4DR5Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr5Q00
1NMFA 1JE5A 4NXML 1YJWA 2R6GA 4JI6Q 3S2HH 3K81C 4P74A 1I6HH 2WAQG 5J3BA 2KCMA 1VQLA 3FHWA 1HZ9A 4ME3A 4BY7G 4LFBQ 4LFAQ 2IX0A 1VQ5A 2JA5G 1K8GA 4POGA 2R92G 2MO1A 4DUZL 2JA9A 4LFCQ 1Q1EA 1FJGL 4GNXA 3S24A 2JA7H 4H02A 1N34L 4LNQA 1WJJA 5DLQE 1PH2A 1E1OA 1N33Q 2LXKA 3CCEA 3LGJA 3A5ZB 2PQAA 2UU9Q 4LF8Q 4OO1I 2KHJA 1SN8A 2Z6KC 4JG2A 1U0LA 3HKSA 4RMFA 5M3FH 3RNUA 1JB7A 1IBLL 4DV7L 2JA8H 3KFUA 4YWKA 5GROA 4BXXH 3PO2G 2CWAA 1V9PA 3ULJA 1FL0A 4GN4B 2F52A 2XTIA 3BZCA 4NXNL 3JAMi 1B70B 1V43A 3HOVH 4A93G 1EOVA 2WFWA 4JYAQ 1VQGA 1HNWL 3CCRA 4LF5Q 3FKIG 3I4NH 4DV2Q 4P72A 1SMXA 3K0XA 3M4OH 1VCIA 2MNAA 3ULPA 1HH2P 2PNHA 4KI0A 4FDBA 4LUVA 1Y14B 3L0OA 3EIVA 4BY1H 4JI8Q 1X65A 4DAMA 1LYLA 1PH6A 4LF7L 1PH4A 4PZ8A 4BBRH 4AQYQ 1YHAA 2HHHL 2A8VA 1IBKL 1TWCH 1S3OA 5M5XH 1YJ9A 4A3GH 3BJUA 4LF4L 2GVAA 4X62L 2VY3A 3K7UC 4A3JG 1MJEA 2ZM6L 4A3BH 2UXCL 4LF6Q 4B3RQ 2WP8J 4DR3Q 4DV3L 4MZ9A 5IT9c 2ATWA 3F8TA 1X9NA 3HOZG 2AWNA 4R4IA 1QUQA 4A4IA 5FJ8H 2LSSA 3PUXA 3F2CA 1WYDA 5LMUQ 3HOYH 3VDYA 2EQSA 2K14A 1NBWA 1JMCA 5IYDG 3CW2C 3PF5A 3M4QA 2IHEA 4B3SL 3S15H 1Q82C 4NXMQ 1NY4A 3H3VH 3PV0A 4IFDG 1SE8A 4JI2L 1Y1WH 3HKZG 4A3EG 1CSQA 1TWGH 2I5HA 4DR4L 2IT1A 5M3MG 2JA6G 4KHPQ 1H95A 2I5LX 3CQZH 1XMOQ 1EQQA 2EIFA 4YWMA 5IYBH 4A3KG 1QVCA 2ZTCA 4DUZQ 1K8AC 1BBWA 4HJAA 1FJGQ 1VQ8A 4A3CG 1XPOA 1IBML 3K8AA 4DR1L 5C44G 3M9BA 3PO3H 2CWPA 4LFCL 2CCZA 3J81c 4UP9A 3HOUG 2RCNA 3CCLA 3K80C 4KHZA 1VQMA 3D0FA 4DV7Q 4HIMA 4DV1L 1K73C 1ASZA 1AE2A 3KJOA 3AQQA 3T1YQ 3OW2A 2CQOA 2OCEA 3UE1A 5JEAG 4NXNQ 4L5QA 2JEAI 2R7DA 1HNWQ 1WCMH 5ELOA 3TEHB 3CCSA 1Q86C 4JI4L 2YTYA 3MXNB 4HJ5A 2L15A 2KHIA 1K3RA 2JA5H 2WB1E 2A19A 5IP7H 3E0EA 4DAYB 3GTKH 1JT8A 1X3EA 3PCOB 5C4XH 1YNXA 1K83H 3UDIA 2Y0SG 4DV2L 1QVFA 3JC66 4DV6Q 1CKMA 4A3IH 1VQAA 4JC0A 4HIOA 3H0GH 4LF7Q 1MIUA 4YY3L 3S1RH 1C7YA 4A3LG 4IO9A 2R7FA 2HHHQ 3GDEA 1IBKQ 1FGUA 1SLJA 2GN5A 4GS3A 3S2DH 3PO2H 4DK3C 5C3EG 1M1KC 4DR7L 2ES2A 2UXCQ 4X62Q 3JAMc 3AEVA 2ZM6Q 1I5FA 1E22A 4A93H 1XNRL 2K5VA 3KF6B 1Z47A 4DV3Q 4EX5A 2B63H 1N36L 1L2FA 2D62A 2E8GA 1LM0A 1CSPA 1EIFA 2AKWB 3RR5A 2I0QA 4WJ4A 4DKAC 4DPGA 1GD7A 4GLAC 1GO3E 4A75A 4JCVE 4DV5L 1PH3A 3GTQH 1BKBA 4JI2Q 5BR8L 3PIOA 2K5NA 4IPCA 5M5WH 4DR4Q 1CKOA 2VUMG 4IOAA 1PYSB 1EQRA 2VQEL 3GD7A 3M4PA 3U50C 1KC8C 2CFMA 4A3JH 4JBMA 1VS0A 3I7FA 2ZJPA 3GTMH 4OXPA 4Y52H 1HR0L 1IBMQ 2Z6KA 3KJPA 4DR1Q 1XMOL 4KHPL 1OXTA 1UWVA 2AMCB 2NN6I 4APVA 2NVYH 1KIXA 3HOZH 1NMGA 1L1OC 4BBSG 4L5SA 2YU9H 2VS1A 3IRBA 3I4MH 4BA2I 4JBJA 4JOIC 1YZ6A 5IYDH 4A3DG 1IL2A 1VQ6A 3I55A 4DV1Q 3GO5A 4YCVA 1XMQL 5IWAL 4AIMA 1OXSC 1KL9A 3A0JA 4JV5L 2HIVA 4JBWA 3ICEA 1YEZA 1B8AA 4HJ7A 4UP7A 3UDXA 1G291 3T1YL 4POFA 1S72A 5FLXc 4JI4Q 3J7ZC 2UXDQ 1IXRA 3F2BA 1KRSA 5GADC 2PMZE 4A3KH 4GKKL 1G6PA 3I2ZA 2RHSB 2UUAL 1EFWA 5C0XJ 4GN3B 5C44H 4YCUA 1SROA 1VQDA 4JI1L 5IY0A 3GTJH 5LMNL 4OONA 1Q7YC 5C0XI 2CKZB 4YY3Q 3HOUH 4DV6L 2JJQA 4X64Q 4YHHL 4O0AA 1SR3A 3RLOA 1E7ZA 1I94L 2XGTA 2IX1A 4DR7Q 2K50A 2MQHA 4B3TL 1GKHA 3GTPH 2N8NA 4IJLA 1YHQA 2UUCL 2R7ZG 2KENA 2ID0A 1UE7A 3PUYA 4DUYQ 4GLVB 4JI7L 1XNRQ 4P73A 1L1OB 1EYGA 2JE6I 3PGZA 4LUOA 3F2DA 3S14H 1N36Q 3HKZE 3PUWA 3CPFA 4PZ7A 1TWFH 2NVQH 3HOXG 1OXVA 1CKNB 1YJNA 3H3VI 4JI3Q 3CPWA 5IP9H 2E2IH 4J15A 3S1NH 4IPDA 1Q81C 4O2DA 4BA1I 5AJ3L 4DV5Q 1C0AA 5BR8Q 4A3LH 1JJGA 2A1AA 4C3JH 1T9HA 5FLMG 3WWVA 2VQEQ 3AFQA 4HJ9A 2N3SA 3SGIA 1D8LA 2I5MX 3CF5A 5C3EH 1XTDA 2VQFL 2JQOA 2NZOA 3EN2A 3KF6A 2F3IA 4MTNA 3CC7A 1Q8KA 4RG1A 1HR0Q 1LTLA 4XIGS 1GM5A 1VQFA 1A0IA 3PUVA 1A62A 2Q2UA 3U4VA 2OWOA 3HOWG 3AYHB 4NPSA 1VQBA 1JJ2A 1SRUA 1E1TA 4QGUA 1HNZL 1EIYB 1XNQL 4WJ3M 4DK6C 3L7ZC 1PH7A 1QVGA 1PH8A 1N9WA 3CMEA 1X3FA 1W2BA 1XMQQ 5IWAQ 3BU2A 3I56A 2Y0SE 4JV5Q 1EUJA 4R4QA 5JJKA 5IYCG 4DV4L 2BA1A 3KDFB 4PMWA 2OTLA 3EBEA 2NN6G 3Q8DA 2VUMH 3BZKA 4IOCA 4BXXG 4C2MH 4P75A 3J81i 3MEFA 1VQ7A 4BY7H 1X56A 4GKKQ 4IPGA 4L5TA 3HOVG 2UXDL 4AH6A 2ZJRA 1NE3A 2K75A 2UUAQ 4OO1G 1HZBA 2R92H 2ZTDA 3I4NG 3NELA 2QGQA 4JI1Q 5LMNQ 3G6EA 4UP8A 2BH2A 2F4VL 1KXLA 2KCTA 1E24A 4YHHQ 2DGYA 2YTVA 3W1BA 4NB3A 1I94Q 2HIXA 2NZHA 2NVXH 3S16H 3RLNA 4QY7A 4DV0L 3CC2A 4X66L 4X64L 1HZAA 3J80i 4DR5Q 1A63A 1J5EL 1HZCA 2BA0A 4B3TQ 4OX9Q 3G48A 1FVIA 2UUCQ 1BVSA 1WOCA 3M3YH 4JI7Q 4R4CA 3OYYA 2K52A 1YIJA 2B29A 4QIWE 2R93G 3CC4A 4R4TA 2MO0A 2NVTH 1K0RA 1HR0W 1VQPA 1VQKA 4A3FG 4DUYL 3GTLH 1RIPA 3PF4A 1PH1A 4L5RC 2E2HH 3FKIH 1WI5A 4JI3L 1VQOA 4K0KL 2BH8A 5AJ3Q 5FJ8G 3H15A 4GKJL 1NJIC 1OTCA 1X55A 2VW9A 3E9HA 2VNUD 4HIKA 3U4ZA 4X65L 2VQFQ 2LXJA 4DNIA 4GOPC 1L1OA 3E9IA 3CXCA 4A3MG 1Y1WG 2R7ZH 1B7YB 3F1ZA 5H1SE 2UUBL 1YHBA 4AYBG 3PIPA 4JOIA 2PI2E 4IFDJ 1CKNA 3CCVA 3CP0A 1PFSA 3FP9A 3HOXH 4DR2Q 4IFDI 5LMNW 1PH9A 2E5LQ 1HNZQ 1XNQQ 1X3GA 3ULLA 3UDGA 3J7A5 1P16A 3CAMA 2YTXA 3G4SA 3T1HL 1E3PA 4C3IH 5GAGC 2EXDA 1OXUA 3S1MH 1SFOH 5E7NA 5FLMH 4DV4Q 4HJ8A 3CD6A 3GTGH 1HNXL 4A3EH 3ERSX 4JI0L 3S17H 1TWHH 1R9TH 4Y7NH 5M3MH 3DLLA 1VQNA 2JA6H 1WCMG 2HQLA 1YBYA 5JEAJ 3HOWH 1RL2A 3S1QH 1EWIA 1AH9A 1Z9FA 1BBUA 2F4VQ 5IP7G 4A3CH 5C4XG 4LF9Q 1A8VA 4B3ML 1YVCA 2OQKA 4GOPB 2JEBI 4LUZA 5GAHC 4DV0Q 4X66Q 3KYHC 3H0GG 4LW1A 4A3IG 4KLKA 5K36G 1J5EQ 1KD1C 3KDFA 4R1JA 3CCQA 1M90C 4TVAB 1QZGA 1K9MC 2ASBA 5IYCH 2QA4A 2Z0SA 3OTOL 4DR5L 4OX9L 3RN2A 3RZOH 4DR6L 2VL6A 2OQ0A 1NTGA 1UE1A 4R4OA 3W5OA 4GNXC 3TRZA 4LWCA 3CCUA 2GVBA 3RN5A 1Q12A 2B63G 1Y1VG 5EAYA 2KBNA 4IJHA 4K0KQ 3KF8B 2RF4A 2RHQB 4GKJQ 1PA6A 3UDFA 3CCJA 1UE6A 4X6AH 1QZHA 1AE3A 3TREA 1U5KA 3NEMA 3M85A 1O7IA 3J80c 1TXYA 4JI5Q 4X65Q 1Q46A 2UXBL 1GVPA 2UUBQ 2FXQA 4A76A 3ZJYC 4C3HH 4GN5A 2R93H 1HJPA 5GAEC 2Q2TA 3DM3A 1KHIA 4TQUS 4PZ6A 3KOJA 3RZDH 4A3FH 4YWLA 1N8RC 1N32L 3RLFA 3ER0A 1IYJB 3TS2A 5HGQA 5JJIA 4DR2L 3I4OA 1Q1BA 2N49A 3CMAA 3T1HQ 2E5LL 2MFIA 1TWAH 2JA7G 3I4MG 1OXXK 1V1QA 4GNXB 1W3SA 3TS0A 1YITA 1VQCA 2IHFA 1HNXQ 5JJLA 5HY6A 2YV5A 3AFPA 5M3FG 1MKHA 1XPUA 2PQAB 2JA8G 4OWTB 3STBC 4A3MH 4JI0Q 2Q2IA 1XPRA 1PH5A 1VQ9A 2JK8A 3PUZA 3TQYA 1G51A 1JJCB 2ZJQA 4JI6L 4QQBX 2ALYB 4OWXB 2AHOB 3PSIA 3KLWA 2E2JH 4LFBL 2QEXA 4EQ5A 4LFAL 1C9OA 4B3MQ 3K7AH 1PV4A 1X6OA 1N34Q 1VQJA 4XTCS 1PHJA 4BBSH 2DUDA 1XJVA 4LF9L 4UY8C 2C35B 4UPAA 4BY1G 4A3DH 5M5YH 1KRTA 3A74A 1UE5A 1IBLQ 3UE0A 1N33L 1CUKA 3OTOQ 2UU9L 2K5HA 2ZTEA 4P71A 2AWOA 4QJFA 1VQEA 4BBRG 4LF8L 4DR6Q 5IE8A 2IY5B 4PG3A 1LUZA 5GQOA 1L0WA 3U58A 1IZ6A 1KAWA 5C0XG 4A3GG 4IPHA 3A5UA 1J6QA 1I3QH 3M7NA 4A3BG 1UEBA 1PVOA 4AYBE 2Q2HA 3J81j 4MNOA 1S40A 4JYAL 4GOPA 5IP9G 3L2PA 1P8LA 4JBKA 4LF5L 2OTJA 4YCWA 2YYZA 3W1GA 1PYBA 2N78A 3HOYG 2V1CC 1QUQB 3D31A 5C4JH 2UXBQ 2PI2A 3B6YA 4JI8L 1VQ4A 3CCMA 1YI2A 2HT1A 2VZAA 4JI5L 3STBD 2H5XA 3HFZB 4OWWB 4AQYL 2D0OA 1KQSA 4LF4Q 1WFQA 2WB1G 2B3GA 3NBHB 1N32Q 1DGSA 1D7QA 2D0PA 1ASYA 1X54A 1Y1VH 5IYBG 3NENA 1VQHA 2WAQE 4QL5A 1MJCA 5ELNA 4LF6L 4B3RL 4DR3L 1I50H 4HIDA 4ALPA 4GLXA 3GTOH 3G71A 3PO3G 4B3SQ 5LMUL 2K4KA 1VQIA
chains in the Genus database with same CATH superfamily
1BR9A 1NMFA 2XVSA 4RCNA 3S15B 1TY0A 1IL8A 1IYUA 2LMCB 5C4ZA 1SYCA 4LFBQ 3FHWA 1HZ9A 4ME3A 5EGTA 3BZDB 2JA9A 1Q1EA 1FJGL 2AQ1B 1PH2A 2RDHA 3CCEA 5JJZA 3A5ZB 2PQAA 2KHJA 5T1IA 2Z6KC 4JG2A 1U0LA 3HKSA 2ZXRA 2PZTA 1IBLL 2JA8H 2NN6H 4YWKA 1SJHD 1V9PA 1AN8A 2F52A 2A74C 3VYUA 3HOVH 2WFWA 1PRTC 1VQGA 4IUQA 5AFWA 3CCRA 4LF5Q 4N9TA 3K0XA 3TZUA 3M4OH 1SNMA 5JPNC 4WRDA 4FO2A 3J80E 1F77A 3L0OA 4BY1H 4A3IB 1TKWB 1RCVD 3Q6SA 3NPPA 2CQAA 1TWCH 5M5XH 4PV1C 2NBFA 4B3RQ 2WP8J 2B63B 4MN3A 1I4PA 1X9NA 3HOZG 2AWNA 1IHZA 2F0MA 1EY9A 1STHA 2K33A 1BCPF 4C3IG 3VDYA 2K14A 1HHVA 5IYDG 1ONLA 1STAA 1O7YA 3CRLC 4ILWA 1STGA 3NBHA 3T51B 1SE8A 1Y1WH 3NWTA 1MI2A 1CSQA 2PMZB 2QDLA 3SE0A 5M3MG 3VR6A 2JA6G 4C1NK 3J7YW 2KECA 4A3CG 1FJGQ 4CHTB 3K8AA 3HOZB 5EBDA 2NVYB 2YU9B 5CMDA 1BQQT 2QEJC 3J81c 4DK1A 2ICIA 3QJYA 5ELCA 1EL0A 2EJGC 1XTCD 1NNXA 1WCMH 5ELOA 3CCSA 1Q86C 4N8X1 2YTYA 2L15A 5JOBA 1K3RA 2JA5H 1JT8A 3OIPA 3E0EA 5C4XH 1YNXA 1K83H 2Y0SG 1X32A 4DV2L 3JC66 4DV6Q 2TMPA 4HIOA 1HCZA 4HSVA 1HXYD 1F9QA 4DF7A 4J6HA 1SLJA 3S2DH 3FVQA 2QDBA 1M1KC 4DR7L 3TMEA 3FRPB 3MA2B 3BS1A 4I65A 5ELDA 4I7ZC 4A93H 1XNRL 3S14B 1HPCA 2D62A 1LT6D 3K5NA 1Q90A 1LM0A 2E8GA 3RR5A 2Y0SB 4DKAC 1KNEA 3AB9A 4FXKC 2PZWA 5T1GA 4V0BA 2B8GA 4JCVE 2D9UA 3GTQH 4EQNA 5BR8L 4IPCA 3A8JE 3QO2A 2VUMG 1PYSB 1EQRA 3U50C 2PYKA 4A3JH 4JBMA 2ZJPA 3GTMH 2JN4A 1I4HA 3KJPA 1XMOL 1OXTA 1UWVA 4APVA 1L1OC 4B08A 1O80A 1Y69U 2MHVA 4A3DG 1EEFD 3I55A 1KL9A 4JV5L 3ICEA 2J0TD 1YNND 2VUMB 3T1YL 4UP7A 2QILA 4C2MB 3K5LA 4BY7B 1NAPA 1FGBD 4GKKL 2F0HA 1G6PA 3EFXD 2RHSB 5C0XJ 2R92B 1DZ1A 3TP8A 4YCUA 2F0QA 1VQDA 4JI1L 3A7LA 1D1KA 4X64Q 2XRSD 3S16B 1E7ZA 2XGTA 2TSSA 4DR7Q 1GKHA 2O5IC 4QF4A 1IYVA 2ID0A 2X6GA 4GLVB 1XNRQ 3J7AF 3PGZA 4DAYA 1A3UA 2IJ0A 4EQOA 5IT9E 4L63B 4PZ7A 1OXVA 4JI3Q 2E2HB 3FKIB 5IP9H 4K2KA 1GUWA 1Q81C 1TS2A 5BR8Q 4OIKA 2A1AA 4C3JH 1T9HA 4HJ9A 1I4QA 2JQOA 2NZOA 1EYDA 1SNCA 2F3IA 4MTNA 1SXTA 1VQFA 5DAUA 3WOFA 3VYTA 1F2LA 4DAVA 1K0SA 1XNQL 1JC7A 4MHEA 1J8IA 1QVGA 2N88A 