4DR5Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr5Q00
2QA4A 2UXDQ 4HJAA 3S14H 1ASZA 2KENA 3E9HA 1GVPA 3HOYG 3S2DH 4IJLA 4B3RQ 3SGIA 4OO1G 5LMUQ 4B3TL 2JK8A 1E24A 2QGQA 4KHPL 1U0LA 1VQ6A 3BZCA 2VQEQ 3CMAA 4WJ3M 4DR1L 2F4VQ 2FXQA 1XNQQ 1VQGA 4A3DG 4LF7Q 3TRZA 3A5UA 4DV4Q 4LW1A 3CCLA 3PO2H 2UXDL 4DKAC 2HIVA 3GD7A 1I50H 3RZOH 4JOIC 4DV0Q 2HHHQ 3I4MG 2JA6H 1JJGA 3RLFA 2JA7H 4A3FG 1KIXA 5C44G 4B3RL 2UU9Q 2Y0SG 4P75A 4DR2Q 5K36G 1A63A 1JE5A 5LMUL 1HNXQ 4HJ7A 4JI2Q 4ALPA 2VQEL 1MJCA 2F4VL 4LF5Q 2KHIA 3KF6B 1XNQL 1AE3A 4Y52H 3HFZB 4LF7L 1I3QH 3E0EA 4DV4L 2JA5H 3S24A 5IE8A 1Y1WG 1XPUA 1TWHH 4R4QA 5IP9G 4IOCA 2NVXH 4JOIA 3U58A 2HHHL 3HOZG 3H0GG 5IT9c 4DR4Q 4QJFA 5FLXc 5GAGC 1M1KC 4DR2L 3KDFA 2UU9L 4JI5Q 4GN5A 3OYYA 3S16H 4QQBX 1HNXL 1OXVA 3HOXH 4B3MQ 5JJKA 3EBEA 2B63G 2WFWA 4JI2L 1H95A 3T1YQ 2MO0A 1N8RC 3PUZA 2K4KA 4IPHA 3CC2A 4LF5L 1QVGA 2CKZB 1FGUA 1VQAA 2A19A 3U4ZA 3W1GA 5GADC 4LF6Q 1TWCH 2K5HA 2VUMH 2VL6A 4C2MH 1XTDA 3KJOA 1J5EQ 5IYBH 2YTVA 1PH8A 3K80C 4PZ6A 1LYLA 4PMWA 1PYSB 1IYJB 3BZKA 2CWAA 4JI7Q 4DR4L 1LUZA 2D0PA 3F2CA 3GDEA 1WJJA 4DV6Q 4JI5L 2K14A 3TS0A 3K8AA 3JAMi 4JBMA 2OTJA 4B3ML 3ULJA 1SRUA 2IHFA 3RNUA 4P71A 4YCVA 3T1YL 3I55A 4A3MG 1VQ9A 2Q2UA 3HOUG 4ME3A 4AQYQ 3HOYH 4LF6L 4BY1G 2ZTCA 2ZTEA 5IYCH 3K81C 1NE3A 3CPFA 3LGJA 1J5EL 3PF5A 3TEHB 1IBKQ 4OO1I 2CFMA 1HNZQ 2MFIA 1EIFA 1IXRA 1SLJA 4BBSH 4JI7L 4LFBQ 4QIWE 3CCEA 3I4OA 1A62A 4DK3C 4DV6L 4JI4Q 4IO9A 4A93H 4BXXG 1XJVA 1HH2P 1B8AA 5C0XG 1PHJA 3G6EA 2R7ZH 4A3DH 2VY3A 4JI8L 4GS3A 1X56A 2KCMA 4A4IA 2R93H 1MKHA 2PQAA 4AQYL 2R6GA 1GM5A 1VQDA 4LUVA 2GVBA 1SR3A 3S1RH 2RF4A 3I7FA 2AWOA 1VQHA 3FKIH 3J7A5 3RZDH 3J81i 1IBKL 5J3BA 3VDYA 1O7IA 1HNZL 3G4SA 4LFBL 1HJPA 3CW2C 4X65Q 3RN5A 4JI4L 1K73C 4HIMA 1VQPA 4DR3Q 4DUZQ 2OQ0A 4UPAA 3FP9A 4A3IG 3J7ZC 3EN2A 3U4VA 1Q81C 5ELOA 3GTGH 3J81j 4A3KG 1I5FA 1R9TH 1PYBA 1LM0A 1TXYA 1VQLA 4FDBA 1OTCA 1Y1VH 1A0IA 1VQ7A 2HQLA 1JB7A 2Y0SE 3GO5A 3J80i 4GNXB 3KF6A 5JJLA 2JEAI 3KYHC 3M7NA 1LTLA 1X6OA 2CCZA 1KQSA 3H15A 1X54A 1KRTA 3UDFA 4X65L 3FHWA 5IYDG 2I5HA 1MJEA 4A3BG 1TWGH 3M85A 4DR3L 4DUZL 5M3FH 1S72A 1SE8A 3STBC 1VQBA 2YV5A 3PIPA 2OQKA 1Y14B 1KD1C 3H3VI 2RCNA 3GTJH 4X62L 1UE6A 3D0FA 1TWFH 3K7AH 1Q12A 1WCMH 4PZ7A 3CC7A 1U5KA 2E2HH 1Q7YC 5FJ8G 3M4OH 2AHOB 2YTYA 1P16A 3M4QA 1G291 3UE0A 5LMNW 1PH1A 1X65A 3PSIA 1PFSA 4LNQA 1NMFA 1RIPA 3RLNA 3TQYA 2VS1A 2Q2HA 1VQ8A 1PH6A 3CCJA 3I4NG 2PQAB 4GN3B 3S15H 4JV5Q 3CCMA 2F3IA 1VQIA 3A5ZB 4JG2A 4JBWA 5IP7G 4R4OA 1G51A 4A3JG 4DV2Q 2JA8H 2R92H 1CKNB 2VZAA 2YTXA 3UDXA 4DAYB 2ZTDA 1OXXK 1L0WA 4GLAC 1PH4A 1CSPA 2QEXA 1JMCA 2B29A 2K5NA 1YI2A 4A3GH 4UP7A 2H5XA 1YJ9A 1QZHA 2NN6I 1Z47A 3GTOH 2ZJPA 2IT1A 1XMQQ 4L5SA 1VQJA 4JV5L 5ELNA 2WAQE 2E5LQ 5JJIA 3EIVA 1GO3E 3Q8DA 2ES2A 3WWVA 4A3EG 4DV2L 2BH8A 5DLQE 3CCVA 2I0QA 3NEMA 5C3EH 2XTIA 3AEVA 1EFWA 4UY8C 2UXBQ 4C3JH 1Q82C 3RLOA 3CCSA 4GNXC 4GLXA 4DV0L 1PH3A 4NXNQ 1YZ6A 2HT1A 2PNHA 4DR5Q 4O2DA 5JEAJ 1B7YB 2DUDA 3S1QH 2IHEA 1E3PA 4OXPA 1J6QA 4GOPB 1VQOA 1EWIA 2ZJQA 1XMQL 4A3LH 1CKMA 2N49A 3GTQH 1KXLA 4KLKA 5IY0A 3G71A 2E5LL 2PMZE 3K0XA 1Q1EA 4IFDJ 5M3MG 2E8GA 1IZ6A 2OCEA 1OXUA 3PUWA 1EYGA 5IYDH 2UXBL 1VQCA 4NXNL 1S40A 4GNXA 1X3GA 4DR5L 1PVOA 3HOVH 3PO3H 4P72A 4LF4Q 3CMEA 1E1OA 4R4IA 1K8GA 2AWNA 1OXTA 2N78A 2KBNA 4IPGA 1X3EA 3CC4A 2ID0A 3DM3A 4NB3A 4JYAQ 5C4XG 5FLMG 1I6HH 1XNRQ 2ZJRA 3STBD 3KLWA 3NENA 4BBRG 4HJ8A 3IRBA 4OWXB 1IBLQ 4YWMA 3KJPA 4O0AA 2UUAQ 1CKOA 1Q46A 2YYZA 2KCTA 1YVCA 4IJHA 1UWVA 4A3CG 2WAQG 4R4CA 1E1TA 4QGUA 1QZGA 3CP0A 2NVTH 4QL5A 2HIXA 4Y7NH 1EIYB 1SROA 2UUBQ 2AKWB 4UP8A 1K0RA 4LF4L 2JQOA 4DR6Q 2NVYH 1CSQA 5BR8Q 4GKJQ 3PF4A 1GKHA 2WB1E 5GAHC 4DUYQ 4JYAL 1XNRL 4UP9A 3D31A 3NBHB 1L1OC 3CCUA 1C9OA 1VQ5A 1IBLL 4LUZA 2K75A 2UUAL 1WFQA 3I4MH 1XPRA 1Q1BA 1CKNA 4A3FH 5C44H 1X55A 1YIJA 2LXKA 4X6AH 3U50C 1HZBA 1UEBA 1S3OA 2KHJA 4YCUA 3DLLA 3UDGA 1B70B 3G48A 2UUBL 5M5YH 4DR6L 4POGA 3HKSA 2JJQA 1K9MC 2K50A 4OONA 4R1JA 5BR8L 4XTCS 4GKJL 4BY7G 4DUYL 1YITA 1GD7A 1NTGA 4GOPC 5EAYA 1HR0W 3BJUA 1PH2A 2A8VA 1Y1WH 4BA2I 5IP9H 1L1OA 4DV7Q 4WJ4A 4OWWB 3ER0A 1YJNA 3KF8B 4RMFA 3MEFA 3HOZH 3H0GH 3F2BA 1N33Q 1KAWA 4JI3Q 4BA1I 4DV1Q 4DK6C 2UUCQ 1JJCB 3PUYA 2B63H 4GKKQ 5HGQA 2BA1A 2IY5B 3OW2A 1YNXA 2MQHA 2ALYB 3JAMc 1NY4A 4MZ9A 1KRSA 3H3VH 1IL2A 1CUKA 2EQSA 2GVAA 4GOPA 4L5QA 4EQ5A 3HOXG 2CQOA 4DV7L 3S2HH 2D62A 2WB1G 4P74A 3CCRA 3PUXA 3ERSX 2IX1A 1HNWQ 1N33L 1DGSA 4JI3L 4IPDA 4DV1L 1Q8KA 1XMOQ 2UUCL 4LF9Q 1VQNA 2JEBI 1SN8A 1WI5A 1VS0A 2A1AA 4JBJA 4LF8Q 2VUMG 4GKKL 1EQRA 5IYBG 4A3MH 2Z6KC 5FLMH 2R7FA 1N34Q 3HOUH 4C3HH 3KFUA 3W1BA 4NXMQ 2MNAA 4BBRH 3GTMH 1HZAA 4BY1H 3M9BA 3TS2A 4DPGA 1V9PA 4XIGS 1YBYA 3CPWA 4AYBG 4HIOA 4KI0A 1OXSC 1HNWL 4QY7A 4YY3Q 1HR0Q 2GN5A 1M90C 3AQQA 1JJ2A 2RHSB 4YCWA 4JI1Q 4RG1A 1XMOL 1BBUA 4LF9L 3E9IA 4BXXH 3MXNB 3J81c 5C0XI 4LF8L 4IOAA 2BH2A 1D7QA 2VQFQ 5LMNQ 2B3GA 5IYCG 1XPOA 1EQQA 1N34L 2Z6KA 4NXML 4BBSG 1L1OB 3UE1A 2K5VA 3M3YH 4GN4B 1HZ9A 4TVAB 4A93G 3W5OA 2E2JH 4TQUS 3TREA 3AFQA 2R7ZG 1C0AA 4HJ5A 4K0KQ 5AJ3Q 1TWAH 4YY3L 2JA9A 4DAMA 1HR0L 2R93G 1KHIA 2MO1A 3J80c 2Q2TA 4JI1L 1PH7A 2WP8J 2EXDA 4A3IH 1W3SA 2VQFL 5LMNL 4BY7H 3JC66 3FKIG 5HY6A 3I2ZA 2L15A 4A3KH 5GQOA 3A74A 3HOWG 1BVSA 3HKZE 1WOCA 3AFPA 4LFAQ 1EUJA 1N36L 4B3SQ 4LFCQ 3S1NH 5JEAG 1QVCA 1HZCA 1PH9A 3PIOA 4K0KL 3S17H 5AJ3L 3M4PA 5GAEC 2VW9A 4X64Q 3PCOB 1Y1VG 4A3BH 3S1MH 2C35B 1V43A 1YHAA 4NPSA 1JT8A 2I5LX 4DR7Q 1FVIA 2DGYA 1BBWA 1VCIA 4JI6Q 1FJGQ 4IFDG 3GTPH 1QUQB 1YHBA 3I56A 1KC8C 4JBKA 3CF5A 3AYHB 1W2BA 4EX5A 1WYDA 4B3SL 4LFAL 4H02A 4LFCL 1QVFA 1VQMA 5M3FG 2ATWA 5FJ8H 3GTKH 1E22A 1UE5A 1VQEA 4L5TA 3B6YA 4DV3Q 2RHQB 3T1HQ 5IWAQ 2BA0A 1PA6A 4X64L 1WCMG 2R7DA 1YJWA 4JI0Q 3I4NH 3ULPA 1PH5A 4DR7L 1NJIC 1N9WA 2I5MX 3F2DA 4JI6L 1FJGL 1UE1A 4JCVE 5IP7H 4LWCA 3RN2A 4A3JH 5GROA 4LUOA 1VQFA 1KL9A 2Z0SA 1K8AC 1AE2A 2Q2IA 4JI8Q 2UXCQ 2IX0A 5M5XH 4PG3A 1Z9FA 4DV3L 3ZJYC 4AH6A 1C7YA 4PZ8A 3T1HL 5E7NA 3HKZG 4HJ9A 5IWAL 2OTLA 2R92G 5C0XJ 2JA8G 2K52A 4JI0L 3PGZA 4DNIA 1T9HA 3PO2G 1EOVA 3BU2A 3OTOQ 4AIMA 2EIFA 4A75A 2XGTA 4X66Q 3ICEA 4AYBE 1V1QA 4A76A 1IBMQ 4A3EH 2JA6G 4A3GG 3L0OA 2JA7G 1YHQA 4P73A 5M5WH 1VQKA 2PI2E 1K3RA 1I94Q 2NVQH 4YHHQ 1L2FA 2NN6G 2UXCL 3PUVA 2E2IH 1NMGA 3L7ZC 1N32Q 2CWPA 1PV4A 4HIDA 1UE7A 1FL0A 4KHZA 1Q86C 1P8LA 4APVA 4POFA 3L2PA 2YU9H 3CD6A 3CAMA 1SFOH 4MNOA 3KDFB 2JA5G 5H1SE 5C3EG 2PI2A 3OTOL 1X9NA 3K7UC 3PV0A 4YWLA 2NZOA 2NZHA 1E7ZA 3A0JA 5C4JH 3CCQA 4X66L 4HIKA 2ZM6Q 1IBML 3GTLH 4C3IH 2VNUD 4DV5Q 2V1CC 4JC0A 2OWOA 1SMXA 5M3MH 1I94L 4OX9Q 4GLVB 4YHHL 4X62Q 4A3LG 1G6PA 1AH9A 3ULLA 1D8LA 1N36Q 1N32L 2D0OA 2JE6I 2N8NA 2AMCB 3RR5A 1ASYA 4J15A 4IFDI 1MIUA 1X3FA 3UDIA 2ASBA 1VQ4A 3CQZH 3F8TA 1YEZA 5C4XH 4L5RC 2F52A 2ZM6L 2LSSA 1BKBA 4MTNA 4DV5L 3F1ZA 4B3TQ 2N3SA 3NELA 3HOVG 3PO3G 3HOWH 1K83H 1NBWA 4OX9L 1QUQA 4KHPQ 1A8VA 4A3CH 4DR1Q 1RL2A 4OWTB 4R4TA 3CXCA 3KOJA 4IPCA 2LXJA 4YWKA
chains in the Genus database with same CATH superfamily
3T51B 3MXUA 3HOYG 1G8ZD 1SE4A 3SGIA 3F2UA 4OO1G 3T13A 5LMUQ 4B3TL 2JK8A 3HOVB 1XYIA 3BZCA 4XXEA 2VQEQ 3CMAA 1A3VA 1GUWA 4LF7Q 3TRZA 1HQRD 2G9HD 2ZXOA 4DV4Q 1AZQA 3CCLA 3NWTA 3GD7A 3RLFA 3K58A 3NBIA 4B3RL 5C44G 1A63A 1I4QA 2A69C 1HNXQ 4ZK9B 5CBEE 4RGTA 3O13A 3HRZC 1EY0A 2WV6D 4Y52H 2F0LA 3SEBA 2JA5H 3VR3A 1MGSA 4ME5A 3J7AV 2EY6A 3CRKC 2NVXH 3V2TA 2CHBD 4JOIA 3U58A 4DR4Q 3NWSA 3I4MB 5FLXc 4A3FB 4DR2L 1M1KC 1PXUA 3OYYA 3QO2A 2Y0SB 4GN5A 5DM63 1PRTC 2LKVA 1OXVA 4B3MQ 1WD1A 2XSCA 4JI2L 1N8RC 1TS5A 3D3RA 4IPHA 1GUSA 4LF5L 2A19A 2VL6A 4C2MH 1XTDA 1J5EQ 4OELB 3K80C 2KECA 1IYJB 2A74C 4JI7Q 4EVOA 3GDEA 5KNDA 4DV6Q 4ID6A 2BE5C 2K14A 4JI5L 4JBMA 3ULJA 1CK1A 2IHFA 3MXGA 1OO9B 4YCVA 3T1YL 4A3MG 4XYOA 2X6LA 1T5XD 4AQYQ 4QB4A 3BYTB 3I73A 2L55A 5C5LA 4LF6L 1H9SA 2HDLA 5IYCH 1NE3A 3LGJA 3DXJC 3TEHB 1IXRA 3D4WA 4QIWE 3CCEA 3I4OA 1A62A 2JSOA 4DK3C 3NQTA 1PHJA 4CHTB 3G6EA 3PMFA 3HOUB 2R93H 1F2MA 2PQAA 5C3XA 3HZXA 1ET9A 3I7FA 3MFYA 3FKIH 3ITPA 2WAQB 3I90A 3VDYA 4M1UB 1HNZL 1ML0D 3OWFA 1S5FD 3G4SA 1A2TA 2EE1A 1BNZA 4JI4L 1TVXA 4DUZQ 2J7ZA 2NYZD 1O78A 3NUCA 3VYSA 2RSOA 4FDBA 2HQLA 1JB7A 1E2ZA 2Y0SE 3GO5A 3KYHC 1LTLA 1KQSA 1PZKD 1EIHA 1TWAB 2I5HA 4A3BG 1TWGH 2L5TA 1BCPD 3PIPA 2YV5A 1TT2A 4A3IB 1K8OA 2XVSA 3GTJH 4X62L 1B9MA 1TWFH 5TSSA 1Q12A 2EY5A 4MHEA 5FJ8G 5I2XA 4HAEA 4LNQA 1RF2D 1ZYRD 1RIPA 2F0UA 3TQYA 2VS1A 2NTTA 4ABNA 1EFID 2A73B 2Q2HA 1H9JA 1PH6A 1SJED 4U68A 3CCJA 4GN3B 1HFNA 3T16A 2F3IA 1VQIA 2GA4B 5IP7G 1CKNB 5BN3A 2ZTDA 4ZRZA 1EYDA 2WB1B 1PTOC 4HSPA 2DY8A 2CW0D 2QEXA 5CYUA 4A3GH 2H5XA 2RA4A 4FF4A 5D65A 1EOTA 4C2MB 1QZHA 2NN6I 1Z47A 4DF7A 2NN6H 1NNXA 4L5SA 1WTRA 4JV5L 3TP5A 5ELNA 2WAQE 5I4DA 2E5LQ 3EIVA 2K7VA 2EY1A 5C3EH 2XTIA 3AEVA 1EL0A 3BDOA 2FINB 2VB3X 2DJGC 1PH3A 2K03A 1TU2B 1XTCD 1B7YB 2EXZA 3S1QH 2IHEA 4G57A 1VQOA 4GOPB 1EWIA 3VR5A 1DOLA 1KXLA 4KLKA 2LS01 1EU3A 3G71A 4A3EB 3BG3A 2NVQB 2FJ2A 5C6AA 2R93B 4ULLA 1S40A 4KKSA 1X3GA 4DR5L 2K5QA 3PO3H 3CMEA 3P75A 1E1OA 1SJHD 1STAA 4R4IA 1K8GA 1OXTA 2L9HA 4RCNA 1IYVA 4PNYA 2K32A 5HGTA 1I6HH 3HOWB 5C4JB 5EPKA 3EA6A 4O0AA 2UUAQ 4TRDA 2WAQG 5IT9E 4QGUA 3CP0A 4Q0FA 2F0VA 2WINB 1EIYB 2AKWB 4CDCC 1K0RA 5ELEA 2OXPA 1AFPA 4FO2A 1JR0D 2WB1E 3CQZB 1PFMA 2EJFC 3E3XA 3NBHB 3LWEA 1L1OC 3CCUA 1STHA 1IBLL 3QOJA 1S5CD 3H09A 1Q1BA 1CKNA 