 1E9SA 2VQEM 3LMMA 2JP7A 3AOEA 1R2ZA 3W68A 1PJIA 2RGOA 2Z4RA 2KDLA 3CGWA 1ZMUA 4M0DA 3D8BA 4P16A 5DNYA 2K9DA 2MH8A 4FWGA 2XEPA 1YE9A 3GLFA 3A46A 4BBAA 1XNRM 4JI5M 4IBCA 1WJ7A 2DZOB 2J7NA 2W82A 4R71A 3CTWB 5ITXE 1QANA 2C98A 3KFUG 1F4IA 3J80S 3VKHA 2KA6B 3LVVA 1XXHA 3OTOM 2V1CA 3T6PA 4LF8M 5LMUM 4F2LA 1V34A 4KO8A 1PJQA 3AOGA 3ZC7B 1MU5A 3C3EA 2CV0A 4WP2A 1JB0F 5E26A 4FWDA 3FTFA 1D2NA 2J7OA 3U6DA 3GLHE 4JI0M 5ITUA 1DO0A 3U6SA 2C5RA 3GP1A 2ZAOA 3I4YA 2JXNA 4FW9A 4NSRA 3FD9A 2L7IA 1HR0M 3UJNA 4LGYA 4LFBM 1ZV1A 2DWMA 5KO3A 4JI2M 2VF8A 3SATA 1I94M 3IG5A 1L1ZA 2F5OA 1IN4A 3R8FA 1R4GA 3A45A 3FTDA 4HEOA 3LW5F 2MGWA 4OW0A 3GLIB 2DHRA 3KDSE 4L4UA 3UZUA 1OJLA 4M9XA 3TPZA 2LTUA 3ZQJA 5FSWA 1XXHB 2JY8A 3FUUA 3GQ5A 1ZQ9A 2KNVA 3KOXE 1IQPA 3MJ5A 4B3RM 1VEKA 1HNZM 1W5SA 2DXIA 1KFVA 1DV0A 3HKPA 2R4JA 3PXGA 5EP4A 1Q3CA 5L8RF 1N33M 1VDLA 3K9OA 4QNMA 3L27A 1EIJA 4FCWA 4R3DA 1Z6TA 1IY1A 4DR3M 1H6UA 2Y20A 3K9PA 1WHCA 3KP0E 5KPRA 1YLAA 3VK8A 1L2BA 5KPZA 2R45A 1WGNA 4B3SM 3M7GA 1Q02A 1L1TA 2KZSA 2G8LA 2R18A 4DV2M 3DA1A 2C9CA 4A3VB 2D7EA 2Y21A 1LV7A 2CHQA 3EIHA 4I81A 4D82A 2GQFA 3ILKA 2J5YA 3GRRA 5C1BA 4K0KM 4XK8F 4B7GA 3GLIA 3B7NA 3U6LA 2D7GA 1N78A 3CF6E 4LJ6A 1MX0A 2KEBA 3IG8A 2QCUA 4QOSA 1MN3A 3U6MA 3PVSA 1WGLA 3KXEC 3ZCBB 1IBMM 1IXSB 5EP3A 2CV1A 1Z5AA 1K82A 3C58A 5FTJA 3GPPA 1XWIA 2LHGA 1G59A 1QAMA 3U6EA 5FTKA 5FLXS 4IBKA 1LTMA 4G4NA 2KHHA 3CF0A 1E32A 4REZA 4L78A 3UK6A 4GH9A 4QOZC 3TE6A 3SYKA 5IREB 4LJ5A 3T38A 3AJIB 2KRKA 3RE8A 2UUCM 1OIPA 4CISA 2HL7A 4I4LA 2N35A 1TTEA 4G6ZA 4X66M 1J7KA 4TUWA 5F3WA 2R46A 1PM5A 1G4AE 2Q2EB 2XFSA 2CUZA 2DWZB 4NL4H 4BLCA 1NV9A 1V92A 2LVNC 2R6FA 4LF5M 4AKGA 2L4FA 2HAKA 3K92A 3KSJA 3L25A 1NJGA 1IXSA 3KOYE 4GC5A 2L4EA 4JI1M 4NSOB 1DGBA 2UUBM 4KLNA 2Z8YM 3HHZA 1NJFA 1IY0A 2R4EA 1JR3A 3RGPA 1IBKM 3BOSA 3FUXA 4LRSA 4D81A 3IECA 3U6PA 2BNKA 3U61B 2AHMA 4LG2A 1QQWA 3MHVC 3SC3A 4X65M 4DV0M 2BWBA 1UFZA 5FTMA 2JY7A 3A98B 3WHKA 1D0LA 2C9OA 5FTLA 4YHHM 1T43A 3U6OA 3FTEA 4Q7JA 3VKGA 3U6CA 1GL7A 3JAMS 3JR5A 2FE8A 5KQ8A 4MH0E 4GKJM 2ZTCA 3HZJA 1HNXM 4NXNM 2OO9A 4ANRA 2KRUA 3HHWA 4P17A 2XH9A 5EP1A 3DOAA 4M0WA 4AG6A 4LFCM 4NXMM 4DV3M 4CHTB 3WHLA 1NV8A 4X64M 4JI4M 1S3SA 2EJSA 2RGHA 3FUWA 4Z8XA 2XLJA 2ZM6M 2UUAM 1TGUA 4EIWA 4NC6A 1QUSA 4M9ZA 2F5NA 2O5RA 1N75A 3M6AA 4DR7M 3GLGE 1PGYA 5EQTA 2OQ4A 2FS1A 1G41A 2DI0A 4QHSA 3U61A 1N36M 2APLA 2QBYB 1DGFA 3KOWE 4B08A 4DV4M 2YNMD 3U6QA 2EKFA 3NBXX 2DENA 1R2YA 2P5TA 4PDIA 3GPYA 3SAVA 2UXDM 2OOAA 3KOZE 4IBEA 3IHPA 4AKHA 1CUKA 2K6BA 4KT0F 1NVMA 2DZNB 1XHBA 3QYEA 2BJVA 4MGYE 3T1YM 2DAEA 4LJ9A 5KQDA 4GKKM 1Q39A 1BVSA 2G5GX 2WSFF 2FH0A 4DR6M 3NWLA 4G4OA 4IBGA 2QENA 4LJ4A 4LFAM 3GO8A 2ZAMA 4LY6A 3J27B 2HHHM 4D80A 3HX3A 2K0BX 4LF6M 3LQRA 1TH4A 2FFJA 3SARA 2CRUA 2KNZA 2MROB 4HL4A 2KZUA 1E9RA 1IY2A 2G3QA 4JI6M 3L2AA 2DWNA 3HJ8A 1SXJC 2V6ZM 4DV6M 2QHOB 2QBYA 1HQYE 1R7RA 3HY5A 3J7BA 3KSXA 5JI2E 5LMNM 4DV5M 3AOEC 2XF3A 2QP9X 3SAWA 2H5XA 3B9PA 1QAOA 4NRWA 2JNHA 2L09A 2LH0A 1TDHA 1XC8A 1HT2E 3TWKA 3CF2A 1NHWC 8CATA 4JI8M 3THGA 1TR8A 4JXJA 5ITTA 4UN2B 3SYLA 4YY3M 2DHYA 4GMQA 4JYAM 4AZFA 3HHXA 2C96A 1NY6A 2VIIA 4B7FA 4JI7M 1SXJA 3LCUA 3JR4A 3GRVA 2XSZD 4QNRA 1L2DA 3H4MA 3HU2A 2QPAA 2L7HA 4AQYM 4IBDA 1Z5CA 1IN6A 5C18A 1G3IA 5ITRA 4ITQA 5EXXA 2Z4SA 3D8LA 4DV7M 2ZTDA 2LVOC 4GIPA 4IBIA 3T15A 1VQ1A 1GVNA 1XMQM 2CV2A 1V33A 4DBGB 4RF0A 1ZAEA 4MGIE 2HWJA 3TL4X 3SAUA 1GKIA 1IN5A 4S12A 3Q8GA 2UU9M 5EP2A 5DYIA 4LRTA 2HKJA 3SFZA 1TH3A 4JI3M 5IWAM 3GPUA 1HNWM 3HJQA 3GLFE 1NNJA 2DNAA 3C9PA 3J81S 2K47A 2XZUA 1QAQA 2KNAA 3R9XB 1IN8A 3RGSA 4DUYM 2LVPC 3I04M 1SXJB 1XB2B 1QZEA 1HJPA 4FVMA 4G4RA 2ZANA 3L28A 4GHAA 4II7A 4L6V6 1DO2A 4Y28F 5EXPA 1RU3A 4RNAA 2CHVA 3BBZA 1MJGM 1D0MA 1PJTA 1N77A 2D7HA 1EFUB 3AFHA 2C99A 1NNUC 4NRVA 4KHPM 1I4WA 2VF7A