5COYA 3R8BA 1UNSA 4FF4A 4OL7A 4JV5Q 1SFOB 3GTGB 5IYCG 3Q8DA 2Z4IA 4ODGA 3MEFA 1VQ7A 1R9TB 2EJFC 2D2CC 4GKKQ 2E74C 2UXDL 2K75A 1HZBA 3NELA 4JI1Q 2BH2A 2F4VL 3U9SA 5M9OA 1E24A 2DGYA 2HIXA 3SDZA 2NVXH 3CC2A 1JOKA 5FOBB 1J5EL 1HZCA 3IFDA 3QWNA 1FVIA 3M3YH 1EYAA 1YIJA 2R93G 3QOJA 1NR4A 2MO0A 1K0RA 3GV6A 1VQPA 5IOCA 1F2ZA 3Q24A 5CV9A 1H9SB 4CGYB 4J1MA 2BH8A 4GKJL 1PZJD 1U4LA 3HP3A 5EPJA 1E2WA 3U4ZA 2M2LA 2G9HD 4A3MG 2R7ZH 1B7YB 2R93B 1YHBA 1JORA 1CKNA 3RZDB 1MSGA 1O7LA 3FP9A 1MSHA 2IX3A 4IQZA 1PH9A 1XNQQ 1HFNA 3J81L 2YTXA 1GJXA 4C3IH 2PPBC 3L3OC 3S1MH 3DWQA 1K28A 1K8OA 3I8ZA 5FLXE 4A3MB 5KGUA 4DN4M 4Y7NH 4Q5VA 5M3MH 2BOSA 1VQNA 1EWHA 2JA6H 4RAUC 1D5XC 1EWIA 2K5DA 2WV6D 2E2JB 2F4VQ 4A3CH 1LT4D 3K7AB 4DXFA 3D4DA 4BBSB 5G3LD 1WTRA 1LTGD 2CH4A 4LUZA 1W6KA 1JMCA 3H0GG 4FP5D 2DY7A 1J5EQ 3NK9A 1KTKA 1Y8NB 1LV9A 3SVMA 2Z0SA 1TS4A 4OX9L 3RZOH 2RDGA 2VL6A 1NTGA 1SE3A 1QE6A 3TRZA 2K1BA 4YIJA 2D5DA 1V1PB 3EA6A 3NP8A 1I3QB 4IJHA 3OWFA 2RF4A 1ICFB 2RHQB 4GKJQ 3RUZA 1PA6A 2B2YA 2NTTA 1K3BC 4RH6A 3TREA 1U5KA 3NEMA 4CKCA 1TXYA 4RHRA 4JI5Q 1HFGA 3OOCA 1GVPA 3K58A 4GN5A 5CV7A 4EGVA 4A3FH 4YWLA 3CKIB 3GQBA 1BCPC 5HGQA 5I9OA 4DR2L 1EFID 3FEWX 4IZ8A 1D5MC 1Q1BA 1IKMA 3P1HA 4Q0FA 1KDBA 3BDLA 3TS0A 2SNSA 1Z6HA 1G8ZD 1RKNA 2YV5A 2PQAB 2JA8G 1PRTB 1EIGA 3STBC 2Q2IA 1PH5A 2JK8A 5KNDA 1A2UA 1NR2A 5CV6A 2ZJQA 4JI6L 1BOSA 3KLWA 4EQ5A 1YNJD 1X6OA 1F2MA 3N52A 4QMGA 4BY1G 4A3DH 1KRTA 1UE5A 3MFGA 2ZTEA 4QJFA 1VQEA 4RKBA 2JA8B 1TQOA 1ZYRC 5FK9C 1BUVT 1KAWA 1B4OA 5J39A 2PNRC 1BO0A 3MC0B 3HOVB 2Q2HA 3ND8A 4L6TB 4JYAL 4GOPA 2OTJA 4YCWA 1TS3A 3M4OB 2WINB 3SK6A 2XIWA 3W3AA 1HQRD 2N78A 5CBAE 1ESRA 1JWSD 4BY1B 1J9OA 1SNOA 2PI2A 2HT1A 3HFZB 1GHJA 4AQYL 1PFMA 4LF4Q 3NBHB 1TWCB 1UEAB 1D7QA 4K8IA 2D0PA 5M5XB 4QUCA 3KF8A 1Y1VH 1VQHA 4LF6L 1SMYC 2F0TA 4ZAIA 4HIDA 5KNCA 5LMUL 2K4KA 3KLRA 1PTOH 2OT2A 2HCCA 1EY4A 4XT3B 4NXML 4K2LA 1Y1WB 1IKLA 4JI6Q 3S2HH 4P74A 3M4YA 5J3BA 1VQLA 3TDQA 4KMUC 1DXMA 3AU7A 2JA5G 1I4XA 3P7JA 1K8GA 2MO1A 4LFCQ 3S24A 1N34L 2EDGA 5DLQE 2DNEA 1M4VA 2K6AA 3LGJA 2Z8LA 3EQLC 1PYWD 2N55A 4U673 3RNUA 1WTPA 1JB7A 4DV7L 5GROA 1FR3A 2CWAA 1LT3D 4GN4B 1TS5A 1B70B 3JAMi 1WCMB 4A93G 1EOVA 5ISRA 4JYAQ 1HNWL 2FMCA 2JA5B 4DA2A 3DM1A 4P72A 1PXUA 4F88A 2FHTA 1VCIA 4QB4A 3ULPA 5C4XB 1K83B 4KI0A 2K32A 4LUVA 2F0WA 4DAMA 3I4LA 4XXEA 1BBXC 1PH6A 4LF7L 1PH4A 2FJ2A 4AQYQ 1YHAA 3S2DB 3IL8A 3NWSA 1YJ9A 3BJUA 4A3JG 2VY3A 3D4WA 1MJEA 2ZM6L 1LTRD 4LF6Q 4A93B 1SNDA 4R4IA 4A4IA 2BDNA 3SK8A 5LMUQ 1LACA 3HOYH 2ICEC 2EQSA 4LMQD 5J1ZA 5CV5A 4B3SL 3PF5A 3M4QA 5CV8A 4NXMQ 3GTQB 1NY4A 2LY7A 3PV0A 4IFDG 4JI2L 1T5EA 3BYTB 2QKIC 1MBYA 2IT1A 4A3JB 1PRTD 2I5LX 3CQZH 2EIFA 3GTMB 3E6ZX 5IYBH 2FFKB 1LO5D 4RGTA 1VQ8A 1Z7TA 4DXGA 1L0YB 1AW7A 3M9BA 4FYDA 1TU2B 5KYIA 4UHVA 4U68A 3DWAA 4DV7Q 1K73C 1ASZA 2CQOA 3UE1A 5JEAG 1LTAD 1HNWQ 1B53A 2KHIA 2A19A 4DAYB 5F2DA 1X3EA 1HTLD 1EQTA 3UDIA 1CKMA 5BN4A 4R9WA 3H0GH 3EVQA 4LF7Q 4YY3L 3TZDA 2R7FA 4C3JG 2ZXPA 4KD4A 3GDEA 5HURA 4HAEA 5D3IB 2ZM6Q 1E22A 4HMJA 2XRQD 1RF2D 1ZEQX 2BE5C 1JB3A 5EKIA 1CSPA 3OMCA 2I0QA 4KY5A 4DPGA 2OXPA 2DJFC 1GO3E 1TIID 1EEID 3OSOA 2B2VA 5IGEA 4ZKBB 4DV5L 4EQPA 1BKBA 4JI2Q 4C3JB 5M5WH 2IL8A 2NB0A 2VQEL 4IOAA 2PZUA 1EU4A 3M4PA 2XNAC 1CQFA 2C9OA 2CFMA 3I7FA 4OXPA 2B2VC 2XSCA 2Z6KA 4HMIA 1KIXA 3P20A 4L5SA 5C5LA 4JOIC 4OHJA 1O78A 2GA4B 3MXGA 1ZXTA 4XQNA 4JK1C 3GO5A 4L8JA 3A0JA 2F0OA 4DNTB 4POFA 5D3DA 1IXRA 4HCSA 1KRSA 5GADC 2PMZE 3K5MA 2F0GA 3F2UA 1EFWA 4S3SA 1SROA 1B3AA 5IY0A 5C0XI 4YY3Q 1GOZA 4DV6L 2PQEA 4FF3A 1QOHA 4O0AA 2VB2X 3RLOA 2NVXB 4DNRB 1I94L 2NTSA 4K6LA 4CKEA 4OIJA 1LABA 3NQTA 2K50A 2MQHA 3GTPH 1YHQA 2R7ZG 3M3YB 1B9NA 5E1FA 3MXNA 3BVZA 4JI7L 4P73A 5I6WA 1JWMD 4JPBW 3PUWA 1EY7A 3H3VI 1CKNB 5KYLA 2E2IH 3S1NH 4IPDA 1WD1A 1STEA 4BA1I 5AJ3L 4DV5Q 4RCOA 1C0AA 2QF7A 1CTMA 1JJGA 5FO8B 2VQEQ 4MIUA 3AFQA 1D8LA 2I5MX 1XTDA 2VQFL 3KF6A 2R7ZB 4HCEA 4CDDC 2L55A 1S5BD 3SK4A 4XIGS 3DHQA 1GM5A 3CU7A 2EY5A 3AYHB 4NPSA 2EXZA 1HNZL 1EIYB 4WJ3M 3L7ZC 1WTHA 4C3IB 3BU2A 1HQMC 2Y0SE 3QIAA 3S1MB 3OWEB 1B3QA 1SYFA 2NYZD 4BXXG 4IOCA 4OGQC 5EPLA 4Y7NB 5M3MB 3I72A 4L5TA 2A69C 2JA6B 4AH6A 4FF1A 4IUPA 1ENCA 2ZTDA 3I4NG 2QGQA 1TR5A 4UP8A 3LX0A 1GUTA 1SNQA 3A8KE 5KRUA 1JQYD 4NB3A 1I94Q 4QY7A 4DV0L 4X64L 1HZAA 3T56B 1AFPA 1WOCA 3URYA 4ZLTF 3JAME 3P75A 4JI7Q 3FMCA 3OYYA 1CA6A 2B29A 3RZOB 2O2LD 2NVTH 1HR0W 1VQKA 4A3FG 3PF4A 3OPOA 4L5RC 2LKVA 1DM0B 1WI5A 4JI3L 5AJ3Q 5FJ8G 3VR2A 3H15A 2A6HC 1SSOA 1NJIC 1OTCA 1ET9A 3NQIA 3E9HA 1GXDC 4F8MA 1PFBA 3BVMA 4X65L 2VQFQ 1L1OA 2H1EA 3CXCA 1IW7C 5H1SE 3O13A 4AYBG 3PIPA 4OELB 3NXWA 2PI2E 4A3FB 3CP0A 3D6WA 3HOXH 2E5LQ 3A8IE 1HNZQ 1X3GA 3UDGA 3D4RA 1MGSA 4PMCA 5I4DA 3G4SA 1E3PA 5GAGC 4FF2A 1OXUA 3QOLA 1SE4A 4HJ8A 3CD6A 3I91A 4IFDH 1HNXL 1CZWA 2R3ZA 1STNA 4JI0L 4KKUA 3DLLA 1A3VA 4H7BA 5JAVA 3HOWH 3S1QH 5IP7G 3I3CA 4LF9Q 3NTKA 1BNZA 1YVCA 4HR7B 4GOPB 1ICWA 2JEBI 5NUCA 5GAHC 4DV0Q 1KLGD 4KLKA 2L9HA 3KDFA 3CCQA 4A3DB 1SEBD 4TVAB 1HRJA 2QA4A 3RN2A 2EE1A 5JEAH 4R4OA 2KCCA 4GNXC 3W5OA 1GUGA 2Q8IB 2K01A 1X3PA 1Q12A 2F0PA 1Y1VG 2Q8TA 3SK5A 3KF8B 4ZRZA 1CFMA 3VR3A 3KBGA 1QZHA 2F3WA 3M85A 3DEPA 3J80c 3DMUA 4X65Q 1Q46A 4KKSA 1EWCA 4G7OC 1SE2A 3ZJYC 3TP7A 5LL6X 1NUCA 2Q2TA 5A35A 3DM3A 1KHIA 4PZ6A 1CA5A 1CK1A 3T4AC 1N32L 3ER0A 2NZ1D 2L5TA 2EYMA 1TT2A 2K7VA 4X3SA 3TS2A 2WIIB 1ILQA 1Y1VB 3MTSA 2SDFA 2MFIA 3UI2A 1TWAH 3I4MG 1CZGA 3PQIA 5EKLA 1W3SA 2IHFA 1PTOB 1HNXQ 5JJLA 5HY6A 3C46A 3AFPA 1MKHA 2DN8A 3A54A 3W2DA 1LTSD 4JI0Q 1XPRA 2PW7A 1B1ZA 3PUZA 2QW7A 3R3OA 4IURA 3S2HB 1JJCB 4OWXB 3PSIA 2QEXA 1ENFA 1RDPD 4DU9A 1PHJA 4XTCS 5IGCA 1SJED 1EIHA 1XXGA 4UY8C 3TSSA 1SYGA 4HSPA 3A74A 3UE0A 1N33L 1CUKA 2AWOA 4FXDA 2V4DA 5GQOA 4ZYSA 4TRDA 5IGGA 2PO4A 1IZ6A 1BCPD 1D1IA 4K8JA 4M1UB 5CR3A 1UEBA 3M7NA 1PVOA 1EOTA 4X3UA 1SNPA 3FPUB 1S40A 4JBKA 3W1GA 3EJIA 1PYBA 3MVVA 3HOYG 2V1CC 3D31A 3L9AX 4G4KA 5LHY1 1YI2A 2AUKA 4B9XA 3CCMA 2L11A 2L12A 1FYCA 4JI5L 3STBD 4OWWB 1DOMA 2D0OA 2F0UA 1JOQA 4CDCC 1WFQA 2WB1G 4IUVA 3DWPA 1N32Q 2AQ3B 1X54A 3H91A 1VF5C 5IYBG 1WVLA 2IW3A 5ELNA 3C2PA 3LWUA 4DR3L 3EROA 2P5ZX 3GTOH 4XQJA 2ZXOA 3NBIA 3HOYB 1PLFA 3J81i 1SYBA 5C3WA 3OIQA 1ZYRD 4ABNA 2E75C 1L0XB 2KCMA 4LJZC 5FO9B 3E5SA 2IX0A 1H9RA 3CQZB 4DUZL 5I2YA 4IALA 2JA7H 5EQ0A 1B50A 1E1OA 1N33Q 4OO1I 4RMFA 3KFUA 2CVRA 4BXXH 2HQEA 5A2QL 4NXNL 1V43A 4ZCKA 1SMYD 3I4NH 2F0JA 2HD3A 4IUNA 1SMXA 4ME5A 2MNAA 1SYEA 1HH2P 2PNHA 3LNNA 4NP5A 2F0LA 1S5ED 3EIVA 1PRTF 1X65A 3V96A 3H0GB 4EVOA 2KUMA 1LYLA 2KOLA 4BBRH 1GUNA 2HUGA 4PNYA 4LF4L 4X62L 4A3BH 3K7UC 5JPMC 2KEDA 4DR3Q 4DV3L 4MZ9A 1EY6A 5IT9c 3VYSA 2ATWA 3F8TA 1WTVA 1FNWA 3BYYB 5FJ8H 3E0JA 1EU3A 1T5XD 1PZKD 3HRZC 4WFN3 3H3VH 3J7AV 3HKZG 5M5WB 4XQQA 4A3EG 1TWGH 2I5HA 3TP5A 1PTOD 1PDQA 3OMGA 5BN5A 4QCLA 4KHPQ 1H95A 2RDFA 1EQQA 1K8AC 1QVCA 2ZTCA 4ZUJA 4DUZQ 1BBWA 4HJAA 1RODA 1XPOA 1IBML 4LAAA 3CRKC 1KDAA 3PO3H 4LFCL 2CCZA 3MXUA 4UP9A 2RCNA 3CCLA 1U4RA 3BG3A 3D0FA 2HCIA 5TSSA 4DV1L 3AQQA 4NXNQ 2JEAI 3MXNB 4HJ5A 3H3VC 1F2YA 5IP7H 3GTKH 3MXPA 3VA5A 1DCZA 1ET6A 4CKBA 4G57A 3J80L 4G7HC 4CJ0B 2B2UC 1MIUA 3S1RH 1C7YA 4IO9A 1II3A 4ZK9B 2GN5A 4GS3A 3KLSX 3PO2H 4C3HG 4DK3C 3GTPB 1ML0D 5EBCA 4X62Q 3X3MA 2AUJD 1I5FA 2M00A 3KF6B 3MZ5A 1Z47A 4DV3Q 2Z1CA 1VDZA 4R8IA 1N36L 1F9PA 1L2FA 3M7GA 2MUYA 2X69A 4WJ4A 2JYOA 4O42A 2E2IB 3BDCA 3S1NB 4GLAC 4A75A 2LS01 2KJXA 2B2TC 4BS9A 2G5DA 3GD7A 1CQVA 1KC8C 1JE4A 1S5DD 5FO7B 1VS0A 2B39A 5E4XA 4Y52H 2E2DC 4KN4C 2A68C 1HR0L 2I46A 1IBMQ 2K03A 3T53B 3Q23A 2AMCB 1KAAA 1NMGA 2EYHA 3I4MH 4BA2I 4JBJA 1LLRD 1YZ6A 1VMCA 1IL2A 1VQ6A 1FNUA 4DV1Q 1U4MA 4YCVA 1A15A 4XYOA 5IWAL 4AIMA 1XMQL 4RGMA 1YEZA 1S72A 3UDXA 1G291 4JW0A 5FLXc 3J7ZC 3F2BA 3G7LA 3C1FA 2BE5D 3T16A 4A3KH 3ND9A 3I2ZA 5C44H 1TVXA 3GTJH 1Q7YC 3HOUH 4XT1B 1QNKA 1NSNS 3S9WA 3ERQA 3AMUA 4ZQ3A 1WTWA 4CJ2C 5J22A 2IX1A 4IJLA 5E4WC 2UUCL 4KY7A 3PUYA 4DUYQ 3TP6A 1L1OB 3GP7A 2JE6I 1OO9B 3QB3A 1EYGA 2NVTB 1N36Q 1XWEA 3CPFA 1TWFH 2NVQH 3HOXG 1YJNA 2J4XA 3OW7A 5BN3A 4O2DA 4H13C 2KHSA 4ZKCB 5DEHA 4A3LH 2A6EC 1V1OA 5DNFA 2KVMA 1LTTD 4DK0A 5I9PA 1EZ6A 5C3EH 3EN2A 4RWSC 5IGBA 1RJTA 4RG1A 1LT5D 1HR0Q 4K14A 1LTLA 3I90A 2F0KA 4DFAA 1A0IA 1MD2D 1A62A 4J8QA 3U4VA 3HOWG 3HOXB 1QJOA 1JJ2A 1SRUA 1D5ZC 3J81E 1C4QA 1VMPA 4DK6C 1PH7A 3HZXA 3D6CA 4N9PA 2PCFB 2C5CA 5CC4A 3CMEA 1W2BA 1XMQQ 4BWGB 3V05A 5IWAQ 3I56A 3MFYA 1CM9A 2B8FA 4DV4L 3KDFB 4PMWA 3EBEA 5JVH3 1JR0D 2H4OA 1H9JA 4P75A 5C3XA 1QCBD 4HN7A 2ZJRA 3HOWB 3S1QB 1KXLA 3G6EA 2DJGC 2XWBB 2KCTA 3Q0AA 1I4GA 2YTVA 4P2CB 3W1BA 1DYQA 3RLNA 1A3TA 3G6JB 4DR5Q 1A63A 2BA0A 2UUCQ 2K52A 4QIWE 2R61A 3CC4A 4R4TA 3ITPA 3GTLH 1RTNA 1PH1A 5IT9L 4RGOS 1KNAA 1PMRA 1VQOA 5KNBA 1WD0A 1X55A 2K05A 1EY8A 4KV6A 1U9RA 4K5WA 4XDXA 3FPPA 2LXJA 3VYRA 2MJ8A 3F1ZA 4JVZA 2UUBL 4CDEC 4JOIA 1QNUA 4IFDJ 2A69D 1GHKA 2KEEA 1BF4A 1PFSA 5LMNW 1H9MA 3ULLA 3CAMA 4HEDA 1GUSA 1O7ZA 1TWAB 5IIFA 1RD9D 3A55A 4RFBA 5E7NA 5FLMH 4QIWB 4C1NI 4DV4Q 2SNMA 4A3EH 1QG7A 1XX8A 2RA4A 3ERSX 3S17H 1TWHH 2KA7A 1YBYA 1F9RA 5JEAJ 1I4RA 