4DR5Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr5Q00
3U58A 4P71A 3GD7A 4NXMQ 1X3GA 2B63H 4JI0Q 1HNWL 1WJJA 1WI5A 2DUDA 3STBD 1T9HA 1PA6A 1FGUA 1YHAA 3PUZA 1N34Q 2PI2E 3ULLA 4OX9Q 2HIXA 4DR6Q 1O7IA 1QUQB 2MO0A 2XTIA 3G4SA 2PQAA 3I4MH 2AWNA 2F4VQ 1LYLA 1V43A 2MQHA 4DK3C 2HHHL 2UUCL 1P16A 1UE7A 1L1OC 2OQKA 4GKKQ 3E9HA 3FKIG 3L7ZC 1YEZA 2F3IA 1HR0Q 1XMQL 2OTLA 1UWVA 2CCZA 2UXDL 2MO1A 4B3SL 1J6QA 2HT1A 1V9PA 2VUMH 5HY6A 5IYCG 4ME3A 1G291 4JI8Q 3U4VA 3L0OA 1UE6A 4BY1H 4NXML 3HOUH 1J5EQ 1IBML 1I3QH 4GOPC 2OWOA 5IY0A 4XTCS 4A3FG 2VL6A 1HNXQ 1KXLA 2N8NA 1K9MC 1SFOH 3G6EA 4YCVA 3HKSA 4QQBX 3KOJA 4BA1I 2JE6I 3GTJH 1TXYA 2KCTA 1KD1C 4A3BG 1K8AC 3G48A 3RZDH 4LF7L 3HOWH 4JV5L 1K0RA 3D31A 1S3OA 4DAMA 3BJUA 1HJPA 4IO9A 3AFPA 4A3MH 4HIKA 2GVAA 5M3FH 4P75A 4AYBG 2PMZE 4A3GG 3MXNB 4KLKA 1VQJA 1EFWA 1CKNA 3K7AH 3LGJA 4J15A 4IOCA 3PO3G 4A3KH 2CFMA 3BU2A 2OCEA 3I56A 1B7YB 4NB3A 3T1YQ 2UXBL 4DV4Q 3M4PA 4MZ9A 4IFDG 2IHEA 3M7NA 2R6GA 5FJ8H 5AJ3Q 2K14A 2B3GA 2UXCQ 5J3BA 1OXVA 4JI1L 3S2HH 2K4KA 4OO1I 1EIYB 1VQBA 5GAGC 5IP9G 1A0IA 2KHJA 2PNHA 3CCQA 3CF5A 4DV2Q 1VQFA 1TWAH 3KDFB 2NN6I 2RHQB 2F52A 4DAYB 4JBKA 3KDFA 3GTPH 4YHHQ 3I55A 4LF9Q 2JJQA 2VZAA 4AH6A 2AHOB 4DV3L 4JBMA 1I94L 1VQ7A 3F2DA 2D0OA 4R4OA 1PFSA 3PO2H 1VCIA 1QUQA 4PG3A 2R7ZG 1RL2A 1PHJA 1IBKL 5IWAQ 2B29A 3BZCA 4GKJQ 3CC2A 3I4NG 4EX5A 1A63A 1VQ8A 3S24A 1XTDA 4GNXA 2IT1A 1MKHA 2BA1A 4MTNA 3J80i 3PIPA 2JA9A 4JYAL 1E3PA 1KL9A 3UDXA 2ASBA 1YJWA 4EQ5A 3CC4A 4DV5L 4YWKA 4DR7Q 1X55A 4A3GH 4JOIA 1FL0A 3CXCA 2A8VA 1GD7A 1CUKA 1SROA 1N34L 3EIVA 5M3FG 5C0XG 4LFAL 2NVQH 5AJ3L 1U0LA 2KHIA 4KI0A 1A8VA 1HZBA 1CSQA 5M5WH 1PH6A 3OW2A 2Z6KA 2OQ0A 2IHFA 1EUJA 4DR5L 3T1YL 1UE5A 2ZTCA 3Q8DA 3K81C 5ELOA 4DK6C 1Q12A 3J7A5 2VNUD 1X9NA 4YCUA 2UXBQ 2K5NA 4JCVE 2MNAA 3EBEA 1QZGA 4BY7H 3W1GA 2CWAA 1WYDA 4LF4L 5C44H 2R92G 3PGZA 3I4OA 4LUVA 5C4XG 2BA0A 2GN5A 4R4QA 4DR1Q 1PH7A 3ICEA 3M3YH 3J80c 2XGTA 1YNXA 2JQOA 3CCMA 1AE3A 5JEAG 1I94Q 4YY3Q 3CCSA 3HFZB 4C3IH 1I50H 5IYDG 2Q2TA 3H3VI 1HNWQ 1YBYA 2RCNA 3JAMc 1N8RC 4DKAC 4IOAA 3B6YA 2D0PA 2NVXH 4DV1Q 1XMOL 5C4JH 3PUWA 1NMGA 4HIDA 2HQLA 2R7ZH 2VUMG 3RLFA 4APVA 4JI4Q 4R4CA 3ERSX 3CCEA 4DUZL 2OTJA 3WWVA 4YWLA 3ULPA 4WJ3M 2KBNA 3ZJYC 1NBWA 4DR2Q 3HOVG 3GTMH 2E2IH 3S16H 3S1RH 1X3EA 4JI8L 4B3SQ 1JJGA 4IJHA 3E9IA 2KENA 2MFIA 4GS3A 4NXNL 3RN2A 1VQKA 4QGUA 2JA7H 4LFBQ 1Q1BA 3J81c 4K0KL 4R4IA 1KAWA 2JA8G 2CQOA 4GN4B 4K0KQ 5FLXc 1JJ2A 2K5HA 4AQYQ 1N33L 3GTKH 1L1OA 5H1SE 4GLVB 5C44G 2R92H 4X62Q 3KFUA 4LFBL 5IWAL 4DPGA 3OTOL 1JJCB 3S17H 4OO1G 3S1MH 4X65L 1M1KC 1Q7YC 1YZ6A 1PH2A 3PO3H 1Q81C 1OXSC 4LW1A 4XIGS 3NELA 4TVAB 1Q82C 4AYBE 1A62A 3KLWA 4X66Q 5LMUQ 1XNQL 3M4OH 1YJ9A 1WCMG 1KRTA 3RZOH 4UY8C 4GN5A 4A3JH 1OXXK 2JA5H 5IYDH 2Y0SE 1MIUA 5DLQE 1E22A 1JB7A 4JI6Q 1XNRQ 1XJVA 1IYJB 1IZ6A 5M3MG 3J81j 1Z47A 2A19A 2YTXA 1BBUA 2ID0A 4ALPA 1IBLQ 3K8AA 3G71A 4GLXA 3UE0A 4A3LH 4HJ7A 4QY7A 4UP7A 1C7YA 1CKMA 1K83H 4P73A 3TREA 5GADC 3CP0A 4BBSH 3S2DH 2VS1A 1SR3A 1EQQA 2R7FA 3K7UC 1CKNB 2UUBQ 3AEVA 2N49A 3HOVH 4A93H 5IP7H 4BXXG 1TWFH 1RIPA 1I6HH 1VQHA 2K52A 2Z0SA 2ZTEA 2ZJRA 1PH3A 2ZJQA 4LFAQ 2FXQA 4A4IA 2VQFQ 5FLMH 3HOXG 3S1NH 3S1QH 4YHHL 4LF9L 1ASYA 4BBSG 3TRZA 1GKHA 3H0GH 4JI7Q 2VW9A 1VQCA 4RG1A 3RN5A 1PH5A 2NZOA 2RF4A 4JI1Q 4JI3Q 3EN2A 1YITA 4JI2Q 1VQIA 2LXJA 2K50A 3S15H 3CCRA 2IX1A 5LMNQ 4BBRG 1X3FA 4BY1G 4DV5Q 1LUZA 2UUBL 1EYGA 2AWOA 4JI5Q 1CSPA 1Z9FA 1QZHA 1SRUA 2WB1G 4IPHA 2I5LX 3IRBA 4HIOA 2JA5G 3CQZH 1X65A 2R7DA 4BY7G 4A3IG 1MJCA 3J81i 3TQYA 1TWGH 3KF6B 2UUCQ 3I4MG 4DR5Q 3CMEA 1GVPA 1N32L 2YV5A 4A3CH 3KF8B 3PUVA 1VQ4A 1PH1A 2E2HH 4JI2L 2A1AA 4DV1L 2VQEL 1XMOQ 4JV5Q 4A3LG 3CC7A 4Y52H 1Y1WG 4LWCA 1N9WA 3UDIA 3D0FA 4A3IH 2JA7G 4IFDJ 5IYBG 1BBWA 1E7ZA 3I4NH 2ATWA 3CCJA 2AMCB 4DV2L 4IFDI 1KHIA 4YY3L 1UEBA 1VQMA 2EQSA 1BKBA 3KJPA 4JBJA 1VQNA 2E2JH 3HOYH 1IBMQ 1LM0A 1X56A 4JG2A 2ZM6L 4NPSA 5IP7G 4X62L 4BXXH 1JT8A 3U50C 3PF4A 5LMNW 4L5TA 1HR0W 3HKZG 4L5QA 4IPDA 1PYBA 4A76A 4A3DG 3CMAA 5IP9H 3H0GG 4LF7Q 1XPUA 5LMNL 4GNXC 4OXPA 4JBWA 4O0AA 3UDFA 1HH2P 4POFA 4DR3L 4A3DH 1BVSA 4QIWE 4JC0A 4A3BH 1Q46A 4DR2L 2WB1E 1PH4A 4HJ5A 3TS0A 3W1BA 4DV6L 1VQ5A 4DNIA 4DV4L 1VQLA 3TS2A 1PV4A 1XMQQ 1X54A 2CKZB 1VQAA 3FHWA 5C3EG 1W2BA 4PMWA 4X65Q 5C0XJ 2PQAB 1K3RA 3A0JA 1YI2A 1WCMH 1IBKQ 4B3TL 2D62A 4B3MQ 3HOUG 2F4VL 4A93G 2QGQA 4OWTB 1C0AA 3PCOB 4KHZA 1R9TH 1XPRA 1PH8A 3AFQA 1W3SA 4UP8A 5ELNA 3GTQH 3KJOA 1WFQA 5IYBH 1NJIC 4FDBA 4GKKL 2QEXA 4AIMA 3HOZH 4X64Q 1E24A 4B3TQ 1V1QA 3GO5A 5HGQA 4LF5L 1AH9A 4OWXB 4LF4Q 5GQOA 1S40A 1ASZA 1C9OA 4LF8Q 4JI6L 1XNRL 3SGIA 4GN3B 4B3RL 3L2PA 3HOYG 5JEAJ 3CPFA 2UUAL 1HZ9A 1EIFA 1HNXL 3GDEA 1XPOA 4X6AH 2E8GA 2UUAQ 1N36L 2NN6G 1VQOA 3PO2G 1PYSB 4RMFA 3I7FA 2BH8A 4JI4L 4DUYL 4YWMA 4KHPQ 2Q2HA 3T1HL 3OTOQ 1YJNA 1MJEA 4YCWA 4L5SA 4IPCA 5GROA 4LF5Q 3NENA 3TEHB 1HZCA 4PZ8A 1X6OA 2LXKA 2HHHQ 4A3CG 4GOPA 5K36G 3A5ZB 1KQSA 1KRSA 5IE8A 3RNUA 5JJLA 2C35B 4R1JA 1VQ9A 1Q1EA 1QVGA 2WAQG 1E1TA 2NVYH 3CPWA 3ULJA 4LFCQ 4DR1L 3PUYA 4A3EH 2ZJPA 3I2ZA 1TWHH 4DUYQ 5JJKA 4DV0L 1JMCA 3PSIA 1NE3A 3M9BA 1L2FA 1P8LA 1G51A 2V1CC 5C3EH 4HJ9A 4A3MG 4JOIC 3H15A 2DGYA 1B8AA 3KYHC 2PI2A 1AE2A 5C0XI 1N36Q 4IJLA 2B63G 4DUZQ 2N3SA 1YHQA 1FVIA 3BZKA 3F1ZA 3S14H 2QA4A 4JI3L 2Z6KC 4P74A 1SLJA 3A74A 1HR0L 4DR3Q 1OTCA 4DR7L 5C4XH 4C3JH 4JI7L 2VY3A 5M5XH 3A5UA 3PF5A 3F8TA 4UP9A 4GLAC 4LUOA 2VQFL 1NMFA 3CCLA 4JYAQ 4GOPB 2Q2UA 3OYYA 2NVTH 1VS0A 2I0QA 3DM3A 1WOCA 2E5LL 2BH2A 1SE8A 4JI0L 1VQPA 4JI5L 2IY5B 1VQ6A 4P72A 4GKJL 3PUXA 4A3FH 1KC8C 4GNXB 2RHSB 3H3VH 1K73C 1VQEA 3AYHB 4LF6Q 1U5KA 3PV0A 4DV6Q 1QVFA 4C2MH 1JE5A 1FJGL 3UE1A 4HJ8A 3ER0A 5E7NA 1NTGA 3HOWG 1GM5A 3CW2C 4OWWB 2WAQE 3FKIH 3MEFA 3HKZE 2L15A 2VQEQ 1HNZL 2UXCL 1L1OB 3J7ZC 2YU9H 2YTVA 2JEAI 2UU9L 3CD6A 1PVOA 1EQRA 4UPAA 3HOZG 2H5XA 2I5HA 4HIMA 2YTYA 1KIXA 1YIJA 1LTLA 4PZ7A 3E0EA 1DGSA 2E5LQ 2EIFA 1OXUA 3UDGA 3RR5A 4Y7NH 3NBHB 4DV7Q 4DR4Q 3W5OA 2WFWA 5FLMG 3HOXH 1EWIA 2I5MX 2R93G 2AKWB 2JK8A 1HZAA 5BR8L 3CCUA 1TWCH 2KCMA 1OXTA 3GTOH 3M4QA 1Y1VH 5IT9c 3F2BA 2ES2A 1H95A 1IL2A 2Y0SG 4QL5A 2K5VA 4QJFA 5GAEC 1SMXA 2UU9Q 2JA6G 4BA2I 4PZ6A 1M90C 3CCVA 3NEMA 3RLNA 3FP9A 1HNZQ 2R93H 4B3ML 3K0XA 2EXDA 2Q2IA 2N78A 4A3KG 1G6PA 2JA8H 5M3MH 2CWPA 3U4ZA 2UXDQ 3JAMi 2HIVA 2WP8J 2JA6H 4C3HH 2ALYB 4LF6L 5IYCH 1N32Q 1D7QA 4LUZA 1K8GA 5BR8Q 2NZHA 4LFCL 4LNQA 4A75A 1NY4A 5FJ8G 4A3EG 3CAMA 1L0WA 1J5EL 1PH9A 4AQYL 1N33Q 4DV7L 4DR4L 1I5FA 1VQDA 4LF8L 4B3RQ 4DV0Q 3RLOA 3F2CA 2K75A 1VQGA 3JC66 4IPGA 4X64L 1Y1WH 1D8LA 1GO3E 4OONA 3KF6A 4DV3Q 4A3JG 1IBLL 3GTGH 1IXRA 3M85A 1B70B 4MNOA 1YHBA 1YVCA 3PIOA 3T1HQ 4NXNQ 2ZTDA 4WJ4A 5JJIA 5EAYA 1E1OA 1CKOA 1QVCA 4O2DA 4TQUS 4OX9L 4DR6L 5M5YH 4L5RC 3VDYA 3STBC 1S72A 2JEBI 4R4TA 4HJAA 1UE1A 5LMUL 1FJGQ 2GVBA 2YYZA 2ZM6Q 1XNQQ 3DLLA 3GTLH 4KHPL 3K80C 4H02A 1EOVA 3AQQA 1Y1VG 5GAHC 1Y14B 1Q8KA 4X66L 1Q86C 4POGA 1SN8A 4BBRH 2IX0A 2LSSA
chains in the Genus database with same CATH superfamily
4OIJA 4R8NA 4FF3A 4P71A 2F0VA 1WJJA 2DUDA 1T9HA 2B8FA 3T51B 1YHAA 3PUZA 4OX9Q 2HIXA 3H3VC 1O7IA 1QUQB 1AZPA 1SE4A 2AWNA 1F2YA 1LTSD 1EEID 2MQHA 4DK3C 4GKKQ 2UUCL 1TY0A 1F9QA 3E9HA 1XMQL 1UWVA 1TQOA 1FNUA 1EZ6A 5IYCG 4ME3A 3QB3A 4JI8Q 4KHVA 3U4VA 3I4MB 5C5LA 4BY1H 4NXML 1IBML 1RHPA 4GOPC 2RDGA 3ND8A 3OIQA 1SYDA 1V8QA 2B2UA 1SDFA 1SFOH 5E4XA 3FRPB 3K6OA 4DAPA 3GTJH 3G48A 5DEHA 3BJUA 3AFPA 3S1MB 4RHSA 5M3FH 3H6MA 3M4YA 4A3GG 4KLKA 1CKNA 3NPPA 1PTOF 3PO3G 1Z7TA 2CFMA 1KAAA 2OCEA 1HTLD 2G5DA 3NQIA 3I56A 4NB3A 3H0GB 1V1OA 4OGQC 2UXBL 4DV4Q 5EBDA 4MZ9A 2IHEA 3IKJA 5FJ8H 5CV6A 5AJ3Q 2MPMA 2JXMB 2EY5A 2K4KA 3D6CA 1A0IA 4DV2Q 1WTOA 2A5HA 1TWAH 3GTPH 2RHQB 3SK6A 4JBKA 3KDFA 4LF9Q 2VZAA 4AH6A 3VR5A 1IKLA 2DY8A 3F2DA 1QJOA 3S1NB 2SNMA 1F9RA 1IBKL 2B29A 2F0UA 4A3GB 1VQ8A 1XTDA 2IT1A 3C1EA 4MTNA 5EKIA 5I2XA 3DXJC 4JYAL 4HR7B 4X3UA 5T1GA 1YJWA 1BCPB 1D1IA 2L12A 3CXCA 2A8VA 1CUKA 3HOYB 3PIO3 4LFAL 2NVQH 5JAVA 1MI2A 2VXWA 5CV4A 1TWGB 3K81C 5CORA 1BCPD 4YCUA 1WD1A 2UXBQ 2EPBA 2MNAA 5C3WA 3HEJA 2ZT9C 1FNWA 1WTPA 2R92G 4IFDH 3OW7A 3I4OA 5A2QL 4DR1Q 1PH7A 1S5FD 3CCMA 1H9MA 1AE3A 1I94Q 3HFZB 2B2UC 5IYDG 1HNWQ 1YBYA 3R3OA 2B63B 4IOAA 4HIDA 1HUMA 2FMMA 4C3JG 1U4MA 1BQQT 2VUMG 1B44D 4YWLA 4DAYA 2HDLA 2HD3A 2RA4A 2NVXB 3H09A 2R7ZB 3RN2A 1ET6A 1F2ZA 4K0KL 4R4IA 3GTPB 4CKEA 2CQOA 1H9SA 1JJ2A 2JA6B 1DCZA 1M4VA 4JK1C 4AQYQ 3HGBA 4MTKA 3A7AB 4PV1C 4X62Q 3KFUA 2F0DA 1BCPC 3OTOL 1Q7YC 1YZ6A 4HTHA 4LAAA 2O5IC 1OXSC 4XIGS 5DNFA 1SJED 5LMUQ 3KLWA 4KN4C 3TP6A 2EY1A 3V05A 1Y1WB 1SJHD 4ZUJA 4DU9A 1KRTA 3BDOA 3RZOH 1OXXK 3G6JB 4BWGB 3T4AC 5KIXA 2NBFA 2Y0SE 3R8BA 1E22A 1DXMA 1XJVA 2N88A 2E75C 2WINB 2OEOA 1VF7A 3FDTA 1BBUA 2ID0A 1B4OA 1LT6D 4GLXA 2AUJD 4QY7A 3P1HA 1K83H 4FP5D 3TREA 3OWFA 2VS1A 1DONA 1TWFH 2Z4IA 1LTAD 3MFYA 2J7ZA 2K52A 2Z0SA 2FXQA 4MN3A 5FLMH 3HOXG 3PO2B 5LL6S 1LTGD 2A6ED 2AUKA 3SK8A 2NZOA 2RF4A 2SEBD 1KLGD 1EY4A 4XXEA 4JI2Q 2Z6BA 1LUZA 1CSPA 1ENCA 1ICFB 2F0SA 2J0TD 1SRUA 2JA5G 5A2QE 1V1PB 3CQZH 2R7DA 2TSSA 1QOHA 4K14A 2LFNA 3DEPA 1C48A 4DR5Q 2D2CC 1N32L 4A3CH 1PH1A 2A1AA 3ONAB 4DK1A 3VR3A 2B2TA 1Y1WG 4LWCA 5CR3A 5CV8A 3TP5A 3CCJA 2AMCB 4YY3L 3KLRA 2EQSA 4O42A 1VQMA 3VA7A 2MHVA 3P20A 3HOYH 1IBMQ 1X56A 1JB3A 2OXPA 2EYPA 1JT8A 4K8JA 5LMNW 4L5TA 2WB1B 4IPDA 1PYBA 4CDFC 4JBWA 4O0AA 