chains in the Genus database with same CATH topology
4LGMA 1YUBA 3J2PB 5E6JA 4B7HA 5BR8M 2ERCA 5A2QS 3ZH9B 3EIEA 5ITQA 2DVWB 2XFTA 3FUTA 4B3TM 4MGHA 4XGIA 4WW0A 4LF4M 1E94E 1WXQA 3PNYA 2F5PA 1QZMA 3L29A 3DFZA 2A5YB 4PD2A 1XNQM 4PT5A 3KS8A 4DR2M 4MGKE 1NSFA 5EXTA 3VK7A 3SBJA 1L8QA 4L16A 4JV5M 3AV0A 4IJEA 4FCTA 3I4VA 1N32M 4LF7M 3SHFA 1QYRA 1KYIA 4B3MM 3FTCA 4FWHA 2RKOA 2EUCA 4BB9A 3GLHB 3FUVA 2EO2A 2L6OA 3TWMA 4WURA 3AL0C 1Q3BA 1R6BX 4OVZA 4LZZA 3SMSA 5KPTA 2BJWA 3KP1E 1C1KA 2H1RA 2F4VM 3GPXA 3T1HM 1DGHA 4DR1M 4IJFA 4Z6YA 2XZFA 3SHGB 1OFHA 1PJJA 1L2CA 4W5WA 1JQJC 3HHYA 5ITYA 2LXEA 2Y0QA 4L15A 5DYGA 3VFDA 3AKZA 5JI3E 2I7PA 5IZ7D 4G4QA 4RF1A 2LNHC 5ITXA 3VLFB 3PNVA 1DGGA 2Y0TA 4LCBA 3L26A 2OPFA 3GLGB 1TH2A 1YSYA 2XGNA 1IXZA 4DUZM 1KSFX 1IXRC 3U5ZA 1G8PA 1HT1E 3QWLA 2UXCM 1Z5BA 2E5LM 2F5SA 4PDGA 4QHTA 3KVWA 1K3XA 3KS4A 4AW4A 3GLHA 4LZJA 3VDUA 5H37D 2LWXA 4AG5A 1N34M 1IN7A 4NOOB 3FYCA 2Z7JA 1NHGC 4OVZB 5EXSA 3HWSA 2X49A 2V1UA 1DGHB 2CEAA 4LJ7A 3HGIA 2X8AA 1QVRA 4X62M 4FD2A 1XMOM 3A42A 3FYDA 3GRYA 3GQ4A 4AKIA 1FNNA 1SXJD 1UM8A 4GHLA 4GITA 2YR0A 3RFWA 2JA2A 3K1JA 3PFIA 4CGYB 3HU3A 3GLGA 1J09A 2QZ4A 1JR3D 3DZDA 4IBFA 1GLNA 3U5ZB 4L8RC 3GRUA 1TDZA 3HJSA 4MB7A 2EA0A 2X4AA 1W5TA 1VDDA 2I7NA 4M9SA 2KXEA 5FTNA 1FJGM 4MGZE 4GRIA 2F5QA 3LVWA 3UGJA 2FOIC 1NY5A 2KW0A 5C1BA 2CE7A 2DWLA 3KW6A 4MM3B 3Q8XA 4PCZA 3GQ3A 4I5SA 3K8ZA 2Z3XA 5EJCA 1T3TA 1IBLM 3NBIA 5GKNA 2VQFM 4OU7A 4I8OA 2ZBKB 4R7GA 3QAUA 4IBJA 2R65A 5IT9S 3W0FA 3W0LB 1K3WA 3MK6A 4FCVA 3SASA 1IM2A 7CATA 4DV1M 2HCBA 3U60B 3K2LA 1ORYB 2YQZA 3J7AS 4DR4M 4XBOA 2CHGA 3VDPA 1HQCA 3FKEA 3UMMA 2NQ8C 3E9SA 4AI6A 3HU1A 2YFQA 3GLFB 3LQQA 3TQSA 4LF9M 4HLQA 4GC9A 2M60A 3SMPA 2XSZA 3M0EA 3I51A 1OFIA 1SXJE 4LJAA 4KODA 1EE8A 5BPVA 4LJ8A 2CFOA 2UXBM 1Z59A 3E4RA 2FNAA 4IIWA 2M5ZA 4JN6A 4OX9M 4ZPXA 1GL6A 2R62A 4DR5M 1J5EM 1X37A 4IBBA 3U60A 3TWLA 1E9SA 2VQEM 3LMMA 3AOEA 1R2ZA 1PJIA 2RGOA 2Z4RA 4M0DA 3D8BA 4P16A 5DNYA 4FWGA 2XEPA 1YE9A 3GLFA 3A46A 4BBAA 1XNRM 4JI5M 4IBCA 2DZOB 2J7NA 2W82A 3CTWB 5ITXE 1QANA 2C98A 3KFUG 3J80S 3VKHA 2KA6B 3LVVA 1XXHA 3OTOM 2V1CA 4LF8M 5LMUM 4KO8A 3AOGA 3ZC7B 1MU5A 2CV0A 5E26A 4FWDA 3FTFA 1D2NA 2J7OA 3U6DA 4JI0M 5ITUA 3U6SA 1DO0A 2C5RA 3GP1A 2ZAOA 3I4YA 4FW9A 4NSRA 3FD9A 2L7IA 1HR0M 3UJNA 4LGYA 4LFBM 2DWMA 5KO3A 4JI2M 3SATA 1I94M 3IG5A 1L1ZA 2F5OA 1IN4A 3R8FA 3A45A 3FTDA 4OW0A 3GLIB 2DHRA 3KDSE 4L4UA 3UZUA 1OJLA 4M9XA 3TPZA 5FSWA 1XXHB 3FUUA 3GQ5A 1ZQ9A 3KOXE 1IQPA 3MJ5A 4B3RM 1HNZM 1W5SA 2DXIA 1KFVA 3HKPA 2R4JA 3PXGA 5EP4A 1Q3CA 1N33M 4QNMA 3L27A 4FCWA 4R3DA 1Z6TA 1IY1A 4DR3M 1H6UA 2Y20A 3KP0E 5KPRA 3VK8A 1L2BA 4B3SM 5KPZA 2R45A 3M7GA 1L1TA 2KZSA 2G8LA 2R18A 4DV2M 3DA1A 2C9CA 4A3VB 2D7EA 2Y21A 1LV7A 2CHQA 3EIHA 4I81A 4D82A 3ILKA 3GRRA 1N78A 4K0KM 3GLIA 4B7GA 3U6LA 2D7GA 3CF6E 4LJ6A 1MX0A 2KEBA 3IG8A 2QCUA 4QOSA 3U6MA 3PVSA 3KXEC 3ZCBB 1IBMM 1IXSB 5EP3A 2CV1A 1Z5AA 1K82A 3C58A 5FTJA 3GPPA 1XWIA 1G59A 1QAMA 3U6EA 5FTKA 5FLXS 4IBKA 4G4NA 3CF0A 1E32A 4REZA 4L78A 3UK6A 4GH9A 4QOZC 