4KTAA 1RL2A 4KN7C 1DONA 1B44D 1A8VA 2A6HD 5HGTA 4A3IG 5K36G 3KYHC 1KD1C 1QZGA 4G7ZC 3DUZA 5C5MA 3NE5B 3OTOL 1IW7D 3T13A 3GV3A 3SXHA 4LWCA 3CCUA 2GVBA 5EPKA 4OO1H 2B63G 3HEJA 1PZID 1SDFA 3CCJA 4X6AH 1AE3A 2VXWA 3OHXC 2RKSA 2UXBL 2OEOA 2NUCA 4KJNA 2UUBQ 4A76A 4C3HH 4KY6A 2J7ZA 1HJPA 3D3RA 3R93A 3KOJA 4IUTA 3MEHA 1IYJB 2BDOA 2WKCA 1QB5D 1AEXA 2E76C 2IPKD 3KLSA 1ENAA 3CMAA 2E5LL 2N49A 4RKLA 2ENBA 3NSWA 2L0CA 2JA7G 1E2VA 1OXXK 2F0FA 3GTOB 1EY0A 3IKJA 3C1EA 2SOBA 2CH4W 1XPUA 3NHHA 2CW0C 3NUCA 5FLXL 1F9SA 4QQBX 3I70A 2MGSA 2ALYB 1JCKB 2AHOB 3BVGA 2F4IA 4LFAL 5CYUA 1D6EC 1VQJA 5D65A 1U4PA 2DUDA 4NDXA 1XJVA 4LF9L 2JA7B 3VR4A 3K6OA 1H9KA 5M5YH 2IWHA 1IBLQ 2MP1A 3OTOQ 2UU9L 4LF8L 2K5HA 4P71A 4BBRG 2IY5B 1BCPB 1L0WA 3A7AB 3U58A 1G91A 1WTQA 5C0XG 3VA7A 5IGDA 1J6QA 3A5UA 4A3BG 4AYBE 3I4NB 2YYZA 5CBEE 5C4JH 2UXBQ 4K5XA 4JI8L 2VZAA 2H5XA 1K8MA 4BBRB 5KEEA 5G3LF 1ESFA 3PMFA 5LL6S 3IAYA 1DGSA 4KK7A 5ELFA 1ASYA 1Q3LA 2PW5A 1G2SA 4A3BB 1G2TA 2WAQE 2EOTA 1I50H 4R8NA 4ALPA 4GLXA 3G71A 3PO3G 4KD3A 1A6XA 1JE5A 1YJWA 2RSNA 2R6GA 1JWUD 1TWGB 3K81C 4AYBB 2WAQG 5DM63 1I6HH 4BY7G 4LFAQ 3X3NA 1VQ5A 4POGA 2R92G 2F0SA 3HS0C 4GNXA 4H02A 4LNQA 3PO3B 1WJJA 2O5JC 4DAPA 2LXKA 2FMMA 2UU9Q 1XYIA 5KIXA 4LF8Q 5CV4A 1SN8A 5M3FH 1WTXA 3ONAB 3PO2G 5IGFA 3ULJA 1FL0A 2WAQB 3BZCA 2XTIA 1HTPA 1UUPA 2L4NA 3FKIG 4FNFA 4DV2Q 3GTKB 1PTOF 2EY1A 4FDBA 1VF7A 1Y14B 4JI8Q 4X3TA 2CHBD 2Q8RE 3S1RB 4PZ8A 3K5OA 2HHHL 2A8VA 1IBKL 3PO2B 1S3OA 3TBIB 4A3GH 3PIP3 1HA6A 2GVAA 2UXCL 5I6YA 2EPBA 4RA8A 4K6DA 1QUQA 2LSSA 3PUXA 3F2CA 1WYDA 2DNCA 3KBXA 1NBWA 3CW2C 2EYOA 2IHEA 3S15H 1Q82C 4XYQA 5K5PA 1CHPD 3NTHA 2A73B 4DR4L 2B2WA 2K5WA 4IUUA 1XMOQ 5EKKA 1PV4A 2VNUD 4YWMA 4A3KG 2WKDA 2F0DA 5JVG3 4DR1L 1EQVA 4NKLA 5C44G 2CWPA 2B2WC 3I4MB 5FKAC 3HOUG 3TN2A 3K80C 4KHZA 1ZKOA 1VQMA 4TSSA 4HIMA 2EVBA 1AE2A 1FD7D 3KJOA 3T1YQ 3OW2A 2OCEA 3LWEA 2F1MA 4L5QA 3IFTA 1M8AA 2R7DA 3TEHB 4JI4L 2SEBD 2EY6A 3MAQA 2WB1E 4A3KB 1I6VC 3MWYW 1GUOA 3PCOB 1QVFA 5C44B 3GTJB 4A3IH 1VQAA 4JC0A 5K36H 2VB3X 3HOUB 2JSOA 4A3LG 2HHHQ 2EYPA 1IBKQ 1FGUA 1G6ZA 4HTHA 4FXGC 2XWJB 5C3EG 1YNNC 2ES2A 2UXCQ 3JAMc 3AEVA 2K5VA 1B9MA 4EX5A 2B63H 1R4PB 1TWFB 2NVQB 4F7XA 1EIFA 2AKWB 3ZYYX 1D2BA 2FINB 1GD7A 1PH3A 4PQXA 1SBBB 2F0VA 3PIOA 1QILA 1S4ZA 2K5NA 4DR4Q 1CKOA 2L1BA 1TY2A 1MHWC 5C3EB 3K57A 2WB1B 4H0LC 4WJWA 4KHPL 4DR1Q 4IN3A 3HOZH 1SAPA 2NN6I 2NVYH 4BBSG 1E2ZA 2YU9H 2VS1A 3IRBA 3N6RA 5IYDH 2RCFA 3SEBA 1OXSC 2HIVA 4JBWA 1B8AA 4HJ7A 2BCOA 4JI4Q 2UXDQ 1V8QA 2Z9HA 1LTID 2UUAL 4GN3B 2KCNA 1UAPA 5LMNL 4OONA 3QG1A 2CKZB 2JJQA 4YHHL 1CI3M 1SR3A 1HUMA 3V2TA 1AZPA 4H44C 4B3TL 2N8NA 2KENA 1UE7A 1KDCA 3E3XA 5C0XH 3F2DA 4LUOA 3S14H 1FNVA 3HKZE 2A68D 3GTLB 1S5CD 1BXTA 3CPWA 2Z6BA 1B2TA 2F0EA 4J15A 3CHBD 3U9OA 5ELEA 2HDMA 4E6IA 5FLMG 2F0NA 3WWVA 2WACA 1STYA 2N3SA 3D8GA 3SGIA 3PIO3 1RHPA 3CF5A 2B2YC 1WTOA 1KABA 3CC7A 1Q8KA 3I73A 5ELBA 1Y8PB 3PUVA 2LFNA 4C56C 2Q2UA 2OWOA 1VQBA 1E1TA 4QGUA 3A56A 1PH8A 1N9WA 1JOOA 1DJRD 1X3FA 2EJMA 4M8AA 1Q8IA 1EUJA 2EZVA 3Q22A 4R4QA 4LK1C 2JP1A 5JJKA 2BA1A 2OTLA 2VUMH 2NN6G 4ZUIA 3HKZB 3BZKA 4A3EB 4C2MH 2M9VA 1X3QA 3S17B 1TWHB 2B2UA 4BY7H 1X56A 2RVLA 4IPGA 3HOVG 2UUAQ 1NE3A 4OO1G 4O1NA 2R92H 5LMNQ 3WDNA 4YHHQ 3C3LA 2NZHA 3S16H 2A6ED 1JICA 4X66L 3J80i 4KJOA 1C48A 4B3TQ 4OX9Q 1HA5A 3G48A 1BVSA 4R4CA 3VR5A 5DM73 4NW2A 4DGZA 3RD4A 4DUYL 5IODA 1RIPA 2E2HH 3FKIH 2B2TA 2X6LA 4K0KL 1STBA 4GZYC 4X3KA 5C6AA 2VW9A 1LTBD 1CT1D 4HIKA 2KQ3A 4GOPC 4DNIA 3E9IA 5L37A 1Y1WG 4C3HB 1S5FD 2XN9C 1A2TA 3DEOA 3CCVA 3SR1A 3HG9A 5EJWA 3H94A 4DR2Q 4IFDI 2EYFA 1AZQA 3J7A5 1P16A 3T1HL 1NCVA 2EXDA 2EYJA 4CDFC 1SFOH 3NTIA 3GTGH 3KUPA 1R9TH 4FVMA 2F0IA 4RHSA 3DXJC 3H09A 1WCMG 2EYLA 2HQLA 5I2XA 2F03A 2K5QA 2Z4HA 4RGNA 1Z9FA 1AH9A 1BBUA 3K59A 5C4XG 1AP0A 4B3ML 2OQKA 4X66Q 4LW1A 4N8FA 2G9DA 2RQXA 3FDTA 1M90C 4R1JA 2JXMB 5M5YB 1K9MC 2ASBA 5IYCH 4OEMB 1Y8OB 4I7AA 4DR5L 3JAML 4DR6L 2OQ0A 1HUNA 1UE1A 1EZ8A 1PTOC 4KKTA 2DY8A 3RN5A 3RMHA 4CBVA 4KHVA 5CGKA 5EAYA 4PMBA 2KBNA 1PFNA 4K0KQ 1YNJC 5CORA 3UDFA 2F3VA 1UE6A 1KLUD 1O7IA 2K04A 5C4JB 3H6MA 2RBMA 4Z9CB 1BDOA 1EY5A 2FXQA 2OF1A 4CJ1B 2R93H 4WORA 5GAEC 3MHBA 4TQUS 3RZDH 1N8RC 4K5VA 4QUFA 3RLFA 4NMZA 1H9SA 1W6JA 4V190 3KK7A 5JJIA 3I4OA 5C4HA 1I50B 3T1HQ 2QCPX 1V1QA 2O4XA 1DD2A 2NWGA 4GNXB 3QR8A 1YITA 1RTOA 1VQCA 4TKOB 4UAIA 5M3FG 1QWYA 4OWTB 4A3MH 1C8CA 2EY2A 1VQ9A 3TQYA 1G51A 1I6HB 2E2JH 4LFBL 1ILPA 1C9OA 4B3MQ 3K7AH 1CHQD 2ZT9C 1N34Q 4BBSH 4MTKA 4B9WA 2C35B 1DOKA 4UPAA 4ULLA 4ID6A 4DR6Q 5M3FB 3R2TA 5IE8A 3SHLA 4PG3A 1LUZA 3WOEA 5A2QE 4A3GG 4IPHA 1I3QH 2HDLA 1E0BA 3J81j 4MNOA 5IP9G 3HGBA 1P8LA 3L2PA 4LF5L 2RSOA 1EYCA 4F87A 1QUQB 1VQ4A 3B6YA 5E3FA 3BDOA 2CW0D 3R2IA 1KQSA 1V1PA 2B3GA 2MPMA 1R4QB 2I07B 4A3GB 4UDUC 3K0YA 3NENA 1SYDA 2A5HA 4QL5A 1MJCA 5D14A 4B3RL 1DOLA 2AQ2B 4B3SQ 1VQIA 2K28A
chains in the Genus database with same CATH topology
1NMFA 1JE5A 4NXML 1YJWA 2R6GA 4JI6Q 3S2HH 3K81C 4P74A 1I6HH 2WAQG 5J3BA 2KCMA 1VQLA 3FHWA 1HZ9A 4ME3A 4BY7G 4LFBQ 4LFAQ 2IX0A 1VQ5A 2JA5G 1K8GA 4POGA 2R92G 2MO1A 4DUZL 2JA9A 4LFCQ 1Q1EA 1FJGL 4GNXA 3S24A 2JA7H 4H02A 1N34L 4LNQA 1WJJA 5DLQE 1PH2A 1E1OA 1N33Q 2LXKA 3CCEA 3LGJA 3A5ZB 2PQAA 2UU9Q 4LF8Q 4OO1I 2KHJA 1SN8A 2Z6KC 4JG2A 1U0LA 3HKSA 4RMFA 5M3FH 3RNUA 1JB7A 1IBLL 4DV7L 2JA8H 3KFUA 4YWKA 5GROA 4BXXH 3PO2G 2CWAA 1V9PA 3ULJA 1FL0A 4GN4B 2F52A 2XTIA 3BZCA 4NXNL 3JAMi 1B70B 1V43A 3HOVH 4A93G 1EOVA 2WFWA 4JYAQ 1VQGA 1HNWL 3CCRA 4LF5Q 3FKIG 3I4NH 4DV2Q 4P72A 1SMXA 3K0XA 3M4OH 1VCIA 2MNAA 3ULPA 1HH2P 2PNHA 4KI0A 4FDBA 4LUVA 1Y14B 3L0OA 3EIVA 4BY1H 4JI8Q 1X65A 4DAMA 1LYLA 1PH6A 4LF7L 1PH4A 4PZ8A 4BBRH 4AQYQ 1YHAA 2HHHL 2A8VA 1IBKL 1TWCH 1S3OA 5M5XH 1YJ9A 4A3GH 3BJUA 4LF4L 2GVAA 4X62L 2VY3A 3K7UC 4A3JG 1MJEA 2ZM6L 4A3BH 2UXCL 4LF6Q 4B3RQ 2WP8J 4DR3Q 4DV3L 4MZ9A 5IT9c 2ATWA 3F8TA 1X9NA 3HOZG 2AWNA 4R4IA 1QUQA 4A4IA 5FJ8H 2LSSA 3PUXA 3F2CA 1WYDA 5LMUQ 3HOYH 3VDYA 2EQSA 2K14A 1NBWA 1JMCA 5IYDG 3CW2C 3PF5A 3M4QA 2IHEA 4B3SL 3S15H 1Q82C 4NXMQ 1NY4A 3H3VH 3PV0A 4IFDG 1SE8A 4JI2L 1Y1WH 3HKZG 4A3EG 1CSQA 1TWGH 2I5HA 4DR4L 2IT1A 5M3MG 2JA6G 4KHPQ 1H95A 2I5LX 3CQZH 1XMOQ 1EQQA 2EIFA 4YWMA 5IYBH 4A3KG 1QVCA 2ZTCA 4DUZQ 1K8AC 1BBWA 4HJAA 1FJGQ 1VQ8A 4A3CG 1XPOA 1IBML 3K8AA 4DR1L 5C44G 3M9BA 3PO3H 2CWPA 4LFCL 2CCZA 3J81c 4UP9A 3HOUG 2RCNA 3CCLA 3K80C 4KHZA 1VQMA 3D0FA 4DV7Q 4HIMA 4DV1L 1K73C 1ASZA 1AE2A 3KJOA 3AQQA 3T1YQ 3OW2A 2CQOA 2OCEA 3UE1A 5JEAG 4NXNQ 4L5QA 2JEAI 2R7DA 1HNWQ 1WCMH 5ELOA 3TEHB 3CCSA 1Q86C 4JI4L 2YTYA 3MXNB 4HJ5A 2L15A 2KHIA 1K3RA 2JA5H 2WB1E 2A19A 5IP7H 3E0EA 4DAYB 3GTKH 1JT8A 1X3EA 3PCOB 5C4XH 1YNXA 1K83H 3UDIA 2Y0SG 4DV2L 1QVFA 3JC66 4DV6Q 1CKMA 4A3IH 1VQAA 4JC0A 4HIOA 3H0GH 4LF7Q 1MIUA 4YY3L 3S1RH 1C7YA 4A3LG 4IO9A 2R7FA 2HHHQ 3GDEA 1IBKQ 1FGUA 1SLJA 2GN5A 4GS3A 3S2DH 3PO2H 4DK3C 5C3EG 1M1KC 4DR7L 2ES2A 2UXCQ 4X62Q 3JAMc 3AEVA 2ZM6Q 1I5FA 1E22A 4A93H 1XNRL 2K5VA 3KF6B 1Z47A 4DV3Q 4EX5A 2B63H 1N36L 1L2FA 2D62A 2E8GA 1LM0A 1CSPA 1EIFA 2AKWB 3RR5A 2I0QA 4WJ4A 4DKAC 4DPGA 1GD7A 4GLAC 1GO3E 4A75A 4JCVE 4DV5L 1PH3A 3GTQH 1BKBA 4JI2Q 5BR8L 3PIOA 2K5NA 4IPCA 5M5WH 4DR4Q 1CKOA 2VUMG 4IOAA 1PYSB 1EQRA 2VQEL 3GD7A 3M4PA 3U50C 1KC8C 2CFMA 4A3JH 4JBMA 1VS0A 3I7FA 2ZJPA 3GTMH 4OXPA 4Y52H 1HR0L 1IBMQ 2Z6KA 3KJPA 4DR1Q 1XMOL 4KHPL 1OXTA 1UWVA 2AMCB 2NN6I 4APVA 2NVYH 1KIXA 3HOZH 1NMGA 1L1OC 4BBSG 4L5SA 2YU9H 2VS1A 3IRBA 3I4MH 4BA2I 4JBJA 4JOIC 1YZ6A 5IYDH 4A3DG 1IL2A 1VQ6A 3I55A 4DV1Q 3GO5A 4YCVA 1XMQL 5IWAL 4AIMA 1OXSC 1KL9A 3A0JA 4JV5L 2HIVA 4JBWA 3ICEA 1YEZA 1B8AA 4HJ7A 4UP7A 3UDXA 1G291 3T1YL 4POFA 1S72A 5FLXc 4JI4Q 3J7ZC 2UXDQ 1IXRA 3F2BA 1KRSA 5GADC 2PMZE 4A3KH 4GKKL 1G6PA 3I2ZA 2RHSB 2UUAL 1EFWA 5C0XJ 4GN3B 5C44H 4YCUA 1SROA 1VQDA 4JI1L 5IY0A 3GTJH 5LMNL 4OONA 1Q7YC 5C0XI 2CKZB 4YY3Q 3HOUH 4DV6L 2JJQA 4X64Q 4YHHL 4O0AA 1SR3A 3RLOA 1E7ZA 1I94L 2XGTA 2IX1A 4DR7Q 2K50A 2MQHA 4B3TL 1GKHA 3GTPH 2N8NA 4IJLA 1YHQA 2UUCL 2R7ZG 2KENA 2ID0A 1UE7A 3PUYA 4DUYQ 4GLVB 4JI7L 1XNRQ 4P73A 1L1OB 1EYGA 2JE6I 3PGZA 4LUOA 3F2DA 3S14H 1N36Q 3HKZE 3PUWA 3CPFA 4PZ7A 1TWFH 2NVQH 3HOXG 1OXVA 1CKNB 1YJNA 3H3VI 4JI3Q 3CPWA 5IP9H 2E2IH 4J15A 3S1NH 4IPDA 1Q81C 4O2DA 4BA1I 5AJ3L 4DV5Q 1C0AA 5BR8Q 4A3LH 1JJGA 2A1AA 4C3JH 1T9HA 5FLMG 3WWVA 2VQEQ 3AFQA 4HJ9A 2N3SA 3SGIA 1D8LA 2I5MX 3CF5A 5C3EH 1XTDA 2VQFL 2JQOA 2NZOA 3EN2A 3KF6A 2F3IA 4MTNA 3CC7A 1Q8KA 4RG1A 1HR0Q 1LTLA 4XIGS 1GM5A 1VQFA 1A0IA 3PUVA 1A62A 2Q2UA 3U4VA 2OWOA 3HOWG 3AYHB 4NPSA 1VQBA 1JJ2A 1SRUA 1E1TA 4QGUA 1HNZL 1EIYB 1XNQL 4WJ3M 4DK6C 3L7ZC 1PH7A 1QVGA 1PH8A 1N9WA 3CMEA 1X3FA 1W2BA 1XMQQ 5IWAQ 3BU2A 3I56A 2Y0SE 4JV5Q 1EUJA 4R4QA 5JJKA 5IYCG 4DV4L 2BA1A 3KDFB 4PMWA 2OTLA 3EBEA 2NN6G 3Q8DA 2VUMH 3BZKA 4IOCA 4BXXG 4C2MH 4P75A 3J81i 3MEFA 1VQ7A 4BY7H 1X56A 4GKKQ 4IPGA 4L5TA 3HOVG 2UXDL 4AH6A 2ZJRA 1NE3A 2K75A 2UUAQ 4OO1G 1HZBA 2R92H 2ZTDA 3I4NG 3NELA 2QGQA 4JI1Q 5LMNQ 3G6EA 4UP8A 2BH2A 2F4VL 1KXLA 2KCTA 1E24A 4YHHQ 2DGYA 2YTVA 3W1BA 4NB3A 1I94Q 2HIXA 2NZHA 2NVXH 3S16H 