2O4XA 5K36H 1X55A 1YIJA 3DWPA 1CM9A 1Z7TA 1HZBA 1UEBA 1S3OA 2UUBL 4YCUA 4DR6L 3S14B 2K50A 2HD3A 2KQ3A 5BR8L 4DUYL 1SMYD 1Q3LA 5IP9H 4DV7Q 1NAPA 4WJ4A 4OWWB 1LT4D 1JC7A 4RMFA 3MEFA 1KAWA 3TZUA 1BXTA 5CV4A 1G2SA 2F0IA 2EOTA 2IPKD 1YNXA 1NY4A 1D1IA 2IJ0A 2JA6B 4A3GB 1IL2A 1JOQA 1CUKA 4GOPA 1KDBA 1TS2A 4O42A 4L5QA 1EEFD 2QDLA 4GZYC 1SNQA 1Y8NB 2WB1G 4C1NI 3CCRA 4LF8Q 2V4DA 4GKKL 3Q23A 4BBRH 2EYHA 1DD2A 1BR9A 1CQFA 3CPWA 4DFAA 1FNVA 2MGSA 4HIOA 4KI0A 4V0BA 1HNWL 4YY3Q 3AQQA 1EY8A 1XMOL 4BXXH 1E0BA 3SR1A 5C0XI 5C0XH 5CV6A 3SK5A 3VYUA 4KD4A 5IYCG 2XRQD 1N34L 2Z6KA 1WVLA 1L1OB 1KDCA 3PO3B 3W5OA 4TQUS 2SOBA 4RKBA 4AYBB 1GHJA 3NBHA 4HJ5A 4DAMA 4J1MA 2R93G 2E74C 2LY7A 4NKLA 4FP5D 3CRLC 1K8MA 3K57A 2VXWA 2QW7A 4F88A 1W3SA 4BY7H 3FKIG 3I2ZA 4A3KH 5JOBA 3K5LA 3A74A 3HOWG 1HA6A 3S1NH 1BDOA 2IL8A 3LX0A 4A3DB 3S17H 2VW9A 5EQ0A 1FYCA 3PCOB 5KYIA 1PFNA 2KHSA 4NPSA 3S1RB 1BUVT 1VCIA 3MWYW 3GTPH 4L8JA 3R93A 1PRTF 3AYHB 4EX5A 4WJWA 4LFAL 5ISRA 2DY7A 2ATWA 1QILA 1UE5A 1VQEA 4L5TA 4IALA 2IWHA 3I4NH 2B2TA 1LTTD 4NW2A 4DR7L 3F2DA 1FJGL 3DWAA 4RGMA 3I4LA 1VQFA 1BOSA 2Z0SA 2Q2IA 3J80L 4L63B 5M5XH 4PG3A 4FXGC 5M3FB 1C7YA 5E7NA 3RUZA 4DNIA 1EOVA 3I91A 4X66Q 4AYBE 1V1QA 1Q8IA 2JA6G 4A3GG 3L0OA 4R8NA 3TP7A 4PQXA 2PI2E 1I94Q 2NN6G 2UXCL 3OW7A 3PUVA 3S9WA 2LFNA 1NMGA 2NB0A 2E2IH 1N32Q 4X3UA 4KHZA 1HCZA 1JQYD 1PFBA 1P8LA 3L2PA 1TY0A 3QIAA 4IUPA 2G9DA 2C9OA 5H1SE 5C3EG 2PI2A 3D6WA 3OTOL 1X9NA 3K7UC 3PV0A 4FF3A 1B50A 2ZM6Q 1IBML 2VNUD 1SBBB 4DV5Q 4JC0A 5M3MH 1LTGD 1RCVD 1ZKOA 1AH9A 4RCOA 4N9PA 2AMCB 3J7AF 1DZ1A 5E4WC 5IODA 1VQ4A 1B44D 3K0YA 3Q24A 4X3SA 2Z1CA 3PO3G 1KTKA 2KJXA 2F0OA 1K83H 2F0FA 1A8VA 3C1FA 5E4XA 4A3CH 4DR1Q 4R4TA 5E1FA 3DMUA 3CXCA 1N36L 4IPCA 2HDMA 1H9MA 1K0SA 1K28A 3VR6A 2UXDQ 1V1PB 3A54A 3H3VC 5IGDA 1SAPA 1DOMA 2WACA 3NK9A 1XXGA 3AMUA 4KHPL 1LLRD 4L6TB 1VQ6A 4FF2A 2EJGC 3GTPB 1O7YA 1U4MA 2FXQA 1XNQQ 4A3DG 3N52A 4MN3A 5LL6S 2IW3A 4DK0A 4FXDA 2HIVA 1NR2A 1PTOF 1I50H 3RZOH 4JOIC 2RKSA 4DV0Q 1JJGA 5K36G 4P75A 1JE5A 4G7HC 5LMUL 4HJ7A 1R4QB 4ALPA 2VQEL 5FO9B 2KHIA 4LF7L 3E0EA 4DV4L 3KBGA 4JPBW 1QWYA 5IE8A 1XPUA 1TWHH 4R4QA 5IP9G 4IOCA 2KOLA 1O7ZA 1BCPC 3BVMA 3D4RA 4QJFA 5C44B 5D14A 1NSNS 3S16H 1C48A 1HNXL 3HOXH 3GP7A 3PUZA 1QVGA 2F0GA 1FGUA 3ND8A 3W1GA 1TWCH 1ZYRC 3KJOA 5G3LD 1D1KA 5IYBH 3D4DA 4DR4L 1LUZA 3F2CA 3SK8A 1WJJA 3K8AA 4B3ML 1SRUA 1E2VA 2Q2UA 1D2BA 5E3FA 2CW0C 3SDZA 2QEJC 2J0TD 5M3MB 2ZTCA 4CKBA 3K81C 1J5EL 3A8JE 3CPFA 3S2HB 3PF5A 1MI2A 4ZYSA 4JI7L 5DM73 2AUJD 2MHVA 4DV6L 4BXXG 1XJVA 1KLUD 1TS3A 2R7ZH 4EQOA 5C0XG 4JI8L 1X56A 4C3HB 4AQYL 2R6GA 3BDLA 1VQDA 2GVBA 1SR3A 1K83B 1F9RA 3J7A5 1LTSD 1O7IA 2E75C 1HJPA 4X65Q 3RN5A 4HIMA 4DR3Q 5COYA 1QOHA 2F0QA 2OQ0A 3V05A 3J7ZC 3EN2A 3A7LA 3U4VA 1WTXA 1Q81C 3J81j 4A3KG 1TXYA 2F4IA 3BVGA 1VQLA 3SHLA 1U4PA 1A0IA 1VQ7A 1I4GA 3J80i 1KDAA 5JJLA 2JEAI 2CH4W 3M7NA 1X6OA 1K3BC 3UDFA 5IYDG 4G4KA 3M85A 4H13C 4LAAA 2K28A 4DUZL 2L1BA 1VQBA 4NMZA 1KD1C 3D0FA 1H9SB 3CC7A 1SE3A 3PIO3 2E2HH 1M8AA 1Q7YC 1WTHA 3KK7A 2CH4A 1NUCA 2YTYA 1P16A 1LTAD 2WIIB 1SDFA 1PH1A 1X65A 5I2YA 1PFSA 3A7AB 5EBCA 1HUMA 3RLNA 1PYWD 3OPOA 4RAUC 4X3KA 5CV8A 3H6MA 3KUPA 5EKKA 4A3BB 1TWHB 3S1MB 5IIFA 1QG7A 2PQAB 3I4NG 1PLFA 1YNND 4CJ1B 4F87A 5A2QL 4QIWB 4M8AA 4R8IA 2R92H 2JA8H 3S16B 5JPNC 2VZAA 2E76C 3VYTA 4GLAC 5C3WA 3HGBA 1PH4A 1CSPA 3GTKB 1BBXC 4KN7C 2DN8A 1I4PA 1SMYC 2DNCA 3FPPA 4LMQD 4B08A 3T4AC 3GTOH 2FMCA 3NE5B 1GO3E 2D2CC 1B3AA 2PW7A 1UNSA 1VDZA 2MJ8A 4UY8C 2UXBQ 1Q82C 4NXNQ 4N9TA 3JAML 5JEAJ 2HQEA 1E3PA 5AFWA 1J6QA 1JWMD 4A3LH 2B8FA 3GTQH 3LWUA 4DN4M 5IY0A 2IX3A 2E5LL 2PMZE 1NCVA 1GOZA 3K0XA 1F2ZA 1DCZA 3J80E 5M3MG 2OCEA 4N8FA 1OXUA 5CMDA 3FMCA 4LF4Q 5CV9A 2KBNA 1X3EA 3V96A 2ID0A 3CC4A 4KTAA 1MHWC 2F0HA 5FLMG 2K01A 4C3HG 3STBD 1TQOA 2A6ED 3KJPA 3MA2B 1CKOA 3R2IA 3J81L 2KCTA 1UWVA 4A3CG 1E1TA 2NVTH 3CU7A 3TZDA 2HIXA 4ZCKA 4Y7NH 1YNJD 2EVBA 1IHZA 4HEDA 2NVYH 1CSQA 4KHVA 4QF4A 3PF4A 4DNTB 4OGQC 4LUZA 2K75A 2UUAL 1WFQA 5KYLA 3K5NA 1CA6A 4ZKBB 4CDDC 2KHJA 2Z9HA 3IAYA 3MXNA 4XTCS 4GOPC 4RGNA 3BJUA 1A3TA 1QNUA 1Y1WH 1TS4A 1FR3A 1YJNA 2HCCA 3NSWA 3HOZH 4JI3Q 1EU4A 1SEBD 1SYGA 3E0JA 4HCEA 4DV1Q 2UUCQ 2JA8B 2B63H 1IL8A 2BA1A 2ZXRA 3OW2A 4OEMB 2Q8TA 1KRSA 3VR2A 3HEJA 3KLSA 2M2LA 3HOXG 4DV7L 2D62A 2IX1A 3ERSX 2O2LD 1XX8A 4IPDA 1V1OA 2NZ1D 4Q5VA 4LF9Q 4JBJA 3NHHA 2JA5B 5IYBG 2Z6KC 3M7GA 2R7FA 2NVXB 4NXMQ 1WTWA 1PTOH 3GTMH 1UEAB 2F3VA 5KNBA 4BY1H 1V9PA 4K6DA 1YBYA 4FYDA 4K14A 1EY6A 2GN5A 4ZUIA 3U9OA 1M90C 2XWBB 1L0YB 4RH6A 4LF8L 2BH2A 2VQFQ 5LMNQ 2KEEA 2RDFA 2F0NA 2K5VA 2X69A 4GN4B 3M3YH 2EYLA 3AFQA 3T53B 1C4QA 3VA7A 2R7ZG 1C0AA 3UI2A 4K0KQ 1A3UA 4YY3L 1EY7A 3J80c 5EGTA 1PH7A 3WOEA 2L0CA 1S4ZA 3TN2A 2RDHA 1TIID 5HY6A 1EEID 3QJYA 4F7XA 5JVH3 2ZXPA 4Y7NB 1WOCA 4B3SQ 1PH9A 4I7ZC 3PIOA 5ELBA 3A55A 1TR5A 1Z6HA 2C35B 2B2TC 2QDBA 3QG1A 1BCPF 4IFDG 4JI6Q 3FKIB 4IQZA 1YHBA 4JBKA 1CHQD 3CF5A 1W2BA 2A6HD 4K6LA 4DXFA 2Q8IB 1QVFA 1VQMA 3SE0A 1E22A 1S5DD 3B6YA 2FHTA 5EKIA 5IWAQ 1Y1WB 2E2DC 1EZ6A 4NP5A 4KV6A 1PH5A 1UE1A 4JCVE 4A3JH 3RN2A 2F0EA 1SNDA 3OOCA 3EROA 4J8QA 1TWGB 4EQPA 1KLGD 1F9SA 1Z9FA 1EY9A 3GTJB 4F8MA 1BF4A 2R92G 1SNCA 1TWFB 2JA8G 2K52A 1MBYA 4DA2A 5EBDA 3SXHA 4A76A 4IUNA 4P73A 5M5WH 3E5SA 2K5DA 4DAPA 1S5ED 1L2FA 4DNRB 1SYCA 1GJXA 3NTKA 4P2CB 4MTKA 5J22A 3EVQA 1PV4A 1IW7D 2B2WA 4HIDA 1UE7A 1FL0A 1CZWA 3X3MA 5FLXL 2YU9H 5LL6X 1SFOH 2XRSD 3KDFB 2JA5G 4YWLA 3CCQA 3A0JA 4X66L 2QILA 4C3IH 3TBIB 3BZDB 1SMXA 1I94L 1RHPA 1RTOA 3FPUB 3FVQA 4OX9Q 4X62Q 3QOLA 5KIXA 5A2QE 4A3LG 1NR4A 1N32L 1HTLD 3RR5A 1ICFB 4KN4C 1YEZA 5C3EB 4HN7A 4S3SA 5C4XH 1VMCA 1GUGA 2ZM6L 2I07B 2JN4A 4DV5L 3F1ZA 4XYQA 5M9OA 3S1QB 2OF1A 1SYFA 4X3TA 2QA4A 2KENA 1GVPA 4R9WA 1J8IA 2F0SA 3S2DH 3I3CA 5CV5A 3Q0AA 1A6XA 1EZ8A 3OIQA 3KBXA 4UAIA 1E24A 4DR1L 2F4VQ 2F0WA 5T1GA 1W6JA 3PO2H 1I6HB 2UXDL 4JK1C 4CDFC 4IN3A 2HHHQ 4TSSA 2JA7H 1KIXA 2UU9Q 2FFKB 4IUUA 1IYUA 3TP6A 4BS9A 4N8X1 5EJWA 1XNQL 1AE3A 3HFZB 4OL7A 1EWHA 3QR8A 4C56C 1Y1WG 1LT3D 5I6YA 2A5HA 3HOZG 5IT9c 1HA5A 5GAGC 3KDFA 2A68D 4QQBX 2TMPA 1RJTA 1DONA 5T1IA 2B63G 2BOSA 1H95A 2MO0A 2PYKA 4DXGA 3CC2A 3EFXD 1VQAA 5GADC 2EZVA 2K5HA 1B2TA 2VUMH 5FO8B 5CORA 2MUYA 1PYSB 3BZKA 1YNNC 3K6OA 3MXPA 3TS0A 2HUGA 3W2DA 1ILPA 4P71A 5ELCA 4ME3A 2B39A 4C3IB 2BDNA 5LHY1 1V8QA 3HOYH 4BY1G 4JVZA 1ENCA 1IBKQ 2C5CA 2B2VA 3C46A 4OO1I 4OO1H 2MFIA 1SLJA 4BBSH 4LFBQ 2R61A 4PV1C 1HH2P 1B8AA 5C4XB 1MKHA 1WTQA 1GM5A 4K8JA 2RBMA 4BBRB 4LUVA 2JYOA 1RDPD 1HRJA 1PZJD 2RF4A 2AWOA 1VQHA 1PTOD 1VQPA 2TSSA 3U9SA 2ICEC 3GTGH 2EYPA 1R9TH 3AU7A 1U4RA 1PYBA 3QWNA 3RMHA 1EQTA 1Y1VH 1OTCA 3MZ5A 4GNXB 1EWCA 4QUCA 3H15A 1KRTA 2B2UA 4X65L 2XWJB 1MJEA 4DR3L 1S72A 4HMIA 1ICWA 3STBC 2OQKA 4UHVA 3H3VI 4IUVA 3MHBA 4BY7B 4HMJA 1UE6A 4A3KB 3K7AH 1WCMH 4PZ7A 1U5KA 2HCIA 4KJNA 3S1NB 3M4YA 1GUNA 3M4OH 2AHOB 1CA5A 3UE0A 1G291 4OIKA 4UDUC 3S17B 2L4NA 1WD0A 2L11A 3S15H 2SNMA 3CCMA 5JJZA 4G7OC 4JBWA 4A3JG 4DV2Q 3UDXA 2YTXA 4RA8A 2KUMA 1OXXK 1L0WA 3Q22A 4K2LA 2K5NA 1YI2A 1X3QA 1YJ9A 2VUMB 3OSOA 2K6AA 4RHRA 2ZJPA 2IT1A 1XMQQ 1QB5D 3I4NB 5EPJA 5JJIA 3Q8DA 3WWVA 4MIUA 2BH8A 3CCVA 2LMCB 5FKAC 1CTMA 3NEMA 1SE2A 4C3JH 5M5XB 3RLOA 3CCSA 2PNHA 1X32A 1DOKA 1ESFA 2DUDA 4K5VA 1CKMA 2N49A 1O80A 2AQ3B 2K04A 1JB3A 4C3IG 3IL8A 1U4LA 1MSHA 2E8GA 3N6RA 2F0KA 3ERQA 1EYGA 2P5ZX 2UXBL 1VQCA 2E2IB 4NXNL 5IGCA 4GNXA 3HOVH 4P72A 3VR4A 4ODGA 2N78A 4IPGA 1L0XB 1AEXA 4IUTA 4NB3A 4JYAQ 5C4XG 1STGA 1RTNA 1XNRQ 2ZJRA 3KLWA 3NENA 4BBRG 3IRBA 4KKTA 4OWXB 4YWMA 1ESRA 2ICIA 1YVCA 4V190 1STYA 1QZGA 4QL5A 5KRUA 1G91A 1GUTA 1SROA 3HS0C 4LF4L 4HR7B 3AB9A 4GKJQ 1GKHA 3FRPB 3D31A 3EQLC 1C9OA 2H1EA 3FDTA 1AZPA 3I4MH 1XPRA 4A3FH 1KNAA 2PPBC 3K7AB 3NP8A 3WOFA 1A2UA 3IFDA 1B70B 3G48A 2KEDA 3LNNA 5M5YH 4POGA 2Z4IA 2JJQA 1K9MC 5F2DA 3M4OB 4BY7G 2G5DA 1GD7A 1NTGA 5EAYA 1PH2A 2A8VA 2M00A 5JVG3 3ER0A 3H0GH 2KCCA 3F2BA 1N33Q 4BA1I 2PMZB 1SNPA 3L3OC 1JJCB 2B2YA 2IY5B 2A6HC 4XQNA 1I50B 1HTPA 3RZOB 3MVVA 1JICA 2MQHA 1LACA 4MZ9A 4K2KA 1STBA 1HQMC 1TY2A 3KLSX 2O5IC 1F9QA 5G3LF 3PUXA 3I72A 1Y8OB 4JI3L 2PZTA 4DV1L 2UUCL 1HHVA 3K59A 1I6VC 3OMGA 2PNRC 3MC0B 5CGKA 2VUMG 1EQRA 2EYFA 3HOUH 4OHJA 3KFUA 4YIJA 5KGUA 3W1BA 4C3JB 1FGBD 2EY2A 1HZAA 3M9BA 3TS2A 4XIGS 4I7AA 3HOXB 1EQVA 3MTSA 1WTPA 1OXSC 1HR0Q 4U673 4JI1Q 1X3PA 4LF9L 1BBUA 3MXNB 2AQ2B 1TWCB 3OIPA 2B3GA 1XPOA 1EQQA 3HG9A 4NXML 4BBSG 5I9OA 3UE1A 1HZ9A 4TVAB 1IW7C 2M9VA 3TREA 2Q8RE 4ZAIA 3TDQA 3C3LA 2NWGA 5AJ3Q 1TWAH 2QF7A 2JA9A 1KHIA 2MO1A 2K1BA 2AUKA 5DAUA 3DWQA 5ELFA 4A3IH 1LT6D 3DHQA 2VQFL 5LMNL 2F1MA 1H9RA 3QB3A 5C4ZA 4K5XA 3Q6SA 4ZQ3A 1BVSA 4LFCQ 1QVCA 2R7ZB 4XQQA 4K0KL 3M4PA 5GAEC 4X64Q 4CKEA 1Y1VG 1ENFA 4XDXA 1YHAA 1JT8A 2I5LX 2RCFA 1FVIA 2DGYA 2F3WA 4FF1A 4C1NK 3I56A 2SDFA 1WYDA 4B3SL 4H02A 5M5YB 1DXMA 3OWEB 1T5EA 4FXKC 4DV3Q 1D5MC 2RHQB 3RD4A 2J4XA 3TSSA 3T1HQ 2BA0A 4XQJA 1SNOA 1WCMG 4JI0Q 5HURA 1YJWA 3WDNA 1N9WA 1I4XA 2I5MX 3H0GB 4JI6L 3NXWA 5D3IB 5IOCA 3KLRA 5GROA 4B9WA 4LUOA 1Y69U 1K8AC 1AE2A 4JI8Q 3MEHA 1EIGA 1SNMA 3MAQA 2B2WC 5IWAL 3SK4A 3R2TA 1EY4A 5C0XJ 1VF7A 3PGZA 4EGVA 2E2HB 2SNSA 4A75A 2XGTA 3J7YW 4A3EH 2ENBA 1VQKA 5EKLA 2NVQH 1F77A 1K3RA 4YHHQ 3NQIA 1B3QA 1U9RA 3EJIA 2R92B 4MNOA 3ND9A 1CT1D 2A68C 5NUCA 4HIKA 2NZOA 2NZHA 3HOWH 4C3JG 5C4JH 3GTLH 4IZ8A 1GUOA 3R3OA 4CJ0B 2OWOA 4FNFA 