3TE6A 3SYKA 5IREB 4LJ5A 3T38A 3AJIB 2KRKA 3RE8A 2UUCM 4CISA 2HL7A 4I4LA 4G6ZA 4X66M 1J7KA 4TUWA 5F3WA 2R46A 1PM5A 1G4AE 2Q2EB 2XFSA 2CUZA 2DWZB 4NL4H 4BLCA 4LF5M 4AKGA 3L25A 3K92A 3KSJA 1NJGA 3KOYE 4GC5A 4JI1M 4NSOB 1DGBA 2UUBM 4KLNA 3HHZA 1NJFA 1IY0A 2R4EA 1JR3A 3RGPA 1IBKM 3BOSA 3FUXA 4LRSA 4D81A 3U6PA 2BNKA 3U61B 2AHMA 4LG2A 1QQWA 3MHVC 3SC3A 4X65M 4DV0M 5FTMA 3A98B 3WHKA 2C9OA 5FTLA 4YHHM 3FTEA 3U6OA 3VKGA 3U6CA 1GL7A 3JAMS 3JR5A 2FE8A 5KQ8A 4MH0E 4GKJM 1HNXM 4NXNM 2KRUA 3HHWA 2XH9A 5EP1A 3DOAA 4M0WA 4AG6A 4LFCM 4NXMM 4DV3M 4CHTB 3WHLA 4X64M 1S3SA 3FUWA 2RGHA 4Z8XA 2XLJA 2ZM6M 2UUAM 1TGUA 4EIWA 4M9ZA 2F5NA 2O5RA 1N75A 3M6AA 4DR7M 5EQTA 2OQ4A 1G41A 4QHSA 3U61A 1N36M 2QBYB 1DGFA 3KOWE 4B08A 4DV4M 2YNMD 3U6QA 1R2YA 2P5TA 4PDIA 3GPYA 3SAVA 2UXDM 3KOZE 4IBEA 4AKHA 1NVMA 2DZNB 1XHBA 4MGYE 2BJVA 3T1YM 4LJ9A 5KQDA 4GKKM 1Q39A 2G5GX 4DR6M 3NWLA 4G4OA 4IBGA 2QENA 4LJ4A 4LFAM 3GO8A 2ZAMA 4LY6A 3J27B 2HHHM 4D80A 4LF6M 3LQRA 1TH4A 2FFJA 3SARA 4HL4A 2KZUA 1E9RA 1IY2A 4JI6M 3L2AA 2DWNA 3HJ8A 1SXJC 2V6ZM 4DV6M 4JI4M 2QBYA 1HQYE 1R7RA 3J7BA 3KSXA 5LMNM 5JI2E 4DV5M 3AOEC 2XF3A 2QP9X 3SAWA 3B9PA 1QAOA 4NRWA 2L09A 2LH0A 1TDHA 1XC8A 1HT2E 3TWKA 3CF2A 1NHWC 8CATA 4JI8M 3THGA 4JXJA 5ITTA 4JYAM 3SYLA 4YY3M 4GMQA 4AZFA 3HHXA 2C96A 1NY6A 2VIIA 4B7FA 4JI7M 1SXJA 3JR4A 3GRVA 2XSZD 4QNRA 1L2DA 3H4MA 3HU2A 2L7HA 2QPAA 4AQYM 4IBDA 1Z5CA 1IN6A 5C18A 1G3IA 5ITRA 4ITQA 5EXXA 2Z4SA 3D8LA 4DV7M 4GIPA 4IBIA 3T15A 1GVNA 1XMQM 2CV2A 4RF0A 1ZAEA 4MGIE 3TL4X 3SAUA 1GKIA 1IN5A 4S12A 2UU9M 5EP2A 5DYIA 4LRTA 2HKJA 3SFZA 1TH3A 4JI3M 5IWAM 3GPUA 1HNWM 3HJQA 1NNJA 3J81S 2K47A 2XZUA 1QAQA 3R9XB 1IN8A 3RGSA 4DUYM 1SXJB 4G4RA 4FVMA 2ZANA 3L28A 4GHAA 4II7A 1DO2A 5EXPA 4RNAA 2CHVA 1N77A 2D7HA 3AFHA 2C99A 1NNUC 4NRVA 4KHPM 1I4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5Q A;  2F5N A;  4PCZ A;  3GQ3 A;  5BR8 M;  3GQ5 A;  5A2Q S;  4DR7 M;  2OQ4 A;  4B3R M;  1HNZ M;  1N36 M;  5ITQ A;  1KFV A;  1IBL M;  4B3T M;  2VQF M;  3U6Q A;  4DV4 M;  2ZBK B;  1R2Y A;  1Q3C A;  4LF4 M;  1N33 M;  4PDI A;  3GPY A;  3SAV A;  2UXD M;  2F5P A;  5IT9 S;  3W0F A;  1K3W A;  3SAS A;  4PD2 A;  4DR3 M;  1XNQ M;  4DV1 M;  4DR2 M;  1L2B A;  3T1Y M;  3VK8 A;  4B3S M;  3VK7 A;  3SBJ A;  1L1T A;  4GKK M;  4JV5 M;  1Q39 A;  3J7A S;  4DR4 M;  4DR6 M;  4G4O A;  4DV2 M;  1N32 M;  4LF7 M;  4LFA M;  3GO8 A;  2HHH M;  4LF6 M;  4B3M M;  4K0K M;  3U6L A;  3SAR A;  4LF9 M;  1MX0 A;  3TWM A;  1Q3B A;  3U6M A;  4JI6 M;  1IBM M;  1EE8 A;  4DV6 M;  4JI4 M;  5LMN M;  2F4V M;  3GPX A;  3T1H M;  1Z5A A;  4DR1 M;  2UXB M;  4DV5 M;  2XZF A;  1K82 A;  1Z59 A;  3C58 A;  3SAW A;  3GPP A;  1PJJ A;  1L2C A;  5ITY A;  4NRW A;  3U6E A;  5FLX S;  1TDH A;  1XC8 A;  4G4Q A;  4G4N A;  3TWK A;  4OX9 M;  4DR5 M;  5ITX A;  1J5E M;  4JI8 M;  5ITT A;  3TWL A;  4JYA M;  4YY3 M;  2VQE M;  2OPF A;  1R2Z A;  1PJI A;  4JI7 M;  2UUC M;  3JR4 A;  4DUZ M;  1L2D A;  4CIS A;  4AQY M;  2UXC M;  1Z5B A;  2E5L M;  3A46 A;  1Z5C A;  4X66 M;  4PDG A;  5ITR A;  2F5S A;  1K3X A;  4ITQ A;  1XNR M;  4DV7 M;  4JI5 M;  1PM5 A;  1N34 M;  2Q2E B;  1XMQ M;  4LF5 M;  5ITX E;  4JI1 M;  3J80 S;  2UUB M;  3SAU A;  3OTO M;  1IBK M;  2UU9 M;  5LMU M;  4LF8 M;  4X62 M;  1XMO M;  5IWA M;  2HKJ A;  3GPU A;  4JI3 M;  3U6P A;  1HNW M;  3A42 A;  1MU5 A;  3GQ4 A;  4X65 M;  4DV0 M;  1NNJ A;  4YHH M;  3J81 S;  3U6D A;  4JI0 M;  5ITU A;  3U6O A;  3U6S A;  3GP1 A;  3JAM S;  3JR5 A;  3U6C A;  2XZU A;  4DUY M;  4GKJ M;  1HR0 M;  4G4R A;  1HNX M;  4LFB M;  4NXN M;  1TDZ A;  4MB7 A;  2EA0 A;  3DOA A;  4JI2 M;  4LFC M;  3SAT A;  1I94 M;  4NXM M;  4DV3 M;  1L1Z A;  2F5O A;  4X64 M;  4KHP M;  4NRV A;  1FJG M;  2ZM6 M;  3A45 A;  2UUA M; 