2KOLA 3UDFA 1HH2P 4DR3L 5AFWA 3EFXD 4FNFA 4JC0A 2A69D 2HDMA 1HHVA 1MGSA 4HJ5A 1M8AA 1VQ5A 1XWEA 4DV4L 4CBVA 1VQLA 2JYOA 5FKAC 3BG3A 3HOUG 4B3MQ 4TSSA 2D62A 3C3LA 2F4VL 1W3SA 5ELEA 4UP8A 1SYGA 2NVQB 1WFQA 2O2LD 1X3QA 1S4ZA 3IFTA 3GO5A 4LF5L 4OWXB 1GUOA 4LF4Q 2LKVA 4KJNA 4JI6L 4LF8Q 3L2PA 3K0YA 3IL8A 2C5CA 3CPFA 4J8QA 4MIUA 5D65A 2F0MA 2NN6G 5BN3A 4JI4L 4FYDA 2PYKA 3T1HL 1YJNA 2F4IA 5GROA 4LF5Q 1EWCA 2LXKA 5K36G 3A5ZB 4J6HA 1AN8A 3RNUA 5IE8A 1QVGA 2BOSA 2KECA 2WAQG 5KGUA 3NUCA 4WJWA 1S5BD 4QF4A 4LFCQ 1STHA 2F0EA 4DR1L 3HZXA 4A3EH 4N9PA 2ZJPA 1KDCA 3SHLA 1CI3M 4DV0L 2ZXRA 1L2FA 1G51A 4BS9A 3MWYW 2DGYA 1N36Q 3P75A 2PI2A 1XXGA 2B63G 2XVSA 2N3SA 2B2VC 2F3WA 3K57A 3BZKA 3BYYB 1JC7A 2VUMB 1JWUD 4K5WA 1GUNA 4UHVA 4WFN3 5IGFA 3QG1A 5C3EB 4DR3Q 3QOJA 2VY3A 2FFKB 3A5UA 4QIWB 4UP9A 4KKTA 3OYYA 2CW0D 2I0QA 3DM3A 4P2CB 1VQPA 1D1KA 5A35A 3PUXA 3Q23A 2EZVA 3S9WA 2RHSB 3AYHB 5F2DA 1U5KA 5EBCA 1SSOA 2CW0C 4DV6Q 1NCVA 4C2MH 1JE5A 1FJGL 4HJ8A 2BE5C 3HOWG 2WAQE 2UXCL 3J7ZC 2YU9H 2YTVA 1SNCA 1EQRA 5KNBA 1CA6A 2YTYA 1KIXA 1LTLA 4PZ7A 5ELBA 2EIFA 3DEOA 3GTLB 1ONLA 3NBHB 2WFWA 1EWIA 1RKNA 4KN7C 4HMIA 2AKWB 2JK8A 4OO1H 1H95A 3F2BA 3TMEA 1PFMA 1UNSA 2Y0SG 4G57A 4QL5A 4QJFA 2L5TA 3ND9A 1M90C 2D9UA 4CHTB 3NEMA 5CGKA 3K0XA 1B1ZA 1MD2D 2Q2IA 4A3KG 1EYDA 4ZK9B 2UXDQ 3JAMi 2HIVA 4C3HH 2ALYB 3D3RA 5IYCH 4LF6L 1K8GA 4K8IA 1Y69U 3CAMA 1J5EL 1PH9A 1N33Q 1I4GA 1R4PB 2KCNA 4DV0Q 1JR0D 1I4RA 3F2CA 2F0NA 3KF8A 2K75A 1VQGA 1D2BA 4C3HG 1D8LA 4OONA 4ABNA 3KF6A 3S1RB 3FKIB 4CDEC 1IXRA 1B70B 1I4QA 1W6KA 3BVMA 4NXNQ 5JVG3 4WJ4A 1WTVA 4O2DA 4TQUS 4OX9L 5M5YH 3VDYA 4ZQ3A 1UE1A 2YYZA 3LX0A 1JWSD 3DLLA 1EY0A 4KHPL 3K80C 5GAHC 2HUGA 3J80E 4V190 4BBRH 2IX0A 3KLSX 1EY8A 1II3A 4JI0Q 1WI5A 2H1EA 3STBD 1FGUA 2XWBB 3ULLA 4DR6Q 5FOBB 3F2UA 2XTIA 3G4SA 3I4MH 4N8FA 2LS01 1UE7A 1SAPA 3FKIG 1BXTA 1D5MC 3C2PA 1QNUA 2MO1A 4F87A 1V9PA 2KVMA 1C4QA 2WIIB 4KD3A 1GOZA 4N9TA 4C3JB 1WTRA 1I3QH 1A6XA 2OWOA 3BVZA 3DM1A 1NUCA 5M3FB 1JCKB 4EQOA 2AQ2B 2JE6I 1B9MA 4A3BG 1K8AC 3RZDH 2PZWA 1BF4A 4LF7L 3MXGA 4DAMA 4IO9A 1HJPA 3S2DB 4KD4A 1CZGA 2O5JC 1BOSA 1WD0A 2PMZE 3I4NB 3O13A 1EFWA 3K5NA 2X6GA 2R3ZA 3BU2A 1B7YB 1IYUA 5JJZA 4IFDG 3M7NA 5IOCA 2K14A 1LTRD 5J3BA 4OO1I 4JI1L 5CYUA 5GAGC 2KHJA 3CCQA 3CF5A 4CJ1B 3KDFB 4B9WA 2AHOB 4DV3L 4JBMA 1VQ7A 3WDNA 3PO2H 3OMGA 1VCIA 1PLFA 1QUQA 2I07B 2XRSD 5KEEA 1PYWD 3MTSA 1A63A 5FLXL 1SNOA 1MKHA 3J80i 4H44C 3PIPA 4A3JB 2EY6A 1E3PA 1KL9A 1TS3A 2ASBA 4EQ5A 3CC4A 4DR7Q 2Z1CA 3OWEB 1X55A 1FL0A 3AMUA 5EJWA 4CDDC 1PDQA 1FYCA 1K8MA 1U0LA 2KHIA 4KI0A 5AJ3L 1HZBA 3GTGB 4ZKCB 5M5WH 1L0XB 2Z6KA 1KDBA 2IHFA 4DR5L 1Q90A 2A69C 2ZTCA 2FJ2A 3MZ5A 2ENBA 4KJOA 5J1ZA 2EDGA 4BY7H 3EBEA 1D5ZC 5M3MB 3J7AV 5DAUA 5C4XG 3M3YH 2R61A 3J80c 3QR8A 1YNXA 5JEAG 3T56B 2Q2TA 3JAMc 1N8RC 1GUSA 1XMOL 2HCIA 2R7ZH 2NZ1D 4QB4A 5G3LD 3NWTA 2OTJA 1O7ZA 2XNAC 2KBNA 5IT9E 3VYUA 1HFGA 1RCVD 2E2IH 3S16H 4JI8L 4IJHA 2KENA 1DOKA 4GS3A 4NXNL 1VQKA 2F0JA 4QGUA 2JA7H 1I4XA 1TT2A 2AQ1B 1DOMA 4A3IB 1ML0D 5FLXc 2PNRC 3J7YW 3BDCA 3ITPA 1N33L 1PFBA 5C44G 3TZUA 1JQYD 1M1KC 2O4XA 3PO3H 4I65A 4OIKA 3NELA 1Q82C 4AYBE 1A62A 4JPBW 1XNQL 1G6ZA 4G4KA 1ILPA 1EYAA 1WCMG 2F0GA 4GN5A 4A3JH 1K28A 3SK5A 3HOZB 5DLQE 1AFPA 4JI6Q 1D6EC 1IYJB 3N6RA 3G71A 2NUCA 2DY7A 4WRDA 4HJ7A 1J9OA 4A3LH 1C7YA 4P73A 2F03A 5GADC 4BBSH 1EQQA 3HOVH 3AEVA 2UUBQ 3JAML 2N49A 1VQHA 3NQTA 1JOKA 2ZJRA 1PH3A 4A4IA 2VQFQ 3S1NH 3S1QH 4YHHL 4BBSG 3TRZA 4RG1A 5I9PA 1I6HB 4JI3Q 3EN2A 4A3EB 4U673 4K2KA 2IX1A 1I6VC 2UUBL 2AWOA 3R93A 1QZHA 2WB1G 5KNCA 4RGNA 1X65A 2IPKD 1MJCA 3KF6B 1GJXA 1B3QA 1GVPA 2YV5A 3KF8B 1VQ4A 1XMOQ 1EQTA 4JV5Q 1STNA 1CA5A 3CC7A 5C6AA 1N9WA 2KEEA 4IFDJ 2BCOA 1E7ZA 1Y8PB 2ATWA 4IFDI 1H9RA 1KHIA 3W3AA 1UEBA 5IT9L 5CBEE 1BKBA 2A6HC 3KJPA 3HRZC 2E2JH 1GUWA 3TN2A 4NPSA 4BXXH 3U50C 1TR5A 1HTPA 5L37A 1PZID 3CMAA 5IP9H 3H0GG 4LF7Q 3EQLC 1ET9A 2DJGC 2F0PA 3E6ZX 4OXPA 2QF7A 2B8GA 2E76C 1CM9A 4KK7A 5ELFA 1Q46A 1CQVA 3HOXB 1T5XD 4FF4A 3QIAA 4DV6L 3A55A 3TZDA 1ESFA 3GQBA 3TS2A 2B2WC 1X54A 2CKZB 3VR4A 3I3CA 4X65Q 3EROA 2XRQD 1MBYA 1KNEA 5ELNA 5IYBH 4AIMA 2F0TA 3HOZH 4X64Q 5CBAE 3RZDB 1V1QA 5HGQA 2H4OA 2Z4HA 2B2TC 4B9XA 4B3RL 3SGIA 3IFDA 1PZKD 1EIFA 1XPOA 1J8IA 3J81L 2FHTA 3EA6A 4DNRB 1VQOA 3M3YB 3I7FA 1G91A 2BH8A 1U4LA 1L0YB 5M5YB 4KHPQ 2Q2HA 3URYA 3OTOQ 3EJIA 4YCWA 2K5DA 2BDNA 4IPCA 3NP8A 3TEHB 2HHHQ 1LTBD 4A3CG 4L8JA 1BNZA 4G7OC 1KRSA 2L0CA 3A8KE 5JJLA 2C35B 1VQ9A 1Q1EA 1E1TA 1NAPA 2NVYH 1TKWB 3S16B 5JJKA 2F0OA 3PSIA 4HJ9A 4A3MG 4CKCA 2KUMA 4NKLA 3H15A 4X3KA 1B8AA 5C0XI 1TU2B 1A2UA 3OHXC 3S14H 2XWJB 2NVTB 4JI3L 2IWHA 3QJYA 2E74C 3A74A 2L11A 4JI7L 1QE6A 4XQJA 3SK4A 1STEA 5C4ZA 2Q2UA 1GUGA 1YNJC 1WOCA 2K04A 2E5LL 3MHBA 4JI0L 4XYOA 4J1MA 1H9SB 1KC8C 4A3FH 2IJ0A 1YNJD 1K3BC 1EY7A 3ER0A 2RCFA 5E7NA 4HCEA 1NTGA 1U4RA 1GM5A 4FF2A 4OWWB 3HKZE 2VQEQ 4CKBA 1L1OB 1ENAA 3P7JA 4F7XA 2JEAI 2UU9L 1JORA 1V1PA 4UPAA 2KQ3A 2L4NA 1ILQA 4PNYA 2E5LQ 1OXUA 3RR5A 5M9OA 4Y7NH 4XT3B 1NR2A 2CHBD 2E2HB 2R93G 2OT2A 5BR8L 1TVXA 3CCUA 3GTOH 1OXTA 3M4QA 1Y1VH 3LNNA 5IT9c 2ES2A 5C44B 2K5VA 4BA2I 3H91A 5IGGA 3CCVA 2FMCA 2EE1A 3FP9A 1HNZQ 4K5XA 4R8IA 2R93H 4B3ML 2CH4W 2E2JB 2EXDA 3J80L 2NVYB 1CQFA 3NK9A 3J81E 3K5OA 1QILA 2EVBA 1CTMA 1SBBB 4LUZA 5BR8Q 2NZHA 4LNQA 4A75A 1NY4A 4K6LA 5DM63 1EIGA 4A3EG 4AQYL 2NN6H 3MVVA 3JC66 1GO3E 1ZXTA 4IUUA 1IBLL 2EYHA 3I90A 4IUPA 1YVCA 3PIOA 5C0XH 3T1HQ 5JJIA 1QVCA 3KBGA 4R4TA 4HJAA 2QILA 2GVBA 1QWYA 2ZM6Q 1FJGQ 1JOQA 1EOVA 1Q8KA 4X66L 1SN8A 1ENFA 2LSSA 3U58A 4NXMQ 2B63H 1PA6A 1N34Q 2PI2E 1E2WA 1UEAB 3HKZB 2MO0A 4HEDA 2WKCA 2F4VQ 1LYLA 1V43A 2A68D 2OQKA 1L1OC 1YEZA 4B3SL 2HT1A 3S14B 5KYIA 1PRTF 2I46A 4G7HC 2ICIA 2LY7A 4RGOS 5IY0A 4OL7A 2N8NA 4YIJA 1K9MC 3G6EA 3HKSA 1A15A 1ZKOA 3KOJA 1Y8NB 4BA1I 3I8ZA 1KD1C 2GA4B 1IW7C 1I3QB 3HOWH 2WV6D 5D3IB 3D31A 4KMUC 2RBMA 1S3OA 2PW7A 1S5DD 4A3MH 3BYTB 4P75A 2K28A 1B50A 2JA8B 1CK1A 2K6AA 1SYEA 5EGTA 1VQJA 3SXHA 4IOCA 4PQXA 4A3KH 1G2SA 1SNPA 2NWGA 4DXFA 5ISRA 3T1YQ 1NSNS 2PO4A 1GUTA 1X32A 1SNMA 3FPPA 1RD9D 5M5XB 2K5QA 3H94A 3PIP3 1OXVA 4PMCA 3S2HH 4HN7A 2PNHA 5JEAH 1DZ1A 1VQFA 2NN6I 4DAYB 5JPNC 4YHHQ 4C2MB 3I55A 5I6WA 2D0OA 4R4OA 1TWFB 4EQPA 4IZ8A 3R2IA 2R7ZG 2RDFA 1PHJA 4KY6A 1CHPD 4GKJQ 3ERQA 4ID6A 3CC2A 4EX5A 3I4NG 4GNXA 1B2TA 4RWSC 2A68C 2JA9A 4IUVA 1CT1D 5M5WB 2PCFB 4DAVA 4YWKA 3L3OC 1FNVA 1G8ZD 4A3GH 4JOIA 1N34L 1Y1VB 3QWNA 3E0JA 5EQ0A 4FXDA 3CHBD 3GTKB 4I7AA 3T1YL 1Y8OB 2KEDA 3J7A5 1F77A 5KNDA 1Q12A 1R9TB 2BDOA 2EJGC 1HQRD 3R2TA 2K5NA 1QZGA 1LTTD 4H7BA 4IUNA 1WYDA 2CWAA 4LF4L 1QG7A 2ZXPA 2BA0A 2GN5A 1SE3A 2F0LA 3MEHA 2EXZA 2XGTA 2JQOA 3FPUB 3VR6A 4ZRZA 3CCSA 1UAPA 1I50H 3H3VI 4RAUC 5BN4A 3B6YA 2D0PA 2NVXH 1LT4D 5C4JH 3PUWA 1NMGA 2HQLA 1F2LA 3RLFA 3CCEA 1I50B 4BBSB 4WJ3M 1NBWA 4N8X1 3HOVG 4LJZC 3GTQB 5G3LF 1X3EA 2MFIA 5HGTA 2Q8RE 4LFBQ 4BBRB 4A3DB 1Q1BA 3U9OA 3PO3B 1G2TA 5C4HA 2WACA 2JA8G 2F0WA 4GN4B 3OOCA 5NUCA 4K0KQ 2K5HA 4QCLA 3GTKH 3S15B 2R92H 5D3DA 1WTQA 4X65L 1PH2A 1HA5A 4TVAB 2UXDL 3M4OH 1AW7A 1YJ9A 4A3KB 4UY8C 1PTOB 2JA5H 5IYDH 4QUCA 1A3VA 3VYTA 5JPMC 2PPBC 2DJFC 4OHJA 1JB7A 5M3MG 5I9OA 1Z47A 2YTXA 3A8JE 2K33A 1PTOH 3K8AA 2JA5B 3MAQA 4UP7A 1X3PA 5D14A 1LT3D 3CP0A 3S2DH 1SR3A 2R7FA 1LV9A 4A93H 1I6HH 4BXXG 2ZTEA 2ZJQA 4LFAQ 1ESRA 2Z8LA 4KY7A 4L63B 1ASYA 4RCNA 3H0GH 2K7VA 2VW9A 1VQCA 3D8GA 4JI7Q 2X69A 3RN5A 1PH5A 4JI1Q 5J39A 2K32A 1LO5D 4XQNA 2KA7A 1VQIA 3A54A 2K50A 4OEMB 5EPKA 3CCRA 4U68A 1SMYC 5LMNQ 1X3FA 4BY1G 3EVQA 1BCPF 3HS0C 4DV5Q 5CV5A 1EYGA 3QOLA 1SEBD 4AYBB 1K0SA 3IRBA 5C5MA 4HIOA 4RGTA 3M4OB 2MJ8A 4BY7G 3NTKA 1TWGH 2UUCQ 5LL6X 3CMEA 2EOTA 4PMBA 2F0IA 2E2HH 1IW7D 2VQEL 3OSOA 1EL0A 2K03A 1PZJD 1AZQA 3X3NA 2NYZD 3D0FA 2JA7G 4K2LA 5IYBG 1BBWA 2TMPA 3I4NH 1SYCA 2L55A 4DV2L 2V4DA 4IURA 3MC0B 2MUYA 2C9OA 1LM0A 4RHRA 1IKMA 3K58A 5IP7G 4X62L 1JICA 1I4HA 4FXGC 1O7LA 1HR0W 2WAQB 4L5QA 3G7LA 4A3DG 3SR1A 1RJTA 2A6HD 4KY5A 4LMQD 3SE0A 4GNXC 1KABA 3TP7A 4A3DH 1BVSA 4QIWE 2DNEA 4A3BH 4DR2L 2WB1E 3NBIA 5K36H 1PH4A 3VYRA 3TS0A 1EWHA 3W1BA 3KLSA 5CC4A 2EYFA 4TRDA 3RUZA 1PV4A 4I7ZC 4BY1B 3HP3A 4PMWA 1YI2A 5C0XJ 1K3RA 3A0JA 4B3TL 1OO9B 1WCMH 1H9KA 2QGQA 4OWTB 3D4RA 3PCOB 1C0AA 3AFQA 4JVZA 1MSHA 3GTQH 4ZAIA 2F0HA 3KJOA 4GKKL 1QB5D 1E24A 3Q22A 1GXDC 1ASZA 4RH6A 1XNRL 4GN3B 5C3XA 2UUAL 1HNXL 3GDEA 3MA2B 1TIID 2B2YC 2UUAQ 3VA5A 1N36L 4XDXA 3PO2G 1PYSB 3GTOB 1IYVA 3NENA 1CFMA 1HZCA 4RGMA 1X6OA 4NW2A 1FR3A 1IL8A 4JW0A 1GHJA 4R1JA 4RKLA 2QDLA 3Q6SA 3A56A 4H0LC 4NP5A 3S1QB 1SXTA 3I2ZA 3PQIA 1JMCA 1NE3A 3M9BA 1P8LA 5C3EH 1KTKA 1STGA 4IJLA 4TKOB 4DUZQ 1YHQA 1FVIA 3F1ZA 1QCBD 2QA4A 1ICWA 3TDQA 2CVRA 5FLXE 2Z6KC 1SNQA 4DR7L 5C4XH 4C3JH 2QW7A 3PF5A 3CCLA 2VQFL 1NMFA 3CRLC 2NVTH 5ELCA 1VS0A 2A73B 4HSVA 2EYMA 3GP7A 4R9WA 2F3VA 2FINB 4JI5L 2IY5B 4GKJL 4ZYSA 1F2MA 4ZLTF 2CQAA 4GNXB 2IX3A 2J4XA 3TSSA 3J7AF 3H3VH 1K73C 1F9PA 3PV0A 3NSWA 3UE1A 5IGEA 3GV6A 3CQZB 3V96A 2K01A 3CW2C 4KKSA 4LK1C 1F9SA 2RKSA 3BDLA 4RA8A 3CD6A 1PVOA 5EKKA 3HOZG 2H5XA 2X6LA 3TBIB 1TS2A 1YIJA 1E2ZA 4XT1B 1VMCA 1DGSA 3E0EA 3RMHA 1CHQD 2LMCB 1EY5A 1A3UA 5FLMG 3HOXH 1HZAA 1SFOB 1TWCH 3AU7A 1IL2A 5GAEC 4IALA 1LABA 4PZ6A 4FO2A 4C56C 3FVQA 4EVOA 1SE2A 1RF2D 1WCMB 2PMZB 3IAYA 3NWSA 2CWPA 3U4ZA 1WTWA 3CRKC 4DFAA 4EQNA 1Q3LA 2HCCA 3DHQA 1N32Q 1D7QA 2F0QA 1MHWC 5KRUA 4F88A 