4GLVB 1EY5A 3GTOB 3ULLA 1D8LA 2N8NA 3R8BA 1ASYA 4WORA 5L37A 2OT2A 1MIUA 1FNWA 1D5ZC 1RD9D 3A8IE 5A35A 3CQZH 3F8TA 4LJZC 4Z9CB 4KY6A 1PRTB 2KA7A 4OIJA 2FMMA 4HTHA 1B53A 1BKBA 4B3TQ 2N3SA 3HOVG 5KNCA 1F9PA 2DNEA 4OX9L 3G6JB 3L9AX 1B9NA 2B8GA 2AQ1B 1RL2A 1LTID 5IGEA 3KOJA 1HR0W 1NMFA 1J9OA 3GTQB 4ILWA 1LT5D 4HJAA 3S14H 1ASZA 3E9HA 3I8ZA 4H0LC 2EYOA 4IJLA 3K5MA 4B3RQ 3P1HA 3TP8A 2CQAA 2QGQA 3G7LA 4DGZA 1U0LA 2K05A 4WJ3M 4PMCA 1VQGA 1R4PB 3A5UA 4LW1A 4DKAC 3SK6A 1II3A 3I4MG 2JA6H 1XWEA 4A3FG 2NUCA 2Y0SG 4HCSA 4DR2Q 1HUNA 2NVTB 4E6IA 4K8IA 4JI2Q 1KAAA 1EYCA 2NVYB 1MJCA 2F4VL 3VYRA 4LF5Q 3KF6B 1E2WA 1LO5D 4PMBA 1I3QH 3DEPA 3S24A 1GXDC 4CGYB 2HHHL 5IGBA 3H0GG 2UU9L 2F0MA 1SSOA 4JI5Q 1KABA 5JJKA 3EBEA 3ONAB 2WFWA 3T1YQ 1ZEQX 1STEA 2K4KA 1DYQA 2CKZB 1B1ZA 3U4ZA 4LF6Q 3C1EA 2B2VC 2YTVA 1PH8A 3A56A 1KNEA 1LYLA 4PZ6A 4PMWA 2CWAA 1QJOA 3HOZB 2D0PA 4CJ2C 3T56B 3SVMA 3TMEA 3JAMi 2OTJA 2R3ZA 1O7LA 3C2PA 3RNUA 4KY5A 1VQ9A 2B63B 3I55A 2I46A 3DM1A 3HOUG 3GTLB 2EDGA 2K33A 2EYJA 2ZTEA 3DUZA 1PDQA 2CFMA 1HNZQ 1EIFA 4EQNA 5I6WA 5FK9C 4XT1B 4JI4Q 4IO9A 4A93H 3BVZA 3BS1A 1ZXTA 4QUFA 5BN5A 4A3DH 2VY3A 4GS3A 2KCMA 4A4IA 1SXTA 1PTOB 3GTMB 3S1RH 1M4VA 4BY1B 3RZDH 3J81i 1IBKL 1LV9A 1QE6A 5J3BA 2XNAC 3X3NA 1WTOA 2B2UC 3CHBD 4LFBL 3CW2C 1K73C 5IGGA 5JEAH 4UPAA 3FP9A 5JAVA 4A3IG 2VB2X 3PQIA 2O5JC 5ELOA 1I5FA 1G6ZA 1LM0A 2A69D 5DNFA 3P20A 3M3YB 4DK1A 1Y8PB 3KF6A 4NDXA 3D8GA 1QNKA 5C4HA 1CFMA 2WKDA 4G7ZC 2CCZA 1CI3M 1X54A 1ILQA 3FHWA 4XT3B 2X6GA 5M3FH 1IKLA 1SE8A 3H94A 5BN4A 2NTSA 1Y14B 2RCNA 1HXYD 1PRTD 5JPMC 1JWSD 1I4HA 4ZUJA 3M4QA 5LMNW 1ET6A 3PSIA 2F0PA 4B9XA 4QMGA 3JAME 1I3QB 4RFBA 4DU9A 1DJRD 2MP1A 1VQ8A 1DM0B 4WFN3 3URYA 2RQXA 4JV5Q 2BE5D 3A5ZB 4JG2A 4ZLTF 1IKMA 4R4OA 1G51A 4DAYB 1JCKB 1JMCA 4BWGB 2B29A 1MD2D 4RHSA 4UP7A 1VQJA 2PZUA 1LTBD 2ES2A 4A3EG 4ZKCB 4DV2L 2F0TA 4A3JB 5DEHA 5DLQE 1FNUA 3GV3A 3NTHA 2I0QA 3J81E 2PCFB 1D6EC 1EFWA 4GNXC 4GLXA 4DV0L 4QCLA 2HT1A 1YZ6A 4DR5Q 4O2DA 5CV7A 4OXPA 3MFGA 2ZJQA 1XMQL 5D3DA 2F03A 4A93B 2RVLA 5K5PA 1Q1EA 4IFDJ 4HSVA 5CR3A 5M5WB 1IZ6A 4RGOS 3PUWA 5IYDH 1F2YA 1PVOA 1ONLA 1CQVA 2YU9B 4FVMA 2AWNA 2WKCA 1SYDA 3A8KE 5EPLA 5FO7B 3RZDB 1RKNA 1SFOB 3DM3A 1AW7A 1CZGA 2XIWA 1SYBA 4IURA 4HJ8A 2QCPX 1IBLQ 5J1ZA 1Q46A 2YYZA 4O1NA 2BCOA 4IJHA 4R4CA 5IGFA 3IKJA 2EPBA 2UUBQ 4UP8A 2JQOA 4DR6Q 5BR8Q 3ZYYX 1WTVA 5GAHC 2N88A 4DUYQ 4JYAL 2CVRA 1XNRL 4UP9A 1VQ5A 2DJFC 3P7JA 3H91A 5C44H 4DAYA 2LXKA 4X6AH 3U50C 4CDEC 3BYYB 4CKCA 3UDGA 3DLLA 2B2YC 3BDCA 3HKSA 3OHXC 2D9UA 4OONA 5C5MA 4R1JA 1C8CA 4GKJL 1HFGA 1VF5C 2SEBD 2K5WA 3S2DB 1YITA 1JWUD 4BA2I 1W6KA 1L1OA 1BO0A 3KF8B 5ELDA 1MSGA 1VMPA 3HKZB 2XN9C 4DK6C 4KY7A 1JORA 3PUYA 3PO2B 4GKKQ 5HGQA 4KD3A 2ALYB 1RODA 3JAMc 2A6EC 3H3VH 1GHKA 2PW5A 2JA7B 2EQSA 2GVAA 3D6CA 1AP0A 4TKOB 4EQ5A 2CQOA 2EYMA 3S2HH 1JE4A 1F2LA 4P74A 1HNWQ 1N33L 1DGSA 1YNJC 4LK1C 5J39A 1Q8KA 1XMOQ 1VQNA 1SN8A 1WI5A 2A1AA 1VS0A 2JEBI 1A15A 1HPCA 3W3AA 4KKUA 4A3MH 5FLMH 1N34Q 4C3HH 4IUQA 3GQBA 3CKIB 2MNAA 1TKWB 4DPGA 4JW0A 4AYBG 4QY7A 5I9PA 3K5OA 1JJ2A 2RHSB 4YCWA 1G6PA 2OEOA 4RG1A 4IOAA 1JOOA 3E9IA 3J81c 1D7QA 2N55A 1UUPA 3I70A 5FOBB 2RDGA 2PO4A 1PZID 4A93G 2E2JH 2MPMA 4H7BA 3OMCA 1BQQT 1HR0L 2Z6BA 2Q2TA 4JI1L 2WP8J 2EXDA 3HOYB 2NBFA 3JC66 4RKLA 1PMRA 2F0JA 2L15A 3DEOA 5GQOA 4BBSB 4KK7A 3HKZE 3AFPA 3E6ZX 4LFAQ 1EUJA 5JEAG 1HZCA 5AJ3L 2PQEA 3NTIA 3KF8A 4A3BH 3S1MH 1LTRD 1STNA 1V43A 4DR7Q 1BBWA 2RSNA 1FJGQ 2D5DA 1QCBD 1QUQB 2JXMB 1AN8A 1KC8C 4LFCL 5M3FG 5FJ8H 2Z8LA 3FEWX 3VA5A 3GTKH 1G2TA 2QKIC 3GTGB 1R9TB 3GV6A 1PA6A 1I4RA 4X64L 2R7DA 5FLXE 1Y1VB 3ULPA 1B4OA 1NJIC 2ZT9C 5IP7H 4LWCA 5CC4A 3PIP3 4J6HA 1JOKA 1KL9A 2UXCQ 2L12A 2IX0A 2H4OA 1Q90A 3ZJYC 2JP1A 4AH6A 4PZ8A 4WRDA 4DV3L 3T1HL 2OTLA 3HKZG 4HJ9A 1FD7D 4JI0L 4KMUC 1WCMB 1T9HA 1ENAA 3PO2G 2PZWA 1V1PA 3BU2A 3OTOQ 4AIMA 2EIFA 2KVMA 3ICEA 1IBMQ 2JA7G 4H44C 1YHQA 2BDOA 1SYEA 4A3MB 3L7ZC 2CWPA 3S15B 5IT9L 1Q86C 1EYAA 4POFA 4APVA 3CD6A 3CAMA 1LABA 4K5WA 5CBAE 1E7ZA 1UAPA 2V1CC 2EJMA 4YHHL 3NPPA 1N36Q 4DAVA 2D0OA 2JE6I 3HP3A 4J15A 1BCPB 4IFDI 4RWSC 1X3FA 4IFDH 3UDIA 2ASBA 2E2JB 1CHPD 1D5XC 2F0DA 4KJOA 4L5RC 2F52A 2KCNA 2LSSA 4MTNA 3NELA 5KEEA 4KHPQ 1NBWA 4CBVA 1QUQA 3IFTA 1S5BD 2Z4HA 4OWTB 1H9KA 2LXJA 4I65A 4YWKA
chains in the Genus database with same CATH topology
2QA4A 2UXDQ 4HJAA 3S14H 1ASZA 2KENA 3E9HA 1GVPA 3HOYG 3S2DH 4IJLA 4B3RQ 3SGIA 4OO1G 5LMUQ 4B3TL 2JK8A 1E24A 2QGQA 4KHPL 1U0LA 1VQ6A 3BZCA 2VQEQ 3CMAA 4WJ3M 4DR1L 2F4VQ 2FXQA 1XNQQ 1VQGA 4A3DG 4LF7Q 3TRZA 3A5UA 4DV4Q 4LW1A 3CCLA 3PO2H 2UXDL 4DKAC 2HIVA 3GD7A 1I50H 3RZOH 4JOIC 4DV0Q 2HHHQ 3I4MG 2JA6H 1JJGA 3RLFA 2JA7H 4A3FG 1KIXA 5C44G 4B3RL 2UU9Q 2Y0SG 4P75A 4DR2Q 5K36G 1A63A 1JE5A 5LMUL 1HNXQ 4HJ7A 4JI2Q 4ALPA 2VQEL 1MJCA 2F4VL 4LF5Q 2KHIA 3KF6B 1XNQL 1AE3A 4Y52H 3HFZB 4LF7L 1I3QH 3E0EA 4DV4L 2JA5H 3S24A 5IE8A 1Y1WG 1XPUA 1TWHH 4R4QA 5IP9G 4IOCA 2NVXH 4JOIA 3U58A 2HHHL 3HOZG 3H0GG 5IT9c 4DR4Q 4QJFA 5FLXc 5GAGC 1M1KC 4DR2L 3KDFA 2UU9L 4JI5Q 4GN5A 3OYYA 3S16H 4QQBX 1HNXL 1OXVA 3HOXH 4B3MQ 5JJKA 3EBEA 2B63G 2WFWA 4JI2L 1H95A 3T1YQ 2MO0A 1N8RC 3PUZA 2K4KA 4IPHA 3CC2A 4LF5L 1QVGA 2CKZB 1FGUA 1VQAA 2A19A 3U4ZA 3W1GA 5GADC 4LF6Q 1TWCH 2K5HA 2VUMH 2VL6A 4C2MH 1XTDA 3KJOA 1J5EQ 5IYBH 2YTVA 1PH8A 3K80C 4PZ6A 1LYLA 4PMWA 1PYSB 1IYJB 3BZKA 2CWAA 4JI7Q 4DR4L 1LUZA 2D0PA 3F2CA 3GDEA 1WJJA 4DV6Q 4JI5L 2K14A 3TS0A 3K8AA 3JAMi 4JBMA 2OTJA 4B3ML 3ULJA 1SRUA 2IHFA 3RNUA 4P71A 4YCVA 3T1YL 3I55A 4A3MG 1VQ9A 2Q2UA 3HOUG 4ME3A 4AQYQ 3HOYH 4LF6L 4BY1G 2ZTCA 2ZTEA 5IYCH 3K81C 1NE3A 3CPFA 3LGJA 1J5EL 3PF5A 3TEHB 1IBKQ 4OO1I 2CFMA 1HNZQ 2MFIA 1EIFA 1IXRA 1SLJA 4BBSH 4JI7L 4LFBQ 4QIWE 3CCEA 3I4OA 1A62A 4DK3C 4DV6L 4JI4Q 4IO9A 4A93H 4BXXG 1XJVA 1HH2P 1B8AA 5C0XG 1PHJA 3G6EA 2R7ZH 4A3DH 2VY3A 4JI8L 4GS3A 1X56A 2KCMA 4A4IA 2R93H 1MKHA 2PQAA 4AQYL 2R6GA 1GM5A 1VQDA 4LUVA 2GVBA 1SR3A 3S1RH 2RF4A 3I7FA 2AWOA 1VQHA 3FKIH 3J7A5 3RZDH 3J81i 1IBKL 5J3BA 3VDYA 1O7IA 1HNZL 3G4SA 4LFBL 1HJPA 3CW2C 4X65Q 3RN5A 4JI4L 1K73C 4HIMA 1VQPA 4DR3Q 4DUZQ 2OQ0A 4UPAA 3FP9A 4A3IG 3J7ZC 3EN2A 3U4VA 1Q81C 5ELOA 3GTGH 3J81j 4A3KG 1I5FA 1R9TH 1PYBA 1LM0A 1TXYA 1VQLA 4FDBA 1OTCA 1Y1VH 1A0IA 1VQ7A 2HQLA 1JB7A 2Y0SE 3GO5A 3J80i 4GNXB 3KF6A 5JJLA 2JEAI 3KYHC 3M7NA 1LTLA 1X6OA 2CCZA 1KQSA 3H15A 1X54A 1KRTA 3UDFA 4X65L 3FHWA 5IYDG 2I5HA 1MJEA 4A3BG 1TWGH 3M85A 4DR3L 4DUZL 5M3FH 1S72A 1SE8A 3STBC 1VQBA 2YV5A 3PIPA 2OQKA 1Y14B 1KD1C 3H3VI 2RCNA 3GTJH 4X62L 1UE6A 3D0FA 1TWFH 3K7AH 1Q12A 1WCMH 4PZ7A 3CC7A 1U5KA 2E2HH 1Q7YC 5FJ8G 3M4OH 2AHOB 2YTYA 1P16A 3M4QA 1G291 3UE0A 5LMNW 1PH1A 1X65A 3PSIA 1PFSA 4LNQA 1NMFA 1RIPA 3RLNA 3TQYA 2VS1A 2Q2HA 1VQ8A 1PH6A 3CCJA 3I4NG 2PQAB 4GN3B 3S15H 4JV5Q 3CCMA 2F3IA 1VQIA 3A5ZB 4JG2A 4JBWA 5IP7G 4R4OA 1G51A 4A3JG 4DV2Q 2JA8H 2R92H 1CKNB 2VZAA 2YTXA 3UDXA 4DAYB 2ZTDA 1OXXK 1L0WA 4GLAC 1PH4A 1CSPA 2QEXA 1JMCA 2B29A 2K5NA 1YI2A 4A3GH 4UP7A 2H5XA 1YJ9A 1QZHA 2NN6I 1Z47A 3GTOH 2ZJPA 2IT1A 1XMQQ 4L5SA 1VQJA 4JV5L 5ELNA 2WAQE 2E5LQ 5JJIA 3EIVA 1GO3E 3Q8DA 2ES2A 3WWVA 4A3EG 4DV2L 2BH8A 5DLQE 3CCVA 2I0QA 3NEMA 5C3EH 2XTIA 3AEVA 1EFWA 4UY8C 2UXBQ 4C3JH 1Q82C 3RLOA 3CCSA 4GNXC 4GLXA 4DV0L 1PH3A 4NXNQ 1YZ6A 2HT1A 2PNHA 4DR5Q 4O2DA 5JEAJ 1B7YB 2DUDA 3S1QH 2IHEA 1E3PA 4OXPA 1J6QA 4GOPB 1VQOA 1EWIA 2ZJQA 1XMQL 4A3LH 1CKMA 2N49A 3GTQH 1KXLA 4KLKA 5IY0A 3G71A 2E5LL 2PMZE 3K0XA 1Q1EA 4IFDJ 5M3MG 2E8GA 1IZ6A 2OCEA 1OXUA 3PUWA 1EYGA 5IYDH 2UXBL 1VQCA 4NXNL 1S40A 4GNXA 1X3GA 4DR5L 1PVOA 3HOVH 3PO3H 4P72A 4LF4Q 3CMEA 1E1OA 4R4IA 1K8GA 2AWNA 1OXTA 2N78A 2KBNA 4IPGA 1X3EA 3CC4A 2ID0A 3DM3A 4NB3A 4JYAQ 5C4XG 5FLMG 1I6HH 1XNRQ 2ZJRA 3STBD 3KLWA 3NENA 4BBRG 4HJ8A 3IRBA 4OWXB 1IBLQ 4YWMA 3KJPA 4O0AA 2UUAQ 1CKOA 1Q46A 2YYZA 2KCTA 1YVCA 4IJHA 1UWVA 4A3CG 2WAQG 4R4CA 1E1TA 4QGUA 1QZGA 3CP0A 2NVTH 4QL5A 2HIXA 4Y7NH 1EIYB 1SROA 2UUBQ 2AKWB 4UP8A 1K0RA 4LF4L 2JQOA 4DR6Q 2NVYH 1CSQA 5BR8Q 4GKJQ 3PF4A 1GKHA 2WB1E 5GAHC 4DUYQ 4JYAL 1XNRL 4UP9A 3D31A 3NBHB 1L1OC 3CCUA 1C9OA 1VQ5A 1IBLL 4LUZA 2K75A 2UUAL 1WFQA 3I4MH 1XPRA 1Q1BA 1CKNA 4A3FH 5C44H 1X55A 1YIJA 2LXKA 4X6AH 3U50C 1HZBA 1UEBA 1S3OA 2KHJA 4YCUA 3DLLA 3UDGA 1B70B 3G48A 2UUBL 5M5YH 4DR6L 4POGA 3HKSA 2JJQA 1K9MC 2K50A 4OONA 4R1JA 5BR8L 4XTCS 4GKJL 4BY7G 4DUYL 1YITA 1GD7A 1NTGA 4GOPC 5EAYA 1HR0W 3BJUA 1PH2A 2A8VA 1Y1WH 4BA2I 5IP9H 1L1OA 4DV7Q 4WJ4A 4OWWB 3ER0A 1YJNA 3KF8B 4RMFA 3MEFA 3HOZH 3H0GH 3F2BA 1N33Q 1KAWA 4JI3Q 4BA1I 4DV1Q 4DK6C 2UUCQ 1JJCB 3PUYA 2B63H 4GKKQ 5HGQA 2BA1A 2IY5B 3OW2A 1YNXA 2MQHA 2ALYB 3JAMc 1NY4A 4MZ9A 1KRSA 3H3VH 1IL2A 1CUKA 2EQSA 2GVAA 4GOPA 4L5QA 4EQ5A 3HOXG 2CQOA 4DV7L 3S2HH 2D62A 2WB1G 4P74A 3CCRA 3PUXA 3ERSX 2IX1A 1HNWQ 1N33L 1DGSA 4JI3L 4IPDA 4DV1L 1Q8KA 1XMOQ 2UUCL 4LF9Q 1VQNA 2JEBI 1SN8A 1WI5A 1VS0A 2A1AA 4JBJA 4LF8Q 2VUMG 4GKKL 1EQRA 5IYBG 4A3MH 2Z6KC 5FLMH 2R7FA 1N34Q 3HOUH 4C3HH 3KFUA 3W1BA 4NXMQ 2MNAA 4BBRH 3GTMH 1HZAA 4BY1H 3M9BA 3TS2A 4DPGA 1V9PA 4XIGS 1YBYA 3CPWA 4AYBG 4HIOA 4KI0A 1OXSC 1HNWL 4QY7A 4YY3Q 1HR0Q 2GN5A 1M90C 3AQQA 1JJ2A 2RHSB 4YCWA 4JI1Q 4RG1A 1XMOL 1BBUA 4LF9L 3E9IA 4BXXH 3MXNB 3J81c 5C0XI 4LF8L 4IOAA 2BH2A 1D7QA 2VQFQ 5LMNQ 2B3GA 5IYCG 1XPOA 1EQQA 1N34L 2Z6KA 4NXML 4BBSG 1L1OB 3UE1A 2K5VA 3M3YH 4GN4B 1HZ9A 4TVAB 4A93G 3W5OA 2E2JH 4TQUS 3TREA 3AFQA 2R7ZG 1C0AA 4HJ5A 