#chains in the Genus database with same CATH topology
 4LGM A;  1YUB A;  1ZMW A;  3J2P B;  5E6J A;  2JY5 A;  2QNJ A;  4B7H A;  5BR8 M;  2ERC A;  5A2Q S;  2WZJ A;  3ZH9 B;  3EIE A;  4GEW A;  5ITQ A;  2DZL A;  2DVW B;  2XFT A;  3FUT A;  4B3T M;  1SG9 A;  4MGH A;  4XGI A;  4WW0 A;  4LF4 M;  1E94 E;  1WXQ A;  3PNY A;  2F5P A;  1QZM A;  3L29 A;  3DFZ A;  2A5Y B;  4PD2 A;  1XNQ M;  4PT5 A;  3KS8 A;  4DR2 M;  4MGK E;  1NSF A;  5EXT A;  1OAI A;  3VK7 A;  3SBJ A;  1L8Q A;  1P3Q Q;  3C3D A;  4L16 A;  3AV0 A;  4JV5 M;  4IJE A;  4FCT A;  3I4V A;  1N32 M;  3V76 A;  4LF7 M;  3SHF A;  1QYR A;  1KYI A;  4B3M M;  3FTC A;  4FWH A;  2RKO A;  2EUC A;  4BB9 A;  3GLH B;  3FUV A;  2EO2 A;  2L6O A;  4CIZ A;  1AUA A;  4WUR A;  3TWM A;  3AL0 C;  1Q3B A;  1R6B X;  4OVZ A;  5DFL A;  4LZZ A;  3SMS A;  5KPT A;  1OIZ A;  2BJW A;  3KP1 E;  1C1K A;  2H1R A;  2F4V M;  3GPX A;  3T1H M;  1DGH A;  3I01 M;  3LCV B;  4IJF A;  4Z6Y A;  4DR1 M;  2XZF A;  2JZ0 A;  3SHG B;  1OFH A;  1PJJ A;  1L2C A;  4W5W A;  1JQJ C;  1PJS A;  3HHY A;  5ITY A;  1OTR A;  2LXE A;  2Y0Q A;  1NO1 A;  4L15 A;  5DYG A;  2JZ1 A;  3VFD A;  2I7P A;  5IZ7 D;  5JI3 E;  3AKZ A;  4G4Q A;  1C7Y A;  4RF1 A;  2LNH C;  5ITX A;  3VLF B;  3BXW A;  3GLI E;  3PNV A;  1DGG A;  2Y0T A;  1XXH E;  4LCB A;  3L26 A;  2OPF A;  1JR3 E;  2LVQ D;  2VDB B;  3GLG B;  1TH2 A;  1YSY A;  2XGN A;  1IXZ A;  2WSC F;  4DUZ M;  1KSF X;  4RKU F;  1IXR C;  2DAI A;  3U5Z A;  1G8P A;  1HT1 E;  1ZMV A;  2GNO A;  3QWL A;  1Z5B A;  2UXC M;  2E5L M;  2F5S A;  4PDG A;  1GAB A;  3FE3 A;  4QHT A;  3KVW A;  1K3X A;  3KS4 A;  4AW4 A;  3GLH A;  4LZJ A;  3VDU A;  5H37 D;  2LWX A;  4AG5 A;  2R44 A;  1N34 M;  1IN7 A;  4NOO B;  3FYC A;  1WR1 B;  2Z7J A;  1NHG C;  4OVZ B;  5EXS A;  3HWS A;  2X49 A;  3FRI A;  2MJ5 B;  3FRH A;  2V1U A;  1DGH B;  1GJS A;  2CEA A;  4LJ7 A;  3H4J A;  3HGI A;  2X8A A;  1QVR A;  4X62 M;  4FD2 A;  1XMO M;  3A42 A;  3B7Z A;  3FYD A;  3GRY A;  3GQ4 A;  4AKI A;  1FNN A;  1SXJ D;  1UM8 A;  4GHL A;  4GIT A;  3W67 A;  1Y8G A;  2YR0 A;  2JA2 A;  3K1J A;  3PFI A;  3RFW A;  4CGY B;  3HU3 A;  3GLG A;  2L2D A;  2OOB A;  1J09 A;  1A5T A;  2QZ4 A;  1JR3 D;  3DZD A;  4IBF A;  1OKS A;  1GLN A;  2MR9 A;  2QSF X;  3B89 A;  3U5Z B;  4L8R C;  3GRU A;  1TDZ A;  3HJS A;  4MB7 A;  2LVA A;  2EA0 A;  2X4A A;  1W5T A;  1VDD A;  2I7N A;  3MMP A;  1VG5 A;  4M9S A;  2DAM A;  2KXE A;  1QUT A;  5FTN A;  1FJG M;  2BWE A;  4GRI A;  2CWB A;  4MGZ E;  2F5Q A;  3LVW A;  3UGJ A;  2FOI C;  1NY5 A;  1TF0 B;  2JUJ A;  2CE7 A;  2DKL A;  2JY6 B;  2KW0 A;  3KW6 A;  4MM3 B;  3Q8X A;  2DWL A;  4PCZ A;  3GQ3 A;  4I5S A;  1QDT A;  3E21 A;  3K8Z A;  1WIV A;  2Z3X A;  2R0I A;  2WSE F;  1GO5 A;  5EJC A;  2O01 F;  1T3T A;  2DAG A;  1IBL M;  1IFY A;  2O25 A;  3NBI A;  5GKN A;  2VQF M;  4OU7 A;  4I8O A;  2ZBK B;  4R7G A;  4F1I A;  3QAU A;  2CP8 A;  4IBJ A;  2R65 A;  1GJT A;  5IT9 S;  3W0F A;  1D0K A;  3W0L B;  3MK6 A;  4FCV A;  1K3W A;  1IM2 A;  7CAT A;  4DV1 M;  3SAS A;  2B3T A;  1VEJ A;  1OAO C;  2HCB A;  2LHC A;  3U60 B;  