4LFCL 4IN3A 3C46A 5FJ8G 3S17B 1ZEQX 1VQDA 4B3RQ 3I70A 5ELDA 3BVGA 4IPGA 1NNXA 4X64L 1Y1WH 1STYA 1HXYD 4A3JG 3GTGH 3M85A 4MNOA 1U4PA 4ULLA 4O1NA 1YHBA 4BY7B 5EAYA 1E1OA 4FF1A 1CKOA 5FK9C 4DR6L 1XYIA 4NDXA 4L5RC 1BR9A 2NB0A 4ZUIA 1S72A 2VB2X 1C8CA 1XNQQ 4H02A 3E5SA 3AQQA 1Y14B 1WTHA 2XSCA 5DM73 3GD7A 1X3GA 1HNWL 2KHSA 1HFNA 3JAME 3OMCA 1IHZA 1QNKA 2PQAA 1BBXC 2R93B 2HHHL 1P16A 2KJXA 2SDFA 4HAEA 3L7ZC 2F3IA 1HR0Q 2OTLA 2CCZA 1J6QA 4L6TB 2VUMH 5EKLA 2RVLA 5HY6A 1G291 2KCCA 3L0OA 1UE6A 3HOUH 1VDZA 2QCPX 2RSOA 3MXUA 4Y7NB 1J5EQ 4XYQA 4XTCS 2JA7B 4A3FG 2VL6A 1HNXQ 1KXLA 3TP8A 3BZDB 4YCVA 4QQBX 5BN5A 1TXYA 2KCTA 2CH4A 1PRTC 4JV5L 1K0RA 4DNTB 4C3IB 4GZYC 2B2YA 4HIKA 2GVAA 1PTOD 3KUPA 3D4DA 4AYBG 3MXNB 4Q0FA 1KLUD 2EJMA 3K7AH 3LGJA 4J15A 3WOFA 1RODA 2K1BA 3NTIA 3T13A 4FXKC 3M4PA 1KNAA 3L9AX 2R6GA 4CGYB 4DGZA 2B3GA 4DF7A 2UXCQ 1SYBA 1HRJA 3CU7A 1EIYB 1VQBA 4B08A 5IP9G 1Z6HA 1SNDA 3HOVB 2F52A 2BE5D 2JJQA 1LTID 1I94L 1PFSA 4PG3A 3HOUB 1RL2A 5IWAQ 4UDUC 3BZCA 1BUVT 1ZYRC 3HG9A 3S24A 5E1FA 4RCOA 2BA1A 4RFBA 2QEJC 4UAIA 5E4WC 3I72A 5CV9A 3Q24A 2JP1A 3UDXA 2B2VA 3K5MA 4DV5L 2EYOA 1GD7A 1SROA 2ZXOA 1VMPA 2AQ3B 3EIVA 3K5LA 5C0XG 5M3FG 4V0BA 1A8VA 1CSQA 5KYLA 1PH6A 3OW2A 1Q8IA 2OQ0A 2Q8TA 1EUJA 1UE5A 3Q8DA 5ELOA 2K5WA 4DK6C 2VNUD 1X9NA 4JCVE 3W1GA 4C3IG 5C44H 3PGZA 4LUVA 1DJRD 2M2LA 4R4QA 3RZOB 3ICEA 1JOOA 4C1NK 4YY3Q 1RDPD 4C3IH 2RCNA 4DKAC 4DV1Q 1WVLA 1STBA 4APVA 4JI4Q 2PZUA 4R4CA 3ERSX 4CJ0B 4DUZL 3WWVA 3ULPA 2M9VA 1NR4A 1O7YA 3ZJYC 1VF5C 4DR2Q 3GTMH 4K6DA 3S1RH 3NTHA 5EPLA 4B3SQ 5IGDA 1JJGA 1BDOA 3E9IA 1XTCD 4XQQA 1FGBD 3GV3A 3J81c 2B2WA 1KAWA 4ZCKA 1BO0A 2G9DA 4M1UB 5T1IA 3LWUA 1L1OA 5H1SE 4GLVB 4LFBL 1R4QB 1S5CD 1EZ8A 2MGSA 4DPGA 1JJCB 5IWAL 4A3MB 3S17H 3S1MH 4OO1G 3I91A 1B53A 2NTSA 4LW1A 1Q81C 3HOWB 2NTTA 3KK7A 5I6YA 4X66Q 1EU3A 3NXWA 5E3FA 4HMJA 1EFID 3I73A 1MIUA 2VB3X 1HCZA 1XNRQ 3AB9A 1IZ6A 1EYCA 3J81j 4X3TA 2A19A 4ALPA 1IBLQ 5CMDA 5HURA 3UE0A 5C4JB 1ZYRD 5IIFA 1CKMA 3DWAA 3K59A 2DNCA 3GTMB 3K7UC 1CKNB 5IP7H 1RIPA 2JN4A 3MFGA 1B9NA 5J22A 2F1MA 1U9RA 4LF9L 4C1NI 1GKHA 5FO9B 2OF1A 3E3XA 1HPCA 5TSSA 3MXPA 4IUTA 4QMGA 5IODA 1GHKA 2PQEA 4ILWA 1YITA 3DUZA 2LXJA 3K7AB 2Q8IB 5I2YA 1WTXA 4CDCC 3S15H 4BBRG 2B39A 3U9SA 4JI5Q 1Z9FA 4E6IA 4G7ZC 4IPHA 2I5LX 1TY2A 4C3HB 1TS5A 2XN9C 4A3IG 3J81i 3TQYA 3I4MG 2IL8A 1SMYD 1A3TA 3PUVA 4JI2L 3A7LA 4DV1L 4A3LG 3DMUA 4Y52H 2RDHA 2WKDA 3UDIA 4A3IH 3DWPA 1MSGA 2A6EC 4WORA 4Q5VA 4JBJA 1VQNA 4Z9CB 4JG2A 2ZM6L 2MP1A 4K5VA 3I4LA 2D5DA 3PF4A 2F0FA 3HKZG 4A76A 4HCSA 2HQEA 2YU9B 2RSNA 1XPUA 1TWAB 3X3MA 5LMNL 1E0BA 4DK0A 2A74C 4F8MA 4POFA 3CKIB 1DM0B 1I4PA 4M8AA 1LACA 1EU4A 3T16A 2RQXA 4KTAA 2IW3A 4DNIA 2QDBA 1PXUA 1XMQQ 5C3EG 1VQAA 3FHWA 1W2BA 4A3BB 2PQAB 1O78A 1IBKQ 4A93G 1YNND 2R92B 4KHZA 1TWHB 1R9TH 1XPRA 1PH8A 3VR2A 2E2IB 1NJIC 3GTJB 1TS4A 4FDBA 3LWEA 2QEXA 3N52A 4B3TQ 1AH9A 5GQOA 1S40A 1C9OA 3HOYG 2F0KA 3WOEA 5JEAJ 2Z9HA 1HZ9A 4X6AH 2E8GA 4EGVA 1LT5D 2XIWA 5COYA 4RMFA 2K05A 4DN4M 4DUYL 3QO2A 5CV7A 4YWMA 2SNSA 1HA6A 1MJEA 1EY6A 3Q0AA 4L5SA 1AEXA 4PZ8A 4GOPA 1KQSA 3DWQA 2EYLA 5LHY1 1A2TA 1CZWA 4IQZA 1HUNA 3CPWA 3ULJA 1PTOC 2P5ZX 5IGCA 1KDAA 3PUYA 4ME5A 2L9HA 4RKBA 4DUYQ 2Y0SB 2V1CC 4HSPA 4JOIC 4MHEA 1DD2A 3KYHC 1AE2A 3PMFA 3FEWX 1H9JA 1RTOA 4H13C 1HQMC 3ZYYX 1LLRD 4P74A 1T5EA 1SLJA 1HR0L 1PRTB 3V2TA 1OTCA 4FVMA 1UUPA 5M5XH 4DXGA 3OIPA 3MXNA 3NBHA 3SDZA 1FD7D 3A8IE 3F8TA 4GLAC 4LUOA 4JYAQ 4GOPB 5JVH3 2L1BA 2JSOA 1W6JA 1AP0A 2G9HD 3W2DA 2BH2A 4NMZA 3BS1A 1SE8A 3FMCA 5C4XB 1VQ6A 4P72A 1PRTD 2DN8A 1VQEA 4KKUA 4LF6Q 1K8OA 1QVFA 3UI2A 3M7GA 4DA2A 4CJ2C 1RTNA 2E2DC 3SEBA 4A3FB 3FKIH 3MEFA 4IUQA 2L15A 1HNZL 1E2VA 1PMRA 1B3AA 3KBXA 5IGBA 2N55A 1K83B 1PFNA 5EPJA 5FO7B 1JWMD 2I5HA 4HIMA 1TWCB 4A93B 1JE4A 2ICEC 2PZTA 3UDGA 4DV7Q 4DR4Q 1YNNC 3W5OA 1EIHA 2I5MX 3S2HB 3C1FA 3T53B 1S5ED 2KCMA 1EEFD 1SYFA 2M00A 5FO8B 2UU9Q 1SMXA 2JA6G 2EYJA 1EOTA 3RLNA 1O80A 4S3SA 3NHHA 1D5XC 2N78A 4ODGA 3OPOA 4QUFA 1G6PA 2JA8H 5M3MH 2PW5A 2WP8J 2JA6H 1EQVA 1EY9A 1DOLA 3RD4A 1L0WA 3D6WA 4DV7L 4DR4L 1I5FA 4LF8L 2EY2A 3RLOA 3D4WA 5I4DA 3SVMA 3VYSA 4DV3Q 1XX8A 5JOBA 1STAA 4KV6A 2ZTDA 4X3SA 3STBC 2QKIC 1DYQA 2JEBI 2EJFC 5LMUL 3GTLH 4OELB 3NE5B 5K5PA 1Y1VG 1Q86C 4POGA 2SOBA 4ZKBB 1TWHH
chains in the Genus database with same CATH topology
3U58A 4P71A 3GD7A 4NXMQ 1X3GA 2B63H 4JI0Q 1HNWL 1WJJA 1WI5A 2DUDA 3STBD 1T9HA 1PA6A 1FGUA 1YHAA 3PUZA 1N34Q 2PI2E 3ULLA 4OX9Q 2HIXA 4DR6Q 1O7IA 1QUQB 2MO0A 2XTIA 3G4SA 2PQAA 3I4MH 2AWNA 2F4VQ 1LYLA 1V43A 2MQHA 4DK3C 2HHHL 2UUCL 1P16A 1UE7A 1L1OC 2OQKA 4GKKQ 3E9HA 3FKIG 3L7ZC 1YEZA 2F3IA 1HR0Q 1XMQL 2OTLA 1UWVA 2CCZA 2UXDL 2MO1A 4B3SL 1J6QA 2HT1A 1V9PA 2VUMH 5HY6A 5IYCG 4ME3A 1G291 4JI8Q 3U4VA 3L0OA 1UE6A 4BY1H 4NXML 3HOUH 1J5EQ 1IBML 1I3QH 4GOPC 2OWOA 5IY0A 4XTCS 4A3FG 2VL6A 1HNXQ 1KXLA 2N8NA 1K9MC 1SFOH 3G6EA 4YCVA 3HKSA 4QQBX 3KOJA 4BA1I 2JE6I 3GTJH 1TXYA 2KCTA 1KD1C 4A3BG 1K8AC 3G48A 3RZDH 4LF7L 3HOWH 4JV5L 1K0RA 3D31A 1S3OA 4DAMA 3BJUA 1HJPA 4IO9A 3AFPA 4A3MH 4HIKA 2GVAA 5M3FH 4P75A 4AYBG 2PMZE 4A3GG 3MXNB 4KLKA 1VQJA 1EFWA 1CKNA 3K7AH 3LGJA 4J15A 4IOCA 3PO3G 4A3KH 2CFMA 3BU2A 2OCEA 3I56A 1B7YB 4NB3A 3T1YQ 2UXBL 4DV4Q 3M4PA 4MZ9A 4IFDG 2IHEA 3M7NA 2R6GA 5FJ8H 5AJ3Q 2K14A 2B3GA 2UXCQ 5J3BA 1OXVA 4JI1L 3S2HH 2K4KA 4OO1I 1EIYB 1VQBA 5GAGC 5IP9G 1A0IA 2KHJA 2PNHA 3CCQA 3CF5A 4DV2Q 1VQFA 1TWAH 3KDFB 2NN6I 2RHQB 2F52A 4DAYB 4JBKA 3KDFA 3GTPH 4YHHQ 3I55A 4LF9Q 2JJQA 2VZAA 4AH6A 2AHOB 4DV3L 4JBMA 1I94L 1VQ7A 3F2DA 2D0OA 4R4OA 1PFSA 3PO2H 1VCIA 1QUQA 4PG3A 2R7ZG 1RL2A 1PHJA 1IBKL 5IWAQ 2B29A 3BZCA 4GKJQ 3CC2A 3I4NG 4EX5A 1A63A 1VQ8A 3S24A 1XTDA 4GNXA 2IT1A 1MKHA 2BA1A 4MTNA 3J80i 3PIPA 2JA9A 4JYAL 1E3PA 1KL9A 3UDXA 2ASBA 1YJWA 4EQ5A 3CC4A 4DV5L 4YWKA 4DR7Q 1X55A 4A3GH 4JOIA 1FL0A 3CXCA 2A8VA 1GD7A 1CUKA 1SROA 1N34L 3EIVA 5M3FG 5C0XG 4LFAL 2NVQH 5AJ3L 1U0LA 2KHIA 4KI0A 1A8VA 1HZBA 1CSQA 5M5WH 1PH6A 3OW2A 2Z6KA 2OQ0A 2IHFA 1EUJA 4DR5L 3T1YL 1UE5A 2ZTCA 3Q8DA 3K81C 5ELOA 4DK6C 1Q12A 3J7A5 2VNUD 1X9NA 4YCUA 2UXBQ 2K5NA 4JCVE 2MNAA 3EBEA 1QZGA 4BY7H 3W1GA 2CWAA 1WYDA 4LF4L 5C44H 2R92G 3PGZA 3I4OA 4LUVA 5C4XG 2BA0A 2GN5A 4R4QA 4DR1Q 1PH7A 3ICEA 3M3YH 3J80c 2XGTA 1YNXA 2JQOA 3CCMA 1AE3A 5JEAG 1I94Q 4YY3Q 3CCSA 3HFZB 4C3IH 1I50H 5IYDG 2Q2TA 3H3VI 1HNWQ 1YBYA 2RCNA 3JAMc 1N8RC 4DKAC 4IOAA 3B6YA 2D0PA 2NVXH 4DV1Q 1XMOL 5C4JH 3PUWA 1NMGA 4HIDA 2HQLA 2R7ZH 2VUMG 3RLFA 4APVA 4JI4Q 4R4CA 3ERSX 3CCEA 4DUZL 2OTJA 3WWVA 4YWLA 3ULPA 4WJ3M 2KBNA 3ZJYC 1NBWA 4DR2Q 3HOVG 3GTMH 2E2IH 3S16H 3S1RH 1X3EA 4JI8L 4B3SQ 1JJGA 4IJHA 3E9IA 2KENA 2MFIA 4GS3A 4NXNL 3RN2A 1VQKA 4QGUA 2JA7H 4LFBQ 1Q1BA 3J81c 4K0KL 4R4IA 1KAWA 2JA8G 2CQOA 4GN4B 4K0KQ 5FLXc 1JJ2A 2K5HA 4AQYQ 1N33L 3GTKH 1L1OA 5H1SE 4GLVB 5C44G 2R92H 4X62Q 3KFUA 4LFBL 5IWAL 4DPGA 3OTOL 1JJCB 3S17H 4OO1G 3S1MH 4X65L 1M1KC 1Q7YC 1YZ6A 1PH2A 3PO3H 1Q81C 1OXSC 4LW1A 4XIGS 3NELA 4TVAB 1Q82C 4AYBE 1A62A 3KLWA 4X66Q 5LMUQ 1XNQL 3M4OH 1YJ9A 1WCMG 1KRTA 3RZOH 4UY8C 4GN5A 4A3JH 1OXXK 2JA5H 5IYDH 2Y0SE 1MIUA 5DLQE 1E22A 1JB7A 4JI6Q 1XNRQ 1XJVA 1IYJB 1IZ6A 5M3MG 3J81j 1Z47A 2A19A 2YTXA 1BBUA 2ID0A 4ALPA 1IBLQ 3K8AA 3G71A 4GLXA 3UE0A 4A3LH 4HJ7A 4QY7A 4UP7A 1C7YA 1CKMA 1K83H 4P73A 3TREA 5GADC 3CP0A 4BBSH 3S2DH 2VS1A 1SR3A 1EQQA 2R7FA 3K7UC 1CKNB 2UUBQ 3AEVA 2N49A 3HOVH 4A93H 5IP7H 4BXXG 1TWFH 1RIPA 1I6HH 1VQHA 2K52A 2Z0SA 2ZTEA 2ZJRA 1PH3A 2ZJQA 4LFAQ 2FXQA 4A4IA 2VQFQ 5FLMH 3HOXG 3S1NH 3S1QH 4YHHL 4LF9L 1ASYA 4BBSG 3TRZA 1GKHA 3H0GH 4JI7Q 2VW9A 1VQCA 4RG1A 3RN5A 1PH5A 2NZOA 2RF4A 4JI1Q 4JI3Q 3EN2A 1YITA 4JI2Q 1VQIA 2LXJA 2K50A 3S15H 3CCRA 2IX1A 5LMNQ 4BBRG 1X3FA 4BY1G 4DV5Q 1LUZA 2UUBL 1EYGA 2AWOA 4JI5Q 1CSPA 1Z9FA 1QZHA 1SRUA 2WB1G 4IPHA 2I5LX 3IRBA 4HIOA 2JA5G 3CQZH 1X65A 2R7DA 4BY7G 4A3IG 1MJCA 3J81i 3TQYA 1TWGH 3KF6B 2UUCQ 3I4MG 4DR5Q 3CMEA 1GVPA 1N32L 2YV5A 4A3CH 3KF8B 3PUVA 1VQ4A 1PH1A 2E2HH 4JI2L 2A1AA 4DV1L 2VQEL 1XMOQ 4JV5Q 4A3LG 3CC7A 4Y52H 1Y1WG 4LWCA 1N9WA 3UDIA 3D0FA 4A3IH 2JA7G 4IFDJ 5IYBG 1BBWA 1E7ZA 3I4NH 2ATWA 3CCJA 2AMCB 4DV2L 4IFDI 1KHIA 4YY3L 1UEBA 1VQMA 2EQSA 1BKBA 3KJPA 4JBJA 1VQNA 2E2JH 3HOYH 1IBMQ 1LM0A 1X56A 4JG2A 2ZM6L 4NPSA 5IP7G 4X62L 4BXXH 1JT8A 3U50C 3PF4A 5LMNW 4L5TA 1HR0W 3HKZG 4L5QA 4IPDA 1PYBA 4A76A 4A3DG 3CMAA 5IP9H 3H0GG 4LF7Q 1XPUA 5LMNL 4GNXC 4OXPA 4JBWA 4O0AA 3UDFA 1HH2P 4POFA 4DR3L 4A3DH 1BVSA 4QIWE 4JC0A 4A3BH 1Q46A 4DR2L 2WB1E 1PH4A 4HJ5A 3TS0A 3W1BA 4DV6L 1VQ5A 4DNIA 4DV4L 1VQLA 3TS2A 1PV4A 1XMQQ 1X54A 2CKZB 1VQAA 3FHWA 5C3EG 1W2BA 4PMWA 4X65Q 5C0XJ 2PQAB 1K3RA 3A0JA 1YI2A 1WCMH 1IBKQ 4B3TL 2D62A 4B3MQ 3HOUG 2F4VL 4A93G 2QGQA 4OWTB 1C0AA 3PCOB 4KHZA 1R9TH 1XPRA 1PH8A 3AFQA 1W3SA 4UP8A 5ELNA 3GTQH 3KJOA 1WFQA 5IYBH 1NJIC 4FDBA 4GKKL 2QEXA 4AIMA 3HOZH 4X64Q 1E24A 4B3TQ 1V1QA 3GO5A 5HGQA 4LF5L 1AH9A 4OWXB 4LF4Q 5GQOA 1S40A 1ASZA 1C9OA 4LF8Q 4JI6L 1XNRL 3SGIA 4GN3B 4B3RL 3L2PA 3HOYG 5JEAJ 3CPFA 2UUAL 1HZ9A 1EIFA 1HNXL 3GDEA 1XPOA 4X6AH 2E8GA 2UUAQ 1N36L 2NN6G 1VQOA 3PO2G 1PYSB 4RMFA 3I7FA 2BH8A 4JI4L 4DUYL 4YWMA 4KHPQ 2Q2HA 3T1HL 3OTOQ 1YJNA 1MJEA 4YCWA 4L5SA 4IPCA 5GROA 4LF5Q 3NENA 3TEHB 1HZCA 4PZ8A 1X6OA 2LXKA 2HHHQ 4A3CG 4GOPA 5K36G 3A5ZB 1KQSA 1KRSA 5IE8A 3RNUA 5JJLA 2C35B 4R1JA 1VQ9A 1Q1EA 1QVGA 2WAQG 1E1TA 2NVYH 3CPWA 3ULJA 4LFCQ 4DR1L 3PUYA 4A3EH 