4K0KQ 5AJ3Q 1TWAH 4YY3L 2JA9A 4DAMA 1HR0L 2R93G 1KHIA 2MO1A 3J80c 2Q2TA 4JI1L 1PH7A 2WP8J 2EXDA 4A3IH 1W3SA 2VQFL 5LMNL 4BY7H 3JC66 3FKIG 5HY6A 3I2ZA 2L15A 4A3KH 5GQOA 3A74A 3HOWG 1BVSA 3HKZE 1WOCA 3AFPA 4LFAQ 1EUJA 1N36L 4B3SQ 4LFCQ 3S1NH 5JEAG 1QVCA 1HZCA 1PH9A 3PIOA 4K0KL 3S17H 5AJ3L 3M4PA 5GAEC 2VW9A 4X64Q 3PCOB 1Y1VG 4A3BH 3S1MH 2C35B 1V43A 1YHAA 4NPSA 1JT8A 2I5LX 4DR7Q 1FVIA 2DGYA 1BBWA 1VCIA 4JI6Q 1FJGQ 4IFDG 3GTPH 1QUQB 1YHBA 3I56A 1KC8C 4JBKA 3CF5A 3AYHB 1W2BA 4EX5A 1WYDA 4B3SL 4LFAL 4H02A 4LFCL 1QVFA 1VQMA 5M3FG 2ATWA 5FJ8H 3GTKH 1E22A 1UE5A 1VQEA 4L5TA 3B6YA 4DV3Q 2RHQB 3T1HQ 5IWAQ 2BA0A 1PA6A 4X64L 1WCMG 2R7DA 1YJWA 4JI0Q 3I4NH 3ULPA 1PH5A 4DR7L 1NJIC 1N9WA 2I5MX 3F2DA 4JI6L 1FJGL 1UE1A 4JCVE 5IP7H 4LWCA 3RN2A 4A3JH 5GROA 4LUOA 1VQFA 1KL9A 2Z0SA 1K8AC 1AE2A 2Q2IA 4JI8Q 2UXCQ 2IX0A 5M5XH 4PG3A 1Z9FA 4DV3L 3ZJYC 4AH6A 1C7YA 4PZ8A 3T1HL 5E7NA 3HKZG 4HJ9A 5IWAL 2OTLA 2R92G 5C0XJ 2JA8G 2K52A 4JI0L 3PGZA 4DNIA 1T9HA 3PO2G 1EOVA 3BU2A 3OTOQ 4AIMA 2EIFA 4A75A 2XGTA 4X66Q 3ICEA 4AYBE 1V1QA 4A76A 1IBMQ 4A3EH 2JA6G 4A3GG 3L0OA 2JA7G 1YHQA 4P73A 5M5WH 1VQKA 2PI2E 1K3RA 1I94Q 2NVQH 4YHHQ 1L2FA 2NN6G 2UXCL 3PUVA 2E2IH 1NMGA 3L7ZC 1N32Q 2CWPA 1PV4A 4HIDA 1UE7A 1FL0A 4KHZA 1Q86C 1P8LA 4APVA 4POFA 3L2PA 2YU9H 3CD6A 3CAMA 1SFOH 4MNOA 3KDFB 2JA5G 5H1SE 5C3EG 2PI2A 3OTOL 1X9NA 3K7UC 3PV0A 4YWLA 2NZOA 2NZHA 1E7ZA 3A0JA 5C4JH 3CCQA 4X66L 4HIKA 2ZM6Q 1IBML 3GTLH 4C3IH 2VNUD 4DV5Q 2V1CC 4JC0A 2OWOA 1SMXA 5M3MH 1I94L 4OX9Q 4GLVB 4YHHL 4X62Q 4A3LG 1G6PA 1AH9A 3ULLA 1D8LA 1N36Q 1N32L 2D0OA 2JE6I 2N8NA 2AMCB 3RR5A 1ASYA 4J15A 4IFDI 1MIUA 1X3FA 3UDIA 2ASBA 1VQ4A 3CQZH 3F8TA 1YEZA 5C4XH 4L5RC 2F52A 2ZM6L 2LSSA 1BKBA 4MTNA 4DV5L 3F1ZA 4B3TQ 2N3SA 3NELA 3HOVG 3PO3G 3HOWH 1K83H 1NBWA 4OX9L 1QUQA 4KHPQ 1A8VA 4A3CH 4DR1Q 1RL2A 4OWTB 4R4TA 3CXCA 3KOJA 4IPCA 2LXJA 4YWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 A;  2UXD Q;  4HJA A;  3S14 H;  1ASZ A;  2KEN A;  3E9H A;  1GVP A;  3HOY G;  3S2D H;  4IJL A;  4B3R Q;  3SGI A;  4OO1 G;  5LMU Q;  4B3T L;  2JK8 A;  1E24 A;  2QGQ A;  4KHP L;  1U0L A;  1VQ6 A;  3BZC A;  2VQE Q;  3CMA A;  4WJ3 M;  4DR1 L;  2F4V Q;  2FXQ A;  1XNQ Q;  1VQG A;  4A3D G;  4LF7 Q;  3TRZ A;  3A5U A;  4DV4 Q;  4LW1 A;  3CCL A;  3PO2 H;  2UXD L;  4DKA C;  2HIV A;  3GD7 A;  1I50 H;  3RZO H;  4JOI C;  4DV0 Q;  2HHH Q;  3I4M G;  2JA6 H;  1JJG A;  3RLF A;  2JA7 H;  4A3F G;  1KIX A;  5C44 G;  4B3R L;  2UU9 Q;  2Y0S G;  4P75 A;  4DR2 Q;  5K36 G;  1A63 A;  1JE5 A;  5LMU L;  1HNX Q;  4HJ7 A;  4JI2 Q;  4ALP A;  2VQE L;  1MJC A;  2F4V L;  4LF5 Q;  2KHI A;  3KF6 B;  1XNQ L;  1AE3 A;  4Y52 H;  3HFZ B;  4LF7 L;  1I3Q H;  3E0E A;  4DV4 L;  2JA5 H;  3S24 A;  5IE8 A;  1Y1W G;  1XPU A;  1TWH H;  4R4Q A;  5IP9 G;  4IOC A;  2NVX H;  4JOI A;  3U58 A;  2HHH L;  3HOZ G;  3H0G G;  5IT9 c;  4DR4 Q;  4QJF A;  5FLX c;  5GAG C;  1M1K C;  4DR2 L;  3KDF A;  2UU9 L;  4JI5 Q;  4GN5 A;  3OYY A;  3S16 H;  4QQB X;  1HNX L;  1OXV A;  3HOX H;  4B3M Q;  5JJK A;  3EBE A;  2B63 G;  2WFW A;  4JI2 L;  1H95 A;  3T1Y Q;  2MO0 A;  1N8R C;  3PUZ A;  2K4K A;  4IPH A;  3CC2 A;  4LF5 L;  1QVG A;  2CKZ B;  1FGU A;  1VQA A;  2A19 A;  3U4Z A;  3W1G A;  5GAD C;  4LF6 Q;  1TWC H;  2K5H A;  2VUM H;  2VL6 A;  4C2M H;  1XTD A;  3KJO A;  1J5E Q;  5IYB H;  2YTV A;  1PH8 A;  3K80 C;  4PZ6 A;  1LYL A;  4PMW A;  1PYS B;  1IYJ B;  3BZK A;  2CWA A;  4JI7 Q;  4DR4 L;  1LUZ A;  2D0P A;  3F2C A;  3GDE A;  1WJJ A;  4DV6 Q;  4JI5 L;  2K14 A;  3TS0 A;  3K8A A;  3JAM i;  4JBM A;  2OTJ A;  4B3M L;  3ULJ A;  1SRU A;  2IHF A;  3RNU A;  4P71 A;  4YCV A;  3T1Y L;  3I55 A;  4A3M G;  1VQ9 A;  2Q2U A;  3HOU G;  4ME3 A;  4AQY Q;  3HOY H;  4LF6 L;  4BY1 G;  2ZTC A;  2ZTE A;  5IYC H;  3K81 C;  1NE3 A;  3CPF A;  3LGJ A;  1J5E L;  3PF5 A;  3TEH B;  1IBK Q;  4OO1 I;  2CFM A;  1HNZ Q;  2MFI A;  1EIF A;  1IXR A;  1SLJ A;  4BBS H;  4JI7 L;  4LFB Q;  4QIW E;  3CCE A;  3I4O A;  1A62 A;  4DK3 C;  4DV6 L;  4JI4 Q;  4IO9 A;  4A93 H;  4BXX G;  1XJV A;  1HH2 P;  1B8A A;  5C0X G;  1PHJ A;  3G6E A;  2R7Z H;  4A3D H;  2VY3 A;  4JI8 L;  4GS3 A;  1X56 A;  2KCM A;  4A4I A;  2R93 H;  1MKH A;  2PQA A;  4AQY L;  2R6G A;  1GM5 A;  1VQD A;  4LUV A;  2GVB A;  1SR3 A;  3S1R H;  2RF4 A;  3I7F A;  2AWO A;  1VQH A;  3FKI H;  3J7A 5;  3RZD H;  3J81 i;  1IBK L;  5J3B A;  3VDY A;  1O7I A;  1HNZ L;  3G4S A;  4LFB L;  1HJP A;  3CW2 C;  4X65 Q;  3RN5 A;  4JI4 L;  1K73 C;  4HIM A;  1VQP A;  4DR3 Q;  4DUZ Q;  2OQ0 A;  4UPA A;  3FP9 A;  4A3I G;  3J7Z C;  3EN2 A;  3U4V A;  1Q81 C;  5ELO A;  3GTG H;  3J81 j;  4A3K G;  1I5F A;  1R9T H;  1PYB A;  1LM0 A;  1TXY A;  1VQL A;  4FDB A;  1OTC A;  1Y1V H;  1A0I A;  1VQ7 A;  2HQL A;  1JB7 A;  2Y0S E;  3GO5 A;  3J80 i;  4GNX B;  3KF6 A;  5JJL A;  2JEA I;  3KYH C;  3M7N A;  1LTL A;  1X6O A;  2CCZ A;  1KQS A;  3H15 A;  1X54 A;  1KRT A;  3UDF A;  4X65 L;  3FHW A;  5IYD G;  2I5H A;  1MJE A;  4A3B G;  1TWG H;  3M85 A;  4DR3 L;  4DUZ L;  5M3F H;  1S72 A;  1SE8 A;  3STB C;  1VQB A;  2YV5 A;  3PIP A;  2OQK A;  1Y14 B;  1KD1 C;  3H3V I;  2RCN A;  3GTJ H;  4X62 L;  1UE6 A;  3D0F A;  1TWF H;  3K7A H;  1Q12 A;  1WCM H;  4PZ7 A;  3CC7 A;  1U5K A;  2E2H H;  1Q7Y C;  5FJ8 G;  3M4O H;  2AHO B;  2YTY A;  1P16 A;  3M4Q A;  1G29 1;  3UE0 A;  5LMN W;  1PH1 A;  1X65 A;  3PSI A;  1PFS A;  4LNQ A;  1NMF A;  1RIP A;  3RLN A;  3TQY A;  2VS1 A;  2Q2H A;  1VQ8 A;  1PH6 A;  3CCJ A;  3I4N G;  2PQA B;  4GN3 B;  3S15 H;  4JV5 Q;  3CCM A;  2F3I A;  1VQI A;  3A5Z B;  4JG2 A;  4JBW A;  5IP7 G;  4R4O A;  1G51 A;  4A3J G;  4DV2 Q;  2JA8 H;  2R92 H;  1CKN B;  2VZA A;  2YTX A;  3UDX A;  4DAY B;  2ZTD A;  1OXX K;  1L0W A;  4GLA C;  1PH4 A;  1CSP A;  2QEX A;  1JMC A;  2B29 A;  2K5N A;  1YI2 A;  4A3G H;  4UP7 A;  2H5X A;  1YJ9 A;  1QZH A;  2NN6 I;  1Z47 A;  3GTO H;  2ZJP A;  2IT1 A;  1XMQ Q;  4L5S A;  1VQJ A;  4JV5 L;  5ELN A;  2WAQ E;  2E5L Q;  5JJI A;  3EIV A;  1GO3 E;  3Q8D A;  2ES2 A;  3WWV A;  4A3E G;  4DV2 L;  2BH8 A;  5DLQ E;  3CCV A;  2I0Q A;  3NEM A;  5C3E H;  2XTI A;  3AEV A;  1EFW A;  4UY8 C;  2UXB Q;  4C3J H;  1Q82 C;  3RLO A;  3CCS A;  4GNX C;  4GLX A;  4DV0 L;  1PH3 A;  4NXN Q;  1YZ6 A;  2HT1 A;  2PNH A;  4DR5 Q;  4O2D A;  5JEA J;  1B7Y B;  2DUD A;  3S1Q H;  2IHE A;  1E3P A;  4OXP A;  1J6Q A;  4GOP B;  1VQO A;  1EWI A;  2ZJQ A;  1XMQ L;  4A3L H;  1CKM A;  2N49 A;  3GTQ H;  1KXL A;  4KLK A;  5IY0 A;  3G71 A;  2E5L L;  2PMZ E;  3K0X A;  1Q1E A;  4IFD J;  5M3M G;  2E8G A;  1IZ6 A;  2OCE A;  1OXU A;  3PUW A;  1EYG A;  5IYD H;  2UXB L;  1VQC A;  4NXN L;  1S40 A;  4GNX A;  1X3G A;  4DR5 L;  1PVO A;  3HOV H;  3PO3 H;  4P72 A;  4LF4 Q;  3CME A;  1E1O A;  4R4I A;  1K8G A;  2AWN A;  1OXT A;  2N78 A;  2KBN A;  4IPG A;  1X3E A;  3CC4 A;  2ID0 A;  3DM3 A;  4NB3 A;  4JYA Q;  5C4X G;  5FLM G;  1I6H H;  1XNR Q;  2ZJR A;  3STB D;  3KLW A;  3NEN A;  4BBR G;  4HJ8 A;  3IRB A;  4OWX B;  1IBL Q;  4YWM A;  3KJP A;  4O0A A;  2UUA Q;  1CKO A;  1Q46 A;  2YYZ A;  2KCT A;  1YVC A;  4IJH A;  1UWV A;  4A3C G;  2WAQ G;  4R4C A;  1E1T A;  4QGU A;  1QZG A;  3CP0 A;  2NVT H;  4QL5 A;  2HIX A;  4Y7N H;  1EIY B;  1SRO A;  2UUB Q;  2AKW B;  4UP8 A;  1K0R A;  4LF4 L;  2JQO A;  4DR6 Q;  2NVY H;  1CSQ A;  5BR8 Q;  4GKJ Q;  3PF4 A;  1GKH A;  2WB1 E;  5GAH C;  4DUY Q;  4JYA L;  1XNR L;  4UP9 A;  3D31 A;  3NBH B;  1L1O C;  3CCU A;  1C9O A;  1VQ5 A;  1IBL L;  4LUZ A;  2K75 A;  2UUA L;  1WFQ A;  3I4M H;  1XPR A;  1Q1B A;  1CKN A;  4A3F H;  5C44 H;  1X55 A;  1YIJ A;  2LXK A;  4X6A H;  3U50 C;  1HZB A;  1UEB A;  1S3O A;  2KHJ A;  4YCU A;  3DLL A;  3UDG A;  1B70 B;  3G48 A;  2UUB L;  5M5Y H;  4DR6 L;  4POG A;  3HKS A;  2JJQ A;  1K9M C;  2K50 A;  4OON A;  4R1J A;  5BR8 L;  4XTC S;  4GKJ L;  4BY7 G;  4DUY L;  1YIT A;  1GD7 A;  1NTG A;  4GOP C;  5EAY A;  1HR0 W;  3BJU A;  1PH2 A;  2A8V A;  1Y1W H;  4BA2 I;  5IP9 H;  1L1O A;  4DV7 Q;  4WJ4 A;  4OWW B;  3ER0 A;  1YJN A;  3KF8 B;  4RMF A;  3MEF A;  3HOZ H;  3H0G H;  3F2B A;  1N33 Q;  1KAW A;  4JI3 Q;  4BA1 I;  4DV1 Q;  4DK6 C;  2UUC Q;  1JJC B;  3PUY A;  2B63 H;  4GKK Q;  5HGQ A;  2BA1 A;  2IY5 B;  3OW2 A;  1YNX A;  2MQH A;  2ALY B;  3JAM c;  1NY4 A;  4MZ9 A;  1KRS A;  3H3V H;  1IL2 A;  1CUK A;  2EQS A;  2GVA A;  4GOP A;  4L5Q A;  4EQ5 A;  3HOX G;  2CQO A;  4DV7 L;  3S2H H;  2D62 A;  2WB1 G;  4P74 A;  3CCR A;  3PUX A;  3ERS X;  2IX1 A;  1HNW Q;  1N33 L;  1DGS A;  4JI3 L;  4IPD A;  4DV1 L;  1Q8K A;  1XMO Q;  2UUC L;  4LF9 Q;  1VQN A;  2JEB I;  1SN8 A;  1WI5 A;  1VS0 A;  2A1A A;  4JBJ A;  4LF8 Q;  2VUM G;  4GKK L;  1EQR A;  5IYB G;  4A3M H;  2Z6K C;  5FLM H;  2R7F A;  1N34 Q;  3HOU H;  4C3H H;  3KFU A;  3W1B A;  4NXM Q;  2MNA A;  4BBR H;  3GTM H;  1HZA A;  4BY1 H;  3M9B A;  3TS2 A;  4DPG A;  1V9P A;  4XIG S;  1YBY A;  3CPW A;  4AYB G;  4HIO A;  4KI0 A;  1OXS C;  1HNW L;  4QY7 A;  4YY3 Q;  1HR0 Q;  2GN5 A;  1M90 C;  3AQQ A;  1JJ2 A;  2RHS B;  4YCW A;  4JI1 Q;  4RG1 A;  1XMO L;  1BBU A;  4LF9 L;  3E9I A;  4BXX H;  3MXN B;  3J81 c;  5C0X I;  4LF8 L;  4IOA A;  2BH2 A;  1D7Q A;  2VQF Q;  5LMN Q;  2B3G A;  5IYC G;  1XPO A;  1EQQ A;  1N34 L;  2Z6K A;  4NXM L;  4BBS G;  1L1O B;  3UE1 A;  2K5V A;  3M3Y H;  4GN4 B;  1HZ9 A;  4TVA B;  