3RLNA 4QY7A 4DV0L 3CC2A 4X66L 4X64L 1HZAA 3J80i 4DR5Q 1A63A 1J5EL 1HZCA 2BA0A 4B3TQ 4OX9Q 3G48A 1FVIA 2UUCQ 1BVSA 1WOCA 3M3YH 4JI7Q 4R4CA 3OYYA 2K52A 1YIJA 2B29A 4QIWE 2R93G 3CC4A 4R4TA 2MO0A 2NVTH 1K0RA 1HR0W 1VQPA 1VQKA 4A3FG 4DUYL 3GTLH 1RIPA 3PF4A 1PH1A 4L5RC 2E2HH 3FKIH 1WI5A 4JI3L 1VQOA 4K0KL 2BH8A 5AJ3Q 5FJ8G 3H15A 4GKJL 1NJIC 1OTCA 1X55A 2VW9A 3E9HA 2VNUD 4HIKA 3U4ZA 4X65L 2VQFQ 2LXJA 4DNIA 4GOPC 1L1OA 3E9IA 3CXCA 4A3MG 1Y1WG 2R7ZH 1B7YB 3F1ZA 5H1SE 2UUBL 1YHBA 4AYBG 3PIPA 4JOIA 2PI2E 4IFDJ 1CKNA 3CCVA 3CP0A 1PFSA 3FP9A 3HOXH 4DR2Q 4IFDI 5LMNW 1PH9A 2E5LQ 1HNZQ 1XNQQ 1X3GA 3ULLA 3UDGA 3J7A5 1P16A 3CAMA 2YTXA 3G4SA 3T1HL 1E3PA 4C3IH 5GAGC 2EXDA 1OXUA 3S1MH 1SFOH 5E7NA 5FLMH 4DV4Q 4HJ8A 3CD6A 3GTGH 1HNXL 4A3EH 3ERSX 4JI0L 3S17H 1TWHH 1R9TH 4Y7NH 5M3MH 3DLLA 1VQNA 2JA6H 1WCMG 2HQLA 1YBYA 5JEAJ 3HOWH 1RL2A 3S1QH 1EWIA 1AH9A 1Z9FA 1BBUA 2F4VQ 5IP7G 4A3CH 5C4XG 4LF9Q 1A8VA 4B3ML 1YVCA 2OQKA 4GOPB 2JEBI 4LUZA 5GAHC 4DV0Q 4X66Q 3KYHC 3H0GG 4LW1A 4A3IG 4KLKA 5K36G 1J5EQ 1KD1C 3KDFA 4R1JA 3CCQA 1M90C 4TVAB 1QZGA 1K9MC 2ASBA 5IYCH 2QA4A 2Z0SA 3OTOL 4DR5L 4OX9L 3RN2A 3RZOH 4DR6L 2VL6A 2OQ0A 1NTGA 1UE1A 4R4OA 3W5OA 4GNXC 3TRZA 4LWCA 3CCUA 2GVBA 3RN5A 1Q12A 2B63G 1Y1VG 5EAYA 2KBNA 4IJHA 4K0KQ 3KF8B 2RF4A 2RHQB 4GKJQ 1PA6A 3UDFA 3CCJA 1UE6A 4X6AH 1QZHA 1AE3A 3TREA 1U5KA 3NEMA 3M85A 1O7IA 3J80c 1TXYA 4JI5Q 4X65Q 1Q46A 2UXBL 1GVPA 2UUBQ 2FXQA 4A76A 3ZJYC 4C3HH 4GN5A 2R93H 1HJPA 5GAEC 2Q2TA 3DM3A 1KHIA 4TQUS 4PZ6A 3KOJA 3RZDH 4A3FH 4YWLA 1N8RC 1N32L 3RLFA 3ER0A 1IYJB 3TS2A 5HGQA 5JJIA 4DR2L 3I4OA 1Q1BA 2N49A 3CMAA 3T1HQ 2E5LL 2MFIA 1TWAH 2JA7G 3I4MG 1OXXK 1V1QA 4GNXB 1W3SA 3TS0A 1YITA 1VQCA 2IHFA 1HNXQ 5JJLA 5HY6A 2YV5A 3AFPA 5M3FG 1MKHA 1XPUA 2PQAB 2JA8G 4OWTB 3STBC 4A3MH 4JI0Q 2Q2IA 1XPRA 1PH5A 1VQ9A 2JK8A 3PUZA 3TQYA 1G51A 1JJCB 2ZJQA 4JI6L 4QQBX 2ALYB 4OWXB 2AHOB 3PSIA 3KLWA 2E2JH 4LFBL 2QEXA 4EQ5A 4LFAL 1C9OA 4B3MQ 3K7AH 1PV4A 1X6OA 1N34Q 1VQJA 4XTCS 1PHJA 4BBSH 2DUDA 1XJVA 4LF9L 4UY8C 2C35B 4UPAA 4BY1G 4A3DH 5M5YH 1KRTA 3A74A 1UE5A 1IBLQ 3UE0A 1N33L 1CUKA 3OTOQ 2UU9L 2K5HA 2ZTEA 4P71A 2AWOA 4QJFA 1VQEA 4BBRG 4LF8L 4DR6Q 5IE8A 2IY5B 4PG3A 1LUZA 5GQOA 1L0WA 3U58A 1IZ6A 1KAWA 5C0XG 4A3GG 4IPHA 3A5UA 1J6QA 1I3QH 3M7NA 4A3BG 1UEBA 1PVOA 4AYBE 2Q2HA 3J81j 4MNOA 1S40A 4JYAL 4GOPA 5IP9G 3L2PA 1P8LA 4JBKA 4LF5L 2OTJA 4YCWA 2YYZA 3W1GA 1PYBA 2N78A 3HOYG 2V1CC 1QUQB 3D31A 5C4JH 2UXBQ 2PI2A 3B6YA 4JI8L 1VQ4A 3CCMA 1YI2A 2HT1A 2VZAA 4JI5L 3STBD 2H5XA 3HFZB 4OWWB 4AQYL 2D0OA 1KQSA 4LF4Q 1WFQA 2WB1G 2B3GA 3NBHB 1N32Q 1DGSA 1D7QA 2D0PA 1ASYA 1X54A 1Y1VH 5IYBG 3NENA 1VQHA 2WAQE 4QL5A 1MJCA 5ELNA 4LF6L 4B3RL 4DR3L 1I50H 4HIDA 4ALPA 4GLXA 3GTOH 3G71A 3PO3G 4B3SQ 5LMUL 2K4KA 1VQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMF A;  1JE5 A;  4NXM L;  1YJW A;  2R6G A;  4JI6 Q;  3S2H H;  3K81 C;  4P74 A;  1I6H H;  2WAQ G;  5J3B A;  2KCM A;  1VQL A;  3FHW A;  1HZ9 A;  4ME3 A;  4BY7 G;  4LFB Q;  4LFA Q;  2IX0 A;  1VQ5 A;  2JA5 G;  1K8G A;  4POG A;  2R92 G;  2MO1 A;  4DUZ L;  2JA9 A;  4LFC Q;  1Q1E A;  1FJG L;  4GNX A;  3S24 A;  2JA7 H;  4H02 A;  1N34 L;  4LNQ A;  1WJJ A;  5DLQ E;  1PH2 A;  1E1O A;  1N33 Q;  2LXK A;  3CCE A;  3LGJ A;  3A5Z B;  2PQA A;  2UU9 Q;  4LF8 Q;  4OO1 I;  2KHJ A;  1SN8 A;  2Z6K C;  4JG2 A;  1U0L A;  3HKS A;  4RMF A;  5M3F H;  3RNU A;  1JB7 A;  1IBL L;  4DV7 L;  2JA8 H;  3KFU A;  4YWK A;  5GRO A;  4BXX H;  3PO2 G;  2CWA A;  1V9P A;  3ULJ A;  1FL0 A;  4GN4 B;  2F52 A;  2XTI A;  3BZC A;  4NXN L;  3JAM i;  1B70 B;  1V43 A;  3HOV H;  4A93 G;  1EOV A;  2WFW A;  4JYA Q;  1VQG A;  1HNW L;  3CCR A;  4LF5 Q;  3FKI G;  3I4N H;  4DV2 Q;  4P72 A;  1SMX A;  3K0X A;  3M4O H;  1VCI A;  2MNA A;  3ULP A;  1HH2 P;  2PNH A;  4KI0 A;  4FDB A;  4LUV A;  1Y14 B;  3L0O A;  3EIV A;  4BY1 H;  4JI8 Q;  1X65 A;  4DAM A;  1LYL A;  1PH6 A;  4LF7 L;  1PH4 A;  4PZ8 A;  4BBR H;  4AQY Q;  1YHA A;  2HHH L;  2A8V A;  1IBK L;  1TWC H;  1S3O A;  5M5X H;  1YJ9 A;  4A3G H;  3BJU A;  4LF4 L;  2GVA A;  4X62 L;  2VY3 A;  3K7U C;  4A3J G;  1MJE A;  2ZM6 L;  4A3B H;  2UXC L;  4LF6 Q;  4B3R Q;  2WP8 J;  4DR3 Q;  4DV3 L;  4MZ9 A;  5IT9 c;  2ATW A;  3F8T A;  1X9N A;  3HOZ G;  2AWN A;  4R4I A;  1QUQ A;  4A4I A;  5FJ8 H;  2LSS A;  3PUX A;  3F2C A;  1WYD A;  5LMU Q;  3HOY H;  3VDY A;  2EQS A;  2K14 A;  1NBW A;  1JMC A;  5IYD G;  3CW2 C;  3PF5 A;  3M4Q A;  2IHE A;  4B3S L;  3S15 H;  1Q82 C;  4NXM Q;  1NY4 A;  3H3V H;  3PV0 A;  4IFD G;  1SE8 A;  4JI2 L;  1Y1W H;  3HKZ G;  4A3E G;  1CSQ A;  1TWG H;  2I5H A;  4DR4 L;  2IT1 A;  5M3M G;  2JA6 G;  4KHP Q;  1H95 A;  2I5L X;  3CQZ H;  1XMO Q;  1EQQ A;  2EIF A;  4YWM A;  5IYB H;  4A3K G;  1QVC A;  2ZTC A;  4DUZ Q;  1K8A C;  1BBW A;  4HJA A;  1FJG Q;  1VQ8 A;  4A3C G;  1XPO A;  1IBM L;  3K8A A;  4DR1 L;  5C44 G;  3M9B A;  3PO3 H;  2CWP A;  4LFC L;  2CCZ A;  3J81 c;  4UP9 A;  3HOU G;  2RCN A;  3CCL A;  3K80 C;  4KHZ A;  1VQM A;  3D0F A;  4DV7 Q;  4HIM A;  4DV1 L;  1K73 C;  1ASZ A;  1AE2 A;  3KJO A;  3AQQ A;  3T1Y Q;  3OW2 A;  2CQO A;  2OCE A;  3UE1 A;  5JEA G;  4NXN Q;  4L5Q A;  2JEA I;  2R7D A;  1HNW Q;  1WCM H;  5ELO A;  3TEH B;  3CCS A;  1Q86 C;  4JI4 L;  2YTY A;  3MXN B;  4HJ5 A;  2L15 A;  2KHI A;  1K3R A;  2JA5 H;  2WB1 E;  2A19 A;  5IP7 H;  3E0E A;  4DAY B;  3GTK H;  1JT8 A;  1X3E A;  3PCO B;  5C4X H;  1YNX A;  1K83 H;  3UDI A;  2Y0S G;  4DV2 L;  1QVF A;  3JC6 6;  4DV6 Q;  1CKM A;  4A3I H;  1VQA A;  4JC0 A;  4HIO A;  3H0G H;  4LF7 Q;  1MIU A;  4YY3 L;  3S1R H;  1C7Y A;  4A3L G;  4IO9 A;  2R7F A;  2HHH Q;  3GDE A;  1IBK Q;  1FGU A;  1SLJ A;  2GN5 A;  4GS3 A;  3S2D H;  3PO2 H;  4DK3 C;  5C3E G;  1M1K C;  4DR7 L;  2ES2 A;  2UXC Q;  4X62 Q;  3JAM c;  3AEV A;  2ZM6 Q;  1I5F A;  1E22 A;  4A93 H;  1XNR L;  2K5V A;  3KF6 B;  1Z47 A;  4DV3 Q;  4EX5 A;  2B63 H;  1N36 L;  1L2F A;  2D62 A;  2E8G A;  1LM0 A;  1CSP A;  1EIF A;  2AKW B;  3RR5 A;  2I0Q A;  4WJ4 A;  4DKA C;  4DPG A;  1GD7 A;  4GLA C;  1GO3 E;  4A75 A;  4JCV E;  4DV5 L;  1PH3 A;  3GTQ H;  1BKB A;  4JI2 Q;  5BR8 L;  3PIO A;  2K5N A;  4IPC A;  5M5W H;  4DR4 Q;  1CKO A;  2VUM G;  4IOA A;  1PYS B;  1EQR A;  2VQE L;  3GD7 A;  3M4P A;  3U50 C;  1KC8 C;  2CFM A;  4A3J H;  4JBM A;  1VS0 A;  3I7F A;  2ZJP A;  3GTM H;  4OXP A;  4Y52 H;  1HR0 L;  1IBM Q;  2Z6K A;  3KJP A;  4DR1 Q;  1XMO L;  4KHP L;  1OXT A;  1UWV A;  2AMC B;  2NN6 I;  4APV A;  2NVY H;  1KIX A;  3HOZ H;  1NMG A;  1L1O C;  4BBS G;  4L5S A;  2YU9 H;  2VS1 A;  3IRB A;  3I4M H;  4BA2 I;  4JBJ A;  4JOI C;  1YZ6 A;  5IYD H;  4A3D G;  1IL2 A;  1VQ6 A;  3I55 A;  4DV1 Q;  3GO5 A;  4YCV A;  1XMQ L;  5IWA L;  4AIM A;  1OXS C;  1KL9 A;  3A0J A;  4JV5 L;  2HIV A;  4JBW A;  3ICE A;  1YEZ A;  1B8A A;  4HJ7 A;  4UP7 A;  3UDX A;  1G29 1;  3T1Y L;  4POF A;  1S72 A;  5FLX c;  4JI4 Q;  3J7Z C;  2UXD Q;  1IXR A;  3F2B A;  1KRS A;  5GAD C;  2PMZ E;  4A3K H;  4GKK L;  1G6P A;  3I2Z A;  2RHS B;  2UUA L;  1EFW A;  5C0X J;  4GN3 B;  5C44 H;  4YCU A;  1SRO A;  1VQD A;  4JI1 L;  5IY0 A;  3GTJ H;  5LMN L;  4OON A;  1Q7Y C;  5C0X I;  2CKZ B;  4YY3 Q;  3HOU H;  4DV6 L;  2JJQ A;  4X64 Q;  4YHH L;  4O0A A;  1SR3 A;  3RLO A;  1E7Z A;  1I94 L;  2XGT A;  2IX1 A;  4DR7 Q;  2K50 A;  2MQH A;  4B3T L;  1GKH A;  3GTP H;  2N8N A;  4IJL A;  1YHQ A;  2UUC L;  2R7Z G;  2KEN A;  2ID0 A;  1UE7 A;  3PUY A;  4DUY Q;  4GLV B;  4JI7 L;  1XNR Q;  4P73 A;  1L1O B;  1EYG A;  2JE6 I;  3PGZ A;  4LUO A;  3F2D A;  3S14 H;  1N36 Q;  3HKZ E;  3PUW A;  3CPF A;  4PZ7 A;  1TWF H;  2NVQ H;  3HOX G;  1OXV A;  1CKN B;  1YJN A;  3H3V I;  4JI3 Q;  3CPW A;  5IP9 H;  2E2I H;  4J15 A;  3S1N H;  4IPD A;  1Q81 C;  4O2D A;  4BA1 I;  5AJ3 L;  4DV5 Q;  1C0A A;  5BR8 Q;  4A3L H;  1JJG A;  2A1A A;  4C3J H;  1T9H A;  5FLM G;  3WWV A;  2VQE Q;  3AFQ A;  4HJ9 A;  2N3S A;  3SGI A;  1D8L A;  2I5M X;  3CF5 A;  5C3E H;  1XTD A;  2VQF L;  2JQO A;  2NZO A;  3EN2 A;  3KF6 A;  2F3I A;  4MTN A;  3CC7 A;  1Q8K A;  4RG1 A;  1HR0 Q;  1LTL A;  4XIG S;  1GM5 A;  1VQF A;  1A0I A;  3PUV A;  1A62 A;  2Q2U A;  3U4V A;  2OWO A;  3HOW G;  3AYH B;  4NPS A;  1VQB A;  1JJ2 A;  1SRU A;  1E1T A;  4QGU A;  1HNZ L;  1EIY B;  1XNQ L;  4WJ3 M;  4DK6 C;  3L7Z C;  1PH7 A;  1QVG A;  1PH8 A;  1N9W A;  3CME A;  1X3F A;  1W2B A;  1XMQ Q;  5IWA Q;  3BU2 A;  3I56 A;  2Y0S E;  4JV5 Q;  1EUJ A;  4R4Q A;  5JJK A;  5IYC G;  4DV4 L;  2BA1 A;  3KDF B;  4PMW A;  2OTL A;  3EBE A;  2NN6 G;  3Q8D A;  2VUM H;  3BZK A;  4IOC A;  4BXX G;  4C2M H;  4P75 A;  3J81 i;  3MEF A;  1VQ7 A;  4BY7 H;  1X56 A;  4GKK Q;  4IPG A;  4L5T A;  3HOV G;  2UXD L;  4AH6 A;  2ZJR A;  1NE3 A;  2K75 A;  2UUA Q;  4OO1 G;  1HZB A;  2R92 H;  2ZTD A;  3I4N G;  3NEL A;  2QGQ A;  4JI1 Q;  5LMN Q;  3G6E A;  4UP8 A;  2BH2 A;  2F4V L;  1KXL A;  2KCT A;  1E24 A;  4YHH Q;  2DGY A;  2YTV A;  3W1B A;  4NB3 A;  1I94 Q;  2HIX A;  2NZH A;  2NVX H;  3S16 H;  3RLN A;  4QY7 A;  4DV0 L;  3CC2 A;  4X66 L;  4X64 L;  