3K2L A;  1ORY B;  2YQZ A;  1R5L A;  3J7A S;  4DR4 M;  4XBO A;  2CHG A;  4CJ6 A;  3VDP A;  3E46 A;  1HQC A;  3FKE A;  3UMM A;  2NQ8 C;  3E9S A;  4AI6 A;  3HU1 A;  2YFQ A;  4G3O A;  2LBC A;  3GLF B;  3LQQ A;  3TQS A;  4LF9 M;  4HLQ A;  4GC9 A;  2M60 A;  3SMP A;  2XSZ A;  3M0E A;  1PRB A;  3B7Q A;  3I51 A;  1OFI A;  1SXJ E;  4LJA A;  1AIP C;  4KOD A;  1EE8 A;  1G71 A;  5BPV A;  3QYB A;  4LJ8 A;  2CFO A;  2DAK A;  2RRU A;  2UXB M;  1Z59 A;  3E4R A;  2FNA A;  1OQY A;  1VEG A;  4IIW A;  2JWS A;  1QDR A;  1T6O A;  2M5Z A;  3F92 A;  4JN6 A;  4OX9 M;  4ZPX A;  1GL6 A;  2R62 A;  3B74 A;  4DR5 M;  1J5E M;  1X37 A;  4IBB A;  3U60 A;  2QQ8 A;  2EKK A;  3TWL A;  1E9S A;  2VQE M;  3LMM A;  2JP7 A;  3AOE A;  1R2Z A;  3W68 A;  1PJI A;  2RGO A;  2Z4R A;  2KDL A;  3CGW A;  1ZMU A;  4M0D A;  3D8B A;  4P16 A;  5DNY A;  2K9D A;  2MH8 A;  4FWG A;  2XEP A;  1YE9 A;  3GLF A;  3A46 A;  4BBA A;  1XNR M;  4JI5 M;  4IBC A;  1WJ7 A;  2DZO B;  2J7N A;  2W82 A;  4R71 A;  3CTW B;  5ITX E;  1QAN A;  2C98 A;  3KFU G;  1F4I A;  3J80 S;  3VKH A;  2KA6 B;  3LVV A;  1XXH A;  3OTO M;  2V1C A;  3T6P A;  4LF8 M;  5LMU M;  4F2L A;  1V34 A;  4KO8 A;  1PJQ A;  3AOG A;  3ZC7 B;  1MU5 A;  3C3E A;  2CV0 A;  4WP2 A;  1JB0 F;  5E26 A;  4FWD A;  3FTF A;  1D2N A;  2J7O A;  3U6D A;  3GLH E;  4JI0 M;  5ITU A;  1DO0 A;  3U6S A;  2C5R A;  3GP1 A;  2ZAO A;  3I4Y A;  2JXN A;  4FW9 A;  4NSR A;  3FD9 A;  2L7I A;  1HR0 M;  3UJN A;  4LGY A;  4LFB M;  1ZV1 A;  2DWM A;  5KO3 A;  4JI2 M;  2VF8 A;  3SAT A;  1I94 M;  3IG5 A;  1L1Z A;  2F5O A;  1IN4 A;  3R8F A;  1R4G A;  3A45 A;  3FTD A;  4HEO A;  3LW5 F;  2MGW A;  4OW0 A;  3GLI B;  2DHR A;  3KDS E;  4L4U A;  3UZU A;  1OJL A;  4M9X A;  3TPZ A;  2LTU A;  3ZQJ A;  5FSW A;  1XXH B;  2JY8 A;  3FUU A;  3GQ5 A;  1ZQ9 A;  2KNV A;  3KOX E;  1IQP A;  3MJ5 A;  4B3R M;  1VEK A;  1HNZ M;  1W5S A;  2DXI A;  1KFV A;  1DV0 A;  3HKP A;  2R4J A;  3PXG A;  5EP4 A;  1Q3C A;  5L8R F;  1N33 M;  1VDL A;  3K9O A;  4QNM A;  3L27 A;  1EIJ A;  4FCW A;  4R3D A;  1Z6T A;  1IY1 A;  4DR3 M;  1H6U A;  2Y20 A;  3K9P A;  1WHC A;  3KP0 E;  5KPR A;  1YLA A;  3VK8 A;  1L2B A;  5KPZ A;  2R45 A;  1WGN A;  4B3S M;  3M7G A;  1Q02 A;  1L1T A;  2KZS A;  2G8L A;  2R18 A;  4DV2 M;  3DA1 A;  2C9C A;  4A3V B;  2D7E A;  2Y21 A;  1LV7 A;  2CHQ A;  3EIH A;  4I81 A;  4D82 A;  2GQF A;  3ILK A;  2J5Y A;  3GRR A;  5C1B A;  4K0K M;  4XK8 F;  4B7G A;  3GLI A;  3B7N A;  3U6L A;  2D7G A;  1N78 A;  3CF6 E;  4LJ6 A;  1MX0 A;  2KEB A;  3IG8 A;  2QCU A;  4QOS A;  1MN3 A;  3U6M A;  3PVS A;  1WGL A;  3KXE C;  3ZCB B;  1IBM M;  1IXS B;  5EP3 A;  2CV1 A;  1Z5A A;  1K82 A;  3C58 A;  5FTJ A;  3GPP A;  1XWI A;  2LHG A;  1G59 A;  1QAM A;  3U6E A;  5FTK A;  5FLX S;  4IBK A;  1LTM A;  4G4N A;  2KHH A;  3CF0 A;  1E32 A;  4REZ A;  4L78 A;  3UK6 A;  4GH9 A;  4QOZ C;  3TE6 A;  3SYK A;  5IRE B;  4LJ5 A;  3T38 A;  3AJI B;  2KRK A;  3RE8 A;  2UUC M;  1OIP A;  4CIS A;  2HL7 A;  4I4L A;  2N35 A;  1TTE A;  4G6Z A;  4X66 M;  1J7K A;  4TUW A;  5F3W A;  2R46 A;  1PM5 A;  1G4A E;  2Q2E B;  2XFS A;  2CUZ A;  2DWZ B;  4NL4 H;  4BLC A;  1NV9 A;  1V92 A;  2LVN C;  2R6F A;  4LF5 M;  4AKG A;  2L4F A;  2HAK A;  3K92 A;  3KSJ A;  3L25 A;  1NJG A;  1IXS A;  3KOY E;  4GC5 A;  2L4E A;  4JI1 M;  4NSO B;  1DGB A;  2UUB M;  4KLN A;  2Z8Y M;  3HHZ A;  1NJF A;  1IY0 A;  2R4E A;  1JR3 A;  3RGP A;  