2ZJPA 3I2ZA 1TWHH 4DUYQ 5JJKA 4DV0L 1JMCA 3PSIA 1NE3A 3M9BA 1L2FA 1P8LA 1G51A 2V1CC 5C3EH 4HJ9A 4A3MG 4JOIC 3H15A 2DGYA 1B8AA 3KYHC 2PI2A 1AE2A 5C0XI 1N36Q 4IJLA 2B63G 4DUZQ 2N3SA 1YHQA 1FVIA 3BZKA 3F1ZA 3S14H 2QA4A 4JI3L 2Z6KC 4P74A 1SLJA 3A74A 1HR0L 4DR3Q 1OTCA 4DR7L 5C4XH 4C3JH 4JI7L 2VY3A 5M5XH 3A5UA 3PF5A 3F8TA 4UP9A 4GLAC 4LUOA 2VQFL 1NMFA 3CCLA 4JYAQ 4GOPB 2Q2UA 3OYYA 2NVTH 1VS0A 2I0QA 3DM3A 1WOCA 2E5LL 2BH2A 1SE8A 4JI0L 1VQPA 4JI5L 2IY5B 1VQ6A 4P72A 4GKJL 3PUXA 4A3FH 1KC8C 4GNXB 2RHSB 3H3VH 1K73C 1VQEA 3AYHB 4LF6Q 1U5KA 3PV0A 4DV6Q 1QVFA 4C2MH 1JE5A 1FJGL 3UE1A 4HJ8A 3ER0A 5E7NA 1NTGA 3HOWG 1GM5A 3CW2C 4OWWB 2WAQE 3FKIH 3MEFA 3HKZE 2L15A 2VQEQ 1HNZL 2UXCL 1L1OB 3J7ZC 2YU9H 2YTVA 2JEAI 2UU9L 3CD6A 1PVOA 1EQRA 4UPAA 3HOZG 2H5XA 2I5HA 4HIMA 2YTYA 1KIXA 1YIJA 1LTLA 4PZ7A 3E0EA 1DGSA 2E5LQ 2EIFA 1OXUA 3UDGA 3RR5A 4Y7NH 3NBHB 4DV7Q 4DR4Q 3W5OA 2WFWA 5FLMG 3HOXH 1EWIA 2I5MX 2R93G 2AKWB 2JK8A 1HZAA 5BR8L 3CCUA 1TWCH 2KCMA 1OXTA 3GTOH 3M4QA 1Y1VH 5IT9c 3F2BA 2ES2A 1H95A 1IL2A 2Y0SG 4QL5A 2K5VA 4QJFA 5GAEC 1SMXA 2UU9Q 2JA6G 4BA2I 4PZ6A 1M90C 3CCVA 3NEMA 3RLNA 3FP9A 1HNZQ 2R93H 4B3ML 3K0XA 2EXDA 2Q2IA 2N78A 4A3KG 1G6PA 2JA8H 5M3MH 2CWPA 3U4ZA 2UXDQ 3JAMi 2HIVA 2WP8J 2JA6H 4C3HH 2ALYB 4LF6L 5IYCH 1N32Q 1D7QA 4LUZA 1K8GA 5BR8Q 2NZHA 4LFCL 4LNQA 4A75A 1NY4A 5FJ8G 4A3EG 3CAMA 1L0WA 1J5EL 1PH9A 4AQYL 1N33Q 4DV7L 4DR4L 1I5FA 1VQDA 4LF8L 4B3RQ 4DV0Q 3RLOA 3F2CA 2K75A 1VQGA 3JC66 4IPGA 4X64L 1Y1WH 1D8LA 1GO3E 4OONA 3KF6A 4DV3Q 4A3JG 1IBLL 3GTGH 1IXRA 3M85A 1B70B 4MNOA 1YHBA 1YVCA 3PIOA 3T1HQ 4NXNQ 2ZTDA 4WJ4A 5JJIA 5EAYA 1E1OA 1CKOA 1QVCA 4O2DA 4TQUS 4OX9L 4DR6L 5M5YH 4L5RC 3VDYA 3STBC 1S72A 2JEBI 4R4TA 4HJAA 1UE1A 5LMUL 1FJGQ 2GVBA 2YYZA 2ZM6Q 1XNQQ 3DLLA 3GTLH 4KHPL 3K80C 4H02A 1EOVA 3AQQA 1Y1VG 5GAHC 1Y14B 1Q8KA 4X66L 1Q86C 4POGA 1SN8A 4BBRH 2IX0A 2LSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U58 A;  4P71 A;  3GD7 A;  4NXM Q;  1X3G A;  2B63 H;  4JI0 Q;  1HNW L;  1WJJ A;  1WI5 A;  2DUD A;  3STB D;  1T9H A;  1PA6 A;  1FGU A;  1YHA A;  3PUZ A;  1N34 Q;  2PI2 E;  3ULL A;  4OX9 Q;  2HIX A;  4DR6 Q;  1O7I A;  1QUQ B;  2MO0 A;  2XTI A;  3G4S A;  2PQA A;  3I4M H;  2AWN A;  2F4V Q;  1LYL A;  1V43 A;  2MQH A;  4DK3 C;  2HHH L;  2UUC L;  1P16 A;  1UE7 A;  1L1O C;  2OQK A;  4GKK Q;  3E9H A;  3FKI G;  3L7Z C;  1YEZ A;  2F3I A;  1HR0 Q;  1XMQ L;  2OTL A;  1UWV A;  2CCZ A;  2UXD L;  2MO1 A;  4B3S L;  1J6Q A;  2HT1 A;  1V9P A;  2VUM H;  5HY6 A;  5IYC G;  4ME3 A;  1G29 1;  4JI8 Q;  3U4V A;  3L0O A;  1UE6 A;  4BY1 H;  4NXM L;  3HOU H;  1J5E Q;  1IBM L;  1I3Q H;  4GOP C;  2OWO A;  5IY0 A;  4XTC S;  4A3F G;  2VL6 A;  1HNX Q;  1KXL A;  2N8N A;  1K9M C;  1SFO H;  3G6E A;  4YCV A;  3HKS A;  4QQB X;  3KOJ A;  4BA1 I;  2JE6 I;  3GTJ H;  1TXY A;  2KCT A;  1KD1 C;  4A3B G;  1K8A C;  3G48 A;  3RZD H;  4LF7 L;  3HOW H;  4JV5 L;  1K0R A;  3D31 A;  1S3O A;  4DAM A;  3BJU A;  1HJP A;  4IO9 A;  3AFP A;  4A3M H;  4HIK A;  2GVA A;  5M3F H;  4P75 A;  4AYB G;  2PMZ E;  4A3G G;  3MXN B;  4KLK A;  1VQJ A;  1EFW A;  1CKN A;  3K7A H;  3LGJ A;  4J15 A;  4IOC A;  3PO3 G;  4A3K H;  2CFM A;  3BU2 A;  2OCE A;  3I56 A;  1B7Y B;  4NB3 A;  3T1Y Q;  2UXB L;  4DV4 Q;  3M4P A;  4MZ9 A;  4IFD G;  2IHE A;  3M7N A;  2R6G A;  5FJ8 H;  5AJ3 Q;  2K14 A;  2B3G A;  2UXC Q;  5J3B A;  1OXV A;  4JI1 L;  3S2H H;  2K4K A;  4OO1 I;  1EIY B;  1VQB A;  5GAG C;  5IP9 G;  1A0I A;  2KHJ A;  2PNH A;  3CCQ A;  3CF5 A;  4DV2 Q;  1VQF A;  1TWA H;  3KDF B;  2NN6 I;  2RHQ B;  2F52 A;  4DAY B;  4JBK A;  3KDF A;  3GTP H;  4YHH Q;  3I55 A;  4LF9 Q;  2JJQ A;  2VZA A;  4AH6 A;  2AHO B;  4DV3 L;  4JBM A;  1I94 L;  1VQ7 A;  3F2D A;  2D0O A;  4R4O A;  1PFS A;  3PO2 H;  1VCI A;  1QUQ A;  4PG3 A;  2R7Z G;  1RL2 A;  1PHJ A;  1IBK L;  5IWA Q;  2B29 A;  3BZC A;  4GKJ Q;  3CC2 A;  3I4N G;  4EX5 A;  1A63 A;  1VQ8 A;  3S24 A;  1XTD A;  4GNX A;  2IT1 A;  1MKH A;  2BA1 A;  4MTN A;  3J80 i;  3PIP A;  2JA9 A;  4JYA L;  1E3P A;  1KL9 A;  3UDX A;  2ASB A;  1YJW A;  4EQ5 A;  3CC4 A;  4DV5 L;  4YWK A;  4DR7 Q;  1X55 A;  4A3G H;  4JOI A;  1FL0 A;  3CXC A;  2A8V A;  1GD7 A;  1CUK A;  1SRO A;  1N34 L;  3EIV A;  5M3F G;  5C0X G;  4LFA L;  2NVQ H;  5AJ3 L;  1U0L A;  2KHI A;  4KI0 A;  1A8V A;  1HZB A;  1CSQ A;  5M5W H;  1PH6 A;  3OW2 A;  2Z6K A;  2OQ0 A;  2IHF A;  1EUJ A;  4DR5 L;  3T1Y L;  1UE5 A;  2ZTC A;  3Q8D A;  3K81 C;  5ELO A;  4DK6 C;  1Q12 A;  3J7A 5;  2VNU D;  1X9N A;  4YCU A;  2UXB Q;  2K5N A;  4JCV E;  2MNA A;  3EBE A;  1QZG A;  4BY7 H;  3W1G A;  2CWA A;  1WYD A;  4LF4 L;  5C44 H;  2R92 G;  3PGZ A;  3I4O A;  4LUV A;  5C4X G;  2BA0 A;  2GN5 A;  4R4Q A;  4DR1 Q;  1PH7 A;  3ICE A;  3M3Y H;  3J80 c;  2XGT A;  1YNX A;  2JQO A;  3CCM A;  1AE3 A;  5JEA G;  1I94 Q;  4YY3 Q;  3CCS A;  3HFZ B;  4C3I H;  1I50 H;  5IYD G;  2Q2T A;  3H3V I;  1HNW Q;  1YBY A;  2RCN A;  3JAM c;  1N8R C;  4DKA C;  4IOA A;  3B6Y A;  2D0P A;  2NVX H;  4DV1 Q;  1XMO L;  5C4J H;  3PUW A;  1NMG A;  4HID A;  2HQL A;  2R7Z H;  2VUM G;  3RLF A;  4APV A;  4JI4 Q;  4R4C A;  3ERS X;  3CCE A;  4DUZ L;  2OTJ A;  3WWV A;  4YWL A;  3ULP A;  4WJ3 M;  2KBN A;  3ZJY C;  1NBW A;  4DR2 Q;  3HOV G;  3GTM H;  2E2I H;  3S16 H;  3S1R H;  1X3E A;  4JI8 L;  4B3S Q;  1JJG A;  4IJH A;  3E9I A;  2KEN A;  2MFI A;  4GS3 A;  4NXN L;  3RN2 A;  1VQK A;  4QGU A;  2JA7 H;  4LFB Q;  1Q1B A;  3J81 c;  4K0K L;  4R4I A;  1KAW A;  2JA8 G;  2CQO A;  4GN4 B;  4K0K Q;  5FLX c;  1JJ2 A;  2K5H A;  4AQY Q;  1N33 L;  3GTK H;  1L1O A;  5H1S E;  4GLV B;  5C44 G;  2R92 H;  4X62 Q;  3KFU A;  4LFB L;  5IWA L;  4DPG A;  3OTO L;  1JJC B;  3S17 H;  4OO1 G;  3S1M H;  4X65 L;  1M1K C;  1Q7Y C;  1YZ6 A;  1PH2 A;  3PO3 H;  1Q81 C;  1OXS C;  4LW1 A;  4XIG S;  3NEL A;  4TVA B;  1Q82 C;  4AYB E;  1A62 A;  3KLW A;  4X66 Q;  5LMU Q;  1XNQ L;  3M4O H;  1YJ9 A;  1WCM G;  1KRT A;  3RZO H;  4UY8 C;  4GN5 A;  4A3J H;  1OXX K;  2JA5 H;  5IYD H;  2Y0S E;  1MIU A;  5DLQ E;  1E22 A;  1JB7 A;  4JI6 Q;  1XNR Q;  1XJV A;  1IYJ B;  1IZ6 A;  5M3M G;  3J81 j;  1Z47 A;  2A19 A;  2YTX A;  1BBU A;  2ID0 A;  4ALP A;  1IBL Q;  3K8A A;  3G71 A;  4GLX A;  3UE0 A;  4A3L H;  4HJ7 A;  4QY7 A;  4UP7 A;  1C7Y A;  1CKM A;  1K83 H;  4P73 A;  3TRE A;  5GAD C;  3CP0 A;  4BBS H;  3S2D H;  2VS1 A;  1SR3 A;  1EQQ A;  2R7F A;  3K7U C;  1CKN B;  2UUB Q;  3AEV A;  2N49 A;  3HOV H;  4A93 H;  5IP7 H;  4BXX G;  1TWF H;  1RIP A;  1I6H H;  1VQH A;  2K52 A;  2Z0S A;  2ZTE A;  2ZJR A;  1PH3 A;  2ZJQ A;  4LFA Q;  2FXQ A;  4A4I A;  2VQF Q;  5FLM H;  3HOX G;  3S1N H;  3S1Q H;  4YHH L;  4LF9 L;  1ASY A;  4BBS G;  3TRZ A;  1GKH A;  3H0G H;  4JI7 Q;  2VW9 A;  1VQC A;  4RG1 A;  3RN5 A;  1PH5 A;  2NZO A;  2RF4 A;  4JI1 Q;  4JI3 Q;  3EN2 A;  1YIT A;  4JI2 Q;  1VQI A;  2LXJ A;  2K50 A;  3S15 H;  3CCR A;  2IX1 A;  5LMN Q;  4BBR G;  1X3F A;  4BY1 G;  4DV5 Q;  1LUZ A;  2UUB L;  1EYG A;  2AWO A;  4JI5 Q;  1CSP A;  1Z9F A;  1QZH A;  1SRU A;  2WB1 G;  4IPH A;  2I5L X;  3IRB A;  4HIO A;  2JA5 G;  3CQZ H;  1X65 A;  2R7D A;  4BY7 G;  4A3I G;  1MJC A;  3J81 i;  3TQY A;  1TWG H;  3KF6 B;  2UUC Q;  3I4M G;  4DR5 Q;  3CME A;  1GVP A;  1N32 L;  2YV5 A;  4A3C H;  3KF8 B;  3PUV A;  1VQ4 A;  1PH1 A;  2E2H H;  4JI2 L;  2A1A A;  4DV1 L;  2VQE L;  1XMO Q;  4JV5 Q;  4A3L G;  3CC7 A;  4Y52 H;  1Y1W G;  4LWC A;  1N9W A;  3UDI A;  3D0F A;  4A3I H;  2JA7 G;  4IFD J;  5IYB G;  1BBW A;  1E7Z A;  3I4N H;  2ATW A;  3CCJ A;  2AMC B;  4DV2 L;  4IFD I;  1KHI A;  4YY3 L;  1UEB A;  1VQM A;  2EQS A;  1BKB A;  3KJP A;  4JBJ A;  1VQN A;  2E2J H;  3HOY H;  1IBM Q;  1LM0 A;  1X56 A;  4JG2 A;  2ZM6 L;  4NPS A;  5IP7 G;  4X62 L;  4BXX H;  1JT8 A;  3U50 C;  3PF4 A;  5LMN W;  4L5T A;  1HR0 W;  3HKZ G;  4L5Q A;  4IPD A;  1PYB A;  4A76 A;  4A3D G;  3CMA A;  5IP9 H;  3H0G G;  4LF7 Q;  1XPU A;  5LMN L;  4GNX C;  4OXP A;  4JBW A;  4O0A A;  3UDF A;  1HH2 P;  4POF A;  4DR3 L;  4A3D H;  1BVS A;  4QIW E;  4JC0 A;  4A3B H;  1Q46 A;  4DR2 L;  2WB1 E;  1PH4 A;  4HJ5 A;  3TS0 A;  3W1B A;  4DV6 L;  1VQ5 A;  4DNI A;  4DV4 L;  1VQL A;  3TS2 A;  1PV4 A;  1XMQ Q;  1X54 A;  2CKZ B;  1VQA A;  3FHW A;  5C3E G;  1W2B A;  4PMW A;  4X65 Q;  5C0X J;  2PQA B;  1K3R A;  3A0J A;  1YI2 A;  1WCM H;  1IBK Q;  4B3T L;  2D62 A;  4B3M Q;  3HOU G;  2F4V L;  4A93 G;  2QGQ A;  4OWT B;  1C0A A;  3PCO B;  4KHZ A;  1R9T H;  1XPR A;  1PH8 A;  3AFQ A;  1W3S A;  4UP8 A;  5ELN A;  3GTQ H;  3KJO A;  1WFQ A;  5IYB H;  1NJI C;  4FDB A;  4GKK L;  2QEX A;  4AIM A;  3HOZ H;  4X64 Q;  1E24 A;  4B3T Q;  1V1Q A;  3GO5 A;  5HGQ A;  4LF5 L;  1AH9 A;  4OWX B;  4LF4 Q;  5GQO A;  1S40 A;  1ASZ A;  1C9O A;  4LF8 Q;  4JI6 L;  1XNR L;  3SGI A;  4GN3 B;  4B3R L;  3L2P A;  3HOY G;  5JEA J;  3CPF A;  2UUA L;  1HZ9 A;  1EIF A;  1HNX L;  3GDE A;  1XPO A;  4X6A H;  2E8G A;  2UUA Q;  1N36 L;  2NN6 G;  1VQO A;  3PO2 G;  1PYS B;  4RMF A;  3I7F A;  2BH8 A;  4JI4 L;  4DUY L;  4YWM A;  4KHP Q;  2Q2H A;  3T1H L;  3OTO Q;  1YJN A;  1MJE A;  4YCW A;  4L5S A;  4IPC A;  5GRO A;  4LF5 Q;  3NEN A;  3TEH B;  1HZC A;  4PZ8 A;  1X6O A;  2LXK A;  2HHH Q;  4A3C G;  4GOP A;  5K36 G;  3A5Z B;  1KQS A;  1KRS A;  5IE8 A;  3RNU A;  5JJL A;  2C35 B;  4R1J A;  1VQ9 A;  1Q1E A;  1QVG