1HZA A;  3J80 i;  4DR5 Q;  1A63 A;  1J5E L;  1HZC A;  2BA0 A;  4B3T Q;  4OX9 Q;  3G48 A;  1FVI A;  2UUC Q;  1BVS A;  1WOC A;  3M3Y H;  4JI7 Q;  4R4C A;  3OYY A;  2K52 A;  1YIJ A;  2B29 A;  4QIW E;  2R93 G;  3CC4 A;  4R4T A;  2MO0 A;  2NVT H;  1K0R A;  1HR0 W;  1VQP A;  1VQK A;  4A3F G;  4DUY L;  3GTL H;  1RIP A;  3PF4 A;  1PH1 A;  4L5R C;  2E2H H;  3FKI H;  1WI5 A;  4JI3 L;  1VQO A;  4K0K L;  2BH8 A;  5AJ3 Q;  5FJ8 G;  3H15 A;  4GKJ L;  1NJI C;  1OTC A;  1X55 A;  2VW9 A;  3E9H A;  2VNU D;  4HIK A;  3U4Z A;  4X65 L;  2VQF Q;  2LXJ A;  4DNI A;  4GOP C;  1L1O A;  3E9I A;  3CXC A;  4A3M G;  1Y1W G;  2R7Z H;  1B7Y B;  3F1Z A;  5H1S E;  2UUB L;  1YHB A;  4AYB G;  3PIP A;  4JOI A;  2PI2 E;  4IFD J;  1CKN A;  3CCV A;  3CP0 A;  1PFS A;  3FP9 A;  3HOX H;  4DR2 Q;  4IFD I;  5LMN W;  1PH9 A;  2E5L Q;  1HNZ Q;  1XNQ Q;  1X3G A;  3ULL A;  3UDG A;  3J7A 5;  1P16 A;  3CAM A;  2YTX A;  3G4S A;  3T1H L;  1E3P A;  4C3I H;  5GAG C;  2EXD A;  1OXU A;  3S1M H;  1SFO H;  5E7N A;  5FLM H;  4DV4 Q;  4HJ8 A;  3CD6 A;  3GTG H;  1HNX L;  4A3E H;  3ERS X;  4JI0 L;  3S17 H;  1TWH H;  1R9T H;  4Y7N H;  5M3M H;  3DLL A;  1VQN A;  2JA6 H;  1WCM G;  2HQL A;  1YBY A;  5JEA J;  3HOW H;  1RL2 A;  3S1Q H;  1EWI A;  1AH9 A;  1Z9F A;  1BBU A;  2F4V Q;  5IP7 G;  4A3C H;  5C4X G;  4LF9 Q;  1A8V A;  4B3M L;  1YVC A;  2OQK A;  4GOP B;  2JEB I;  4LUZ A;  5GAH C;  4DV0 Q;  4X66 Q;  3KYH C;  3H0G G;  4LW1 A;  4A3I G;  4KLK A;  5K36 G;  1J5E Q;  1KD1 C;  3KDF A;  4R1J A;  3CCQ A;  1M90 C;  4TVA B;  1QZG A;  1K9M C;  2ASB A;  5IYC H;  2QA4 A;  2Z0S A;  3OTO L;  4DR5 L;  4OX9 L;  3RN2 A;  3RZO H;  4DR6 L;  2VL6 A;  2OQ0 A;  1NTG A;  1UE1 A;  4R4O A;  3W5O A;  4GNX C;  3TRZ A;  4LWC A;  3CCU A;  2GVB A;  3RN5 A;  1Q12 A;  2B63 G;  1Y1V G;  5EAY A;  2KBN A;  4IJH A;  4K0K Q;  3KF8 B;  2RF4 A;  2RHQ B;  4GKJ Q;  1PA6 A;  3UDF A;  3CCJ A;  1UE6 A;  4X6A H;  1QZH A;  1AE3 A;  3TRE A;  1U5K A;  3NEM A;  3M85 A;  1O7I A;  3J80 c;  1TXY A;  4JI5 Q;  4X65 Q;  1Q46 A;  2UXB L;  1GVP A;  2UUB Q;  2FXQ A;  4A76 A;  3ZJY C;  4C3H H;  4GN5 A;  2R93 H;  1HJP A;  5GAE C;  2Q2T A;  3DM3 A;  1KHI A;  4TQU S;  4PZ6 A;  3KOJ A;  3RZD H;  4A3F H;  4YWL A;  1N8R C;  1N32 L;  3RLF A;  3ER0 A;  1IYJ B;  3TS2 A;  5HGQ A;  5JJI A;  4DR2 L;  3I4O A;  1Q1B A;  2N49 A;  3CMA A;  3T1H Q;  2E5L L;  2MFI A;  1TWA H;  2JA7 G;  3I4M G;  1OXX K;  1V1Q A;  4GNX B;  1W3S A;  3TS0 A;  1YIT A;  1VQC A;  2IHF A;  1HNX Q;  5JJL A;  5HY6 A;  2YV5 A;  3AFP A;  5M3F G;  1MKH A;  1XPU A;  2PQA B;  2JA8 G;  4OWT B;  3STB C;  4A3M H;  4JI0 Q;  2Q2I A;  1XPR A;  1PH5 A;  1VQ9 A;  2JK8 A;  3PUZ A;  3TQY A;  1G51 A;  1JJC B;  2ZJQ A;  4JI6 L;  4QQB X;  2ALY B;  4OWX B;  2AHO B;  3PSI A;  3KLW A;  2E2J H;  4LFB L;  2QEX A;  4EQ5 A;  4LFA L;  1C9O A;  4B3M Q;  3K7A H;  1PV4 A;  1X6O A;  1N34 Q;  1VQJ A;  4XTC S;  1PHJ A;  4BBS H;  2DUD A;  1XJV A;  4LF9 L;  4UY8 C;  2C35 B;  4UPA A;  4BY1 G;  4A3D H;  5M5Y H;  1KRT A;  3A74 A;  1UE5 A;  1IBL Q;  3UE0 A;  1N33 L;  1CUK A;  3OTO Q;  2UU9 L;  2K5H A;  2ZTE A;  4P71 A;  2AWO A;  4QJF A;  1VQE A;  4BBR G;  4LF8 L;  4DR6 Q;  5IE8 A;  2IY5 B;  4PG3 A;  1LUZ A;  5GQO A;  1L0W A;  3U58 A;  1IZ6 A;  1KAW A;  5C0X G;  4A3G G;  4IPH A;  3A5U A;  1J6Q A;  1I3Q H;  3M7N A;  4A3B G;  1UEB A;  1PVO A;  4AYB E;  2Q2H A;  3J81 j;  4MNO A;  1S40 A;  4JYA L;  4GOP A;  5IP9 G;  3L2P A;  1P8L A;  4JBK A;  4LF5 L;  2OTJ A;  4YCW A;  2YYZ A;  3W1G A;  1PYB A;  2N78 A;  3HOY G;  2V1C C;  1QUQ B;  3D31 A;  5C4J H;  2UXB Q;  2PI2 A;  3B6Y A;  4JI8 L;  1VQ4 A;  3CCM A;  1YI2 A;  2HT1 A;  2VZA A;  4JI5 L;  3STB D;  2H5X A;  3HFZ B;  4OWW B;  4AQY L;  2D0O A;  1KQS A;  4LF4 Q;  1WFQ A;  2WB1 G;  2B3G A;  3NBH B;  1N32 Q;  1DGS A;  1D7Q A;  2D0P A;  1ASY A;  1X54 A;  1Y1V H;  5IYB G;  3NEN A;  1VQH A;  2WAQ E;  4QL5 A;  1MJC A;  5ELN A;  4LF6 L;  4B3R L;  4DR3 L;  1I50 H;  4HID A;  4ALP A;  4GLX A;  3GTO H;  3G71 A;  3PO3 G;  4B3S Q;  5LMU L;  2K4K A;  1VQI A; 
#chains in the Genus database with same CATH topology
 1BR9 A;  1NMF A;  2XVS A;  4RCN A;  3S15 B;  1TY0 A;  1IL8 A;  1IYU A;  2LMC B;  5C4Z A;  1SYC A;  4LFB Q;  3FHW A;  1HZ9 A;  4ME3 A;  5EGT A;  3BZD B;  2JA9 A;  1Q1E A;  1FJG L;  2AQ1 B;  1PH2 A;  2RDH A;  3CCE A;  5JJZ A;  3A5Z B;  2PQA A;  2KHJ A;  5T1I A;  2Z6K C;  4JG2 A;  1U0L A;  3HKS A;  2ZXR A;  2PZT A;  1IBL L;  2JA8 H;  2NN6 H;  4YWK A;  1SJH D;  1V9P A;  1AN8 A;  2F52 A;  2A74 C;  3VYU A;  3HOV H;  2WFW A;  1PRT C;  1VQG A;  4IUQ A;  5AFW A;  3CCR A;  4LF5 Q;  4N9T A;  3K0X A;  3TZU A;  3M4O H;  1SNM A;  5JPN C;  4WRD A;  4FO2 A;  3J80 E;  1F77 A;  3L0O A;  4BY1 H;  4A3I B;  1TKW B;  1RCV D;  3Q6S A;  3NPP A;  2CQA A;  1TWC H;  5M5X H;  4PV1 C;  2NBF A;  4B3R Q;  2WP8 J;  2B63 B;  4MN3 A;  1I4P A;  1X9N A;  3HOZ G;  2AWN A;  1IHZ A;  2F0M A;  1EY9 A;  1STH A;  2K33 A;  1BCP F;  4C3I G;  3VDY A;  2K14 A;  1HHV A;  5IYD G;  1ONL A;  1STA A;  1O7Y A;  3CRL C;  4ILW A;  1STG A;  3NBH A;  3T51 B;  1SE8 A;  1Y1W H;  3NWT A;  1MI2 A;  1CSQ A;  2PMZ B;  2QDL A;  3SE0 A;  5M3M G;  3VR6 A;  2JA6 G;  4C1N K;  3J7Y W;  2KEC A;  4A3C G;  1FJG Q;  4CHT B;  3K8A A;  3HOZ B;  5EBD A;  2NVY B;  2YU9 B;  5CMD A;  1BQQ T;  2QEJ C;  3J81 c;  4DK1 A;  2ICI A;  3QJY A;  5ELC A;  1EL0 A;  2EJG C;  1XTC D;  1NNX A;  1WCM H;  5ELO A;  3CCS A;  1Q86 C;  4N8X 1;  2YTY A;  2L15 A;  5JOB A;  1K3R A;  2JA5 H;  1JT8 A;  3OIP A;  3E0E A;  5C4X H;  1YNX A;  1K83 H;  2Y0S G;  1X32 A;  4DV2 L;  3JC6 6;  4DV6 Q;  2TMP A;  4HIO A;  1HCZ A;  4HSV A;  1HXY D;  1F9Q A;  4DF7 A;  4J6H A;  1SLJ A;  3S2D H;  3FVQ A;  2QDB A;  1M1K C;  4DR7 L;  3TME A;  3FRP B;  3MA2 B;  3BS1 A;  4I65 A;  5ELD A;  4I7Z C;  4A93 H;  1XNR L;  3S14 B;  1HPC A;  2D62 A;  1LT6 D;  3K5N A;  1Q90 A;  1LM0 A;  2E8G A;  3RR5 A;  2Y0S B;  4DKA C;  1KNE A;  3AB9 A;  4FXK C;  2PZW A;  5T1G A;  4V0B A;  2B8G A;  4JCV E;  2D9U A;  3GTQ H;  4EQN A;  5BR8 L;  4IPC A;  3A8J E;  3QO2 A;  2VUM G;  1PYS B;  1EQR A;  3U50 C;  2PYK A;  4A3J H;  4JBM A;  2ZJP A;  3GTM H;  2JN4 A;  1I4H A;  3KJP A;  1XMO L;  1OXT A;  1UWV A;  4APV A;  1L1O C;  4B08 A;  1O80 A;  1Y69 U;  2MHV A;  4A3D G;  1EEF D;  3I55 A;  1KL9 A;  4JV5 L;  3ICE A;  2J0T D;  1YNN D;  2VUM B;  3T1Y L;  4UP7 A;  2QIL A;  4C2M B;  3K5L A;  4BY7 B;  1NAP A;  1FGB D;  4GKK L;  2F0H A;  1G6P A;  3EFX D;  2RHS B;  5C0X J;  2R92 B;  1DZ1 A;  3TP8 A;  4YCU A;  2F0Q A;  1VQD A;  4JI1 L;  3A7L A;  1D1K A;  4X64 Q;  2XRS D;  3S16 B;  1E7Z A;  2XGT A;  2TSS A;  4DR7 Q;  1GKH A;  2O5I C;  4QF4 A;  1IYV A;  2ID0 A;  2X6G A;  4GLV B;  1XNR Q;  3J7A F;  3PGZ A;  4DAY A;  1A3U A;  2IJ0 A;  4EQO A;  5IT9 E;  4L63 B;  4PZ7 A;  1OXV A;  4JI3 Q;  2E2H B;  3FKI B;  5IP9 H;  4K2K A;  1GUW A;  1Q81 C;  1TS2 A;  5BR8 Q;  4OIK A;  2A1A A;  4C3J H;  1T9H A;  4HJ9 A;  1I4Q A;  2JQO A;  2NZO A;  1EYD A;  1SNC A;  2F3I A;  4MTN A;  1SXT A;  1VQF A;  5DAU A;  3WOF A;  3VYT A;  1F2L A;  4DAV A;  1K0S A;  1XNQ L;  1JC7 A;  4MHE A;  1J8I A;  1QVG A;  2N88 A;  5COY A;  3R8B A;  1UNS A;  4FF4 A;  4OL7 A;  4JV5 Q;  1SFO B;  3GTG B;  5IYC G;  3Q8D A;  2Z4I A;  4ODG A;  3MEF A;  1VQ7 A;  1R9T B;  2EJF C;  2D2C C;  4GKK Q;  2E74 C;  2UXD L;  2K75 A;  1HZB A;  3NEL A;  4JI1 Q;  2BH2 A;  2F4V L;  3U9S A;  5M9O A;  1E24 A;  2DGY A;  2HIX A;  3SDZ A;  2NVX H;  3CC2 A;  1JOK A;  5FOB B;  1J5E L;  1HZC A;  3IFD A;  3QWN A;  1FVI A;  3M3Y H;  1EYA A;  1YIJ A;  2R93 G;  3QOJ A;  1NR4 A;  2MO0 A;  1K0R A;  3GV6 A;  1VQP A;  5IOC A;  1F2Z A;  3Q24 A;  5CV9 A;  1H9S B;  4CGY B;  4J1M A;  2BH8 A;  4GKJ L;  1PZJ D;  1U4L A;  3HP3 A;  5EPJ A;  1E2W A;  3U4Z A;  2M2L A;  2G9H D;  4A3M G;  2R7Z H;  1B7Y B;  2R93 B;  1YHB A;  1JOR A;  1CKN A;  3RZD B;  1MSG A;  1O7L A;  3FP9 A;  1MSH A;  2IX3 A;  4IQZ A;  1PH9 A;  1XNQ Q;  1HFN A;  3J81 L;  2YTX A;  1GJX A;  4C3I H;  2PPB C;  3L3O C;  3S1M H;  3DWQ A;  1K28 A;  1K8O A;  3I8Z A;  5FLX E;  4A3M B;  5KGU A;  4DN4 M;  4Y7N H;  4Q5V A;  5M3M H;  2BOS A;  1VQN A;  1EWH A;  2JA6 H;  4RAU C;  1D5X C;  1EWI A;  2K5D A;  2WV6 D;  2E2J B;  2F4V Q;  4A3C H;  1LT4 D;  3K7A B;  4DXF A;  3D4D A;  4BBS B;  5G3L D;  1WTR A;  1LTG D;  2CH4 A;  4LUZ A;  1W6K A;  1JMC A;  3H0G G;  4FP5 D;  2DY7 A;  1J5E Q;  3NK9 A;  1KTK A;  1Y8N B;  1LV9 A;  3SVM A;  2Z0S A;  1TS4 A;  4OX9 L;  3RZO H;  2RDG A;  2VL6 A;  1NTG A;  1SE3 A;  1QE6 A;  3TRZ A;  2K1B A;  4YIJ A;  2D5D A;  1V1P B;  3EA6 A;  3NP8 A;  1I3Q B;  4IJH A;  3OWF A;  2RF4 A;  1ICF B;  2RHQ B;  4GKJ Q;  3RUZ A;  1PA6 A;  2B2Y A;  2NTT A;  1K3B C;  4RH6 A;  3TRE A;  1U5K A;  3NEM A;  4CKC A;  1TXY A;  4RHR A;  4JI5 Q;  1HFG A;  3OOC A;  1GVP A;  3K58 A;  4GN5 A;  5CV7 A;  4EGV A;  4A3F H;  4YWL A;  3CKI B;  3GQB A;  1BCP C;  5HGQ A;  5I9O A;  4DR2 L;  1EFI D;  3FEW X;  4IZ8 A;  1D5M C;  1Q1B A;  