1IBK M;  3BOS A;  3FUX A;  4LRS A;  4D81 A;  3IEC A;  3U6P A;  2BNK A;  3U61 B;  2AHM A;  4LG2 A;  1QQW A;  3MHV C;  3SC3 A;  4X65 M;  4DV0 M;  2BWB A;  1UFZ A;  5FTM A;  2JY7 A;  3A98 B;  3WHK A;  1D0L A;  2C9O A;  5FTL A;  4YHH M;  1T43 A;  3U6O A;  3FTE A;  4Q7J A;  3VKG A;  3U6C A;  1GL7 A;  3JAM S;  3JR5 A;  2FE8 A;  5KQ8 A;  4MH0 E;  4GKJ M;  2ZTC A;  3HZJ A;  1HNX M;  4NXN M;  2OO9 A;  4ANR A;  2KRU A;  3HHW A;  4P17 A;  2XH9 A;  5EP1 A;  3DOA A;  4M0W A;  4AG6 A;  4LFC M;  4NXM M;  4DV3 M;  4CHT B;  3WHL A;  1NV8 A;  4X64 M;  4JI4 M;  1S3S A;  2EJS A;  2RGH A;  3FUW A;  4Z8X A;  2XLJ A;  2ZM6 M;  2UUA M;  1TGU A;  4EIW A;  4NC6 A;  1QUS A;  4M9Z A;  2F5N A;  2O5R A;  1N75 A;  3M6A A;  4DR7 M;  3GLG E;  1PGY A;  5EQT A;  2OQ4 A;  2FS1 A;  1G41 A;  2DI0 A;  4QHS A;  3U61 A;  1N36 M;  2APL A;  2QBY B;  1DGF A;  3KOW E;  4B08 A;  4DV4 M;  2YNM D;  3U6Q A;  2EKF A;  3NBX X;  2DEN A;  1R2Y A;  2P5T A;  4PDI A;  3GPY A;  3SAV A;  2UXD M;  2OOA A;  3KOZ E;  4IBE A;  3IHP A;  4AKH A;  1CUK A;  2K6B A;  4KT0 F;  1NVM A;  2DZN B;  1XHB A;  3QYE A;  2BJV A;  4MGY E;  3T1Y M;  2DAE A;  4LJ9 A;  5KQD A;  4GKK M;  1Q39 A;  1BVS A;  2G5G X;  2WSF F;  2FH0 A;  4DR6 M;  3NWL A;  4G4O A;  4IBG A;  2QEN A;  4LJ4 A;  4LFA M;  3GO8 A;  2ZAM A;  4LY6 A;  3J27 B;  2HHH M;  4D80 A;  3HX3 A;  2K0B X;  4LF6 M;  3LQR A;  1TH4 A;  2FFJ A;  3SAR A;  2CRU A;  2KNZ A;  2MRO B;  4HL4 A;  2KZU A;  1E9R A;  1IY2 A;  2G3Q A;  4JI6 M;  3L2A A;  2DWN A;  3HJ8 A;  1SXJ C;  2V6Z M;  4DV6 M;  2QHO B;  2QBY A;  1HQY E;  1R7R A;  3HY5 A;  3J7B A;  3KSX A;  5JI2 E;  5LMN M;  4DV5 M;  3AOE C;  2XF3 A;  2QP9 X;  3SAW A;  2H5X A;  3B9P A;  1QAO A;  4NRW A;  2JNH A;  2L09 A;  2LH0 A;  1TDH A;  1XC8 A;  1HT2 E;  3TWK A;  3CF2 A;  1NHW C;  8CAT A;  4JI8 M;  3THG A;  1TR8 A;  4JXJ A;  5ITT A;  4UN2 B;  3SYL A;  4YY3 M;  2DHY A;  4GMQ A;  4JYA M;  4AZF A;  3HHX A;  2C96 A;  1NY6 A;  2VII A;  4B7F A;  4JI7 M;  1SXJ A;  3LCU A;  3JR4 A;  3GRV A;  2XSZ D;  4QNR A;  1L2D A;  3H4M A;  3HU2 A;  2QPA A;  2L7H A;  4AQY M;  4IBD A;  1Z5C A;  1IN6 A;  5C18 A;  1G3I A;  5ITR A;  4ITQ A;  5EXX A;  2Z4S A;  3D8L A;  4DV7 M;  2ZTD A;  2LVO C;  4GIP A;  4IBI A;  3T15 A;  1VQ1 A;  1GVN A;  1XMQ M;  2CV2 A;  1V33 A;  4DBG B;  4RF0 A;  1ZAE A;  4MGI E;  2HWJ A;  3TL4 X;  3SAU A;  1GKI A;  1IN5 A;  4S12 A;  3Q8G A;  2UU9 M;  5EP2 A;  5DYI A;  4LRT A;  2HKJ A;  3SFZ A;  1TH3 A;  4JI3 M;  5IWA M;  3GPU A;  1HNW M;  3HJQ A;  3GLF E;  1NNJ A;  2DNA A;  3C9P A;  3J81 S;  2K47 A;  2XZU A;  1QAQ A;  2KNA A;  3R9X B;  1IN8 A;  3RGS A;  4DUY M;  2LVP C;  3I04 M;  1SXJ B;  1XB2 B;  1QZE A;  1HJP A;  4FVM A;  4G4R A;  2ZAN A;  3L28 A;  4GHA A;  4II7 A;  4L6V 6;  1DO2 A;  4Y28 F;  5EXP A;  1RU3 A;  4RNA A;  2CHV A;  3BBZ A;  1MJG M;  1D0M A;  1PJT A;  1N77 A;  2D7H A;  1EFU B;  3AFH A;  2C99 A;  1NNU C;  4NRV A;  4KHP M;  1I4W A;  2VF7 A; 
#chains in the Genus database with same CATH homology