A;  2WAQ G;  1E1T A;  2NVY H;  3CPW A;  3ULJ A;  4LFC Q;  4DR1 L;  3PUY A;  4A3E H;  2ZJP A;  3I2Z A;  1TWH H;  4DUY Q;  5JJK A;  4DV0 L;  1JMC A;  3PSI A;  1NE3 A;  3M9B A;  1L2F A;  1P8L A;  1G51 A;  2V1C C;  5C3E H;  4HJ9 A;  4A3M G;  4JOI C;  3H15 A;  2DGY A;  1B8A A;  3KYH C;  2PI2 A;  1AE2 A;  5C0X I;  1N36 Q;  4IJL A;  2B63 G;  4DUZ Q;  2N3S A;  1YHQ A;  1FVI A;  3BZK A;  3F1Z A;  3S14 H;  2QA4 A;  4JI3 L;  2Z6K C;  4P74 A;  1SLJ A;  3A74 A;  1HR0 L;  4DR3 Q;  1OTC A;  4DR7 L;  5C4X H;  4C3J H;  4JI7 L;  2VY3 A;  5M5X H;  3A5U A;  3PF5 A;  3F8T A;  4UP9 A;  4GLA C;  4LUO A;  2VQF L;  1NMF A;  3CCL A;  4JYA Q;  4GOP B;  2Q2U A;  3OYY A;  2NVT H;  1VS0 A;  2I0Q A;  3DM3 A;  1WOC A;  2E5L L;  2BH2 A;  1SE8 A;  4JI0 L;  1VQP A;  4JI5 L;  2IY5 B;  1VQ6 A;  4P72 A;  4GKJ L;  3PUX A;  4A3F H;  1KC8 C;  4GNX B;  2RHS B;  3H3V H;  1K73 C;  1VQE A;  3AYH B;  4LF6 Q;  1U5K A;  3PV0 A;  4DV6 Q;  1QVF A;  4C2M H;  1JE5 A;  1FJG L;  3UE1 A;  4HJ8 A;  3ER0 A;  5E7N A;  1NTG A;  3HOW G;  1GM5 A;  3CW2 C;  4OWW B;  2WAQ E;  3FKI H;  3MEF A;  3HKZ E;  2L15 A;  2VQE Q;  1HNZ L;  2UXC L;  1L1O B;  3J7Z C;  2YU9 H;  2YTV A;  2JEA I;  2UU9 L;  3CD6 A;  1PVO A;  1EQR A;  4UPA A;  3HOZ G;  2H5X A;  2I5H A;  4HIM A;  2YTY A;  1KIX A;  1YIJ A;  1LTL A;  4PZ7 A;  3E0E A;  1DGS A;  2E5L Q;  2EIF A;  1OXU A;  3UDG A;  3RR5 A;  4Y7N H;  3NBH B;  4DV7 Q;  4DR4 Q;  3W5O A;  2WFW A;  5FLM G;  3HOX H;  1EWI A;  2I5M X;  2R93 G;  2AKW B;  2JK8 A;  1HZA A;  5BR8 L;  3CCU A;  1TWC H;  2KCM A;  1OXT A;  3GTO H;  3M4Q A;  1Y1V H;  5IT9 c;  3F2B A;  2ES2 A;  1H95 A;  1IL2 A;  2Y0S G;  4QL5 A;  2K5V A;  4QJF A;  5GAE C;  1SMX A;  2UU9 Q;  2JA6 G;  4BA2 I;  4PZ6 A;  1M90 C;  3CCV A;  3NEM A;  3RLN A;  3FP9 A;  1HNZ Q;  2R93 H;  4B3M L;  3K0X A;  2EXD A;  2Q2I A;  2N78 A;  4A3K G;  1G6P A;  2JA8 H;  5M3M H;  2CWP A;  3U4Z A;  2UXD Q;  3JAM i;  2HIV A;  2WP8 J;  2JA6 H;  4C3H H;  2ALY B;  4LF6 L;  5IYC H;  1N32 Q;  1D7Q A;  4LUZ A;  1K8G A;  5BR8 Q;  2NZH A;  4LFC L;  4LNQ A;  4A75 A;  1NY4 A;  5FJ8 G;  4A3E G;  3CAM A;  1L0W A;  1J5E L;  1PH9 A;  4AQY L;  1N33 Q;  4DV7 L;  4DR4 L;  1I5F A;  1VQD A;  4LF8 L;  4B3R Q;  4DV0 Q;  3RLO A;  3F2C A;  2K75 A;  1VQG A;  3JC6 6;  4IPG A;  4X64 L;  1Y1W H;  1D8L A;  1GO3 E;  4OON A;  3KF6 A;  4DV3 Q;  4A3J G;  1IBL L;  3GTG H;  1IXR A;  3M85 A;  1B70 B;  4MNO A;  1YHB A;  1YVC A;  3PIO A;  3T1H Q;  4NXN Q;  2ZTD A;  4WJ4 A;  5JJI A;  5EAY A;  1E1O A;  1CKO A;  1QVC A;  4O2D A;  4TQU S;  4OX9 L;  4DR6 L;  5M5Y H;  4L5R C;  3VDY A;  3STB C;  1S72 A;  2JEB I;  4R4T A;  4HJA A;  1UE1 A;  5LMU L;  1FJG Q;  2GVB A;  2YYZ A;  2ZM6 Q;  1XNQ Q;  3DLL A;  3GTL H;  4KHP L;  3K80 C;  4H02 A;  1EOV A;  3AQQ A;  1Y1V G;  5GAH C;  1Y14 B;  1Q8K A;  4X66 L;  1Q86 C;  4POG A;  1SN8 A;  4BBR H;  2IX0 A;  2LSS A; 
#chains in the Genus database with same CATH topology
 4OIJ A;  4R8N A;  4FF3 A;  4P71 A;  2F0V A;  1WJJ A;  2DUD A;  1T9H A;  2B8F A;  3T51 B;  1YHA A;  3PUZ A;  4OX9 Q;  2HIX A;  3H3V C;  1O7I A;  1QUQ B;  1AZP A;  1SE4 A;  2AWN A;  1F2Y A;  1LTS D;  1EEI D;  2MQH A;  4DK3 C;  4GKK Q;  2UUC L;  1TY0 A;  1F9Q A;  3E9H A;  1XMQ L;  1UWV A;  1TQO A;  1FNU A;  1EZ6 A;  5IYC G;  4ME3 A;  3QB3 A;  4JI8 Q;  4KHV A;  3U4V A;  3I4M B;  5C5L A;  4BY1 H;  4NXM L;  1IBM L;  1RHP A;  4GOP C;  2RDG A;  3ND8 A;  3OIQ A;  1SYD A;  1V8Q A;  2B2U A;  1SDF A;  1SFO H;  5E4X A;  3FRP B;  3K6O A;  4DAP A;  3GTJ H;  3G48 A;  5DEH A;  3BJU A;  3AFP A;  3S1M B;  4RHS A;  5M3F H;  3H6M A;  3M4Y A;  4A3G G;  4KLK A;  1CKN A;  3NPP A;  1PTO F;  3PO3 G;  1Z7T A;  2CFM A;  1KAA A;  2OCE A;  1HTL D;  2G5D A;  3NQI A;  3I56 A;  4NB3 A;  3H0G B;  1V1O A;  4OGQ C;  2UXB L;  4DV4 Q;  5EBD A;  4MZ9 A;  2IHE A;  3IKJ A;  5FJ8 H;  5CV6 A;  5AJ3 Q;  2MPM A;  2JXM B;  2EY5 A;  2K4K A;  3D6C A;  1A0I A;  4DV2 Q;  1WTO A;  2A5H A;  1TWA H;  3GTP H;  2RHQ B;  3SK6 A;  4JBK A;  3KDF A;  4LF9 Q;  2VZA A;  4AH6 A;  3VR5 A;  1IKL A;  2DY8 A;  3F2D A;  1QJO A;  3S1N B;  2SNM A;  1F9R A;  1IBK L;  2B29 A;  2F0U A;  4A3G B;  1VQ8 A;  1XTD A;  2IT1 A;  3C1E A;  4MTN A;  5EKI A;  5I2X A;  3DXJ C;  4JYA L;  4HR7 B;  4X3U A;  5T1G A;  1YJW A;  1BCP B;  1D1I A;  2L12 A;  3CXC A;  2A8V A;  1CUK A;  3HOY B;  3PIO 3;  4LFA L;  2NVQ H;  5JAV A;  1MI2 A;  2VXW A;  5CV4 A;  1TWG B;  3K81 C;  5COR A;  1BCP D;  4YCU A;  1WD1 A;  2UXB Q;  2EPB A;  2MNA A;  5C3W A;  3HEJ A;  2ZT9 C;  1FNW A;  1WTP A;  2R92 G;  4IFD H;  3OW7 A;  3I4O A;  5A2Q L;  4DR1 Q;  1PH7 A;  1S5F D;  3CCM A;  1H9M A;  1AE3 A;  1I94 Q;  3HFZ B;  2B2U C;  5IYD G;  1HNW Q;  1YBY A;  3R3O A;  2B63 B;  4IOA A;  4HID A;  1HUM A;  2FMM A;  4C3J G;  1U4M A;  1BQQ T;  2VUM G;  1B44 D;  4YWL A;  4DAY A;  2HDL A;  2HD3 A;  2RA4 A;  2NVX B;  3H09 A;  2R7Z B;  3RN2 A;  1ET6 A;  1F2Z A;  4K0K L;  4R4I A;  3GTP B;  4CKE A;  2CQO A;  1H9S A;  1JJ2 A;  2JA6 B;  1DCZ A;  1M4V A;  4JK1 C;  4AQY Q;  3HGB A;  4MTK A;  3A7A B;  4PV1 C;  4X62 Q;  3KFU A;  2F0D A;  1BCP C;  3OTO L;  1Q7Y C;  1YZ6 A;  4HTH A;  4LAA A;  2O5I C;  1OXS C;  4XIG S;  5DNF A;  1SJE D;  5LMU Q;  3KLW A;  4KN4 C;  3TP6 A;  2EY1 A;  3V05 A;  1Y1W B;  1SJH D;  4ZUJ A;  4DU9 A;  1KRT A;  3BDO A;  3RZO H;  1OXX K;  3G6J B;  4BWG B;  3T4A C;  5KIX A;  2NBF A;  2Y0S E;  3R8B A;  1E22 A;  1DXM A;  1XJV A;  2N88 A;  2E75 C;  2WIN B;  2OEO A;  1VF7 A;  3FDT A;  1BBU A;  2ID0 A;  1B4O A;  1LT6 D;  4GLX A;  2AUJ D;  4QY7 A;  3P1H A;  1K83 H;  4FP5 D;  3TRE A;  3OWF A;  2VS1 A;  1DON A;  1TWF H;  2Z4I A;  1LTA D;  3MFY A;  2J7Z A;  2K52 A;  2Z0S A;  2FXQ A;  4MN3 A;  5FLM H;  3HOX G;  3PO2 B;  5LL6 S;  1LTG D;  2A6E D;  2AUK A;  3SK8 A;  2NZO A;  2RF4 A;  2SEB D;  1KLG D;  1EY4 A;  4XXE A;  4JI2 Q;  2Z6B A;  1LUZ A;  1CSP A;  1ENC A;  1ICF B;  2F0S A;  2J0T D;  1SRU A;  2JA5 G;  5A2Q E;  1V1P B;  3CQZ H;  2R7D A;  2TSS A;  1QOH A;  4K14 A;  2LFN A;  3DEP A;  1C48 A;  4DR5 Q;  2D2C C;  1N32 L;  4A3C H;  1PH1 A;  2A1A A;  3ONA B;  4DK1 A;  3VR3 A;  2B2T A;  1Y1W G;  4LWC A;  5CR3 A;  5CV8 A;  3TP5 A;  3CCJ A;  2AMC B;  4YY3 L;  3KLR A;  2EQS A;  4O42 A;  1VQM A;  3VA7 A;  2MHV A;  3P20 A;  3HOY H;  1IBM Q;  1X56 A;  1JB3 A;  2OXP A;  2EYP A;  1JT8 A;  4K8J A;  5LMN W;  4L5T A;  2WB1 B;  4IPD A;  1PYB A;  4CDF C;  4JBW A;  4O0A A;  2KOL A;  3UDF A;  1HH2 P;  4DR3 L;  5AFW A;  3EFX D;  4FNF A;  4JC0 A;  2A69 D;  2HDM A;  1HHV A;  1MGS A;  4HJ5 A;  1M8A A;  1VQ5 A;  1XWE A;  4DV4 L;  4CBV A;  1VQL A;  2JYO A;  5FKA C;  3BG3 A;  3HOU G;  4B3M Q;  4TSS A;  2D62 A;  3C3L A;  2F4V L;  1W3S A;  5ELE A;  4UP8 A;  1SYG A;  2NVQ B;  1WFQ A;  2O2L D;  1X3Q A;  1S4Z A;  3IFT A;  3GO5 A;  4LF5 L;  4OWX B;  1GUO A;  4LF4 Q;  2LKV A;  4KJN A;  4JI6 L;  4LF8 Q;  3L2P A;  3K0Y A;  3IL8 A;  2C5C A;  3CPF A;  4J8Q A;  4MIU A;  5D65 A;  2F0M A;  2NN6 G;  5BN3 A;  4JI4 L;  4FYD A;  2PYK A;  3T1H L;  1YJN A;  2F4I A;  5GRO A;  4LF5 Q;  1EWC A;  2LXK A;  5K36 G;  3A5Z B;  4J6H A;  1AN8 A;  3RNU A;  5IE8 A;  1QVG A;  2BOS A;  2KEC A;  2WAQ G;  5KGU A;  3NUC A;  4WJW A;  1S5B D;  4QF4 A;  4LFC Q;  1STH A;  2F0E A;  4DR1 L;  3HZX A;  4A3E H;  4N9P A;  2ZJP A;  1KDC A;  3SHL A;  1CI3 M;  4DV0 L;  2ZXR A;  1L2F A;  1G51 A;  4BS9 A;  3MWY W;  2DGY A;  1N36 Q;  3P75 A;  2PI2 A;  1XXG A;  2B63 G;  2XVS A;  2N3S A;  2B2V C;  2F3W A;  3K57 A;  3BZK A;  3BYY B;  1JC7 A;  2VUM B;  1JWU D;  4K5W A;  1GUN A;  4UHV A;  4WFN 3;  5IGF A;  3QG1 A;  5C3E B;  4DR3 Q;  3QOJ A;  2VY3 A;  2FFK B;  3A5U A;  4QIW B;  4UP9 A;  4KKT A;  3OYY A;  2CW0 D;  2I0Q A;  3DM3 A;  4P2C B;  1VQP A;  1D1K A;  5A35 A;  3PUX A;  3Q23 A;  2EZV A;  3S9W A;  2RHS B;  3AYH B;  5F2D A;  1U5K A;  5EBC A;  1SSO A;  2CW0 C;  4DV6 Q;  1NCV A;  4C2M H;  1JE5 A;  1FJG L;  4HJ8 A;  2BE5 C;  3HOW G;  2WAQ E;  2UXC L;  3J7Z C;  2YU9 H;  2YTV A;  1SNC A;  1EQR A;  5KNB A;  1CA6 A;  2YTY A;  1KIX A;  1LTL A;  4PZ7 A;  5ELB A;  2EIF A;  3DEO A;  3GTL B;  1ONL A;  3NBH B;  2WFW A;  1EWI A;  1RKN A;  4KN7 C;  4HMI A;  2AKW B;  2JK8 A;  4OO1 H;  1H95 A;  3F2B A;  3TME A;  1PFM A;  1UNS A;  2Y0S G;  4G57 A;  4QL5 A;  4QJF A;  2L5T A;  3ND9 A;  1M90 C;  2D9U A;  4CHT B;  3NEM A;  5CGK A;  3K0X A;  1B1Z A;  1MD2 D;  2Q2I A;  4A3K G;  1EYD A;  4ZK9 B;  2UXD Q;  3JAM i;  2HIV A;  4C3H H;  2ALY B;  3D3R A;  5IYC H;  4LF6 L;  1K8G A;  4K8I A;  1Y69 U;  3CAM A;  1J5E L;  1PH9 A;  1N33 Q;  1I4G A;  1R4P B;  2KCN A;  4DV0 Q;  1JR0 D;  1I4R A;  3F2C A;  2F0N A;  3KF8 A;  2K75 A;  1VQG A;  1D2B A;  4C3H G;  1D8L A;  4OON A;  4ABN A;  3KF6 A;  3S1R B;  3FKI B;  4CDE C;  1IXR A;  1B70 B;  1I4Q A;  1W6K A;  3BVM A;  4NXN Q;  5JVG 3;  4WJ4 A;  1WTV A;  4O2D A;  4TQU S;  4OX9 L;  5M5Y H;  3VDY A;  4ZQ3 A;  1UE1 A;  2YYZ A;  3LX0 A;  1JWS D;  3DLL A;  1EY0 A;  4KHP L;  3K80 C;  5GAH C;  2HUG A;  3J80 E;  4V19 0;  4BBR H;  2IX0 A;  3KLS X;  1EY8 A;  1II3 A;  4JI0 Q;  1WI5 A;  2H1E A;  3STB D;  1FGU A;  2XWB B;  3ULL A;  4DR6 Q;  5FOB B;  3F2U A;  2XTI A;  3G4S A;  3I4M H;  4N8F A;  2LS0 1;  1UE7 A;  1SAP A;  3FKI G;  1BXT A;  1D5M C;  3C2P A;  1QNU A;  2MO1 A;  4F87 A;  