1IKM A;  3P1H A;  4Q0F A;  1KDB A;  3BDL A;  3TS0 A;  2SNS A;  1Z6H A;  1G8Z D;  1RKN A;  2YV5 A;  2PQA B;  2JA8 G;  1PRT B;  1EIG A;  3STB C;  2Q2I A;  1PH5 A;  2JK8 A;  5KND A;  1A2U A;  1NR2 A;  5CV6 A;  2ZJQ A;  4JI6 L;  1BOS A;  3KLW A;  4EQ5 A;  1YNJ D;  1X6O A;  1F2M A;  3N52 A;  4QMG A;  4BY1 G;  4A3D H;  1KRT A;  1UE5 A;  3MFG A;  2ZTE A;  4QJF A;  1VQE A;  4RKB A;  2JA8 B;  1TQO A;  1ZYR C;  5FK9 C;  1BUV T;  1KAW A;  1B4O A;  5J39 A;  2PNR C;  1BO0 A;  3MC0 B;  3HOV B;  2Q2H A;  3ND8 A;  4L6T B;  4JYA L;  4GOP A;  2OTJ A;  4YCW A;  1TS3 A;  3M4O B;  2WIN B;  3SK6 A;  2XIW A;  3W3A A;  1HQR D;  2N78 A;  5CBA E;  1ESR A;  1JWS D;  4BY1 B;  1J9O A;  1SNO A;  2PI2 A;  2HT1 A;  3HFZ B;  1GHJ A;  4AQY L;  1PFM A;  4LF4 Q;  3NBH B;  1TWC B;  1UEA B;  1D7Q A;  4K8I A;  2D0P A;  5M5X B;  4QUC A;  3KF8 A;  1Y1V H;  1VQH A;  4LF6 L;  1SMY C;  2F0T A;  4ZAI A;  4HID A;  5KNC A;  5LMU L;  2K4K A;  3KLR A;  1PTO H;  2OT2 A;  2HCC A;  1EY4 A;  4XT3 B;  4NXM L;  4K2L A;  1Y1W B;  1IKL A;  4JI6 Q;  3S2H H;  4P74 A;  3M4Y A;  5J3B A;  1VQL A;  3TDQ A;  4KMU C;  1DXM A;  3AU7 A;  2JA5 G;  1I4X A;  3P7J A;  1K8G A;  2MO1 A;  4LFC Q;  3S24 A;  1N34 L;  2EDG A;  5DLQ E;  2DNE A;  1M4V A;  2K6A A;  3LGJ A;  2Z8L A;  3EQL C;  1PYW D;  2N55 A;  4U67 3;  3RNU A;  1WTP A;  1JB7 A;  4DV7 L;  5GRO A;  1FR3 A;  2CWA A;  1LT3 D;  4GN4 B;  1TS5 A;  1B70 B;  3JAM i;  1WCM B;  4A93 G;  1EOV A;  5ISR A;  4JYA Q;  1HNW L;  2FMC A;  2JA5 B;  4DA2 A;  3DM1 A;  4P72 A;  1PXU A;  4F88 A;  2FHT A;  1VCI A;  4QB4 A;  3ULP A;  5C4X B;  1K83 B;  4KI0 A;  2K32 A;  4LUV A;  2F0W A;  4DAM A;  3I4L A;  4XXE A;  1BBX C;  1PH6 A;  4LF7 L;  1PH4 A;  2FJ2 A;  4AQY Q;  1YHA A;  3S2D B;  3IL8 A;  3NWS A;  1YJ9 A;  3BJU A;  4A3J G;  2VY3 A;  3D4W A;  1MJE A;  2ZM6 L;  1LTR D;  4LF6 Q;  4A93 B;  1SND A;  4R4I A;  4A4I A;  2BDN A;  3SK8 A;  5LMU Q;  1LAC A;  3HOY H;  2ICE C;  2EQS A;  4LMQ D;  5J1Z A;  5CV5 A;  4B3S L;  3PF5 A;  3M4Q A;  5CV8 A;  4NXM Q;  3GTQ B;  1NY4 A;  2LY7 A;  3PV0 A;  4IFD G;  4JI2 L;  1T5E A;  3BYT B;  2QKI C;  1MBY A;  2IT1 A;  4A3J B;  1PRT D;  2I5L X;  3CQZ H;  2EIF A;  3GTM B;  3E6Z X;  5IYB H;  2FFK B;  1LO5 D;  4RGT A;  1VQ8 A;  1Z7T A;  4DXG A;  1L0Y B;  1AW7 A;  3M9B A;  4FYD A;  1TU2 B;  5KYI A;  4UHV A;  4U68 A;  3DWA A;  4DV7 Q;  1K73 C;  1ASZ A;  2CQO A;  3UE1 A;  5JEA G;  1LTA D;  1HNW Q;  1B53 A;  2KHI A;  2A19 A;  4DAY B;  5F2D A;  1X3E A;  1HTL D;  1EQT A;  3UDI A;  1CKM A;  5BN4 A;  4R9W A;  3H0G H;  3EVQ A;  4LF7 Q;  4YY3 L;  3TZD A;  2R7F A;  4C3J G;  2ZXP A;  4KD4 A;  3GDE A;  5HUR A;  4HAE A;  5D3I B;  2ZM6 Q;  1E22 A;  4HMJ A;  2XRQ D;  1RF2 D;  1ZEQ X;  2BE5 C;  1JB3 A;  5EKI A;  1CSP A;  3OMC A;  2I0Q A;  4KY5 A;  4DPG A;  2OXP A;  2DJF C;  1GO3 E;  1TII D;  1EEI D;  3OSO A;  2B2V A;  5IGE A;  4ZKB B;  4DV5 L;  4EQP A;  1BKB A;  4JI2 Q;  4C3J B;  5M5W H;  2IL8 A;  2NB0 A;  2VQE L;  4IOA A;  2PZU A;  1EU4 A;  3M4P A;  2XNA C;  1CQF A;  2C9O A;  2CFM A;  3I7F A;  4OXP A;  2B2V C;  2XSC A;  2Z6K A;  4HMI A;  1KIX A;  3P20 A;  4L5S A;  5C5L A;  4JOI C;  4OHJ A;  1O78 A;  2GA4 B;  3MXG A;  1ZXT A;  4XQN A;  4JK1 C;  3GO5 A;  4L8J A;  3A0J A;  2F0O A;  4DNT B;  4POF A;  5D3D A;  1IXR A;  4HCS A;  1KRS A;  5GAD C;  2PMZ E;  3K5M A;  2F0G A;  3F2U A;  1EFW A;  4S3S A;  1SRO A;  1B3A A;  5IY0 A;  5C0X I;  4YY3 Q;  1GOZ A;  4DV6 L;  2PQE A;  4FF3 A;  1QOH A;  4O0A A;  2VB2 X;  3RLO A;  2NVX B;  4DNR B;  1I94 L;  2NTS A;  4K6L A;  4CKE A;  4OIJ A;  1LAB A;  3NQT A;  2K50 A;  2MQH A;  3GTP H;  1YHQ A;  2R7Z G;  3M3Y B;  1B9N A;  5E1F A;  3MXN A;  3BVZ A;  4JI7 L;  4P73 A;  5I6W A;  1JWM D;  4JPB W;  3PUW A;  1EY7 A;  3H3V I;  1CKN B;  5KYL A;  2E2I H;  3S1N H;  4IPD A;  1WD1 A;  1STE A;  4BA1 I;  5AJ3 L;  4DV5 Q;  4RCO A;  1C0A A;  2QF7 A;  1CTM A;  1JJG A;  5FO8 B;  2VQE Q;  4MIU A;  3AFQ A;  1D8L A;  2I5M X;  1XTD A;  2VQF L;  3KF6 A;  2R7Z B;  4HCE A;  4CDD C;  2L55 A;  1S5B D;  3SK4 A;  4XIG S;  3DHQ A;  1GM5 A;  3CU7 A;  2EY5 A;  3AYH B;  4NPS A;  2EXZ A;  1HNZ L;  1EIY B;  4WJ3 M;  3L7Z C;  1WTH A;  4C3I B;  3BU2 A;  1HQM C;  2Y0S E;  3QIA A;  3S1M B;  3OWE B;  1B3Q A;  1SYF A;  2NYZ D;  4BXX G;  4IOC A;  4OGQ C;  5EPL A;  4Y7N B;  5M3M B;  3I72 A;  4L5T A;  2A69 C;  2JA6 B;  4AH6 A;  4FF1 A;  4IUP A;  1ENC A;  2ZTD A;  3I4N G;  2QGQ A;  1TR5 A;  4UP8 A;  3LX0 A;  1GUT A;  1SNQ A;  3A8K E;  5KRU A;  1JQY D;  4NB3 A;  1I94 Q;  4QY7 A;  4DV0 L;  4X64 L;  1HZA A;  3T56 B;  1AFP A;  1WOC A;  3URY A;  4ZLT F;  3JAM E;  3P75 A;  4JI7 Q;  3FMC A;  3OYY A;  1CA6 A;  2B29 A;  3RZO B;  2O2L D;  2NVT H;  1HR0 W;  1VQK A;  4A3F G;  3PF4 A;  3OPO A;  4L5R C;  2LKV A;  1DM0 B;  1WI5 A;  4JI3 L;  5AJ3 Q;  5FJ8 G;  3VR2 A;  3H15 A;  2A6H C;  1SSO A;  1NJI C;  1OTC A;  1ET9 A;  3NQI A;  3E9H A;  1GXD C;  4F8M A;  1PFB A;  3BVM A;  4X65 L;  2VQF Q;  1L1O A;  2H1E A;  3CXC A;  1IW7 C;  5H1S E;  3O13 A;  4AYB G;  3PIP A;  4OEL B;  3NXW A;  2PI2 E;  4A3F B;  3CP0 A;  3D6W A;  3HOX H;  2E5L Q;  3A8I E;  1HNZ Q;  1X3G A;  3UDG A;  3D4R A;  1MGS A;  4PMC A;  5I4D A;  3G4S A;  1E3P A;  5GAG C;  4FF2 A;  1OXU A;  3QOL A;  1SE4 A;  4HJ8 A;  3CD6 A;  3I91 A;  4IFD H;  1HNX L;  1CZW A;  2R3Z A;  1STN A;  4JI0 L;  4KKU A;  3DLL A;  1A3V A;  4H7B A;  5JAV A;  3HOW H;  3S1Q H;  5IP7 G;  3I3C A;  4LF9 Q;  3NTK A;  1BNZ A;  1YVC A;  4HR7 B;  4GOP B;  1ICW A;  2JEB I;  5NUC A;  5GAH C;  4DV0 Q;  1KLG D;  4KLK A;  2L9H A;  3KDF A;  3CCQ A;  4A3D B;  1SEB D;  4TVA B;  1HRJ A;  2QA4 A;  3RN2 A;  2EE1 A;  5JEA H;  4R4O A;  2KCC A;  4GNX C;  3W5O A;  1GUG A;  2Q8I B;  2K01 A;  1X3P A;  1Q12 A;  2F0P A;  1Y1V G;  2Q8T A;  3SK5 A;  3KF8 B;  4ZRZ A;  1CFM A;  3VR3 A;  3KBG A;  1QZH A;  2F3W A;  3M85 A;  3DEP A;  3J80 c;  3DMU A;  4X65 Q;  1Q46 A;  4KKS A;  1EWC A;  4G7O C;  1SE2 A;  3ZJY C;  3TP7 A;  5LL6 X;  1NUC A;  2Q2T A;  5A35 A;  3DM3 A;  1KHI A;  4PZ6 A;  1CA5 A;  1CK1 A;  3T4A C;  1N32 L;  3ER0 A;  2NZ1 D;  2L5T A;  2EYM A;  1TT2 A;  2K7V A;  4X3S A;  3TS2 A;  2WII B;  1ILQ A;  1Y1V B;  3MTS A;  2SDF A;  2MFI A;  3UI2 A;  1TWA H;  3I4M G;  1CZG A;  3PQI A;  5EKL A;  1W3S A;  2IHF A;  1PTO B;  1HNX Q;  5JJL A;  5HY6 A;  3C46 A;  3AFP A;  1MKH A;  2DN8 A;  3A54 A;  3W2D A;  1LTS D;  4JI0 Q;  1XPR A;  2PW7 A;  1B1Z A;  3PUZ A;  2QW7 A;  3R3O A;  4IUR A;  3S2H B;  1JJC B;  4OWX B;  3PSI A;  2QEX A;  1ENF A;  1RDP D;  4DU9 A;  1PHJ A;  4XTC S;  5IGC A;  1SJE D;  1EIH A;  1XXG A;  4UY8 C;  3TSS A;  1SYG A;  4HSP A;  3A74 A;  3UE0 A;  1N33 L;  1CUK A;  2AWO A;  4FXD A;  2V4D A;  5GQO A;  4ZYS A;  4TRD A;  5IGG A;  2PO4 A;  1IZ6 A;  1BCP D;  1D1I A;  4K8J A;  4M1U B;  5CR3 A;  1UEB A;  3M7N A;  1PVO A;  1EOT A;  4X3U A;  1SNP A;  3FPU B;  1S40 A;  4JBK A;  3W1G A;  3EJI A;  1PYB A;  3MVV A;  3HOY G;  2V1C C;  3D31 A;  3L9A X;  4G4K A;  5LHY 1;  1YI2 A;  2AUK A;  4B9X A;  3CCM A;  2L11 A;  2L12 A;  1FYC A;  4JI5 L;  3STB D;  4OWW B;  1DOM A;  2D0O A;  2F0U A;  1JOQ A;  4CDC C;  1WFQ A;  2WB1 G;  4IUV A;  3DWP A;  1N32 Q;  2AQ3 B;  1X54 A;  3H91 A;  1VF5 C;  5IYB G;  1WVL A;  2IW3 A;  5ELN A;  3C2P A;  3LWU A;  4DR3 L;  3ERO A;  2P5Z X;  3GTO H;  4XQJ A;  2ZXO A;  3NBI A;  3HOY B;  1PLF A;  3J81 i;  1SYB A;  5C3W A;  3OIQ A;  1ZYR D;  4ABN A;  2E75 C;  1L0X B;  2KCM A;  4LJZ C;  5FO9 B;  3E5S A;  2IX0 A;  1H9R A;  3CQZ B;  4DUZ L;  5I2Y A;  4IAL A;  2JA7 H;  5EQ0 A;  1B50 A;  1E1O A;  1N33 Q;  4OO1 I;  4RMF A;  3KFU A;  2CVR A;  4BXX H;  2HQE A;  5A2Q L;  4NXN L;  1V43 A;  4ZCK A;  1SMY D;  3I4N H;  2F0J A;  2HD3 A;  4IUN A;  1SMX A;  4ME5 A;  2MNA A;  1SYE A;  1HH2 P;  2PNH A;  3LNN A;  4NP5 A;  2F0L A;  1S5E D;  3EIV A;  1PRT F;  1X65 A;  3V96 A;  3H0G B;  4EVO A;  2KUM A;  1LYL A;  2KOL A;  4BBR H;  1GUN A;  2HUG A;  4PNY A;  4LF4 L;  4X62 L;  4A3B H;  3K7U C;  5JPM C;  2KED A;  4DR3 Q;  4DV3 L;  4MZ9 A;  1EY6 A;  5IT9 c;  3VYS A;  2ATW A;  3F8T A;  1WTV A;  1FNW A;  3BYY B;  5FJ8 H;  3E0J A;  1EU3 A;  1T5X D;  1PZK D;  3HRZ C;  4WFN 3;  3H3V H;  3J7A V;  3HKZ G;  5M5W B;  4XQQ A;  4A3E G;  1TWG H;  2I5H A;  3TP5 A;  1PTO D;  1PDQ A;  3OMG A;  5BN5 A;  4QCL A;  4KHP Q;  1H95 A;  2RDF A;  1EQQ A;  1K8A C;  1QVC A;  2ZTC A;  4ZUJ A;  4DUZ Q;  1BBW A;  4HJA A;  1ROD A;  1XPO A;  1IBM L;  4LAA A;  3CRK C;  1KDA A;  3PO3 H;  4LFC L;  2CCZ A;  3MXU A;  4UP9 A;  2RCN A;  3CCL A;  1U4R A;  3BG3 A;  3D0F A;  2HCI A;  5TSS A;  4DV1 L;  3AQQ A;  4NXN Q;  2JEA I;  3MXN B;  4HJ5 A;  3H3V C;  1F2Y A;  5IP7 H;  3GTK H;  3MXP A;  3VA5 A;  1DCZ A;  1ET6 A;  4CKB A;  4G57 A;  3J80 L;  4G7H C;  4CJ0 B;  2B2U C;  1MIU A;  3S1R H;  1C7Y A;  4IO9 A;  1II3 A;  4ZK9 B;  2GN5 A;  4GS3 A;  3KLS X;  3PO2 H;  4C3H G;  4DK3 C;  3GTP B;  1ML0 D;  5EBC A;  4X62 Q;  3X3M A;  2AUJ D;  1I5F A;  2M00 A;  3KF6 B;  3MZ5 