 4LGM A;  1YUB A;  3J2P B;  5E6J A;  4B7H A;  5BR8 M;  2ERC A;  5A2Q S;  3ZH9 B;  3EIE A;  5ITQ A;  2DVW B;  2XFT A;  3FUT A;  4B3T M;  4MGH A;  4XGI A;  4WW0 A;  4LF4 M;  1E94 E;  1WXQ A;  3PNY A;  2F5P A;  1QZM A;  3L29 A;  3DFZ A;  2A5Y B;  4PD2 A;  1XNQ M;  4PT5 A;  3KS8 A;  4DR2 M;  4MGK E;  1NSF A;  5EXT A;  3VK7 A;  3SBJ A;  1L8Q A;  4L16 A;  4JV5 M;  3AV0 A;  4IJE A;  4FCT A;  3I4V A;  1N32 M;  4LF7 M;  3SHF A;  1QYR A;  1KYI A;  4B3M M;  3FTC A;  4FWH A;  2RKO A;  2EUC A;  4BB9 A;  3GLH B;  3FUV A;  2EO2 A;  2L6O A;  3TWM A;  4WUR A;  3AL0 C;  1Q3B A;  1R6B X;  4OVZ A;  4LZZ A;  3SMS A;  5KPT A;  2BJW A;  3KP1 E;  1C1K A;  2H1R A;  2F4V M;  3GPX A;  3T1H M;  1DGH A;  4DR1 M;  4IJF A;  4Z6Y A;  2XZF A;  3SHG B;  1OFH A;  1PJJ A;  1L2C A;  4W5W A;  1JQJ C;  3HHY A;  5ITY A;  2LXE A;  2Y0Q A;  4L15 A;  5DYG A;  3VFD A;  3AKZ A;  5JI3 E;  2I7P A;  5IZ7 D;  4G4Q A;  4RF1 A;  2LNH C;  5ITX A;  3VLF B;  3PNV A;  1DGG A;  2Y0T A;  4LCB A;  3L26 A;  2OPF A;  3GLG B;  1TH2 A;  1YSY A;  2XGN A;  1IXZ A;  4DUZ M;  1KSF X;  1IXR C;  3U5Z A;  1G8P A;  1HT1 E;  3QWL A;  2UXC M;  1Z5B A;  2E5L M;  2F5S A;  4PDG A;  4QHT A;  3KVW A;  1K3X A;  3KS4 A;  4AW4 A;  3GLH A;  4LZJ A;  3VDU A;  5H37 D;  2LWX A;  4AG5 A;  1N34 M;  1IN7 A;  4NOO B;  3FYC A;  2Z7J A;  1NHG C;  4OVZ B;  5EXS A;  3HWS A;  2X49 A;  2V1U A;  1DGH B;  2CEA A;  4LJ7 A;  3HGI A;  2X8A A;  1QVR A;  4X62 M;  4FD2 A;  1XMO M;  3A42 A;  3FYD A;  3GRY A;  3GQ4 A;  4AKI A;  1FNN A;  1SXJ D;  1UM8 A;  4GHL A;  4GIT A;  2YR0 A;  3RFW A;  2JA2 A;  3K1J A;  3PFI A;  4CGY B;  3HU3 A;  3GLG A;  1J09 A;  2QZ4 A;  1JR3 D;  3DZD A;  4IBF A;  1GLN A;  3U5Z B;  4L8R C;  3GRU A;  1TDZ A;  3HJS A;  4MB7 A;  2EA0 A;  2X4A A;  1W5T A;  1VDD A;  2I7N A;  4M9S A;  2KXE A;  5FTN A;  1FJG M;  4MGZ E;  4GRI A;  2F5Q A;  3LVW A;  3UGJ A;  2FOI C;  1NY5 A;  2KW0 A;  5C1B A;  2CE7 A;  2DWL A;  3KW6 A;  4MM3 B;  3Q8X A;  4PCZ A;  3GQ3 A;  4I5S A;  3K8Z A;  2Z3X A;  5EJC A;  1T3T A;  1IBL M;  3NBI A;  5GKN A;  2VQF M;  4OU7 A;  4I8O A;  2ZBK B;  4R7G A;  3QAU A;  4IBJ A;  2R65 A;  5IT9 S;  3W0F A;  3W0L B;  1K3W A;  3MK6 A;  4FCV A;  3SAS A;  1IM2 A;  7CAT A;  4DV1 M;  2HCB A;  3U60 B;  3K2L A;  1ORY B;  2YQZ A;  3J7A S;  4DR4 M;  4XBO A;  2CHG A;  3VDP A;  1HQC A;  3FKE A;  3UMM A;  2NQ8 C;  3E9S A;  4AI6 A;  3HU1 A;  2YFQ A;  3GLF B;  3LQQ A;  3TQS A;  4LF9 M;  4HLQ A;  4GC9 A;  2M60 A;  3SMP A;  2XSZ A;  3M0E A;  3I51 A;  1OFI A;  1SXJ E;  4LJA A;  4KOD A;  1EE8 A;  5BPV A;  4LJ8 A;  2CFO A;  2UXB M;  1Z59 A;  3E4R A;  2FNA A;  4IIW A;  2M5Z A;  4JN6 A;  4OX9 M;  4ZPX A;  1GL6 A;  2R62 A;  4DR5 M;  1J5E M;  1X37 A;  4IBB A;  3U60 A;  3TWL A;  1E9S A;  2VQE M;  3LMM A;  3AOE A;  1R2Z A;  1PJI A;  2RGO A;  2Z4R A;  4M0D A;  3D8B A;  4P16 A;  5DNY A;  4FWG A;  2XEP A;  1YE9 A;  3GLF A;  3A46 A;  4BBA A;  1XNR M;  4JI5 M;  4IBC A;  2DZO B;  2J7N A;  2W82 A;  3CTW B;  5ITX E;  1QAN A;  2C98 A;  3KFU G;  3J80 S;  3VKH A;  2KA6 B;  3LVV A;  1XXH A;  3OTO M;  2V1C A;  4LF8 M;  5LMU M;  4KO8 A;  3AOG A;  3ZC7 B;  1MU5 A;  2CV0 A;  5E26 A;  4FWD A;  3FTF A;  1D2N A;  2J7O A;  3U6D A;  4JI0 M;  5ITU A;  3U6S A;  1DO0 A;  2C5R A;  3GP1 A;  2ZAO A;  3I4Y A;  4FW9 A;  4NSR A;  3FD9 A;  2L7I A;  1HR0 M;  3UJN A;  4LGY A;  4LFB M;  2DWM A;  5KO3 A;  4JI2 M;  3SAT A;  1I94 M;  3IG5 A;  1L1Z A;  2F5O A;  1IN4 A;  3R8F A;  3A45 A;  3FTD A;  4OW0 A;  3GLI B;  2DHR A;  3KDS E;  4L4U A;  3UZU A;  1OJL A;  4M9X A;  3TPZ A;  5FSW A;  1XXH B;  3FUU A;  3GQ5 A;  1ZQ9 A;  3KOX E;  1IQP A;  3MJ5 A;  4B3R M;  1HNZ M;  1W5S A;  2DXI A;  1KFV A;  3HKP A;  2R4J A;  3PXG A;  5EP4 A;  1Q3C A;  1N33 M;  4QNM A;  3L27 A;  4FCW A;  4R3D A;  1Z6T A;  1IY1 