1V9P A;  2KVM A;  1C4Q A;  2WII B;  4KD3 A;  1GOZ A;  4N9T A;  4C3J B;  1WTR A;  1I3Q H;  1A6X A;  2OWO A;  3BVZ A;  3DM1 A;  1NUC A;  5M3F B;  1JCK B;  4EQO A;  2AQ2 B;  2JE6 I;  1B9M A;  4A3B G;  1K8A C;  3RZD H;  2PZW A;  1BF4 A;  4LF7 L;  3MXG A;  4DAM A;  4IO9 A;  1HJP A;  3S2D B;  4KD4 A;  1CZG A;  2O5J C;  1BOS A;  1WD0 A;  2PMZ E;  3I4N B;  3O13 A;  1EFW A;  3K5N A;  2X6G A;  2R3Z A;  3BU2 A;  1B7Y B;  1IYU A;  5JJZ A;  4IFD G;  3M7N A;  5IOC A;  2K14 A;  1LTR D;  5J3B A;  4OO1 I;  4JI1 L;  5CYU A;  5GAG C;  2KHJ A;  3CCQ A;  3CF5 A;  4CJ1 B;  3KDF B;  4B9W A;  2AHO B;  4DV3 L;  4JBM A;  1VQ7 A;  3WDN A;  3PO2 H;  3OMG A;  1VCI A;  1PLF A;  1QUQ A;  2I07 B;  2XRS D;  5KEE A;  1PYW D;  3MTS A;  1A63 A;  5FLX L;  1SNO A;  1MKH A;  3J80 i;  4H44 C;  3PIP A;  4A3J B;  2EY6 A;  1E3P A;  1KL9 A;  1TS3 A;  2ASB A;  4EQ5 A;  3CC4 A;  4DR7 Q;  2Z1C A;  3OWE B;  1X55 A;  1FL0 A;  3AMU A;  5EJW A;  4CDD C;  1PDQ A;  1FYC A;  1K8M A;  1U0L A;  2KHI A;  4KI0 A;  5AJ3 L;  1HZB A;  3GTG B;  4ZKC B;  5M5W H;  1L0X B;  2Z6K A;  1KDB A;  2IHF A;  4DR5 L;  1Q90 A;  2A69 C;  2ZTC A;  2FJ2 A;  3MZ5 A;  2ENB A;  4KJO A;  5J1Z A;  2EDG A;  4BY7 H;  3EBE A;  1D5Z C;  5M3M B;  3J7A V;  5DAU A;  5C4X G;  3M3Y H;  2R61 A;  3J80 c;  3QR8 A;  1YNX A;  5JEA G;  3T56 B;  2Q2T A;  3JAM c;  1N8R C;  1GUS A;  1XMO L;  2HCI A;  2R7Z H;  2NZ1 D;  4QB4 A;  5G3L D;  3NWT A;  2OTJ A;  1O7Z A;  2XNA C;  2KBN A;  5IT9 E;  3VYU A;  1HFG A;  1RCV D;  2E2I H;  3S16 H;  4JI8 L;  4IJH A;  2KEN A;  1DOK A;  4GS3 A;  4NXN L;  1VQK A;  2F0J A;  4QGU A;  2JA7 H;  1I4X A;  1TT2 A;  2AQ1 B;  1DOM A;  4A3I B;  1ML0 D;  5FLX c;  2PNR C;  3J7Y W;  3BDC A;  3ITP A;  1N33 L;  1PFB A;  5C44 G;  3TZU A;  1JQY D;  1M1K C;  2O4X A;  3PO3 H;  4I65 A;  4OIK A;  3NEL A;  1Q82 C;  4AYB E;  1A62 A;  4JPB W;  1XNQ L;  1G6Z A;  4G4K A;  1ILP A;  1EYA A;  1WCM G;  2F0G A;  4GN5 A;  4A3J H;  1K28 A;  3SK5 A;  3HOZ B;  5DLQ E;  1AFP A;  4JI6 Q;  1D6E C;  1IYJ B;  3N6R A;  3G71 A;  2NUC A;  2DY7 A;  4WRD A;  4HJ7 A;  1J9O A;  4A3L H;  1C7Y A;  4P73 A;  2F03 A;  5GAD C;  4BBS H;  1EQQ A;  3HOV H;  3AEV A;  2UUB Q;  3JAM L;  2N49 A;  1VQH A;  3NQT A;  1JOK A;  2ZJR A;  1PH3 A;  4A4I A;  2VQF Q;  3S1N H;  3S1Q H;  4YHH L;  4BBS G;  3TRZ A;  4RG1 A;  5I9P A;  1I6H B;  4JI3 Q;  3EN2 A;  4A3E B;  4U67 3;  4K2K A;  2IX1 A;  1I6V C;  2UUB L;  2AWO A;  3R93 A;  1QZH A;  2WB1 G;  5KNC A;  4RGN A;  1X65 A;  2IPK D;  1MJC A;  3KF6 B;  1GJX A;  1B3Q A;  1GVP A;  2YV5 A;  3KF8 B;  1VQ4 A;  1XMO Q;  1EQT A;  4JV5 Q;  1STN A;  1CA5 A;  3CC7 A;  5C6A A;  1N9W A;  2KEE A;  4IFD J;  2BCO A;  1E7Z A;  1Y8P B;  2ATW A;  4IFD I;  1H9R A;  1KHI A;  3W3A A;  1UEB A;  5IT9 L;  5CBE E;  1BKB A;  2A6H C;  3KJP A;  3HRZ C;  2E2J H;  1GUW A;  3TN2 A;  4NPS A;  4BXX H;  3U50 C;  1TR5 A;  1HTP A;  5L37 A;  1PZI D;  3CMA A;  5IP9 H;  3H0G G;  4LF7 Q;  3EQL C;  1ET9 A;  2DJG C;  2F0P A;  3E6Z X;  4OXP A;  2QF7 A;  2B8G A;  2E76 C;  1CM9 A;  4KK7 A;  5ELF A;  1Q46 A;  1CQV A;  3HOX B;  1T5X D;  4FF4 A;  3QIA A;  4DV6 L;  3A55 A;  3TZD A;  1ESF A;  3GQB A;  3TS2 A;  2B2W C;  1X54 A;  2CKZ B;  3VR4 A;  3I3C A;  4X65 Q;  3ERO A;  2XRQ D;  1MBY A;  1KNE A;  5ELN A;  5IYB H;  4AIM A;  2F0T A;  3HOZ H;  4X64 Q;  5CBA E;  3RZD B;  1V1Q A;  5HGQ A;  2H4O A;  2Z4H A;  2B2T C;  4B9X A;  4B3R L;  3SGI A;  3IFD A;  1PZK D;  1EIF A;  1XPO A;  1J8I A;  3J81 L;  2FHT A;  3EA6 A;  4DNR B;  1VQO A;  3M3Y B;  3I7F A;  1G91 A;  2BH8 A;  1U4L A;  1L0Y B;  5M5Y B;  4KHP Q;  2Q2H A;  3URY A;  3OTO Q;  3EJI A;  4YCW A;  2K5D A;  2BDN A;  4IPC A;  3NP8 A;  3TEH B;  2HHH Q;  1LTB D;  4A3C G;  4L8J A;  1BNZ A;  4G7O C;  1KRS A;  2L0C A;  3A8K E;  5JJL A;  2C35 B;  1VQ9 A;  1Q1E A;  1E1T A;  1NAP A;  2NVY H;  1TKW B;  3S16 B;  5JJK A;  2F0O A;  3PSI A;  4HJ9 A;  4A3M G;  4CKC A;  2KUM A;  4NKL A;  3H15 A;  4X3K A;  1B8A A;  5C0X I;  1TU2 B;  1A2U A;  3OHX C;  3S14 H;  2XWJ B;  2NVT B;  4JI3 L;  2IWH A;  3QJY A;  2E74 C;  3A74 A;  2L11 A;  4JI7 L;  1QE6 A;  4XQJ A;  3SK4 A;  1STE A;  5C4Z A;  2Q2U A;  1GUG A;  1YNJ C;  1WOC A;  2K04 A;  2E5L L;  3MHB A;  4JI0 L;  4XYO A;  4J1M A;  1H9S B;  1KC8 C;  4A3F H;  2IJ0 A;  1YNJ D;  1K3B C;  1EY7 A;  3ER0 A;  2RCF A;  5E7N A;  4HCE A;  1NTG A;  1U4R A;  1GM5 A;  4FF2 A;  4OWW B;  3HKZ E;  2VQE Q;  4CKB A;  1L1O B;  1ENA A;  3P7J A;  4F7X A;  2JEA I;  2UU9 L;  1JOR A;  1V1P A;  4UPA A;  2KQ3 A;  2L4N A;  1ILQ A;  4PNY A;  2E5L Q;  1OXU A;  3RR5 A;  5M9O A;  4Y7N H;  4XT3 B;  1NR2 A;  2CHB D;  2E2H B;  2R93 G;  2OT2 A;  5BR8 L;  1TVX A;  3CCU A;  3GTO H;  1OXT A;  3M4Q A;  1Y1V H;  3LNN A;  5IT9 c;  2ES2 A;  5C44 B;  2K5V A;  4BA2 I;  3H91 A;  5IGG A;  3CCV A;  2FMC A;  2EE1 A;  3FP9 A;  1HNZ Q;  4K5X A;  4R8I A;  2R93 H;  4B3M L;  2CH4 W;  2E2J B;  2EXD A;  3J80 L;  2NVY B;  1CQF A;  3NK9 A;  3J81 E;  3K5O A;  1QIL A;  2EVB A;  1CTM A;  1SBB B;  4LUZ A;  5BR8 Q;  2NZH A;  4LNQ A;  4A75 A;  1NY4 A;  4K6L A;  5DM6 3;  1EIG A;  4A3E G;  4AQY L;  2NN6 H;  3MVV A;  3JC6 6;  1GO3 E;  1ZXT A;  4IUU A;  1IBL L;  2EYH A;  3I90 A;  4IUP A;  1YVC A;  3PIO A;  5C0X H;  3T1H Q;  5JJI A;  1QVC A;  3KBG A;  4R4T A;  4HJA A;  2QIL A;  2GVB A;  1QWY A;  2ZM6 Q;  1FJG Q;  1JOQ A;  1EOV A;  1Q8K A;  4X66 L;  1SN8 A;  1ENF A;  2LSS A;  3U58 A;  4NXM Q;  2B63 H;  1PA6 A;  1N34 Q;  2PI2 E;  1E2W A;  1UEA B;  3HKZ B;  2MO0 A;  4HED A;  2WKC A;  2F4V Q;  1LYL A;  1V43 A;  2A68 D;  2OQK A;  1L1O C;  1YEZ A;  4B3S L;  2HT1 A;  3S14 B;  5KYI A;  1PRT F;  2I46 A;  4G7H C;  2ICI A;  2LY7 A;  4RGO S;  5IY0 A;  4OL7 A;  2N8N A;  4YIJ A;  1K9M C;  3G6E A;  3HKS A;  1A15 A;  1ZKO A;  3KOJ A;  1Y8N B;  4BA1 I;  3I8Z A;  1KD1 C;  2GA4 B;  1IW7 C;  1I3Q B;  3HOW H;  2WV6 D;  5D3I B;  3D31 A;  4KMU C;  2RBM A;  1S3O A;  2PW7 A;  1S5D D;  4A3M H;  3BYT B;  4P75 A;  2K28 A;  1B50 A;  2JA8 B;  1CK1 A;  2K6A A;  1SYE A;  5EGT A;  1VQJ A;  3SXH A;  4IOC A;  4PQX A;  4A3K H;  1G2S A;  1SNP A;  2NWG A;  4DXF A;  5ISR A;  3T1Y Q;  1NSN S;  2PO4 A;  1GUT A;  1X32 A;  1SNM A;  3FPP A;  1RD9 D;  5M5X B;  2K5Q A;  3H94 A;  3PIP 3;  1OXV A;  4PMC A;  3S2H H;  4HN7 A;  2PNH A;  5JEA H;  1DZ1 A;  1VQF A;  2NN6 I;  4DAY B;  5JPN C;  4YHH Q;  4C2M B;  3I55 A;  5I6W A;  2D0O A;  4R4O A;  1TWF B;  4EQP A;  4IZ8 A;  3R2I A;  2R7Z G;  2RDF A;  1PHJ A;  4KY6 A;  1CHP D;  4GKJ Q;  3ERQ A;  4ID6 A;  3CC2 A;  4EX5 A;  3I4N G;  4GNX A;  1B2T A;  4RWS C;  2A68 C;  2JA9 A;  4IUV A;  1CT1 D;  5M5W B;  2PCF B;  4DAV A;  4YWK A;  3L3O C;  1FNV A;  1G8Z D;  4A3G H;  4JOI A;  1N34 L;  1Y1V B;  3QWN A;  3E0J A;  5EQ0 A;  4FXD A;  3CHB D;  3GTK B;  4I7A A;  3T1Y L;  1Y8O B;  2KED A;  3J7A 5;  1F77 A;  5KND A;  1Q12 A;  1R9T B;  2BDO A;  2EJG C;  1HQR D;  3R2T A;  2K5N A;  1QZG A;  1LTT D;  4H7B A;  4IUN A;  1WYD A;  2CWA A;  4LF4 L;  1QG7 A;  2ZXP A;  2BA0 A;  2GN5 A;  1SE3 A;  2F0L A;  3MEH A;  2EXZ A;  2XGT A;  2JQO A;  3FPU B;  3VR6 A;  4ZRZ A;  3CCS A;  1UAP A;  1I50 H;  3H3V I;  4RAU C;  5BN4 A;  3B6Y A;  2D0P A;  2NVX H;  1LT4 D;  5C4J H;  3PUW A;  1NMG A;  2HQL A;  1F2L A;  3RLF A;  3CCE A;  1I50 B;  4BBS B;  4WJ3 M;  1NBW A;  4N8X 1;  3HOV G;  4LJZ C;  3GTQ B;  5G3L F;  1X3E A;  2MFI A;  5HGT A;  2Q8R E;  4LFB Q;  4BBR B;  4A3D B;  1Q1B A;  3U9O A;  3PO3 B;  1G2T A;  5C4H A;  2WAC A;  2JA8 G;  2F0W A;  4GN4 B;  3OOC A;  5NUC A;  4K0K Q;  2K5H A;  4QCL A;  3GTK H;  3S15 B;  2R92 H;  5D3D A;  1WTQ A;  4X65 L;  1PH2 A;  1HA5 A;  4TVA B;  2UXD L;  3M4O H;  1AW7 A;  1YJ9 A;  4A3K B;  4UY8 C;  1PTO B;  2JA5 H;  5IYD H;  4QUC A;  1A3V A;  3VYT A;  5JPM C;  2PPB C;  2DJF C;  4OHJ A;  1JB7 A;  5M3M G;  5I9O A;  1Z47 A;  2YTX A;  3A8J E;  2K33 A;  1PTO H;  3K8A A;  2JA5 B;  3MAQ A;  4UP7 A;  1X3P A;  5D14 A;  1LT3 D;  3CP0 A;  3S2D H;  1SR3 A;  2R7F A;  1LV9 A;  4A93 H;  1I6H H;  4BXX G;  2ZTE A;  2ZJQ A;  4LFA Q;  1ESR A;  2Z8L A;  4KY7 A;  4L63 B;  1ASY A;  4RCN A;  3H0G H;  2K7V A;  2VW9 A;  1VQC A;  3D8G A;  4JI7 Q;  2X69 A;  3RN5 A;  1PH5 A;  4JI1 Q;  5J39 A;  2K32 A;  1LO5 D;  4XQN A;  2KA7 A;  1VQI A;  3A54 A;  2K50 A;  4OEM B;  5EPK A;  3CCR A;  4U68 A;  1SMY C;  5LMN Q;  1X3F A;  4BY1 G;  3EVQ A;  1BCP F;  3HS0 C;  4DV5 Q;  5CV5 A;  1EYG A;  3QOL A;  1SEB D;  4AYB B;  1K0S A;  3IRB A;  5C5M A;  4HIO A;  4RGT A;  3M4O B;  2MJ8 A;  4BY7 G;  3NTK A;  1TWG H;  2UUC Q;  5LL6 X;  3CME A;  2EOT A;  4PMB A;  2F0I A;  2E2H H;  1IW7 D;  2VQE L;  3OSO A;  1EL0 A;  2K03 A;  1PZJ D;  1AZQ A;  3X3N A;  2NYZ D;  3D0F A;  2JA7 G;  4K2L A;  5IYB G;  1BBW A;  2TMP A;  3I4N H;  1SYC A;  2L55 A;  4DV2 L;  2V4D A;  4IUR A;  3MC0 B;  2MUY A;  2C9O A;  1LM0 A;  4RHR A;  1IKM A;  3K58 A;  5IP7 G;  4X62 L;  1JIC A;  1I4H A;  4FXG C;  1O7L A;  1HR0 W;  2WAQ B;  4L5Q A;  3G7L A;  4A3D G;  3SR1 A;  1RJT A;  2A6H D;  4KY5 A;  4LMQ D;  3SE0 A;  4GNX C;  1KAB A;  3TP7 A;  4A3D H;  1BVS A;  4QIW E;  2DNE A;  4A3B H;  4DR2 L;  2WB1 E;  3NBI A;  5K36 H;  1PH4 A;  3VYR A;  3TS0 A;  1EWH A;  3W1B A;  3KLS A;  5CC4 A;  2EYF A;  4TRD A;  3RUZ A;  1PV4 A;  4I7Z C;  4BY1 B;  3HP3 A;  4PMW A;  1YI2 