A;  1Z47 A;  4DV3 Q;  2Z1C A;  1VDZ A;  4R8I A;  1N36 L;  1F9P A;  1L2F A;  3M7G A;  2MUY A;  2X69 A;  4WJ4 A;  2JYO A;  4O42 A;  2E2I B;  3BDC A;  3S1N B;  4GLA C;  4A75 A;  2LS0 1;  2KJX A;  2B2T C;  4BS9 A;  2G5D A;  3GD7 A;  1CQV A;  1KC8 C;  1JE4 A;  1S5D D;  5FO7 B;  1VS0 A;  2B39 A;  5E4X A;  4Y52 H;  2E2D C;  4KN4 C;  2A68 C;  1HR0 L;  2I46 A;  1IBM Q;  2K03 A;  3T53 B;  3Q23 A;  2AMC B;  1KAA A;  1NMG A;  2EYH A;  3I4M H;  4BA2 I;  4JBJ A;  1LLR D;  1YZ6 A;  1VMC A;  1IL2 A;  1VQ6 A;  1FNU A;  4DV1 Q;  1U4M A;  4YCV A;  1A15 A;  4XYO A;  5IWA L;  4AIM A;  1XMQ L;  4RGM A;  1YEZ A;  1S72 A;  3UDX A;  1G29 1;  4JW0 A;  5FLX c;  3J7Z C;  3F2B A;  3G7L A;  3C1F A;  2BE5 D;  3T16 A;  4A3K H;  3ND9 A;  3I2Z A;  5C44 H;  1TVX A;  3GTJ H;  1Q7Y C;  3HOU H;  4XT1 B;  1QNK A;  1NSN S;  3S9W A;  3ERQ A;  3AMU A;  4ZQ3 A;  1WTW A;  4CJ2 C;  5J22 A;  2IX1 A;  4IJL A;  5E4W C;  2UUC L;  4KY7 A;  3PUY A;  4DUY Q;  3TP6 A;  1L1O B;  3GP7 A;  2JE6 I;  1OO9 B;  3QB3 A;  1EYG A;  2NVT B;  1N36 Q;  1XWE A;  3CPF A;  1TWF H;  2NVQ H;  3HOX G;  1YJN A;  2J4X A;  3OW7 A;  5BN3 A;  4O2D A;  4H13 C;  2KHS A;  4ZKC B;  5DEH A;  4A3L H;  2A6E C;  1V1O A;  5DNF A;  2KVM A;  1LTT D;  4DK0 A;  5I9P A;  1EZ6 A;  5C3E H;  3EN2 A;  4RWS C;  5IGB A;  1RJT A;  4RG1 A;  1LT5 D;  1HR0 Q;  4K14 A;  1LTL A;  3I90 A;  2F0K A;  4DFA A;  1A0I A;  1MD2 D;  1A62 A;  4J8Q A;  3U4V A;  3HOW G;  3HOX B;  1QJO A;  1JJ2 A;  1SRU A;  1D5Z C;  3J81 E;  1C4Q A;  1VMP A;  4DK6 C;  1PH7 A;  3HZX A;  3D6C A;  4N9P A;  2PCF B;  2C5C A;  5CC4 A;  3CME A;  1W2B A;  1XMQ Q;  4BWG B;  3V05 A;  5IWA Q;  3I56 A;  3MFY A;  1CM9 A;  2B8F A;  4DV4 L;  3KDF B;  4PMW A;  3EBE A;  5JVH 3;  1JR0 D;  2H4O A;  1H9J A;  4P75 A;  5C3X A;  1QCB D;  4HN7 A;  2ZJR A;  3HOW B;  3S1Q B;  1KXL A;  3G6E A;  2DJG C;  2XWB B;  2KCT A;  3Q0A A;  1I4G A;  2YTV A;  4P2C B;  3W1B A;  1DYQ A;  3RLN A;  1A3T A;  3G6J B;  4DR5 Q;  1A63 A;  2BA0 A;  2UUC Q;  2K52 A;  4QIW E;  2R61 A;  3CC4 A;  4R4T A;  3ITP A;  3GTL H;  1RTN A;  1PH1 A;  5IT9 L;  4RGO S;  1KNA A;  1PMR A;  1VQO A;  5KNB A;  1WD0 A;  1X55 A;  2K05 A;  1EY8 A;  4KV6 A;  1U9R A;  4K5W A;  4XDX A;  3FPP A;  2LXJ A;  3VYR A;  2MJ8 A;  3F1Z A;  4JVZ A;  2UUB L;  4CDE C;  4JOI A;  1QNU A;  4IFD J;  2A69 D;  1GHK A;  2KEE A;  1BF4 A;  1PFS A;  5LMN W;  1H9M A;  3ULL A;  3CAM A;  4HED A;  1GUS A;  1O7Z A;  1TWA B;  5IIF A;  1RD9 D;  3A55 A;  4RFB A;  5E7N A;  5FLM H;  4QIW B;  4C1N I;  4DV4 Q;  2SNM A;  4A3E H;  1QG7 A;  1XX8 A;  2RA4 A;  3ERS X;  3S17 H;  1TWH H;  2KA7 A;  1YBY A;  1F9R A;  5JEA J;  1I4R A;  4KTA A;  1RL2 A;  4KN7 C;  1DON A;  1B44 D;  1A8V A;  2A6H D;  5HGT A;  4A3I G;  5K36 G;  3KYH C;  1KD1 C;  1QZG A;  4G7Z C;  3DUZ A;  5C5M A;  3NE5 B;  3OTO L;  1IW7 D;  3T13 A;  3GV3 A;  3SXH A;  4LWC A;  3CCU A;  2GVB A;  5EPK A;  4OO1 H;  2B63 G;  3HEJ A;  1PZI D;  1SDF A;  3CCJ A;  4X6A H;  1AE3 A;  2VXW A;  3OHX C;  2RKS A;  2UXB L;  2OEO A;  2NUC A;  4KJN A;  2UUB Q;  4A76 A;  4C3H H;  4KY6 A;  2J7Z A;  1HJP A;  3D3R A;  3R93 A;  3KOJ A;  4IUT A;  3MEH A;  1IYJ B;  2BDO A;  2WKC A;  1QB5 D;  1AEX A;  2E76 C;  2IPK D;  3KLS A;  1ENA A;  3CMA A;  2E5L L;  2N49 A;  4RKL A;  2ENB A;  3NSW A;  2L0C A;  2JA7 G;  1E2V A;  1OXX K;  2F0F A;  3GTO B;  1EY0 A;  3IKJ A;  3C1E A;  2SOB A;  2CH4 W;  1XPU A;  3NHH A;  2CW0 C;  3NUC A;  5FLX L;  1F9S A;  4QQB X;  3I70 A;  2MGS A;  2ALY B;  1JCK B;  2AHO B;  3BVG A;  2F4I A;  4LFA L;  5CYU A;  1D6E C;  1VQJ A;  5D65 A;  1U4P A;  2DUD A;  4NDX A;  1XJV A;  4LF9 L;  2JA7 B;  3VR4 A;  3K6O A;  1H9K A;  5M5Y H;  2IWH A;  1IBL Q;  2MP1 A;  3OTO Q;  2UU9 L;  4LF8 L;  2K5H A;  4P71 A;  4BBR G;  2IY5 B;  1BCP B;  1L0W A;  3A7A B;  3U58 A;  1G91 A;  1WTQ A;  5C0X G;  3VA7 A;  5IGD A;  1J6Q A;  3A5U A;  4A3B G;  4AYB E;  3I4N B;  2YYZ A;  5CBE E;  5C4J H;  2UXB Q;  4K5X A;  4JI8 L;  2VZA A;  2H5X A;  1K8M A;  4BBR B;  5KEE A;  5G3L F;  1ESF A;  3PMF A;  5LL6 S;  3IAY A;  1DGS A;  4KK7 A;  5ELF A;  1ASY A;  1Q3L A;  2PW5 A;  1G2S A;  4A3B B;  1G2T A;  2WAQ E;  2EOT A;  1I50 H;  4R8N A;  4ALP A;  4GLX A;  3G71 A;  3PO3 G;  4KD3 A;  1A6X A;  1JE5 A;  1YJW A;  2RSN A;  2R6G A;  1JWU D;  1TWG B;  3K81 C;  4AYB B;  2WAQ G;  5DM6 3;  1I6H H;  4BY7 G;  4LFA Q;  3X3N A;  1VQ5 A;  4POG A;  2R92 G;  2F0S A;  3HS0 C;  4GNX A;  4H02 A;  4LNQ A;  3PO3 B;  1WJJ A;  2O5J C;  4DAP A;  2LXK A;  2FMM A;  2UU9 Q;  1XYI A;  5KIX A;  4LF8 Q;  5CV4 A;  1SN8 A;  5M3F H;  1WTX A;  3ONA B;  3PO2 G;  5IGF A;  3ULJ A;  1FL0 A;  2WAQ B;  3BZC A;  2XTI A;  1HTP A;  1UUP A;  2L4N A;  3FKI G;  4FNF A;  4DV2 Q;  3GTK B;  1PTO F;  2EY1 A;  4FDB A;  1VF7 A;  1Y14 B;  4JI8 Q;  4X3T A;  2CHB D;  2Q8R E;  3S1R B;  4PZ8 A;  3K5O A;  2HHH L;  2A8V A;  1IBK L;  3PO2 B;  1S3O A;  3TBI B;  4A3G H;  3PIP 3;  1HA6 A;  2GVA A;  2UXC L;  5I6Y A;  2EPB A;  4RA8 A;  4K6D A;  1QUQ A;  2LSS A;  3PUX A;  3F2C A;  1WYD A;  2DNC A;  3KBX A;  1NBW A;  3CW2 C;  2EYO A;  2IHE A;  3S15 H;  1Q82 C;  4XYQ A;  5K5P A;  1CHP D;  3NTH A;  2A73 B;  4DR4 L;  2B2W A;  2K5W A;  4IUU A;  1XMO Q;  5EKK A;  1PV4 A;  2VNU D;  4YWM A;  4A3K G;  2WKD A;  2F0D A;  5JVG 3;  4DR1 L;  1EQV A;  4NKL A;  5C44 G;  2CWP A;  2B2W C;  3I4M B;  5FKA C;  3HOU G;  3TN2 A;  3K80 C;  4KHZ A;  1ZKO A;  1VQM A;  4TSS A;  4HIM A;  2EVB A;  1AE2 A;  1FD7 D;  3KJO A;  3T1Y Q;  3OW2 A;  2OCE A;  3LWE A;  2F1M A;  4L5Q A;  3IFT A;  1M8A A;  2R7D A;  3TEH B;  4JI4 L;  2SEB D;  2EY6 A;  3MAQ A;  2WB1 E;  4A3K B;  1I6V C;  3MWY W;  1GUO A;  3PCO B;  1QVF A;  5C44 B;  3GTJ B;  4A3I H;  1VQA A;  4JC0 A;  5K36 H;  2VB3 X;  3HOU B;  2JSO A;  4A3L G;  2HHH Q;  2EYP A;  1IBK Q;  1FGU A;  1G6Z A;  4HTH A;  4FXG C;  2XWJ B;  5C3E G;  1YNN C;  2ES2 A;  2UXC Q;  3JAM c;  3AEV A;  2K5V A;  1B9M A;  4EX5 A;  2B63 H;  1R4P B;  1TWF B;  2NVQ B;  4F7X A;  1EIF A;  2AKW B;  3ZYY X;  1D2B A;  2FIN B;  1GD7 A;  1PH3 A;  4PQX A;  1SBB B;  2F0V A;  3PIO A;  1QIL A;  1S4Z A;  2K5N A;  4DR4 Q;  1CKO A;  2L1B A;  1TY2 A;  1MHW C;  5C3E B;  3K57 A;  2WB1 B;  4H0L C;  4WJW A;  4KHP L;  4DR1 Q;  4IN3 A;  3HOZ H;  1SAP A;  2NN6 I;  2NVY H;  4BBS G;  1E2Z A;  2YU9 H;  2VS1 A;  3IRB A;  3N6R A;  5IYD H;  2RCF A;  3SEB A;  1OXS C;  2HIV A;  4JBW A;  1B8A A;  4HJ7 A;  2BCO A;  4JI4 Q;  2UXD Q;  1V8Q A;  2Z9H A;  1LTI D;  2UUA L;  4GN3 B;  2KCN A;  1UAP A;  5LMN L;  4OON A;  3QG1 A;  2CKZ B;  2JJQ A;  4YHH L;  1CI3 M;  1SR3 A;  1HUM A;  3V2T A;  1AZP A;  4H44 C;  4B3T L;  2N8N A;  2KEN A;  1UE7 A;  1KDC A;  3E3X A;  5C0X H;  3F2D A;  4LUO A;  3S14 H;  1FNV A;  3HKZ E;  2A68 D;  3GTL B;  1S5C D;  1BXT A;  3CPW A;  2Z6B A;  1B2T A;  2F0E A;  4J15 A;  3CHB D;  3U9O A;  5ELE A;  2HDM A;  4E6I A;  5FLM G;  2F0N A;  3WWV A;  2WAC A;  1STY A;  2N3S A;  3D8G A;  3SGI A;  3PIO 3;  1RHP A;  3CF5 A;  2B2Y C;  1WTO A;  1KAB A;  3CC7 A;  1Q8K A;  3I73 A;  5ELB A;  1Y8P B;  3PUV A;  2LFN A;  4C56 C;  2Q2U A;  2OWO A;  1VQB A;  1E1T A;  4QGU A;  3A56 A;  1PH8 A;  1N9W A;  1JOO A;  1DJR D;  1X3F A;  2EJM A;  4M8A A;  1Q8I A;  1EUJ A;  2EZV A;  3Q22 A;  4R4Q A;  4LK1 C;  2JP1 A;  5JJK A;  2BA1 A;  2OTL A;  2VUM H;  2NN6 G;  4ZUI A;  3HKZ B;  3BZK A;  4A3E B;  4C2M H;  2M9V A;  1X3Q A;  3S17 B;  1TWH B;  2B2U A;  4BY7 H;  1X56 A;  2RVL A;  4IPG A;  3HOV G;  2UUA Q;  1NE3 A;  4OO1 G;  4O1N A;  2R92 H;  5LMN Q;  3WDN A;  4YHH Q;  3C3L A;  2NZH A;  3S16 H;  2A6E D;  1JIC A;  4X66 L;  3J80 i;  4KJO A;  1C48 A;  4B3T Q;  4OX9 Q;  1HA5 A;  3G48 A;  1BVS A;  4R4C A;  3VR5 A;  5DM7 3;  4NW2 A;  4DGZ A;  3RD4 A;  4DUY L;  5IOD A;  1RIP A;  2E2H H;  3FKI H;  2B2T A;  2X6L A;  4K0K L;  1STB A;  4GZY C;  4X3K A;  5C6A A;  2VW9 A;  1LTB D;  1CT1 D;  4HIK A;  2KQ3 A;  4GOP C;  4DNI A;  3E9I A;  5L37 A;  1Y1W G;  4C3H B;  1S5F D;  2XN9 C;  1A2T A;  3DEO A;  3CCV A;  3SR1 A;  3HG9 A;  5EJW A;  3H94 A;  4DR2 Q;  4IFD I;  2EYF A;  1AZQ A;  3J7A 5;  1P16 A;  3T1H L;  1NCV A;  2EXD A;  2EYJ A;  4CDF C;  1SFO H;  3NTI A;  3GTG H;  3KUP A;  1R9T H;  4FVM A;  2F0I A;  4RHS A;  3DXJ C;  3H09 A;  1WCM G;  2EYL A;  2HQL A;  5I2X A;  2F03 A;  2K5Q A;  2Z4H A;  4RGN A;  1Z9F A;  1AH9 A;  1BBU A;  3K59 A;  5C4X G;  1AP0 A;  4B3M L;  2OQK A;  4X66 Q;  4LW1 A;  4N8F A;  2G9D A;  2RQX A;  3FDT A;  1M90 C;  4R1J A;  2JXM B;  5M5Y B;  1K9M C;  2ASB A;  5IYC H;  4OEM B;  1Y8O B;  4I7A A;  4DR5 L;  3JAM L;  4DR6 L;  2OQ0 A;  1HUN A;  1UE1 A;  1EZ8 A;  1PTO C;  4KKT A;  2DY8 A;  3RN5 A;  3RMH A;  4CBV A;  4KHV A;  5CGK A;  5EAY A;  4PMB A;  2KBN A;  1PFN A;  4K0K Q;  1YNJ C;  5COR A;  3UDF A;  2F3V A;  1UE6 A;  1KLU D;  1O7I A;  2K04 A;  5C4J B;  3H6M A;  2RBM A;  4Z9C B;  1BDO A;  1EY5 A;  2FXQ A;  2OF1 A;  4CJ1 B;  2R93 H;  4WOR A;  5GAE C;  3MHB A;  4TQU S;  3RZD H;  1N8R C;  4K5V A;  4QUF A;  3RLF A;  4NMZ A;  1H9S A;  1W6J A;  4V19 0;  3KK7 A;  5JJI A;  3I4O A;  5C4H A;  1I50 B;  3T1H Q;  2QCP X;  1V1Q A;  2O4X A;  1DD2 A;  2NWG A;  4GNX B;  3QR8 A;  1YIT A;  1RTO A;  1VQC A;  4TKO B;  4UAI A;  5M3F G;  1QWY A;  4OWT B;  4A3M H;  1C8C A;  2EY2 A;  1VQ9 A;  3TQY A;  1G51 A;  1I6H B;  2E2J H;  4LFB L;  1ILP A;  1C9O A;  4B3M Q;  3K7A H;  1CHQ D;  2ZT9 C;  1N34 Q;  4BBS H;  4MTK A;  4B9W A;  2C35 B;  1DOK A;  4UPA A;  4ULL A;  4ID6 A;  4DR6 Q;  5M3F B;  3R2T A;  5IE8 A;  3SHL A;  4PG3 A;  1LUZ A;  3WOE A;  5A2Q E;  4A3G G;  4IPH A;  1I3Q H;  2HDL A;  1E0B A;  3J81 j;  4MNO A;  5IP9 G;  3HGB A;  1P8L A;  3L2P A;  4LF5 L;  2RSO A;  1EYC A;  4F87 A;  1QUQ B;  1VQ4 A;  3B6Y A;  5E3F A;  3BDO A;  2CW0 D;  3R2I A;  1KQS A;  1V1P A;  2B3G A;  2MPM A;  1R4Q B;  2I07 B;  4A3G B;  4UDU C;  3K0Y A;  3NEN A;  1SYD A;  2A5H A;  4QL5 A;  1MJC A;  5D14 A;  4B3R L;  1DOL A;  2AQ2 B;  4B3S Q;  1VQI A;  2K28 A; 