4A93 G;  3W5O A;  2E2J H;  4TQU S;  3TRE A;  3AFQ A;  2R7Z G;  1C0A A;  4HJ5 A;  4K0K Q;  5AJ3 Q;  1TWA H;  4YY3 L;  2JA9 A;  4DAM A;  1HR0 L;  2R93 G;  1KHI A;  2MO1 A;  3J80 c;  2Q2T A;  4JI1 L;  1PH7 A;  2WP8 J;  2EXD A;  4A3I H;  1W3S A;  2VQF L;  5LMN L;  4BY7 H;  3JC6 6;  3FKI G;  5HY6 A;  3I2Z A;  2L15 A;  4A3K H;  5GQO A;  3A74 A;  3HOW G;  1BVS A;  3HKZ E;  1WOC A;  3AFP A;  4LFA Q;  1EUJ A;  1N36 L;  4B3S Q;  4LFC Q;  3S1N H;  5JEA G;  1QVC A;  1HZC A;  1PH9 A;  3PIO A;  4K0K L;  3S17 H;  5AJ3 L;  3M4P A;  5GAE C;  2VW9 A;  4X64 Q;  3PCO B;  1Y1V G;  4A3B H;  3S1M H;  2C35 B;  1V43 A;  1YHA A;  4NPS A;  1JT8 A;  2I5L X;  4DR7 Q;  1FVI A;  2DGY A;  1BBW A;  1VCI A;  4JI6 Q;  1FJG Q;  4IFD G;  3GTP H;  1QUQ B;  1YHB A;  3I56 A;  1KC8 C;  4JBK A;  3CF5 A;  3AYH B;  1W2B A;  4EX5 A;  1WYD A;  4B3S L;  4LFA L;  4H02 A;  4LFC L;  1QVF A;  1VQM A;  5M3F G;  2ATW A;  5FJ8 H;  3GTK H;  1E22 A;  1UE5 A;  1VQE A;  4L5T A;  3B6Y A;  4DV3 Q;  2RHQ B;  3T1H Q;  5IWA Q;  2BA0 A;  1PA6 A;  4X64 L;  1WCM G;  2R7D A;  1YJW A;  4JI0 Q;  3I4N H;  3ULP A;  1PH5 A;  4DR7 L;  1NJI C;  1N9W A;  2I5M X;  3F2D A;  4JI6 L;  1FJG L;  1UE1 A;  4JCV E;  5IP7 H;  4LWC A;  3RN2 A;  4A3J H;  5GRO A;  4LUO A;  1VQF A;  1KL9 A;  2Z0S A;  1K8A C;  1AE2 A;  2Q2I A;  4JI8 Q;  2UXC Q;  2IX0 A;  5M5X H;  4PG3 A;  1Z9F A;  4DV3 L;  3ZJY C;  4AH6 A;  1C7Y A;  4PZ8 A;  3T1H L;  5E7N A;  3HKZ G;  4HJ9 A;  5IWA L;  2OTL A;  2R92 G;  5C0X J;  2JA8 G;  2K52 A;  4JI0 L;  3PGZ A;  4DNI A;  1T9H A;  3PO2 G;  1EOV A;  3BU2 A;  3OTO Q;  4AIM A;  2EIF A;  4A75 A;  2XGT A;  4X66 Q;  3ICE A;  4AYB E;  1V1Q A;  4A76 A;  1IBM Q;  4A3E H;  2JA6 G;  4A3G G;  3L0O A;  2JA7 G;  1YHQ A;  4P73 A;  5M5W H;  1VQK A;  2PI2 E;  1K3R A;  1I94 Q;  2NVQ H;  4YHH Q;  1L2F A;  2NN6 G;  2UXC L;  3PUV A;  2E2I H;  1NMG A;  3L7Z C;  1N32 Q;  2CWP A;  1PV4 A;  4HID A;  1UE7 A;  1FL0 A;  4KHZ A;  1Q86 C;  1P8L A;  4APV A;  4POF A;  3L2P A;  2YU9 H;  3CD6 A;  3CAM A;  1SFO H;  4MNO A;  3KDF B;  2JA5 G;  5H1S E;  5C3E G;  2PI2 A;  3OTO L;  1X9N A;  3K7U C;  3PV0 A;  4YWL A;  2NZO A;  2NZH A;  1E7Z A;  3A0J A;  5C4J H;  3CCQ A;  4X66 L;  4HIK A;  2ZM6 Q;  1IBM L;  3GTL H;  4C3I H;  2VNU D;  4DV5 Q;  2V1C C;  4JC0 A;  2OWO A;  1SMX A;  5M3M H;  1I94 L;  4OX9 Q;  4GLV B;  4YHH L;  4X62 Q;  4A3L G;  1G6P A;  1AH9 A;  3ULL A;  1D8L A;  1N36 Q;  1N32 L;  2D0O A;  2JE6 I;  2N8N A;  2AMC B;  3RR5 A;  1ASY A;  4J15 A;  4IFD I;  1MIU A;  1X3F A;  3UDI A;  2ASB A;  1VQ4 A;  3CQZ H;  3F8T A;  1YEZ A;  5C4X H;  4L5R C;  2F52 A;  2ZM6 L;  2LSS A;  1BKB A;  4MTN A;  4DV5 L;  3F1Z A;  4B3T Q;  2N3S A;  3NEL A;  3HOV G;  3PO3 G;  3HOW H;  1K83 H;  1NBW A;  4OX9 L;  1QUQ A;  4KHP Q;  1A8V A;  4A3C H;  4DR1 Q;  1RL2 A;  4OWT B;  4R4T A;  3CXC A;  3KOJ A;  4IPC A;  2LXJ A;  4YWK A; 
#chains in the Genus database with same CATH topology
 3T51 B;  3MXU A;  3HOY G;  1G8Z D;  1SE4 A;  3SGI A;  3F2U A;  4OO1 G;  3T13 A;  5LMU Q;  4B3T L;  2JK8 A;  3HOV B;  1XYI A;  3BZC A;  4XXE A;  2VQE Q;  3CMA A;  1A3V A;  1GUW A;  4LF7 Q;  3TRZ A;  1HQR D;  2G9H D;  2ZXO A;  4DV4 Q;  1AZQ A;  3CCL A;  3NWT A;  3GD7 A;  3RLF A;  3K58 A;  3NBI A;  4B3R L;  5C44 G;  1A63 A;  1I4Q A;  2A69 C;  1HNX Q;  4ZK9 B;  5CBE E;  4RGT A;  3O13 A;  3HRZ C;  1EY0 A;  2WV6 D;  4Y52 H;  2F0L A;  3SEB A;  2JA5 H;  3VR3 A;  1MGS A;  4ME5 A;  3J7A V;  2EY6 A;  3CRK C;  2NVX H;  3V2T A;  2CHB D;  4JOI A;  3U58 A;  4DR4 Q;  3NWS A;  3I4M B;  5FLX c;  4A3F B;  4DR2 L;  1M1K C;  1PXU A;  3OYY A;  3QO2 A;  2Y0S B;  4GN5 A;  5DM6 3;  1PRT C;  2LKV A;  1OXV A;  4B3M Q;  1WD1 A;  2XSC A;  4JI2 L;  1N8R C;  1TS5 A;  3D3R A;  4IPH A;  1GUS A;  4LF5 L;  2A19 A;  2VL6 A;  4C2M H;  1XTD A;  1J5E Q;  4OEL B;  3K80 C;  2KEC A;  1IYJ B;  2A74 C;  4JI7 Q;  4EVO A;  3GDE A;  5KND A;  4DV6 Q;  4ID6 A;  2BE5 C;  2K14 A;  4JI5 L;  4JBM A;  3ULJ A;  1CK1 A;  2IHF A;  3MXG A;  1OO9 B;  4YCV A;  3T1Y L;  4A3M G;  4XYO A;  2X6L A;  1T5X D;  4AQY Q;  4QB4 A;  3BYT B;  3I73 A;  2L55 A;  5C5L A;  4LF6 L;  1H9S A;  2HDL A;  5IYC H;  1NE3 A;  3LGJ A;  3DXJ C;  3TEH B;  1IXR A;  3D4W A;  4QIW E;  3CCE A;  3I4O A;  1A62 A;  2JSO A;  4DK3 C;  3NQT A;  1PHJ A;  4CHT B;  3G6E A;  3PMF A;  3HOU B;  2R93 H;  1F2M A;  2PQA A;  5C3X A;  3HZX A;  1ET9 A;  3I7F A;  3MFY A;  3FKI H;  3ITP A;  2WAQ B;  3I90 A;  3VDY A;  4M1U B;  1HNZ L;  1ML0 D;  3OWF A;  1S5F D;  3G4S A;  1A2T A;  2EE1 A;  1BNZ A;  4JI4 L;  1TVX A;  4DUZ Q;  2J7Z A;  2NYZ D;  1O78 A;  3NUC A;  3VYS A;  2RSO A;  4FDB A;  2HQL A;  1JB7 A;  1E2Z A;  2Y0S E;  3GO5 A;  3KYH C;  1LTL A;  1KQS A;  1PZK D;  1EIH A;  1TWA B;  2I5H A;  4A3B G;  1TWG H;  2L5T A;  1BCP D;  3PIP A;  2YV5 A;  1TT2 A;  4A3I B;  1K8O A;  2XVS A;  3GTJ H;  4X62 L;  1B9M A;  1TWF H;  5TSS A;  1Q12 A;  2EY5 A;  4MHE A;  5FJ8 G;  5I2X A;  4HAE A;  4LNQ A;  1RF2 D;  1ZYR D;  1RIP A;  2F0U A;  3TQY A;  2VS1 A;  2NTT A;  4ABN A;  1EFI D;  2A73 B;  2Q2H A;  1H9J A;  1PH6 A;  1SJE D;  4U68 A;  3CCJ A;  4GN3 B;  1HFN A;  3T16 A;  2F3I A;  1VQI A;  2GA4 B;  5IP7 G;  1CKN B;  5BN3 A;  2ZTD A;  4ZRZ A;  1EYD A;  2WB1 B;  1PTO C;  4HSP A;  2DY8 A;  2CW0 D;  2QEX A;  5CYU A;  4A3G H;  2H5X A;  2RA4 A;  4FF4 A;  5D65 A;  1EOT A;  4C2M B;  1QZH A;  2NN6 I;  1Z47 A;  4DF7 A;  2NN6 H;  1NNX A;  4L5S A;  1WTR A;  4JV5 L;  3TP5 A;  5ELN A;  2WAQ E;  5I4D A;  2E5L Q;  3EIV A;  2K7V A;  2EY1 A;  5C3E H;  2XTI A;  3AEV A;  1EL0 A;  3BDO A;  2FIN B;  2VB3 X;  2DJG C;  1PH3 A;  2K03 A;  1TU2 B;  1XTC D;  1B7Y B;  2EXZ A;  3S1Q H;  2IHE A;  4G57 A;  1VQO A;  4GOP B;  1EWI A;  3VR5 A;  1DOL A;  1KXL A;  4KLK A;  2LS0 1;  1EU3 A;  3G71 A;  4A3E B;  3BG3 A;  2NVQ B;  2FJ2 A;  5C6A A;  2R93 B;  4ULL A;  1S40 A;  4KKS A;  1X3G A;  4DR5 L;  2K5Q A;  3PO3 H;  3CME A;  3P75 A;  1E1O A;  1SJH D;  1STA A;  4R4I A;  1K8G A;  1OXT A;  2L9H A;  4RCN A;  1IYV A;  4PNY A;  2K32 A;  5HGT A;  1I6H H;  3HOW B;  5C4J B;  5EPK A;  3EA6 A;  4O0A A;  2UUA Q;  4TRD A;  2WAQ G;  5IT9 E;  4QGU A;  3CP0 A;  4Q0F A;  2F0V A;  2WIN B;  1EIY B;  2AKW B;  4CDC C;  1K0R A;  5ELE A;  2OXP A;  1AFP A;  4FO2 A;  1JR0 D;  2WB1 E;  3CQZ B;  1PFM A;  2EJF C;  3E3X A;  3NBH B;  3LWE A;  1L1O C;  3CCU A;  1STH A;  1IBL L;  3QOJ A;  1S5C D;  3H09 A;  1Q1B A;  1CKN A;  2O4X A;  5K36 H;  1X55 A;  1YIJ A;  3DWP A;  1CM9 A;  1Z7T A;  1HZB A;  1UEB A;  1S3O A;  2UUB L;  4YCU A;  4DR6 L;  3S14 B;  2K50 A;  2HD3 A;  2KQ3 A;  5BR8 L;  4DUY L;  1SMY D;  1Q3L A;  5IP9 H;  4DV7 Q;  1NAP A;  4WJ4 A;  4OWW B;  1LT4 D;  1JC7 A;  4RMF A;  3MEF A;  1KAW A;  3TZU A;  1BXT A;  5CV4 A;  1G2S A;  2F0I A;  2EOT A;  2IPK D;  1YNX A;  1NY4 A;  1D1I A;  2IJ0 A;  2JA6 B;  4A3G B;  1IL2 A;  1JOQ A;  1CUK A;  4GOP A;  1KDB A;  1TS2 A;  4O42 A;  4L5Q A;  1EEF D;  2QDL A;  4GZY C;  1SNQ A;  1Y8N B;  2WB1 G;  4C1N I;  3CCR A;  4LF8 Q;  2V4D A;  4GKK L;  3Q23 A;  4BBR H;  2EYH A;  1DD2 A;  1BR9 A;  1CQF A;  3CPW A;  4DFA A;  1FNV A;  2MGS A;  4HIO A;  4KI0 A;  4V0B A;  1HNW L;  4YY3 Q;  3AQQ A;  1EY8 A;  1XMO L;  4BXX H;  1E0B A;  3SR1 A;  5C0X I;  5C0X H;  5CV6 A;  3SK5 A;  3VYU A;  4KD4 A;  5IYC G;  2XRQ D;  1N34 L;  2Z6K A;  1WVL A;  1L1O B;  1KDC A;  3PO3 B;  3W5O A;  4TQU S;  2SOB A;  4RKB A;  4AYB B;  1GHJ A;  3NBH A;  4HJ5 A;  4DAM A;  4J1M A;  2R93 G;  2E74 C;  2LY7 A;  4NKL A;  4FP5 D;  3CRL C;  1K8M A;  3K57 A;  2VXW A;  2QW7 A;  4F88 A;  1W3S A;  4BY7 H;  3FKI G;  3I2Z A;  4A3K H;  5JOB A;  3K5L A;  3A74 A;  3HOW G;  1HA6 A;  3S1N H;  1BDO A;  2IL8 A;  3LX0 A;  4A3D B;  3S17 H;  2VW9 A;  5EQ0 A;  1FYC A;  3PCO B;  5KYI A;  1PFN A;  2KHS A;  4NPS A;  3S1R B;  1BUV T;  1VCI A;  3MWY W;  3GTP H;  4L8J A;  3R93 A;  1PRT F;  3AYH B;  4EX5 A;  4WJW A;  4LFA L;  5ISR A;  2DY7 A;  2ATW A;  1QIL A;  1UE5 A;  1VQE A;  4L5T A;  4IAL A;  2IWH A;  3I4N H;  2B2T A;  1LTT D;  4NW2 A;  4DR7 L;  3F2D A;  1FJG L;  3DWA A;  4RGM A;  3I4L A;  1VQF A;  1BOS A;  2Z0S A;  2Q2I A;  3J80 L;  4L63 B;  5M5X H;  4PG3 A;  4FXG C;  5M3F B;  1C7Y A;  5E7N A;  3RUZ A;  4DNI A;  1EOV A;  3I91 A;  4X66 Q;  4AYB E;  1V1Q A;  1Q8I A;  2JA6 G;  4A3G G;  3L0O A;  4R8N A;  3TP7 A;  4PQX A;  2PI2 E;  1I94 Q;  2NN6 G;  2UXC L;  3OW7 A;  3PUV A;  3S9W A;  2LFN A;  1NMG A;  2NB0 A;  2E2I H;  1N32 Q;  4X3U A;  4KHZ A;  1HCZ A;  1JQY D;  1PFB A;  1P8L A;  3L2P A;  1TY0 A;  3QIA A;  4IUP A;  2G9D A;  2C9O A;  5H1S E;  5C3E G;  2PI2 A;  3D6W A;  3OTO L;  1X9N A;  3K7U C;  3PV0 A;  4FF3 A;  1B50 A;  2ZM6 Q;  1IBM L;  2VNU D;  1SBB B;  4DV5 Q;  4JC0 A;  5M3M H;  1LTG D;  1RCV D;  1ZKO A;  1AH9 A;  4RCO A;  4N9P A;  2AMC B;  3J7A F;  1DZ1 A;  5E4W C;  5IOD A;  1VQ4 A;  1B44 D;  3K0Y A;  3Q24 A;  4X3S A;  2Z1C A;  3PO3 G;  1KTK A;  2KJX A;  2F0O A;  1K83 H;  2F0F A;  1A8V A;  3C1F A;  5E4X A;  4A3C H;  4DR1 Q;  4R4T A;  5E1F A;  3DMU A;  3CXC A;  1N36 L;  4IPC A;  2HDM A;  1H9M A;  1K0S A;  1K28 A;  3VR6 A;  2UXD Q;  1V1P B;  3A54 A;  3H3V C;  5IGD A;  1SAP A;  1DOM A;  2WAC A;  3NK9 A;  1XXG A;  3AMU A;  4KHP L;  1LLR D;  4L6T B;  1VQ6 A;  4FF2 A;  2EJG C;  3GTP B;  1O7Y A;  1U4M