A;  5C0X J;  1K3R A;  3A0J A;  4B3T L;  1OO9 B;  1WCM H;  1H9K A;  2QGQ A;  4OWT B;  3D4R A;  3PCO B;  1C0A A;  3AFQ A;  4JVZ A;  1MSH A;  3GTQ H;  4ZAI A;  2F0H A;  3KJO A;  4GKK L;  1QB5 D;  1E24 A;  3Q22 A;  1GXD C;  1ASZ A;  4RH6 A;  1XNR L;  4GN3 B;  5C3X A;  2UUA L;  1HNX L;  3GDE A;  3MA2 B;  1TII D;  2B2Y C;  2UUA Q;  3VA5 A;  1N36 L;  4XDX A;  3PO2 G;  1PYS B;  3GTO B;  1IYV A;  3NEN A;  1CFM A;  1HZC A;  4RGM A;  1X6O A;  4NW2 A;  1FR3 A;  1IL8 A;  4JW0 A;  1GHJ A;  4R1J A;  4RKL A;  2QDL A;  3Q6S A;  3A56 A;  4H0L C;  4NP5 A;  3S1Q B;  1SXT A;  3I2Z A;  3PQI A;  1JMC A;  1NE3 A;  3M9B A;  1P8L A;  5C3E H;  1KTK A;  1STG A;  4IJL A;  4TKO B;  4DUZ Q;  1YHQ A;  1FVI A;  3F1Z A;  1QCB D;  2QA4 A;  1ICW A;  3TDQ A;  2CVR A;  5FLX E;  2Z6K C;  1SNQ A;  4DR7 L;  5C4X H;  4C3J H;  2QW7 A;  3PF5 A;  3CCL A;  2VQF L;  1NMF A;  3CRL C;  2NVT H;  5ELC A;  1VS0 A;  2A73 B;  4HSV A;  2EYM A;  3GP7 A;  4R9W A;  2F3V A;  2FIN B;  4JI5 L;  2IY5 B;  4GKJ L;  4ZYS A;  1F2M A;  4ZLT F;  2CQA A;  4GNX B;  2IX3 A;  2J4X A;  3TSS A;  3J7A F;  3H3V H;  1K73 C;  1F9P A;  3PV0 A;  3NSW A;  3UE1 A;  5IGE A;  3GV6 A;  3CQZ B;  3V96 A;  2K01 A;  3CW2 C;  4KKS A;  4LK1 C;  1F9S A;  2RKS A;  3BDL A;  4RA8 A;  3CD6 A;  1PVO A;  5EKK A;  3HOZ G;  2H5X A;  2X6L A;  3TBI B;  1TS2 A;  1YIJ A;  1E2Z A;  4XT1 B;  1VMC A;  1DGS A;  3E0E A;  3RMH A;  1CHQ D;  2LMC B;  1EY5 A;  1A3U A;  5FLM G;  3HOX H;  1HZA A;  1SFO B;  1TWC H;  3AU7 A;  1IL2 A;  5GAE C;  4IAL A;  1LAB A;  4PZ6 A;  4FO2 A;  4C56 C;  3FVQ A;  4EVO A;  1SE2 A;  1RF2 D;  1WCM B;  2PMZ B;  3IAY A;  3NWS A;  2CWP A;  3U4Z A;  1WTW A;  3CRK C;  4DFA A;  4EQN A;  1Q3L A;  2HCC A;  3DHQ A;  1N32 Q;  1D7Q A;  2F0Q A;  1MHW C;  5KRU A;  4F88 A;  4LFC L;  4IN3 A;  3C46 A;  5FJ8 G;  3S17 B;  1ZEQ X;  1VQD A;  4B3R Q;  3I70 A;  5ELD A;  3BVG A;  4IPG A;  1NNX A;  4X64 L;  1Y1W H;  1STY A;  1HXY D;  4A3J G;  3GTG H;  3M85 A;  4MNO A;  1U4P A;  4ULL A;  4O1N A;  1YHB A;  4BY7 B;  5EAY A;  1E1O A;  4FF1 A;  1CKO A;  5FK9 C;  4DR6 L;  1XYI A;  4NDX A;  4L5R C;  1BR9 A;  2NB0 A;  4ZUI A;  1S72 A;  2VB2 X;  1C8C A;  1XNQ Q;  4H02 A;  3E5S A;  3AQQ A;  1Y14 B;  1WTH A;  2XSC A;  5DM7 3;  3GD7 A;  1X3G A;  1HNW L;  2KHS A;  1HFN A;  3JAM E;  3OMC A;  1IHZ A;  1QNK A;  2PQA A;  1BBX C;  2R93 B;  2HHH L;  1P16 A;  2KJX A;  2SDF A;  4HAE A;  3L7Z C;  2F3I A;  1HR0 Q;  2OTL A;  2CCZ A;  1J6Q A;  4L6T B;  2VUM H;  5EKL A;  2RVL A;  5HY6 A;  1G29 1;  2KCC A;  3L0O A;  1UE6 A;  3HOU H;  1VDZ A;  2QCP X;  2RSO A;  3MXU A;  4Y7N B;  1J5E Q;  4XYQ A;  4XTC S;  2JA7 B;  4A3F G;  2VL6 A;  1HNX Q;  1KXL A;  3TP8 A;  3BZD B;  4YCV A;  4QQB X;  5BN5 A;  1TXY A;  2KCT A;  2CH4 A;  1PRT C;  4JV5 L;  1K0R A;  4DNT B;  4C3I B;  4GZY C;  2B2Y A;  4HIK A;  2GVA A;  1PTO D;  3KUP A;  3D4D A;  4AYB G;  3MXN B;  4Q0F A;  1KLU D;  2EJM A;  3K7A H;  3LGJ A;  4J15 A;  3WOF A;  1ROD A;  2K1B A;  3NTI A;  3T13 A;  4FXK C;  3M4P A;  1KNA A;  3L9A X;  2R6G A;  4CGY B;  4DGZ A;  2B3G A;  4DF7 A;  2UXC Q;  1SYB A;  1HRJ A;  3CU7 A;  1EIY B;  1VQB A;  4B08 A;  5IP9 G;  1Z6H A;  1SND A;  3HOV B;  2F52 A;  2BE5 D;  2JJQ A;  1LTI D;  1I94 L;  1PFS A;  4PG3 A;  3HOU B;  1RL2 A;  5IWA Q;  4UDU C;  3BZC A;  1BUV T;  1ZYR C;  3HG9 A;  3S24 A;  5E1F A;  4RCO A;  2BA1 A;  4RFB A;  2QEJ C;  4UAI A;  5E4W C;  3I72 A;  5CV9 A;  3Q24 A;  2JP1 A;  3UDX A;  2B2V A;  3K5M A;  4DV5 L;  2EYO A;  1GD7 A;  1SRO A;  2ZXO A;  1VMP A;  2AQ3 B;  3EIV A;  3K5L A;  5C0X G;  5M3F G;  4V0B A;  1A8V A;  1CSQ A;  5KYL A;  1PH6 A;  3OW2 A;  1Q8I A;  2OQ0 A;  2Q8T A;  1EUJ A;  1UE5 A;  3Q8D A;  5ELO A;  2K5W A;  4DK6 C;  2VNU D;  1X9N A;  4JCV E;  3W1G A;  4C3I G;  5C44 H;  3PGZ A;  4LUV A;  1DJR D;  2M2L A;  4R4Q A;  3RZO B;  3ICE A;  1JOO A;  4C1N K;  4YY3 Q;  1RDP D;  4C3I H;  2RCN A;  4DKA C;  4DV1 Q;  1WVL A;  1STB A;  4APV A;  4JI4 Q;  2PZU A;  4R4C A;  3ERS X;  4CJ0 B;  4DUZ L;  3WWV A;  3ULP A;  2M9V A;  1NR4 A;  1O7Y A;  3ZJY C;  1VF5 C;  4DR2 Q;  3GTM H;  4K6D A;  3S1R H;  3NTH A;  5EPL A;  4B3S Q;  5IGD A;  1JJG A;  1BDO A;  3E9I A;  1XTC D;  4XQQ A;  1FGB D;  3GV3 A;  3J81 c;  2B2W A;  1KAW A;  4ZCK A;  1BO0 A;  2G9D A;  4M1U B;  5T1I A;  3LWU A;  1L1O A;  5H1S E;  4GLV B;  4LFB L;  1R4Q B;  1S5C D;  1EZ8 A;  2MGS A;  4DPG A;  1JJC B;  5IWA L;  4A3M B;  3S17 H;  3S1M H;  4OO1 G;  3I91 A;  1B53 A;  2NTS A;  4LW1 A;  1Q81 C;  3HOW B;  2NTT A;  3KK7 A;  5I6Y A;  4X66 Q;  1EU3 A;  3NXW A;  5E3F A;  4HMJ A;  1EFI D;  3I73 A;  1MIU A;  2VB3 X;  1HCZ A;  1XNR Q;  3AB9 A;  1IZ6 A;  1EYC A;  3J81 j;  4X3T A;  2A19 A;  4ALP A;  1IBL Q;  5CMD A;  5HUR A;  3UE0 A;  5C4J B;  1ZYR D;  5IIF A;  1CKM A;  3DWA A;  3K59 A;  2DNC A;  3GTM B;  3K7U C;  1CKN B;  5IP7 H;  1RIP A;  2JN4 A;  3MFG A;  1B9N A;  5J22 A;  2F1M A;  1U9R A;  4LF9 L;  4C1N I;  1GKH A;  5FO9 B;  2OF1 A;  3E3X A;  1HPC A;  5TSS A;  3MXP A;  4IUT A;  4QMG A;  5IOD A;  1GHK A;  2PQE A;  4ILW A;  1YIT A;  3DUZ A;  2LXJ A;  3K7A B;  2Q8I B;  5I2Y A;  1WTX A;  4CDC C;  3S15 H;  4BBR G;  2B39 A;  3U9S A;  4JI5 Q;  1Z9F A;  4E6I A;  4G7Z C;  4IPH A;  2I5L X;  1TY2 A;  4C3H B;  1TS5 A;  2XN9 C;  4A3I G;  3J81 i;  3TQY A;  3I4M G;  2IL8 A;  1SMY D;  1A3T A;  3PUV A;  4JI2 L;  3A7L A;  4DV1 L;  4A3L G;  3DMU A;  4Y52 H;  2RDH A;  2WKD A;  3UDI A;  4A3I H;  3DWP A;  1MSG A;  2A6E C;  4WOR A;  4Q5V A;  4JBJ A;  1VQN A;  4Z9C B;  4JG2 A;  2ZM6 L;  2MP1 A;  4K5V A;  3I4L A;  2D5D A;  3PF4 A;  2F0F A;  3HKZ G;  4A76 A;  4HCS A;  2HQE A;  2YU9 B;  2RSN A;  1XPU A;  1TWA B;  3X3M A;  5LMN L;  1E0B A;  4DK0 A;  2A74 C;  4F8M A;  4POF A;  3CKI B;  1DM0 B;  1I4P A;  4M8A A;  1LAC A;  1EU4 A;  3T16 A;  2RQX A;  4KTA A;  2IW3 A;  4DNI A;  2QDB A;  1PXU A;  1XMQ Q;  5C3E G;  1VQA A;  3FHW A;  1W2B A;  4A3B B;  2PQA B;  1O78 A;  1IBK Q;  4A93 G;  1YNN D;  2R92 B;  4KHZ A;  1TWH B;  1R9T H;  1XPR A;  1PH8 A;  3VR2 A;  2E2I B;  1NJI C;  3GTJ B;  1TS4 A;  4FDB A;  3LWE A;  2QEX A;  3N52 A;  4B3T Q;  1AH9 A;  5GQO A;  1S40 A;  1C9O A;  3HOY G;  2F0K A;  3WOE A;  5JEA J;  2Z9H A;  1HZ9 A;  4X6A H;  2E8G A;  4EGV A;  1LT5 D;  2XIW A;  5COY A;  4RMF A;  2K05 A;  4DN4 M;  4DUY L;  3QO2 A;  5CV7 A;  4YWM A;  2SNS A;  1HA6 A;  1MJE A;  1EY6 A;  3Q0A A;  4L5S A;  1AEX A;  4PZ8 A;  4GOP A;  1KQS A;  3DWQ A;  2EYL A;  5LHY 1;  1A2T A;  1CZW A;  4IQZ A;  1HUN A;  3CPW A;  3ULJ A;  1PTO C;  2P5Z X;  5IGC A;  1KDA A;  3PUY A;  4ME5 A;  2L9H A;  4RKB A;  4DUY Q;  2Y0S B;  2V1C C;  4HSP A;  4JOI C;  4MHE A;  1DD2 A;  3KYH C;  1AE2 A;  3PMF A;  3FEW X;  1H9J A;  1RTO A;  4H13 C;  1HQM C;  3ZYY X;  1LLR D;  4P74 A;  1T5E A;  1SLJ A;  1HR0 L;  1PRT B;  3V2T A;  1OTC A;  4FVM A;  1UUP A;  5M5X H;  4DXG A;  3OIP A;  3MXN A;  3NBH A;  3SDZ A;  1FD7 D;  3A8I E;  3F8T A;  4GLA C;  4LUO A;  4JYA Q;  4GOP B;  5JVH 3;  2L1B A;  2JSO A;  1W6J A;  1AP0 A;  2G9H D;  3W2D A;  2BH2 A;  4NMZ A;  3BS1 A;  1SE8 A;  3FMC A;  5C4X B;  1VQ6 A;  4P72 A;  1PRT D;  2DN8 A;  1VQE A;  4KKU A;  4LF6 Q;  1K8O A;  1QVF A;  3UI2 A;  3M7G A;  4DA2 A;  4CJ2 C;  1RTN A;  2E2D C;  3SEB A;  4A3F B;  3FKI H;  3MEF A;  4IUQ A;  2L15 A;  1HNZ L;  1E2V A;  1PMR A;  1B3A A;  3KBX A;  5IGB A;  2N55 A;  1K83 B;  1PFN A;  5EPJ A;  5FO7 B;  1JWM D;  2I5H A;  4HIM A;  1TWC B;  4A93 B;  1JE4 A;  2ICE C;  2PZT A;  3UDG A;  4DV7 Q;  4DR4 Q;  1YNN C;  3W5O A;  1EIH A;  2I5M X;  3S2H B;  3C1F A;  3T53 B;  1S5E D;  2KCM A;  1EEF D;  1SYF A;  2M00 A;  5FO8 B;  2UU9 Q;  1SMX A;  2JA6 G;  2EYJ A;  1EOT A;  3RLN A;  1O80 A;  4S3S A;  3NHH A;  1D5X C;  2N78 A;  4ODG A;  3OPO A;  4QUF A;  1G6P A;  2JA8 H;  5M3M H;  2PW5 A;  2WP8 J;  2JA6 H;  1EQV A;  1EY9 A;  1DOL A;  3RD4 A;  1L0W A;  3D6W A;  4DV7 L;  4DR4 L;  1I5F A;  4LF8 L;  2EY2 A;  3RLO A;  3D4W A;  5I4D A;  3SVM A;  3VYS A;  4DV3 Q;  1XX8 A;  5JOB A;  1STA A;  4KV6 A;  2ZTD A;  4X3S A;  3STB C;  2QKI C;  1DYQ A;  2JEB I;  2EJF C;  5LMU L;  3GTL H;  4OEL B;  3NE5 B;  5K5P A;  1Y1V G;  1Q86 C;  4POG A;  2SOB A;  4ZKB B;  1TWH H; 
#chains in the Genus database with same CATH homology