A;  4DR3 M;  1H6U A;  2Y20 A;  3KP0 E;  5KPR A;  3VK8 A;  1L2B A;  4B3S M;  5KPZ A;  2R45 A;  3M7G A;  1L1T A;  2KZS A;  2G8L A;  2R18 A;  4DV2 M;  3DA1 A;  2C9C A;  4A3V B;  2D7E A;  2Y21 A;  1LV7 A;  2CHQ A;  3EIH A;  4I81 A;  4D82 A;  3ILK A;  3GRR A;  1N78 A;  4K0K M;  3GLI A;  4B7G A;  3U6L A;  2D7G A;  3CF6 E;  4LJ6 A;  1MX0 A;  2KEB A;  3IG8 A;  2QCU A;  4QOS A;  3U6M A;  3PVS A;  3KXE C;  3ZCB B;  1IBM M;  1IXS B;  5EP3 A;  2CV1 A;  1Z5A A;  1K82 A;  3C58 A;  5FTJ A;  3GPP A;  1XWI A;  1G59 A;  1QAM A;  3U6E A;  5FTK A;  5FLX S;  4IBK A;  4G4N A;  3CF0 A;  1E32 A;  4REZ A;  4L78 A;  3UK6 A;  4GH9 A;  4QOZ C;  3TE6 A;  3SYK A;  5IRE B;  4LJ5 A;  3T38 A;  3AJI B;  2KRK A;  3RE8 A;  2UUC M;  4CIS A;  2HL7 A;  4I4L A;  4G6Z A;  4X66 M;  1J7K A;  4TUW A;  5F3W A;  2R46 A;  1PM5 A;  1G4A E;  2Q2E B;  2XFS A;  2CUZ A;  2DWZ B;  4NL4 H;  4BLC A;  4LF5 M;  4AKG A;  3L25 A;  3K92 A;  3KSJ A;  1NJG A;  3KOY E;  4GC5 A;  4JI1 M;  4NSO B;  1DGB A;  2UUB M;  4KLN A;  3HHZ A;  1NJF A;  1IY0 A;  2R4E A;  1JR3 A;  3RGP A;  1IBK M;  3BOS A;  3FUX A;  4LRS A;  4D81 A;  3U6P A;  2BNK A;  3U61 B;  2AHM A;  4LG2 A;  1QQW A;  3MHV C;  3SC3 A;  4X65 M;  4DV0 M;  5FTM A;  3A98 B;  3WHK A;  2C9O A;  5FTL A;  4YHH M;  3FTE A;  3U6O A;  3VKG A;  3U6C A;  1GL7 A;  3JAM S;  3JR5 A;  2FE8 A;  5KQ8 A;  4MH0 E;  4GKJ M;  1HNX M;  4NXN M;  2KRU A;  3HHW A;  2XH9 A;  5EP1 A;  3DOA A;  4M0W A;  4AG6 A;  4LFC M;  4NXM M;  4DV3 M;  4CHT B;  3WHL A;  4X64 M;  1S3S A;  3FUW A;  2RGH A;  4Z8X A;  2XLJ A;  2ZM6 M;  2UUA M;  1TGU A;  4EIW A;  4M9Z A;  2F5N A;  2O5R A;  1N75 A;  3M6A A;  4DR7 M;  5EQT A;  2OQ4 A;  1G41 A;  4QHS A;  3U61 A;  1N36 M;  2QBY B;  1DGF A;  3KOW E;  4B08 A;  4DV4 M;  2YNM D;  3U6Q A;  1R2Y A;  2P5T A;  4PDI A;  3GPY A;  3SAV A;  2UXD M;  3KOZ E;  4IBE A;  4AKH A;  1NVM A;  2DZN B;  1XHB A;  4MGY E;  2BJV A;  3T1Y M;  4LJ9 A;  5KQD A;  4GKK M;  1Q39 A;  2G5G X;  4DR6 M;  3NWL A;  4G4O A;  4IBG A;  2QEN A;  4LJ4 A;  4LFA M;  3GO8 A;  2ZAM A;  4LY6 A;  3J27 B;  2HHH M;  4D80 A;  4LF6 M;  3LQR A;  1TH4 A;  2FFJ A;  3SAR A;  4HL4 A;  2KZU A;  1E9R A;  1IY2 A;  4JI6 M;  3L2A A;  2DWN A;  3HJ8 A;  1SXJ C;  2V6Z M;  4DV6 M;  4JI4 M;  2QBY A;  1HQY E;  1R7R A;  3J7B A;  3KSX A;  5LMN M;  5JI2 E;  4DV5 M;  3AOE C;  2XF3 A;  2QP9 X;  3SAW A;  3B9P A;  1QAO A;  4NRW A;  2L09 A;  2LH0 A;  1TDH A;  1XC8 A;  1HT2 E;  3TWK A;  3CF2 A;  1NHW C;  8CAT A;  4JI8 M;  3THG A;  4JXJ A;  5ITT A;  4JYA M;  3SYL A;  4YY3 M;  4GMQ A;  4AZF A;  3HHX A;  2C96 A;  1NY6 A;  2VII A;  4B7F A;  4JI7 M;  1SXJ A;  3JR4 A;  3GRV A;  2XSZ D;  4QNR A;  1L2D A;  3H4M A;  3HU2 A;  2L7H A;  2QPA A;  4AQY M;  4IBD A;  1Z5C A;  1IN6 A;  5C18 A;  1G3I A;  5ITR A;  4ITQ A;  5EXX A;  2Z4S A;  3D8L A;  4DV7 M;  4GIP A;  4IBI A;  3T15 A;  1GVN A;  1XMQ M;  2CV2 A;  4RF0 A;  1ZAE A;  4MGI E;  3TL4 X;  3SAU A;  1GKI A;  1IN5 A;  4S12 A;  2UU9 M;  5EP2 A;  5DYI A;  4LRT A;  2HKJ A;  3SFZ A;  1TH3 A;  4JI3 M;  5IWA M;  3GPU A;  1HNW M;  3HJQ A;  1NNJ A;  3J81 S;  2K47 A;  2XZU A;  1QAQ A;  3R9X B;  1IN8 A;  3RGS A;  4DUY M;  1SXJ B;  4G4R A;  4FVM A;  2ZAN A;  3L28 A;  4GHA A;  4II7 A;  1DO2 A;  5EXP A;  4RNA A;  2CHV A;  1N77 A;  2D7H A;  3AFH A;  2C99 A;  1NNU C;  4NRV A;  4KHP M;  1I4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...