A;  2FXQ A;  1XNQ Q;  4A3D G;  3N52 A;  4MN3 A;  5LL6 S;  2IW3 A;  4DK0 A;  4FXD A;  2HIV A;  1NR2 A;  1PTO F;  1I50 H;  3RZO H;  4JOI C;  2RKS A;  4DV0 Q;  1JJG A;  5K36 G;  4P75 A;  1JE5 A;  4G7H C;  5LMU L;  4HJ7 A;  1R4Q B;  4ALP A;  2VQE L;  5FO9 B;  2KHI A;  4LF7 L;  3E0E A;  4DV4 L;  3KBG A;  4JPB W;  1QWY A;  5IE8 A;  1XPU A;  1TWH H;  4R4Q A;  5IP9 G;  4IOC A;  2KOL A;  1O7Z A;  1BCP C;  3BVM A;  3D4R A;  4QJF A;  5C44 B;  5D14 A;  1NSN S;  3S16 H;  1C48 A;  1HNX L;  3HOX H;  3GP7 A;  3PUZ A;  1QVG A;  2F0G A;  1FGU A;  3ND8 A;  3W1G A;  1TWC H;  1ZYR C;  3KJO A;  5G3L D;  1D1K A;  5IYB H;  3D4D A;  4DR4 L;  1LUZ A;  3F2C A;  3SK8 A;  1WJJ A;  3K8A A;  4B3M L;  1SRU A;  1E2V A;  2Q2U A;  1D2B A;  5E3F A;  2CW0 C;  3SDZ A;  2QEJ C;  2J0T D;  5M3M B;  2ZTC A;  4CKB A;  3K81 C;  1J5E L;  3A8J E;  3CPF A;  3S2H B;  3PF5 A;  1MI2 A;  4ZYS A;  4JI7 L;  5DM7 3;  2AUJ D;  2MHV A;  4DV6 L;  4BXX G;  1XJV A;  1KLU D;  1TS3 A;  2R7Z H;  4EQO A;  5C0X G;  4JI8 L;  1X56 A;  4C3H B;  4AQY L;  2R6G A;  3BDL A;  1VQD A;  2GVB A;  1SR3 A;  1K83 B;  1F9R A;  3J7A 5;  1LTS D;  1O7I A;  2E75 C;  1HJP A;  4X65 Q;  3RN5 A;  4HIM A;  4DR3 Q;  5COY A;  1QOH A;  2F0Q A;  2OQ0 A;  3V05 A;  3J7Z C;  3EN2 A;  3A7L A;  3U4V A;  1WTX A;  1Q81 C;  3J81 j;  4A3K G;  1TXY A;  2F4I A;  3BVG A;  1VQL A;  3SHL A;  1U4P A;  1A0I A;  1VQ7 A;  1I4G A;  3J80 i;  1KDA A;  5JJL A;  2JEA I;  2CH4 W;  3M7N A;  1X6O A;  1K3B C;  3UDF A;  5IYD G;  4G4K A;  3M85 A;  4H13 C;  4LAA A;  2K28 A;  4DUZ L;  2L1B A;  1VQB A;  4NMZ A;  1KD1 C;  3D0F A;  1H9S B;  3CC7 A;  1SE3 A;  3PIO 3;  2E2H H;  1M8A A;  1Q7Y C;  1WTH A;  3KK7 A;  2CH4 A;  1NUC A;  2YTY A;  1P16 A;  1LTA D;  2WII B;  1SDF A;  1PH1 A;  1X65 A;  5I2Y A;  1PFS A;  3A7A B;  5EBC A;  1HUM A;  3RLN A;  1PYW D;  3OPO A;  4RAU C;  4X3K A;  5CV8 A;  3H6M A;  3KUP A;  5EKK A;  4A3B B;  1TWH B;  3S1M B;  5IIF A;  1QG7 A;  2PQA B;  3I4N G;  1PLF A;  1YNN D;  4CJ1 B;  4F87 A;  5A2Q L;  4QIW B;  4M8A A;  4R8I A;  2R92 H;  2JA8 H;  3S16 B;  5JPN C;  2VZA A;  2E76 C;  3VYT A;  4GLA C;  5C3W A;  3HGB A;  1PH4 A;  1CSP A;  3GTK B;  1BBX C;  4KN7 C;  2DN8 A;  1I4P A;  1SMY C;  2DNC A;  3FPP A;  4LMQ D;  4B08 A;  3T4A C;  3GTO H;  2FMC A;  3NE5 B;  1GO3 E;  2D2C C;  1B3A A;  2PW7 A;  1UNS A;  1VDZ A;  2MJ8 A;  4UY8 C;  2UXB Q;  1Q82 C;  4NXN Q;  4N9T A;  3JAM L;  5JEA J;  2HQE A;  1E3P A;  5AFW A;  1J6Q A;  1JWM D;  4A3L H;  2B8F A;  3GTQ H;  3LWU A;  4DN4 M;  5IY0 A;  2IX3 A;  2E5L L;  2PMZ E;  1NCV A;  1GOZ A;  3K0X A;  1F2Z A;  1DCZ A;  3J80 E;  5M3M G;  2OCE A;  4N8F A;  1OXU A;  5CMD A;  3FMC A;  4LF4 Q;  5CV9 A;  2KBN A;  1X3E A;  3V96 A;  2ID0 A;  3CC4 A;  4KTA A;  1MHW C;  2F0H A;  5FLM G;  2K01 A;  4C3H G;  3STB D;  1TQO A;  2A6E D;  3KJP A;  3MA2 B;  1CKO A;  3R2I A;  3J81 L;  2KCT A;  1UWV A;  4A3C G;  1E1T A;  2NVT H;  3CU7 A;  3TZD A;  2HIX A;  4ZCK A;  4Y7N H;  1YNJ D;  2EVB A;  1IHZ A;  4HED A;  2NVY H;  1CSQ A;  4KHV A;  4QF4 A;  3PF4 A;  4DNT B;  4OGQ C;  4LUZ A;  2K75 A;  2UUA L;  1WFQ A;  5KYL A;  3K5N A;  1CA6 A;  4ZKB B;  4CDD C;  2KHJ A;  2Z9H A;  3IAY A;  3MXN A;  4XTC S;  4GOP C;  4RGN A;  3BJU A;  1A3T A;  1QNU A;  1Y1W H;  1TS4 A;  1FR3 A;  1YJN A;  2HCC A;  3NSW A;  3HOZ H;  4JI3 Q;  1EU4 A;  1SEB D;  1SYG A;  3E0J A;  4HCE A;  4DV1 Q;  2UUC Q;  2JA8 B;  2B63 H;  1IL8 A;  2BA1 A;  2ZXR A;  3OW2 A;  4OEM B;  2Q8T A;  1KRS A;  3VR2 A;  3HEJ A;  3KLS A;  2M2L A;  3HOX G;  4DV7 L;  2D62 A;  2IX1 A;  3ERS X;  2O2L D;  1XX8 A;  4IPD A;  1V1O A;  2NZ1 D;  4Q5V A;  4LF9 Q;  4JBJ A;  3NHH A;  2JA5 B;  5IYB G;  2Z6K C;  3M7G A;  2R7F A;  2NVX B;  4NXM Q;  1WTW A;  1PTO H;  3GTM H;  1UEA B;  2F3V A;  5KNB A;  4BY1 H;  1V9P A;  4K6D A;  1YBY A;  4FYD A;  4K14 A;  1EY6 A;  2GN5 A;  4ZUI A;  3U9O A;  1M90 C;  2XWB B;  1L0Y B;  4RH6 A;  4LF8 L;  2BH2 A;  2VQF Q;  5LMN Q;  2KEE A;  2RDF A;  2F0N A;  2K5V A;  2X69 A;  4GN4 B;  3M3Y H;  2EYL A;  3AFQ A;  3T53 B;  1C4Q A;  3VA7 A;  2R7Z G;  1C0A A;  3UI2 A;  4K0K Q;  1A3U A;  4YY3 L;  1EY7 A;  3J80 c;  5EGT A;  1PH7 A;  3WOE A;  2L0C A;  1S4Z A;  3TN2 A;  2RDH A;  1TII D;  5HY6 A;  1EEI D;  3QJY A;  4F7X A;  5JVH 3;  2ZXP A;  4Y7N B;  1WOC A;  4B3S Q;  1PH9 A;  4I7Z C;  3PIO A;  5ELB A;  3A55 A;  1TR5 A;  1Z6H A;  2C35 B;  2B2T C;  2QDB A;  3QG1 A;  1BCP F;  4IFD G;  4JI6 Q;  3FKI B;  4IQZ A;  1YHB A;  4JBK A;  1CHQ D;  3CF5 A;  1W2B A;  2A6H D;  4K6L A;  4DXF A;  2Q8I B;  1QVF A;  1VQM A;  3SE0 A;  1E22 A;  1S5D D;  3B6Y A;  2FHT A;  5EKI A;  5IWA Q;  1Y1W B;  2E2D C;  1EZ6 A;  4NP5 A;  4KV6 A;  1PH5 A;  1UE1 A;  4JCV E;  4A3J H;  3RN2 A;  2F0E A;  1SND A;  3OOC A;  3ERO A;  4J8Q A;  1TWG B;  4EQP A;  1KLG D;  1F9S A;  1Z9F A;  1EY9 A;  3GTJ B;  4F8M A;  1BF4 A;  2R92 G;  1SNC A;  1TWF B;  2JA8 G;  2K52 A;  1MBY A;  4DA2 A;  5EBD A;  3SXH A;  4A76 A;  4IUN A;  4P73 A;  5M5W H;  3E5S A;  2K5D A;  4DAP A;  1S5E D;  1L2F A;  4DNR B;  1SYC A;  1GJX A;  3NTK A;  4P2C B;  4MTK A;  5J22 A;  3EVQ A;  1PV4 A;  1IW7 D;  2B2W A;  4HID A;  1UE7 A;  1FL0 A;  1CZW A;  3X3M A;  5FLX L;  2YU9 H;  5LL6 X;  1SFO H;  2XRS D;  3KDF B;  2JA5 G;  4YWL A;  3CCQ A;  3A0J A;  4X66 L;  2QIL A;  4C3I H;  3TBI B;  3BZD B;  1SMX A;  1I94 L;  1RHP A;  1RTO A;  3FPU B;  3FVQ A;  4OX9 Q;  4X62 Q;  3QOL A;  5KIX A;  5A2Q E;  4A3L G;  1NR4 A;  1N32 L;  1HTL D;  3RR5 A;  1ICF B;  4KN4 C;  1YEZ A;  5C3E B;  4HN7 A;  4S3S A;  5C4X H;  1VMC A;  1GUG A;  2ZM6 L;  2I07 B;  2JN4 A;  4DV5 L;  3F1Z A;  4XYQ A;  5M9O A;  3S1Q B;  2OF1 A;  1SYF A;  4X3T A;  2QA4 A;  2KEN A;  1GVP A;  4R9W A;  1J8I A;  2F0S A;  3S2D H;  3I3C A;  5CV5 A;  3Q0A A;  1A6X A;  1EZ8 A;  3OIQ A;  3KBX A;  4UAI A;  1E24 A;  4DR1 L;  2F4V Q;  2F0W A;  5T1G A;  1W6J A;  3PO2 H;  1I6H B;  2UXD L;  4JK1 C;  4CDF C;  4IN3 A;  2HHH Q;  4TSS A;  2JA7 H;  1KIX A;  2UU9 Q;  2FFK B;  4IUU A;  1IYU A;  3TP6 A;  4BS9 A;  4N8X 1;  5EJW A;  1XNQ L;  1AE3 A;  3HFZ B;  4OL7 A;  1EWH A;  3QR8 A;  4C56 C;  1Y1W G;  1LT3 D;  5I6Y A;  2A5H A;  3HOZ G;  5IT9 c;  1HA5 A;  5GAG C;  3KDF A;  2A68 D;  4QQB X;  2TMP A;  1RJT A;  1DON A;  5T1I A;  2B63 G;  2BOS A;  1H95 A;  2MO0 A;  2PYK A;  4DXG A;  3CC2 A;  3EFX D;  1VQA A;  5GAD C;  2EZV A;  2K5H A;  1B2T A;  2VUM H;  5FO8 B;  5COR A;  2MUY A;  1PYS B;  3BZK A;  1YNN C;  3K6O A;  3MXP A;  3TS0 A;  2HUG A;  3W2D A;  1ILP A;  4P71 A;  5ELC A;  4ME3 A;  2B39 A;  4C3I B;  2BDN A;  5LHY 1;  1V8Q A;  3HOY H;  4BY1 G;  4JVZ A;  1ENC A;  1IBK Q;  2C5C A;  2B2V A;  3C46 A;  4OO1 I;  4OO1 H;  2MFI A;  1SLJ A;  4BBS H;  4LFB Q;  2R61 A;  4PV1 C;  1HH2 P;  1B8A A;  5C4X B;  1MKH A;  1WTQ A;  1GM5 A;  4K8J A;  2RBM A;  4BBR B;  4LUV A;  2JYO A;  1RDP D;  1HRJ A;  1PZJ D;  2RF4 A;  2AWO A;  1VQH A;  1PTO D;  1VQP A;  2TSS A;  3U9S A;  2ICE C;  3GTG H;  2EYP A;  1R9T H;  3AU7 A;  1U4R A;  1PYB A;  3QWN A;  3RMH A;  1EQT A;  1Y1V H;  1OTC A;  3MZ5 A;  4GNX B;  1EWC A;  4QUC A;  3H15 A;  1KRT A;  2B2U A;  4X65 L;  2XWJ B;  1MJE A;  4DR3 L;  1S72 A;  4HMI A;  1ICW A;  3STB C;  2OQK A;  4UHV A;  3H3V I;  4IUV A;  3MHB A;  4BY7 B;  4HMJ A;  1UE6 A;  4A3K B;  3K7A H;  1WCM H;  4PZ7 A;  1U5K A;  2HCI A;  4KJN A;  3S1N B;  3M4Y A;  1GUN A;  3M4O H;  2AHO B;  1CA5 A;  3UE0 A;  1G29 1;  4OIK A;  4UDU C;  3S17 B;  2L4N A;  1WD0 A;  2L11 A;  3S15 H;  2SNM A;  3CCM A;  5JJZ A;  4G7O C;  4JBW A;  4A3J G;  4DV2 Q;  3UDX A;  2YTX A;  4RA8 A;  2KUM A;  1OXX K;  1L0W A;  3Q22 A;  4K2L A;  2K5N A;  1YI2 A;  1X3Q A;  1YJ9 A;  2VUM B;  3OSO A;  2K6A A;  4RHR A;  2ZJP A;  2IT1 A;  1XMQ Q;  1QB5 D;  3I4N B;  5EPJ A;  5JJI A;  3Q8D A;  3WWV A;  4MIU A;  2BH8 A;  3CCV A;  2LMC B;  5FKA C;  1CTM A;  3NEM A;  1SE2 A;  4C3J H;  5M5X B;  3RLO A;  3CCS A;  2PNH A;  1X32 A;  1DOK A;  1ESF A;  2DUD A;  4K5V A;  1CKM A;  2N49 A;  1O80 A;  2AQ3 B;  2K04 A;  1JB3 A;  4C3I G;  3IL8 A;  1U4L A;  1MSH A;  2E8G A;  3N6R A;  2F0K A;  3ERQ A;  1EYG A;  2P5Z X;  2UXB L;  1VQC A;  2E2I B;  4NXN L;  5IGC A;  4GNX A;  3HOV H;  4P72 A;  3VR4 A;  4ODG A;  2N78 A;  4IPG A;  1L0X B;  1AEX A;  4IUT A;  4NB3 A;  4JYA Q;  5C4X G;  1STG A;  1RTN A;  1XNR Q;  2ZJR A;  3KLW A;  3NEN A;  4BBR G;  3IRB A;  4KKT A;  4OWX B;  4YWM A;  1ESR A;  2ICI A;  1YVC A;  4V19 0;  1STY A;  1QZG A;  4QL5 A;  5KRU A;  1G91 A;  1GUT A;  1SRO A;  3HS0 C;  4LF4 L;  4HR7 B;  3AB9 A;  4GKJ Q;  1GKH A;  3FRP B;  3D31 A;  3EQL C;  1C9O A;  2H1E A;  3FDT A;  1AZP A;  3I4M H;  1XPR A;  4A3F H;  1KNA A;  2PPB C;  3K7A B;  3NP8 A;  3WOF A;  1A2U A;  3IFD A;  1B70 B;  3G48 A;  2KED A;  3LNN A;  5M5Y H;  4POG A;  2Z4I A;  2JJQ A;  1K9M C;  5F2D A;  3M4O B;  4BY7 G;  2G5D A;  1GD7 A;  1NTG A;  5EAY A;  1PH2 A;  2A8V A;  2M00 A;  5JVG 3;  3ER0 A;  3H0G H;  2KCC A;  3F2B A;  1N33 Q;  4BA1 I;  2PMZ B;  1SNP A;  3L3O C;  1JJC B;  2B2Y A;  2IY5 B;  2A6H C;  4XQN A;  1I50 B;  1HTP A;  3RZO B;  3MVV A;  1JIC A;  2MQH A;  1LAC A;  4MZ9 A;  4K2K A;  1STB A;  1HQM C;  1TY2 A;  3KLS X;  2O5I C;  1F9Q A;  5G3L F;  3PUX A;  3I72 A;  1Y8O B;  4JI3 L;  2PZT A;  4DV1 L;  2UUC L;  1HHV A;  3K59 A;  1I6V