 3U58 A;  4P71 A;  3GD7 A;  4NXM Q;  1X3G A;  2B63 H;  4JI0 Q;  1HNW L;  1WJJ A;  1WI5 A;  2DUD A;  3STB D;  1T9H A;  1PA6 A;  1FGU A;  1YHA A;  3PUZ A;  1N34 Q;  2PI2 E;  3ULL A;  4OX9 Q;  2HIX A;  4DR6 Q;  1O7I A;  1QUQ B;  2MO0 A;  2XTI A;  3G4S A;  2PQA A;  3I4M H;  2AWN A;  2F4V Q;  1LYL A;  1V43 A;  2MQH A;  4DK3 C;  2HHH L;  2UUC L;  1P16 A;  1UE7 A;  1L1O C;  2OQK A;  4GKK Q;  3E9H A;  3FKI G;  3L7Z C;  1YEZ A;  2F3I A;  1HR0 Q;  1XMQ L;  2OTL A;  1UWV A;  2CCZ A;  2UXD L;  2MO1 A;  4B3S L;  1J6Q A;  2HT1 A;  1V9P A;  2VUM H;  5HY6 A;  5IYC G;  4ME3 A;  1G29 1;  4JI8 Q;  3U4V A;  3L0O A;  1UE6 A;  4BY1 H;  4NXM L;  3HOU H;  1J5E Q;  1IBM L;  1I3Q H;  4GOP C;  2OWO A;  5IY0 A;  4XTC S;  4A3F G;  2VL6 A;  1HNX Q;  1KXL A;  2N8N A;  1K9M C;  1SFO H;  3G6E A;  4YCV A;  3HKS A;  4QQB X;  3KOJ A;  4BA1 I;  2JE6 I;  3GTJ H;  1TXY A;  2KCT A;  1KD1 C;  4A3B G;  1K8A C;  3G48 A;  3RZD H;  4LF7 L;  3HOW H;  4JV5 L;  1K0R A;  3D31 A;  1S3O A;  4DAM A;  3BJU A;  1HJP A;  4IO9 A;  3AFP A;  4A3M H;  4HIK A;  2GVA A;  5M3F H;  4P75 A;  4AYB G;  2PMZ E;  4A3G G;  3MXN B;  4KLK A;  1VQJ A;  1EFW A;  1CKN A;  3K7A H;  3LGJ A;  4J15 A;  4IOC A;  3PO3 G;  4A3K H;  2CFM A;  3BU2 A;  2OCE A;  3I56 A;  1B7Y B;  4NB3 A;  3T1Y Q;  2UXB L;  4DV4 Q;  3M4P A;  4MZ9 A;  4IFD G;  2IHE A;  3M7N A;  2R6G A;  5FJ8 H;  5AJ3 Q;  2K14 A;  2B3G A;  2UXC Q;  5J3B A;  1OXV A;  4JI1 L;  3S2H H;  2K4K A;  4OO1 I;  1EIY B;  1VQB A;  5GAG C;  5IP9 G;  1A0I A;  2KHJ A;  2PNH A;  3CCQ A;  3CF5 A;  4DV2 Q;  1VQF A;  1TWA H;  3KDF B;  2NN6 I;  2RHQ B;  2F52 A;  4DAY B;  4JBK A;  3KDF A;  3GTP H;  4YHH Q;  3I55 A;  4LF9 Q;  2JJQ A;  2VZA A;  4AH6 A;  2AHO B;  4DV3 L;  4JBM A;  1I94 L;  1VQ7 A;  3F2D A;  2D0O A;  4R4O A;  1PFS A;  3PO2 H;  1VCI A;  1QUQ A;  4PG3 A;  2R7Z G;  1RL2 A;  1PHJ A;  1IBK L;  5IWA Q;  2B29 A;  3BZC A;  4GKJ Q;  3CC2 A;  3I4N G;  4EX5 A;  1A63 A;  1VQ8 A;  3S24 A;  1XTD A;  4GNX A;  2IT1 A;  1MKH A;  2BA1 A;  4MTN A;  3J80 i;  3PIP A;  2JA9 A;  4JYA L;  1E3P A;  1KL9 A;  3UDX A;  2ASB A;  1YJW A;  4EQ5 A;  3CC4 A;  4DV5 L;  4YWK A;  4DR7 Q;  1X55 A;  4A3G H;  4JOI A;  1FL0 A;  3CXC A;  2A8V A;  1GD7 A;  1CUK A;  1SRO A;  1N34 L;  3EIV A;  5M3F G;  5C0X G;  4LFA L;  2NVQ H;  5AJ3 L;  1U0L A;  2KHI A;  4KI0 A;  1A8V A;  1HZB A;  1CSQ A;  5M5W H;  1PH6 A;  3OW2 A;  2Z6K A;  2OQ0 A;  2IHF A;  1EUJ A;  4DR5 L;  3T1Y L;  1UE5 A;  2ZTC A;  3Q8D A;  3K81 C;  5ELO A;  4DK6 C;  1Q12 A;  3J7A 5;  2VNU D;  1X9N A;  4YCU A;  2UXB Q;  2K5N A;  4JCV E;  2MNA A;  3EBE A;  1QZG A;  4BY7 H;  3W1G A;  2CWA A;  1WYD A;  4LF4 L;  5C44 H;  2R92 G;  3PGZ A;  3I4O A;  4LUV A;  5C4X G;  2BA0 A;  2GN5 A;  4R4Q A;  4DR1 Q;  1PH7 A;  3ICE A;  3M3Y H;  3J80 c;  2XGT A;  1YNX A;  2JQO A;  3CCM A;  1AE3 A;  5JEA G;  1I94 Q;  4YY3 Q;  3CCS A;  3HFZ B;  4C3I H;  1I50 H;  5IYD G;  2Q2T A;  3H3V I;  1HNW Q;  1YBY A;  2RCN A;  3JAM c;  1N8R C;  4DKA C;  4IOA A;  3B6Y A;  2D0P A;  2NVX H;  4DV1 Q;  1XMO L;  5C4J H;  3PUW A;  1NMG A;  4HID A;  2HQL A;  2R7Z H;  2VUM G;  3RLF A;  4APV A;  4JI4 Q;  4R4C A;  3ERS X;  3CCE A;  4DUZ L;  2OTJ A;  3WWV A;  4YWL A;  3ULP A;  4WJ3 M;  2KBN A;  3ZJY C;  1NBW A;  4DR2 Q;  3HOV G;  3GTM H;  2E2I H;  3S16 H;  3S1R H;  1X3E A;  4JI8 L;  4B3S Q;  1JJG A;  4IJH A;  3E9I A;  2KEN A;  2MFI A;  4GS3 A;  4NXN L;  3RN2 A;  1VQK A;  4QGU A;  2JA7 H;  4LFB Q;  1Q1B A;  3J81 c;  4K0K L;  4R4I A;  1KAW A;  2JA8 G;  2CQO A;  4GN4 B;  4K0K Q;  5FLX c;  1JJ2 A;  2K5H A;  4AQY Q;  1N33 L;  3GTK H;  1L1O A;  5H1S E;  4GLV B;  5C44 G;  2R92 H;  4X62 Q;  3KFU A;  4LFB L;  5IWA L;  4DPG A;  3OTO L;  1JJC B;  3S17 H;  4OO1 G;  3S1M H;  4X65 L;  1M1K C;  1Q7Y C;  1YZ6 A;  1PH2 A;  3PO3 H;  1Q81 C;  1OXS C;  4LW1 A;  4XIG S;  3NEL A;  4TVA B;  1Q82 C;  4AYB E;  1A62 A;  3KLW A;  4X66 Q;  5LMU Q;  1XNQ L;  3M4O H;  1YJ9 A;  1WCM G;  1KRT A;  3RZO H;  4UY8 C;  4GN5 A;  4A3J H;  1OXX K;  2JA5 H;  5IYD H;  2Y0S E;  1MIU A;  5DLQ E;  1E22 A;  1JB7 A;  4JI6 Q;  1XNR Q;  1XJV A;  1IYJ B;  1IZ6 A;  5M3M G;  3J81 j;  1Z47 A;  2A19 A;  2YTX A;  1BBU A;  2ID0 A;  4ALP A;  1IBL Q;  3K8A A;  3G71 A;  4GLX A;  3UE0 A;  4A3L H;  4HJ7 A;  4QY7 A;  4UP7 A;  1C7Y A;  1CKM A;  1K83 H;  4P73 A;  3TRE A;  5GAD C;  3CP0 A;  4BBS H;  3S2D H;  2VS1 A;  1SR3 A;  1EQQ A;  2R7F A;  3K7U C;  1CKN B;  2UUB Q;  3AEV A;  2N49 A;  3HOV H;  4A93 H;  5IP7 H;  4BXX G;  1TWF H;  1RIP A;  1I6H H;  1VQH A;  2K52 A;  2Z0S A;  2ZTE A;  2ZJR A;  1PH3 A;  2ZJQ A;  4LFA Q;  2FXQ A;  4A4I A;  2VQF Q;  5FLM H;  3HOX G;  3S1N H;  3S1Q H;  4YHH L;  4LF9 L;  1ASY A;  4BBS G;  3TRZ A;  1GKH A;  3H0G H;  4JI7 Q;  2VW9 A;  1VQC A;  4RG1 A;  3RN5 A;  1PH5 A;  2NZO A;  2RF4 A;  4JI1 Q;  4JI3 Q;  3EN2 A;  1YIT A;  4JI2 Q;  1VQI A;  2LXJ A;  2K50 A;  3S15 H;  3CCR A;  2IX1 A;  5LMN Q;  4BBR G;  1X3F A;  4BY1 G;  4DV5 Q;  1LUZ A;  2UUB L;  1EYG A;  2AWO A;  4JI5 Q;  1CSP A;  1Z9F A;  1QZH A;  1SRU A;  2WB1 G;  4IPH A;  2I5L X;  3IRB A;  4HIO A;  2JA5 G;  3CQZ H;  1X65 A;  2R7D A;  4BY7 G;  4A3I G;  1MJC A;  3J81 i;  3TQY A;  1TWG H;  3KF6 B;  2UUC Q;  3I4M G;  4DR5 Q;  3CME A;  1GVP A;  1N32 L;  2YV5 A;  4A3C H;  3KF8 B;  3PUV A;  1VQ4 A;  1PH1 A;  2E2H H;  4JI2 L;  2A1A A;  4DV1 L;  2VQE L;  1XMO Q;  4JV5 Q;  4A3L G;  3CC7 A;  4Y52 H;  1Y1W G;  4LWC A;  1N9W A;  3UDI A;  3D0F A;  4A3I H;  2JA7 G;  4IFD J;  5IYB G;  1BBW A;  1E7Z A;  3I4N H;  2ATW A;  3CCJ A;  2AMC B;  4DV2 L;  4IFD I;  1KHI A;  4YY3 L;  1UEB A;  1VQM A;  2EQS A;  1BKB A;  3KJP A;  4JBJ A;  1VQN A;  2E2J H;  3HOY H;  1IBM Q;  1LM0 A;  1X56 A;  4JG2 A;  2ZM6 L;  4NPS A;  5IP7 G;  4X62 L;  4BXX H;  1JT8 A;  3U50 C;  3PF4 A;  5LMN W;  4L5T A;  1HR0 W;  3HKZ G;  4L5Q A;  4IPD A;  1PYB A;  4A76 A;  4A3D G;  3CMA A;  5IP9 H;  3H0G G;  4LF7 Q;  1XPU A;  5LMN L;  4GNX C;  4OXP A;  4JBW A;  4O0A A;  3UDF A;  1HH2 P;  4POF A;  4DR3 L;  4A3D H;  1BVS A;  4QIW E;  4JC0 A;  4A3B H;  1Q46 A;  4DR2 L;  2WB1 E;  1PH4 A;  4HJ5 A;  3TS0 A;  3W1B A;  4DV6 L;  1VQ5 A;  4DNI A;  4DV4 L;  1VQL A;  3TS2 A;  1PV4 A;  1XMQ Q;  1X54 A;  2CKZ B;  1VQA A;  3FHW A;  5C3E G;  1W2B A;  4PMW A;  4X65 Q;  5C0X J;  2PQA B;  1K3R A;  3A0J A;  1YI2 A;  1WCM H;  1IBK Q;  4B3T L;  2D62 A;  4B3M Q;  3HOU G;  2F4V L;  4A93 G;  2QGQ A;  4OWT B;  1C0A A;  3PCO B;  4KHZ A;  1R9T H;  1XPR A;  1PH8 A;  3AFQ A;  1W3S A;  4UP8 A;  5ELN A;  3GTQ H;  3KJO A;  1WFQ A;  5IYB H;  1NJI C;  4FDB A;  4GKK L;  2QEX A;  4AIM A;  3HOZ H;  4X64 Q;  1E24 A;  4B3T Q;  1V1Q A;  3GO5 A;  5HGQ A;  4LF5 L;  1AH9 A;  4OWX B;  4LF4 Q;  5GQO A;  1S40 A;  1ASZ A;  1C9O A;  4LF8 Q;  4JI6 L;  1XNR L;  3SGI A;  4GN3 B;  4B3R L;  3L2P A;  3HOY G;  5JEA J;  3CPF A;  2UUA L;  1HZ9 A;  1EIF A;  1HNX L;  3GDE A;  1XPO A;  4X6A H;  2E8G A;  2UUA Q;  1N36 L;  2NN6 G;  1VQO A;  3PO2 G;  1PYS B;  4RMF A;  3I7F A;  2BH8 A;  4JI4 L;  4DUY L;  4YWM A;  4KHP Q;  2Q2H A;  3T1H L;  3OTO Q;  1YJN A;  1MJE A;  4YCW A;  4L5S A;  4IPC A;  5GRO A;  4LF5 Q;  3NEN A;  3TEH B;  1HZC A;  4PZ8 A;  1X6O A;  2LXK A;  2HHH Q;  4A3C G;  4GOP A;  5K36 G;  3A5Z B;  1KQS A;  1KRS A;  5IE8 A;  3RNU A;  5JJL A;  2C35 B;  4R1J A;  1VQ9 A;  1Q1E A;  1QVG A;  2WAQ G;  1E1T A;  2NVY H;  3CPW A;  3ULJ A;  4LFC Q;  4DR1 L;  3PUY A;  4A3E H;  2ZJP A;  3I2Z A;  1TWH H;  4DUY Q;  5JJK A;  4DV0 L;  1JMC A;  3PSI A;  1NE3 A;  3M9B A;  1L2F A;  1P8L A;  1G51 A;  2V1C C;  5C3E H;  4HJ9 A;  4A3M G;  4JOI C;  3H15 A;  2DGY A;  1B8A A;  3KYH C;  2PI2 A;  1AE2 A;  5C0X I;  1N36 Q;  4IJL A;  2B63 G;  4DUZ Q;  2N3S A;  1YHQ A;  1FVI A;  3BZK A;  3F1Z A;  3S14 H;  2QA4 A;  4JI3 L;  2Z6K C;  4P74 A;  1SLJ A;  3A74 A;  1HR0 L;  4DR3 Q;  1OTC A;  4DR7 L;  5C4X H;  4C3J H;  4JI7 L;  2VY3 A;  5M5X H;  3A5U A;  3PF5 A;  3F8T A;  4UP9 A;  4GLA C;  4LUO A;  2VQF L;  1NMF A;  3CCL A;  4JYA Q;  4GOP B;  2Q2U A;  3OYY A;  2NVT H;  1VS0 A;  2I0Q A;  3DM3 A;  1WOC A;  2E5L L;  2BH2 A;  1SE8 A;  4JI0 L;  1VQP A;  4JI5 L;  2IY5 B;  1VQ6 A;  4P72 A;  4GKJ L;  3PUX A;  4A3F H;  1KC8 C;  4GNX B;  2RHS B;  3H3V H;  1K73 C;  1VQE A;  3AYH B;  4LF6 Q;  1U5K A;  3PV0 A;  4DV6 Q;  1QVF A;  4C2M H;  1JE5 A;  1FJG L;  3UE1 A;  4HJ8 A;  3ER0 A;  5E7N A;  1NTG A;  3HOW G;  1GM5 A;  3CW2 C;  4OWW B;  2WAQ E;  3FKI H;  3MEF A;  3HKZ E;  2L15 A;  2VQE Q;  1HNZ L;  2UXC L;  1L1O B;  3J7Z C;  2YU9 H;  2YTV A;  2JEA I;  2UU9 L;  3CD6 A;  1PVO A;  1EQR A;  4UPA A;  3HOZ G;  2H5X A;  2I5H A;  4HIM A;  2YTY A;  1KIX A;  1YIJ A;  1LTL A;  4PZ7 A;  3E0E A;  1DGS A;  2E5L Q;  2EIF A;  1OXU A;  3UDG A;  3RR5 A;  4Y7N H;  3NBH B;  4DV7 Q;  4DR4 Q;  3W5O A;  2WFW A;  5FLM G;  3HOX H;  1EWI A;  2I5M X;  2R93 G;  2AKW B;  2JK8 A;  1HZA A;  5BR8 L;  3CCU A;  1TWC H;  2KCM A;  1OXT A;  3GTO H;  3M4Q A;  1Y1V H;  5IT9 c;  3F2B A;  2ES2 A;  1H95 A;  1IL2 A;  2Y0S G;  4QL5 A;  2K5V A;  4QJF A;  5GAE C;  1SMX A;  2UU9 Q;  2JA6 G;  4BA2 I;  4PZ6 A;  1M90 C;  3CCV A;  3NEM A;  3RLN A;  3FP9 A;  1HNZ Q;  2R93 H;  4B3M L;  3K0X A;  2EXD A;  2Q2I A;  2N78 A;  4A3K G;  1G6P A;  2JA8 H;  5M3M H;  2CWP A;  3U4Z A;  2UXD Q;  3JAM i;  2HIV A;  2WP8 J;  2JA6 H;  4C3H H;  2ALY B;  4LF6 L;  5IYC H;  1N32 Q;  1D7Q A;  4LUZ A;  1K8G A;  5BR8 Q;  2NZH A;  4LFC L;  4LNQ A;  4A75 A;  1NY4 A;  5FJ8 G;  4A3E G;  3CAM A;  1L0W A;  1J5E L;  1PH9 A;  4AQY L;  1N33 Q;  4DV7 L;  4DR4 L;  1I5F A;  1VQD A;  4LF8 L;  4B3R Q;  4DV0 Q;  3RLO A;  3F2C A;  2K75 A;  1VQG A;  3JC6 6;  4IPG A;  4X64 L;  1Y1W H;  1D8L A;  1GO3 E;  4OON A;  3KF6 A;  4DV3 Q;  4A3J G;  1IBL L;  3GTG H;  1IXR A;  3M85 A;  1B70 B;  4MNO A;  1YHB A;  1YVC A;  3PIO A;  3T1H Q;  4NXN Q;  2ZTD A;  4WJ4 A;  5JJI A;  5EAY A;  1E1O A;  1CKO A;  1QVC A;  4O2D A;  4TQU S;  4OX9 L;  4DR6 L;  5M5Y H;  4L5R C;  3VDY A;  3STB C;  1S72 A;  2JEB I;  4R4T A;  4HJA A;  1UE1 A;  5LMU L;  1FJG Q;  2GVB A;  2YYZ A;  2ZM6 Q;  1XNQ Q;  3DLL A;  3GTL H;  4KHP L;  3K80 C;  4H02 A;  1EOV A;  3AQQ A;  1Y1V G;  5GAH C;  1Y14 B;  1Q8K A;  4X66 L;  1Q86 C;  4POG A;  1SN8 A;  4BBR H;  2IX0 A;  2LSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...