C;  3OMG A;  2PNR C;  3MC0 B;  5CGK A;  2VUM G;  1EQR A;  2EYF A;  3HOU H;  4OHJ A;  3KFU A;  4YIJ A;  5KGU A;  3W1B A;  4C3J B;  1FGB D;  2EY2 A;  1HZA A;  3M9B A;  3TS2 A;  4XIG S;  4I7A A;  3HOX B;  1EQV A;  3MTS A;  1WTP A;  1OXS C;  1HR0 Q;  4U67 3;  4JI1 Q;  1X3P A;  4LF9 L;  1BBU A;  3MXN B;  2AQ2 B;  1TWC B;  3OIP A;  2B3G A;  1XPO A;  1EQQ A;  3HG9 A;  4NXM L;  4BBS G;  5I9O A;  3UE1 A;  1HZ9 A;  4TVA B;  1IW7 C;  2M9V A;  3TRE A;  2Q8R E;  4ZAI A;  3TDQ A;  3C3L A;  2NWG A;  5AJ3 Q;  1TWA H;  2QF7 A;  2JA9 A;  1KHI A;  2MO1 A;  2K1B A;  2AUK A;  5DAU A;  3DWQ A;  5ELF A;  4A3I H;  1LT6 D;  3DHQ A;  2VQF L;  5LMN L;  2F1M A;  1H9R A;  3QB3 A;  5C4Z A;  4K5X A;  3Q6S A;  4ZQ3 A;  1BVS A;  4LFC Q;  1QVC A;  2R7Z B;  4XQQ A;  4K0K L;  3M4P A;  5GAE C;  4X64 Q;  4CKE A;  1Y1V G;  1ENF A;  4XDX A;  1YHA A;  1JT8 A;  2I5L X;  2RCF A;  1FVI A;  2DGY A;  2F3W A;  4FF1 A;  4C1N K;  3I56 A;  2SDF A;  1WYD A;  4B3S L;  4H02 A;  5M5Y B;  1DXM A;  3OWE B;  1T5E A;  4FXK C;  4DV3 Q;  1D5M C;  2RHQ B;  3RD4 A;  2J4X A;  3TSS A;  3T1H Q;  2BA0 A;  4XQJ A;  1SNO A;  1WCM G;  4JI0 Q;  5HUR A;  1YJW A;  3WDN A;  1N9W A;  1I4X A;  2I5M X;  3H0G B;  4JI6 L;  3NXW A;  5D3I B;  5IOC A;  3KLR A;  5GRO A;  4B9W A;  4LUO A;  1Y69 U;  1K8A C;  1AE2 A;  4JI8 Q;  3MEH A;  1EIG A;  1SNM A;  3MAQ A;  2B2W C;  5IWA L;  3SK4 A;  3R2T A;  1EY4 A;  5C0X J;  1VF7 A;  3PGZ A;  4EGV A;  2E2H B;  2SNS A;  4A75 A;  2XGT A;  3J7Y W;  4A3E H;  2ENB A;  1VQK A;  5EKL A;  2NVQ H;  1F77 A;  1K3R A;  4YHH Q;  3NQI A;  1B3Q A;  1U9R A;  3EJI A;  2R92 B;  4MNO A;  3ND9 A;  1CT1 D;  2A68 C;  5NUC A;  4HIK A;  2NZO A;  2NZH A;  3HOW H;  4C3J G;  5C4J H;  3GTL H;  4IZ8 A;  1GUO A;  3R3O A;  4CJ0 B;  2OWO A;  4FNF A;  4GLV B;  1EY5 A;  3GTO B;  3ULL A;  1D8L A;  2N8N A;  3R8B A;  1ASY A;  4WOR A;  5L37 A;  2OT2 A;  1MIU A;  1FNW A;  1D5Z C;  1RD9 D;  3A8I E;  5A35 A;  3CQZ H;  3F8T A;  4LJZ C;  4Z9C B;  4KY6 A;  1PRT B;  2KA7 A;  4OIJ A;  2FMM A;  4HTH A;  1B53 A;  1BKB A;  4B3T Q;  2N3S A;  3HOV G;  5KNC A;  1F9P A;  2DNE A;  4OX9 L;  3G6J B;  3L9A X;  1B9N A;  2B8G A;  2AQ1 B;  1RL2 A;  1LTI D;  5IGE A;  3KOJ A;  1HR0 W;  1NMF A;  1J9O A;  3GTQ B;  4ILW A;  1LT5 D;  4HJA A;  3S14 H;  1ASZ A;  3E9H A;  3I8Z A;  4H0L C;  2EYO A;  4IJL A;  3K5M A;  4B3R Q;  3P1H A;  3TP8 A;  2CQA A;  2QGQ A;  3G7L A;  4DGZ A;  1U0L A;  2K05 A;  4WJ3 M;  4PMC A;  1VQG A;  1R4P B;  3A5U A;  4LW1 A;  4DKA C;  3SK6 A;  1II3 A;  3I4M G;  2JA6 H;  1XWE A;  4A3F G;  2NUC A;  2Y0S G;  4HCS A;  4DR2 Q;  1HUN A;  2NVT B;  4E6I A;  4K8I A;  4JI2 Q;  1KAA A;  1EYC A;  2NVY B;  1MJC A;  2F4V L;  3VYR A;  4LF5 Q;  3KF6 B;  1E2W A;  1LO5 D;  4PMB A;  1I3Q H;  3DEP A;  3S24 A;  1GXD C;  4CGY B;  2HHH L;  5IGB A;  3H0G G;  2UU9 L;  2F0M A;  1SSO A;  4JI5 Q;  1KAB A;  5JJK A;  3EBE A;  3ONA B;  2WFW A;  3T1Y Q;  1ZEQ X;  1STE A;  2K4K A;  1DYQ A;  2CKZ B;  1B1Z A;  3U4Z A;  4LF6 Q;  3C1E A;  2B2V C;  2YTV A;  1PH8 A;  3A56 A;  1KNE A;  1LYL A;  4PZ6 A;  4PMW A;  2CWA A;  1QJO A;  3HOZ B;  2D0P A;  4CJ2 C;  3T56 B;  3SVM A;  3TME A;  3JAM i;  2OTJ A;  2R3Z A;  1O7L A;  3C2P A;  3RNU A;  4KY5 A;  1VQ9 A;  2B63 B;  3I55 A;  2I46 A;  3DM1 A;  3HOU G;  3GTL B;  2EDG A;  2K33 A;  2EYJ A;  2ZTE A;  3DUZ A;  1PDQ A;  2CFM A;  1HNZ Q;  1EIF A;  4EQN A;  5I6W A;  5FK9 C;  4XT1 B;  4JI4 Q;  4IO9 A;  4A93 H;  3BVZ A;  3BS1 A;  1ZXT A;  4QUF A;  5BN5 A;  4A3D H;  2VY3 A;  4GS3 A;  2KCM A;  4A4I A;  1SXT A;  1PTO B;  3GTM B;  3S1R H;  1M4V A;  4BY1 B;  3RZD H;  3J81 i;  1IBK L;  1LV9 A;  1QE6 A;  5J3B A;  2XNA C;  3X3N A;  1WTO A;  2B2U C;  3CHB D;  4LFB L;  3CW2 C;  1K73 C;  5IGG A;  5JEA H;  4UPA A;  3FP9 A;  5JAV A;  4A3I G;  2VB2 X;  3PQI A;  2O5J C;  5ELO A;  1I5F A;  1G6Z A;  1LM0 A;  2A69 D;  5DNF A;  3P20 A;  3M3Y B;  4DK1 A;  1Y8P B;  3KF6 A;  4NDX A;  3D8G A;  1QNK A;  5C4H A;  1CFM A;  2WKD A;  4G7Z C;  2CCZ A;  1CI3 M;  1X54 A;  1ILQ A;  3FHW A;  4XT3 B;  2X6G A;  5M3F H;  1IKL A;  1SE8 A;  3H94 A;  5BN4 A;  2NTS A;  1Y14 B;  2RCN A;  1HXY D;  1PRT D;  5JPM C;  1JWS D;  1I4H A;  4ZUJ A;  3M4Q A;  5LMN W;  1ET6 A;  3PSI A;  2F0P A;  4B9X A;  4QMG A;  3JAM E;  1I3Q B;  4RFB A;  4DU9 A;  1DJR D;  2MP1 A;  1VQ8 A;  1DM0 B;  4WFN 3;  3URY A;  2RQX A;  4JV5 Q;  2BE5 D;  3A5Z B;  4JG2 A;  4ZLT F;  1IKM A;  4R4O A;  1G51 A;  4DAY B;  1JCK B;  1JMC A;  4BWG B;  2B29 A;  1MD2 D;  4RHS A;  4UP7 A;  1VQJ A;  2PZU A;  1LTB D;  2ES2 A;  4A3E G;  4ZKC B;  4DV2 L;  2F0T A;  4A3J B;  5DEH A;  5DLQ E;  1FNU A;  3GV3 A;  3NTH A;  2I0Q A;  3J81 E;  2PCF B;  1D6E C;  1EFW A;  4GNX C;  4GLX A;  4DV0 L;  4QCL A;  2HT1 A;  1YZ6 A;  4DR5 Q;  4O2D A;  5CV7 A;  4OXP A;  3MFG A;  2ZJQ A;  1XMQ L;  5D3D A;  2F03 A;  4A93 B;  2RVL A;  5K5P A;  1Q1E A;  4IFD J;  4HSV A;  5CR3 A;  5M5W B;  1IZ6 A;  4RGO S;  3PUW A;  5IYD H;  1F2Y A;  1PVO A;  1ONL A;  1CQV A;  2YU9 B;  4FVM A;  2AWN A;  2WKC A;  1SYD A;  3A8K E;  5EPL A;  5FO7 B;  3RZD B;  1RKN A;  1SFO B;  3DM3 A;  1AW7 A;  1CZG A;  2XIW A;  1SYB A;  4IUR A;  4HJ8 A;  2QCP X;  1IBL Q;  5J1Z A;  1Q46 A;  2YYZ A;  4O1N A;  2BCO A;  4IJH A;  4R4C A;  5IGF A;  3IKJ A;  2EPB A;  2UUB Q;  4UP8 A;  2JQO A;  4DR6 Q;  5BR8 Q;  3ZYY X;  1WTV A;  5GAH C;  2N88 A;  4DUY Q;  4JYA L;  2CVR A;  1XNR L;  4UP9 A;  1VQ5 A;  2DJF C;  3P7J A;  3H91 A;  5C44 H;  4DAY A;  2LXK A;  4X6A H;  3U50 C;  4CDE C;  3BYY B;  4CKC A;  3UDG A;  3DLL A;  2B2Y C;  3BDC A;  3HKS A;  3OHX C;  2D9U A;  4OON A;  5C5M A;  4R1J A;  1C8C A;  4GKJ L;  1HFG A;  1VF5 C;  2SEB D;  2K5W A;  3S2D B;  1YIT A;  1JWU D;  4BA2 I;  1W6K A;  1L1O A;  1BO0 A;  3KF8 B;  5ELD A;  1MSG A;  1VMP A;  3HKZ B;  2XN9 C;  4DK6 C;  4KY7 A;  1JOR A;  3PUY A;  3PO2 B;  4GKK Q;  5HGQ A;  4KD3 A;  2ALY B;  1ROD A;  3JAM c;  2A6E C;  3H3V H;  1GHK A;  2PW5 A;  2JA7 B;  2EQS A;  2GVA A;  3D6C A;  1AP0 A;  4TKO B;  4EQ5 A;  2CQO A;  2EYM A;  3S2H H;  1JE4 A;  1F2L A;  4P74 A;  1HNW Q;  1N33 L;  1DGS A;  1YNJ C;  4LK1 C;  5J39 A;  1Q8K A;  1XMO Q;  1VQN A;  1SN8 A;  1WI5 A;  2A1A A;  1VS0 A;  2JEB I;  1A15 A;  1HPC A;  3W3A A;  4KKU A;  4A3M H;  5FLM H;  1N34 Q;  4C3H H;  4IUQ A;  3GQB A;  3CKI B;  2MNA A;  1TKW B;  4DPG A;  4JW0 A;  4AYB G;  4QY7 A;  5I9P A;  3K5O A;  1JJ2 A;  2RHS B;  4YCW A;  1G6P A;  2OEO A;  4RG1 A;  4IOA A;  1JOO A;  3E9I A;  3J81 c;  1D7Q A;  2N55 A;  1UUP A;  3I70 A;  5FOB B;  2RDG A;  2PO4 A;  1PZI D;  4A93 G;  2E2J H;  2MPM A;  4H7B A;  3OMC A;  1BQQ T;  1HR0 L;  2Z6B A;  2Q2T A;  4JI1 L;  2WP8 J;  2EXD A;  3HOY B;  2NBF A;  3JC6 6;  4RKL A;  1PMR A;  2F0J A;  2L15 A;  3DEO A;  5GQO A;  4BBS B;  4KK7 A;  3HKZ E;  3AFP A;  3E6Z X;  4LFA Q;  1EUJ A;  5JEA G;  1HZC A;  5AJ3 L;  2PQE A;  3NTI A;  3KF8 A;  4A3B H;  3S1M H;  1LTR D;  1STN A;  1V43 A;  4DR7 Q;  1BBW A;  2RSN A;  1FJG Q;  2D5D A;  1QCB D;  1QUQ B;  2JXM B;  1AN8 A;  1KC8 C;  4LFC L;  5M3F G;  5FJ8 H;  2Z8L A;  3FEW X;  3VA5 A;  3GTK H;  1G2T A;  2QKI C;  3GTG B;  1R9T B;  3GV6 A;  1PA6 A;  1I4R A;  4X64 L;  2R7D A;  5FLX E;  1Y1V B;  3ULP A;  1B4O A;  1NJI C;  2ZT9 C;  5IP7 H;  4LWC A;  5CC4 A;  3PIP 3;  4J6H A;  1JOK A;  1KL9 A;  2UXC Q;  2L12 A;  2IX0 A;  2H4O A;  1Q90 A;  3ZJY C;  2JP1 A;  4AH6 A;  4PZ8 A;  4WRD A;  4DV3 L;  3T1H L;  2OTL A;  3HKZ G;  4HJ9 A;  1FD7 D;  4JI0 L;  4KMU C;  1WCM B;  1T9H A;  1ENA A;  3PO2 G;  2PZW A;  1V1P A;  3BU2 A;  3OTO Q;  4AIM A;  2EIF A;  2KVM A;  3ICE A;  1IBM Q;  2JA7 G;  4H44 C;  1YHQ A;  2BDO A;  1SYE A;  4A3M B;  3L7Z C;  2CWP A;  3S15 B;  5IT9 L;  1Q86 C;  1EYA A;  4POF A;  4APV A;  3CD6 A;  3CAM A;  1LAB A;  4K5W A;  5CBA E;  1E7Z A;  1UAP A;  2V1C C;  2EJM A;  4YHH L;  3NPP A;  1N36 Q;  4DAV A;  2D0O A;  2JE6 I;  3HP3 A;  4J15 A;  1BCP B;  4IFD I;  4RWS C;  1X3F A;  4IFD H;  3UDI A;  2ASB A;  2E2J B;  1CHP D;  1D5X C;  2F0D A;  4KJO A;  4L5R C;  2F52 A;  2KCN A;  2LSS A;  4MTN A;  3NEL A;  5KEE A;  4KHP Q;  1NBW A;  4CBV A;  1QUQ A;  3IFT A;  1S5B D;  2Z4H A;  4OWT B;  1H9K A;  2LXJ A;  4I65 A;  4YWK A; 
#chains in the Genus database with same CATH homology
 2QA4 A;  2UXD Q;  4HJA A;  3S14 H;  1ASZ A;  2KEN A;  3E9H A;  1GVP A;  3HOY G;  3S2D H;  4IJL A;  4B3R Q;  3SGI A;  4OO1 G;  5LMU Q;  4B3T L;  2JK8 A;  1E24 A;  2QGQ A;  4KHP L;  1U0L A;  1VQ6 A;  3BZC A;  2VQE Q;  3CMA A;  4WJ3 M;  4DR1 L;  2F4V Q;  2FXQ A;  1XNQ Q;  1VQG A;  4A3D G;  4LF7 Q;  3TRZ A;  3A5U A;  4DV4 Q;  4LW1 A;  3CCL A;  3PO2 H;  2UXD L;  4DKA C;  2HIV A;  3GD7 A;  1I50 H;  3RZO H;  4JOI C;  4DV0 Q;  2HHH Q;  3I4M G;  2JA6 H;  1JJG A;  3RLF A;  2JA7 H;  4A3F G;  1KIX A;  5C44 G;  4B3R L;  2UU9 Q;  2Y0S G;  4P75 A;  4DR2 Q;  5K36 G;  1A63 A;  1JE5 A;  5LMU L;  1HNX Q;  4HJ7 A;  4JI2 Q;  4ALP A;  2VQE L;  1MJC A;  2F4V L;  4LF5 Q;  2KHI A;  3KF6 B;  1XNQ L;  1AE3 A;  4Y52 H;  3HFZ B;  4LF7 L;  1I3Q H;  3E0E A;  4DV4 L;  2JA5 H;  3S24 A;  5IE8 A;  1Y1W G;  1XPU A;  1TWH H;  4R4Q A;  5IP9 G;  4IOC A;  2NVX H;  4JOI A;  3U58 A;  2HHH L;  3HOZ G;  3H0G G;  5IT9 c;  4DR4 Q;  4QJF A;  5FLX c;  5GAG C;  1M1K C;  4DR2 L;  3KDF A;  2UU9 L;  4JI5 Q;  4GN5 A;  3OYY A;  3S16 H;  4QQB X;  1HNX L;  1OXV A;  3HOX H;  4B3M Q;  5JJK A;  3EBE A;  2B63 G;  2WFW A;  4JI2 L;  1H95 A;  3T1Y Q;  2MO0 A;  1N8R C;  3PUZ A;  2K4K A;  4IPH A;  3CC2 A;  4LF5 L;  1QVG A;  2CKZ B;  1FGU A;  1VQA A;  2A19 A;  3U4Z A;  3W1G A;  5GAD C;  4LF6 Q;  1TWC H;  2K5H A;  2VUM H;  2VL6 A;  4C2M H;  1XTD A;  3KJO A;  1J5E Q;  5IYB H;  2YTV A;  1PH8 A;  3K80 C;  4PZ6 A;  1LYL A;  4PMW A;  1PYS B;  1IYJ B;  3BZK A;  2CWA A;  4JI7 Q;  4DR4 L;  1LUZ A;  2D0P A;  3F2C A;  3GDE A;  1WJJ A;  4DV6 Q;  4JI5 L;  2K14 A;  3TS0 A;  3K8A A;  3JAM i;  4JBM A;  2OTJ A;  4B3M L;  3ULJ A;  1SRU A;  2IHF A;  3RNU A;  4P71 A;  4YCV A;  3T1Y L;  3I55 A;  4A3M G;  1VQ9 A;  2Q2U A;  3HOU G;  4ME3 A;  4AQY Q;  3HOY H;  4LF6 L;  4BY1 G;  2ZTC A;  2ZTE A;  5IYC H;  3K81 C;  1NE3 A;  3CPF A;  3LGJ A;  1J5E L;  3PF5 A;  3TEH B;  1IBK Q;  4OO1 I;  2CFM A;  1HNZ Q;  2MFI A;  1EIF A;  1IXR A;  1SLJ A;  4BBS H;  4JI7 L;  4LFB Q;  4QIW E;  3CCE A;  3I4O A;  1A62 A;  4DK3 C;  4DV6 L;  4JI4 Q;  4IO9 A;  4A93 H;  4BXX G;  1XJV A;  1HH2 P;  1B8A A;  5C0X G;  1PHJ A;  3G6E A;  2R7Z H;  4A3D H;  2VY3 A;  4JI8 L;  4GS3 A;  1X56 A;  2KCM A;  4A4I A;  2R93 H;  1MKH A;  2PQA A;  4AQY L;  2R6G A;  1GM5 A;  1VQD A;  4LUV A;  2GVB A;  1SR3 A;  3S1R H;  2RF4 A;  3I7F A;  2AWO A;  1VQH A;  3FKI H;  3J7A 5;  3RZD H;  3J81 i;  1IBK L;  5J3B A;  3VDY A;  1O7I A;  1HNZ L;  3G4S A;  4LFB L;  1HJP A;  3CW2 C;  4X65 Q;  3RN5 A;  4JI4 L;  1K73 C;  4HIM A;  1VQP A;  4DR3 Q;  4DUZ Q;  2OQ0 A;  4UPA A;  3FP9 A;  4A3I G;  3J7Z C;  3EN2 A;  3U4V A;  1Q81 C;  5ELO A;  3GTG H;  3J81 j;  4A3K G;  1I5F A;  1R9T H;  1PYB A;  1LM0 A;  1TXY A;  1VQL A;  4FDB A;  1OTC A;  1Y1V H;  1A0I A;  1VQ7 A;  2HQL A;  1JB7 A;  2Y0S E;  3GO5 A;  3J80 i;  4GNX B;  3KF6 A;  5JJL A;  2JEA I;  3KYH C;  3M7N A;  1LTL A;  1X6O A;  2CCZ A;  1KQS A;  3H15 A;  1X54 A;  1KRT A;  3UDF A;  4X65 L;  3FHW A;  5IYD G;  2I5H A;  1MJE A;  4A3B G;  1TWG H;  3M85 A;  4DR3 L;  4DUZ L;  5M3F H;  1S72 A;  1SE8 A;  3STB C;  1VQB A;  2YV5 A;  3PIP A;  2OQK A;  1Y14 B;  1KD1 C;  3H3V I;  2RCN A;  3GTJ H;  4X62 L;  1UE6 A;  3D0F A;  1TWF H;  3K7A H;  1Q12 A;  1WCM H;  4PZ7 A;  3CC7 A;  1U5K A;  2E2H H;  1Q7Y C;  5FJ8 G;  3M4O H;  2AHO B;  2YTY A;  1P16 A;  3M4Q A;  1G29 1;  3UE0 A;  5LMN W;  1PH1 A;  1X65 A;  3PSI A;  1PFS A;  4LNQ A;  1NMF A;  1RIP A;  3RLN A;  3TQY A;  2VS1 A;  2Q2H A;  1VQ8 A;  1PH6 A;  3CCJ A;  3I4N G;  2PQA B;  4GN3 B;  3S15 H;  4JV5 Q;  3CCM A;  2F3I A;  1VQI A;  3A5Z B;  4JG2 A;  4JBW A;  5IP7 G;  4R4O A;  1G51 A;  4A3J G;  4DV2 Q;  2JA8 H;  2R92 H;  1CKN B;  2VZA A;  2YTX A;  3UDX A;  4DAY B;  2ZTD A;  1OXX K;  1L0W A;  4GLA C;  1PH4 A;  1CSP A;  2QEX A;  1JMC A;  2B29 A;  2K5N A;  1YI2 A;  4A3G H;  4UP7 A;  2H5X A;  1YJ9 A;  1QZH A;  2NN6 I;  1Z47 A;  3GTO H;  2ZJP A;  2IT1 A;  1XMQ Q;  4L5S A;  1VQJ A;  4JV5 L;  5ELN A;  2WAQ E;  2E5L Q;  5JJI A;  3EIV A;  1GO3 E;  3Q8D A;  2ES2 A;  3WWV A;  4A3E G;  4DV2 L;  2BH8 A;  5DLQ E;  3CCV A;  2I0Q A;  3NEM A;  5C3E H;  2XTI A;  3AEV A;  1EFW A;  4UY8 C;  2UXB Q;  4C3J H;  1Q82 C;  3RLO A;  3CCS A;  4GNX C;  4GLX A;  4DV0 L;  1PH3 A;  4NXN Q;  1YZ6 A;  2HT1 A;  2PNH A;  4DR5 Q;  4O2D A;  5JEA J;  1B7Y B;  2DUD A;  3S1Q H;  2IHE A;  1E3P A;  4OXP A;  1J6Q A;  4GOP B;  1VQO A;  1EWI A;  2ZJQ A;  1XMQ L;  4A3L H;  1CKM A;  2N49 A;  3GTQ H;  1KXL A;  4KLK A;  5IY0 A;  3G71 A;  2E5L L;  2PMZ E;  3K0X A;  1Q1E A;  4IFD J;  5M3M G;  2E8G A;  1IZ6 A;  2OCE A;  1OXU A;  3PUW A;  1EYG A;  5IYD H;  2UXB L;  1VQC A;  4NXN L;  1S40 A;  4GNX A;  1X3G A;  4DR5 L;  1PVO A;  3HOV H;  3PO3 H;  4P72 A;  4LF4 Q;  3CME A;  1E1O A;  4R4I A;  1K8G A;  2AWN A;  1OXT A;  2N78 A;  2KBN A;  4IPG A;  1X3E A;  3CC4 A;  2ID0 A;  3DM3 A;  4NB3 A;  4JYA Q;  5C4X G;  5FLM G;  1I6H H;  1XNR Q;  2ZJR A;  3STB D;  3KLW A;  3NEN A;  4BBR G;  4HJ8 A;  3IRB A;  4OWX B;  1IBL Q;  4YWM A;  3KJP A;  4O0A A;  2UUA Q;  1CKO A;  1Q46 A;  2YYZ A;  2KCT A;  1YVC A;  4IJH A;  1UWV A;  4A3C G;  2WAQ G;  4R4C A;  1E1T A;  4QGU A;  1QZG A;  3CP0 A;  2NVT H;  4QL5 A;  2HIX A;  4Y7N H;  1EIY B;  1SRO A;  2UUB Q;  2AKW B;  4UP8 A;  1K0R A;  4LF4 L;  2JQO A;  4DR6 Q;  2NVY H;  1CSQ A;  5BR8 Q;  4GKJ Q;  3PF4 A;  1GKH A;  2WB1 E;  5GAH C;  4DUY Q;  4JYA L;  1XNR L;  4UP9 A;  3D31 A;  3NBH B;  1L1O C;  3CCU A;  1C9O A;  1VQ5 A;  1IBL L;  4LUZ A;  2K75 A;  2UUA L;  1WFQ A;  3I4M H;  1XPR A;  1Q1B A;  1CKN A;  4A3F H;  5C44 H;  1X55 A;  1YIJ A;  2LXK A;  4X6A H;  3U50 C;  1HZB A;  1UEB A;  1S3O A;  2KHJ A;  4YCU A;  3DLL A;  3UDG A;  1B70 B;  3G48 A;  2UUB L;  5M5Y H;  4DR6 L;  4POG A;  3HKS A;  2JJQ A;  1K9M C;  2K50 A;  4OON A;  4R1J A;  5BR8 L;  4XTC S;  4GKJ L;  4BY7 G;  4DUY L;  1YIT A;  1GD7 A;  1NTG A;  4GOP C;  5EAY A;  1HR0 W;  3BJU A;  1PH2 A;  2A8V A;  1Y1W H;  4BA2 I;  5IP9 H;  1L1O A;  4DV7 Q;  4WJ4 A;  4OWW B;  3ER0 A;  1YJN A;  3KF8 B;  4RMF A;  3MEF A;  3HOZ H;  3H0G H;  3F2B A;  1N33 Q;  1KAW A;  4JI3 Q;  4BA1 I;  4DV1 Q;  4DK6 C;  2UUC Q;  1JJC B;  3PUY A;  2B63 H;  4GKK Q;  5HGQ A;  2BA1 A;  2IY5 B;  3OW2 A;  1YNX A;  2MQH A;  2ALY B;  3JAM c;  1NY4 A;  4MZ9 A;  1KRS A;  3H3V H;  1IL2 A;  1CUK A;  2EQS A;  2GVA A;  4GOP A;  4L5Q A;  4EQ5 A;  3HOX G;  2CQO A;  4DV7 L;  3S2H H;  2D62 A;  2WB1 G;  4P74 A;  3CCR A;  3PUX A;  3ERS X;  2IX1 A;  1HNW Q;  1N33 L;  1DGS A;  4JI3 L;  4IPD A;  4DV1 L;  1Q8K A;  1XMO Q;  2UUC L;  4LF9 Q;  1VQN A;  2JEB I;  1SN8 A;  1WI5 A;  1VS0 A;  2A1A A;  4JBJ A;  4LF8 Q;  2VUM G;  4GKK L;  1EQR A;  5IYB G;  4A3M H;  2Z6K C;  5FLM H;  2R7F A;  1N34 Q;  3HOU H;  4C3H H;  3KFU A;  3W1B A;  4NXM Q;  2MNA A;  4BBR H;  3GTM H;  1HZA A;  4BY1 H;  3M9B A;  3TS2 A;  4DPG A;  1V9P A;  4XIG S;  1YBY A;  3CPW A;  4AYB G;  4HIO A;  4KI0 A;  1OXS C;  1HNW L;  4QY7 A;  4YY3 Q;  1HR0 Q;  2GN5 A;  1M90 C;  3AQQ A;  1JJ2 A;  2RHS B;  4YCW A;  4JI1 Q;  4RG1 A;  1XMO L;  1BBU A;  4LF9 L;  3E9I A;  4BXX H;  3MXN B;  3J81 c;  5C0X I;  4LF8 L;  4IOA A;  2BH2 A;  1D7Q A;  2VQF Q;  5LMN Q;  2B3G A;  5IYC G;  1XPO A;  1EQQ A;  1N34 L;  2Z6K A;  4NXM L;  4BBS G;  1L1O B;  3UE1 A;  2K5V A;  3M3Y H;  4GN4 B;  1HZ9 A;  4TVA B;  4A93 G;  3W5O A;  2E2J H;  4TQU S;  3TRE A;  3AFQ A;  2R7Z G;  1C0A A;  4HJ5 A;  4K0K Q;  5AJ3 Q;  1TWA H;  4YY3 L;  2JA9 A;  4DAM A;  1HR0 L;  2R93 G;  1KHI A;  2MO1 A;  3J80 c;  2Q2T A;  4JI1 L;  1PH7 A;  2WP8 J;  2EXD A;  4A3I H;  1W3S A;  2VQF L;  5LMN L;  4BY7 H;  3JC6 6;  3FKI G;  5HY6 A;  3I2Z A;  2L15 A;  4A3K H;  5GQO A;  3A74 A;  3HOW G;  1BVS A;  3HKZ E;  1WOC A;  3AFP A;  4LFA Q;  1EUJ A;  1N36 L;  4B3S Q;  4LFC Q;  3S1N H;  5JEA G;  1QVC A;  1HZC A;  1PH9 A;  3PIO A;  4K0K L;  3S17 H;  5AJ3 L;  3M4P A;  5GAE C;  2VW9 A;  4X64 Q;  3PCO B;  1Y1V G;  4A3B H;  3S1M H;  2C35 B;  1V43 A;  1YHA A;  4NPS A;  1JT8 A;  2I5L X;  4DR7 Q;  1FVI A;  2DGY A;  1BBW A;  1VCI A;  4JI6 Q;  1FJG Q;  4IFD G;  3GTP H;  1QUQ B;  1YHB A;  3I56 A;  1KC8 C;  4JBK A;  3CF5 A;  3AYH B;  1W2B A;  4EX5 A;  1WYD A;  4B3S L;  4LFA L;  4H02 A;  4LFC L;  1QVF A;  1VQM A;  5M3F G;  2ATW A;  5FJ8 H;  3GTK H;  1E22 A;  1UE5 A;  1VQE A;  4L5T A;  3B6Y A;  4DV3 Q;  2RHQ B;  3T1H Q;  5IWA Q;  2BA0 A;  1PA6 A;  4X64 L;  1WCM G;  2R7D A;  1YJW A;  4JI0 Q;  3I4N H;  3ULP A;  1PH5 A;  4DR7 L;  1NJI C;  1N9W A;  2I5M X;  3F2D A;  4JI6 L;  1FJG L;  1UE1 A;  4JCV E;  5IP7 H;  4LWC A;  3RN2 A;  4A3J H;  5GRO A;  4LUO A;  1VQF A;  1KL9 A;  2Z0S A;  1K8A C;  1AE2 A;  2Q2I A;  4JI8 Q;  2UXC Q;  2IX0 A;  5M5X H;  4PG3 A;  1Z9F A;  4DV3 L;  3ZJY C;  4AH6 A;  1C7Y A;  4PZ8 A;  3T1H L;  5E7N A;  3HKZ G;  4HJ9 A;  5IWA L;  2OTL A;  2R92 G;  5C0X J;  2JA8 G;  2K52 A;  4JI0 L;  3PGZ A;  4DNI A;  1T9H A;  3PO2 G;  1EOV A;  3BU2 A;  3OTO Q;  4AIM A;  2EIF A;  4A75 A;  2XGT A;  4X66 Q;  3ICE A;  4AYB E;  1V1Q A;  4A76 A;  1IBM Q;  4A3E H;  2JA6 G;  4A3G G;  3L0O A;  2JA7 G;  1YHQ A;  4P73 A;  5M5W H;  1VQK A;  2PI2 E;  1K3R A;  1I94 Q;  2NVQ H;  4YHH Q;  1L2F A;  2NN6 G;  2UXC L;  3PUV A;  2E2I H;  1NMG A;  3L7Z C;  1N32 Q;  2CWP A;  1PV4 A;  4HID A;  1UE7 A;  1FL0 A;  4KHZ A;  1Q86 C;  1P8L A;  4APV A;  4POF A;  3L2P A;  2YU9 H;  3CD6 A;  3CAM A;  1SFO H;  4MNO A;  3KDF B;  2JA5 G;  5H1S E;  5C3E G;  2PI2 A;  3OTO L;  1X9N A;  3K7U C;  3PV0 A;  4YWL A;  2NZO A;  2NZH A;  1E7Z A;  3A0J A;  5C4J H;  3CCQ A;  4X66 L;  4HIK A;  2ZM6 Q;  1IBM L;  3GTL H;  4C3I H;  2VNU D;  4DV5 Q;  2V1C C;  4JC0 A;  2OWO A;  1SMX A;  5M3M H;  1I94 L;  4OX9 Q;  4GLV B;  4YHH L;  4X62 Q;  4A3L G;  1G6P A;  1AH9 A;  3ULL A;  1D8L A;  1N36 Q;  1N32 L;  2D0O A;  2JE6 I;  2N8N A;  2AMC B;  3RR5 A;  1ASY A;  4J15 A;  4IFD I;  1MIU A;  1X3F A;  3UDI A;  2ASB A;  1VQ4 A;  3CQZ H;  3F8T A;  1YEZ A;  5C4X H;  4L5R C;  2F52 A;  2ZM6 L;  2LSS A;  1BKB A;  4MTN A;  4DV5 L;  3F1Z A;  4B3T Q;  2N3S A;  3NEL A;  3HOV G;  3PO3 G;  3HOW H;  1K83 H;  1NBW A;  4OX9 L;  1QUQ A;  4KHP Q;  1A8V A;  4A3C H;  4DR1 Q;  1RL2 A;  4OWT B;  4R4T A;  3CXC A;  3KOJ A;  4IPC A;  2LXJ A;  4YWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...