#chains in the Genus database with same CATH homology
 1NMF A;  1JE5 A;  4NXM L;  1YJW A;  2R6G A;  4JI6 Q;  3S2H H;  3K81 C;  4P74 A;  1I6H H;  2WAQ G;  5J3B A;  2KCM A;  1VQL A;  3FHW A;  1HZ9 A;  4ME3 A;  4BY7 G;  4LFB Q;  4LFA Q;  2IX0 A;  1VQ5 A;  2JA5 G;  1K8G A;  4POG A;  2R92 G;  2MO1 A;  4DUZ L;  2JA9 A;  4LFC Q;  1Q1E A;  1FJG L;  4GNX A;  3S24 A;  2JA7 H;  4H02 A;  1N34 L;  4LNQ A;  1WJJ A;  5DLQ E;  1PH2 A;  1E1O A;  1N33 Q;  2LXK A;  3CCE A;  3LGJ A;  3A5Z B;  2PQA A;  2UU9 Q;  4LF8 Q;  4OO1 I;  2KHJ A;  1SN8 A;  2Z6K C;  4JG2 A;  1U0L A;  3HKS A;  4RMF A;  5M3F H;  3RNU A;  1JB7 A;  1IBL L;  4DV7 L;  2JA8 H;  3KFU A;  4YWK A;  5GRO A;  4BXX H;  3PO2 G;  2CWA A;  1V9P A;  3ULJ A;  1FL0 A;  4GN4 B;  2F52 A;  2XTI A;  3BZC A;  4NXN L;  3JAM i;  1B70 B;  1V43 A;  3HOV H;  4A93 G;  1EOV A;  2WFW A;  4JYA Q;  1VQG A;  1HNW L;  3CCR A;  4LF5 Q;  3FKI G;  3I4N H;  4DV2 Q;  4P72 A;  1SMX A;  3K0X A;  3M4O H;  1VCI A;  2MNA A;  3ULP A;  1HH2 P;  2PNH A;  4KI0 A;  4FDB A;  4LUV A;  1Y14 B;  3L0O A;  3EIV A;  4BY1 H;  4JI8 Q;  1X65 A;  4DAM A;  1LYL A;  1PH6 A;  4LF7 L;  1PH4 A;  4PZ8 A;  4BBR H;  4AQY Q;  1YHA A;  2HHH L;  2A8V A;  1IBK L;  1TWC H;  1S3O A;  5M5X H;  1YJ9 A;  4A3G H;  3BJU A;  4LF4 L;  2GVA A;  4X62 L;  2VY3 A;  3K7U C;  4A3J G;  1MJE A;  2ZM6 L;  4A3B H;  2UXC L;  4LF6 Q;  4B3R Q;  2WP8 J;  4DR3 Q;  4DV3 L;  4MZ9 A;  5IT9 c;  2ATW A;  3F8T A;  1X9N A;  3HOZ G;  2AWN A;  4R4I A;  1QUQ A;  4A4I A;  5FJ8 H;  2LSS A;  3PUX A;  3F2C A;  1WYD A;  5LMU Q;  3HOY H;  3VDY A;  2EQS A;  2K14 A;  1NBW A;  1JMC A;  5IYD G;  3CW2 C;  3PF5 A;  3M4Q A;  2IHE A;  4B3S L;  3S15 H;  1Q82 C;  4NXM Q;  1NY4 A;  3H3V H;  3PV0 A;  4IFD G;  1SE8 A;  4JI2 L;  1Y1W H;  3HKZ G;  4A3E G;  1CSQ A;  1TWG H;  2I5H A;  4DR4 L;  2IT1 A;  5M3M G;  2JA6 G;  4KHP Q;  1H95 A;  2I5L X;  3CQZ H;  1XMO Q;  1EQQ A;  2EIF A;  4YWM A;  5IYB H;  4A3K G;  1QVC A;  2ZTC A;  4DUZ Q;  1K8A C;  1BBW A;  4HJA A;  1FJG Q;  1VQ8 A;  4A3C G;  1XPO A;  1IBM L;  3K8A A;  4DR1 L;  5C44 G;  3M9B A;  3PO3 H;  2CWP A;  4LFC L;  2CCZ A;  3J81 c;  4UP9 A;  3HOU G;  2RCN A;  3CCL A;  3K80 C;  4KHZ A;  1VQM A;  3D0F A;  4DV7 Q;  4HIM A;  4DV1 L;  1K73 C;  1ASZ A;  1AE2 A;  3KJO A;  3AQQ A;  3T1Y Q;  3OW2 A;  2CQO A;  2OCE A;  3UE1 A;  5JEA G;  4NXN Q;  4L5Q A;  2JEA I;  2R7D A;  1HNW Q;  1WCM H;  5ELO A;  3TEH B;  3CCS A;  1Q86 C;  4JI4 L;  2YTY A;  3MXN B;  4HJ5 A;  2L15 A;  2KHI A;  1K3R A;  2JA5 H;  2WB1 E;  2A19 A;  5IP7 H;  3E0E A;  4DAY B;  3GTK H;  1JT8 A;  1X3E A;  3PCO B;  5C4X H;  1YNX A;  1K83 H;  3UDI A;  2Y0S G;  4DV2 L;  1QVF A;  3JC6 6;  4DV6 Q;  1CKM A;  4A3I H;  1VQA A;  4JC0 A;  4HIO A;  3H0G H;  4LF7 Q;  1MIU A;  4YY3 L;  3S1R H;  1C7Y A;  4A3L G;  4IO9 A;  2R7F A;  2HHH Q;  3GDE A;  1IBK Q;  1FGU A;  1SLJ A;  2GN5 A;  4GS3 A;  3S2D H;  3PO2 H;  4DK3 C;  5C3E G;  1M1K C;  4DR7 L;  2ES2 A;  2UXC Q;  4X62 Q;  3JAM c;  3AEV A;  2ZM6 Q;  1I5F A;  1E22 A;  4A93 H;  1XNR L;  2K5V A;  3KF6 B;  1Z47 A;  4DV3 Q;  4EX5 A;  2B63 H;  1N36 L;  1L2F A;  2D62 A;  2E8G A;  1LM0 A;  1CSP A;  1EIF A;  2AKW B;  3RR5 A;  2I0Q A;  4WJ4 A;  4DKA C;  4DPG A;  1GD7 A;  4GLA C;  1GO3 E;  4A75 A;  4JCV E;  4DV5 L;  1PH3 A;  3GTQ H;  1BKB A;  4JI2 Q;  5BR8 L;  3PIO A;  2K5N A;  4IPC A;  5M5W H;  4DR4 Q;  1CKO A;  2VUM G;  4IOA A;  1PYS B;  1EQR A;  2VQE L;  3GD7 A;  3M4P A;  3U50 C;  1KC8 C;  2CFM A;  4A3J H;  4JBM A;  1VS0 A;  3I7F A;  2ZJP A;  3GTM H;  4OXP A;  4Y52 H;  1HR0 L;  1IBM Q;  2Z6K A;  3KJP A;  4DR1 Q;  1XMO L;  4KHP L;  1OXT A;  1UWV A;  2AMC B;  2NN6 I;  4APV A;  2NVY H;  1KIX A;  3HOZ H;  1NMG A;  1L1O C;  4BBS G;  4L5S A;  2YU9 H;  2VS1 A;  3IRB A;  3I4M H;  4BA2 I;  4JBJ A;  4JOI C;  1YZ6 A;  5IYD H;  4A3D G;  1IL2 A;  1VQ6 A;  3I55 A;  4DV1 Q;  3GO5 A;  4YCV A;  1XMQ L;  5IWA L;  4AIM A;  1OXS C;  1KL9 A;  3A0J A;  4JV5 L;  2HIV A;  4JBW A;  3ICE A;  1YEZ A;  1B8A A;  4HJ7 A;  4UP7 A;  3UDX A;  1G29 1;  3T1Y L;  4POF A;  1S72 A;  5FLX c;  4JI4 Q;  3J7Z C;  2UXD Q;  1IXR A;  3F2B A;  1KRS A;  5GAD C;  2PMZ E;  4A3K H;  4GKK L;  1G6P A;  3I2Z A;  2RHS B;  2UUA L;  1EFW A;  5C0X J;  4GN3 B;  5C44 H;  4YCU A;  1SRO A;  1VQD A;  4JI1 L;  5IY0 A;  3GTJ H;  5LMN L;  4OON A;  1Q7Y C;  5C0X I;  2CKZ B;  4YY3 Q;  3HOU H;  4DV6 L;  2JJQ A;  4X64 Q;  4YHH L;  4O0A A;  1SR3 A;  3RLO A;  1E7Z A;  1I94 L;  2XGT A;  2IX1 A;  4DR7 Q;  2K50 A;  2MQH A;  4B3T L;  1GKH A;  3GTP H;  2N8N A;  4IJL A;  1YHQ A;  2UUC L;  2R7Z G;  2KEN A;  2ID0 A;  1UE7 A;  3PUY A;  4DUY Q;  4GLV B;  4JI7 L;  1XNR Q;  4P73 A;  1L1O B;  1EYG A;  2JE6 I;  3PGZ A;  4LUO A;  3F2D A;  3S14 H;  1N36 Q;  3HKZ E;  3PUW A;  3CPF A;  4PZ7 A;  1TWF H;  2NVQ H;  3HOX G;  1OXV A;  1CKN B;  1YJN A;  3H3V I;  4JI3 Q;  3CPW A;  5IP9 H;  2E2I H;  4J15 A;  3S1N H;  4IPD A;  1Q81 C;  4O2D A;  4BA1 I;  5AJ3 L;  4DV5 Q;  1C0A A;  5BR8 Q;  4A3L H;  1JJG A;  2A1A A;  4C3J H;  1T9H A;  5FLM G;  3WWV A;  2VQE Q;  3AFQ A;  4HJ9 A;  2N3S A;  3SGI A;  1D8L A;  2I5M X;  3CF5 A;  5C3E H;  1XTD A;  2VQF L;  2JQO A;  2NZO A;  3EN2 A;  3KF6 A;  2F3I A;  4MTN A;  3CC7 A;  1Q8K A;  4RG1 A;  1HR0 Q;  1LTL A;  4XIG S;  1GM5 A;  1VQF A;  1A0I A;  3PUV A;  1A62 A;  2Q2U A;  3U4V A;  2OWO A;  3HOW G;  3AYH B;  4NPS A;  1VQB A;  1JJ2 A;  1SRU A;  1E1T A;  4QGU A;  1HNZ L;  1EIY B;  1XNQ L;  4WJ3 M;  4DK6 C;  3L7Z C;  1PH7 A;  1QVG A;  1PH8 A;  1N9W A;  3CME A;  1X3F A;  1W2B A;  1XMQ Q;  5IWA Q;  3BU2 A;  3I56 A;  2Y0S E;  4JV5 Q;  1EUJ A;  4R4Q A;  5JJK A;  5IYC G;  4DV4 L;  2BA1 A;  3KDF B;  4PMW A;  2OTL A;  3EBE A;  2NN6 G;  3Q8D A;  2VUM H;  3BZK A;  4IOC A;  4BXX G;  4C2M H;  4P75 A;  3J81 i;  3MEF A;  1VQ7 A;  4BY7 H;  1X56 A;  4GKK Q;  4IPG A;  4L5T A;  3HOV G;  2UXD L;  4AH6 A;  2ZJR A;  1NE3 A;  2K75 A;  2UUA Q;  4OO1 G;  1HZB A;  2R92 H;  2ZTD A;  3I4N G;  3NEL A;  2QGQ A;  4JI1 Q;  5LMN Q;  3G6E A;  4UP8 A;  2BH2 A;  2F4V L;  1KXL A;  2KCT A;  1E24 A;  4YHH Q;  2DGY A;  2YTV A;  3W1B A;  4NB3 A;  1I94 Q;  2HIX A;  2NZH A;  2NVX H;  3S16 H;  3RLN A;  4QY7 A;  4DV0 L;  3CC2 A;  4X66 L;  4X64 L;  1HZA A;  3J80 i;  4DR5 Q;  1A63 A;  1J5E L;  1HZC A;  2BA0 A;  4B3T Q;  4OX9 Q;  3G48 A;  1FVI A;  2UUC Q;  1BVS A;  1WOC A;  3M3Y H;  4JI7 Q;  4R4C A;  3OYY A;  2K52 A;  1YIJ A;  2B29 A;  4QIW E;  2R93 G;  3CC4 A;  4R4T A;  2MO0 A;  2NVT H;  1K0R A;  1HR0 W;  1VQP A;  1VQK A;  4A3F G;  4DUY L;  3GTL H;  1RIP A;  3PF4 A;  1PH1 A;  4L5R C;  2E2H H;  3FKI H;  1WI5 A;  4JI3 L;  1VQO A;  4K0K L;  2BH8 A;  5AJ3 Q;  5FJ8 G;  3H15 A;  4GKJ L;  1NJI C;  1OTC A;  1X55 A;  2VW9 A;  3E9H A;  2VNU D;  4HIK A;  3U4Z A;  4X65 L;  2VQF Q;  2LXJ A;  4DNI A;  4GOP C;  1L1O A;  3E9I A;  3CXC A;  4A3M G;  1Y1W G;  2R7Z H;  1B7Y B;  3F1Z A;  5H1S E;  2UUB L;  1YHB A;  4AYB G;  3PIP A;  4JOI A;  2PI2 E;  4IFD J;  1CKN A;  3CCV A;  3CP0 A;  1PFS A;  3FP9 A;  3HOX H;  4DR2 Q;  4IFD I;  5LMN W;  1PH9 A;  2E5L Q;  1HNZ Q;  1XNQ Q;  1X3G A;  3ULL A;  3UDG A;  3J7A 5;  1P16 A;  3CAM A;  2YTX A;  3G4S A;  3T1H L;  1E3P A;  4C3I H;  5GAG C;  2EXD A;  1OXU A;  3S1M H;  1SFO H;  5E7N A;  5FLM H;  4DV4 Q;  4HJ8 A;  3CD6 A;  3GTG H;  1HNX L;  4A3E H;  3ERS X;  4JI0 L;  3S17 H;  1TWH H;  1R9T H;  4Y7N H;  5M3M H;  3DLL A;  1VQN A;  2JA6 H;  1WCM G;  2HQL A;  1YBY A;  5JEA J;  3HOW H;  1RL2 A;  3S1Q H;  1EWI A;  1AH9 A;  1Z9F A;  1BBU A;  2F4V Q;  5IP7 G;  4A3C H;  5C4X G;  4LF9 Q;  1A8V A;  4B3M L;  1YVC A;  2OQK A;  4GOP B;  2JEB I;  4LUZ A;  5GAH C;  4DV0 Q;  4X66 Q;  3KYH C;  3H0G G;  4LW1 A;  4A3I G;  4KLK A;  5K36 G;  1J5E Q;  1KD1 C;  3KDF A;  4R1J A;  3CCQ A;  1M90 C;  4TVA B;  1QZG A;  1K9M C;  2ASB A;  5IYC H;  2QA4 A;  2Z0S A;  3OTO L;  4DR5 L;  4OX9 L;  3RN2 A;  3RZO H;  4DR6 L;  2VL6 A;  2OQ0 A;  1NTG A;  1UE1 A;  4R4O A;  3W5O A;  4GNX C;  3TRZ A;  4LWC A;  3CCU A;  2GVB A;  3RN5 A;  1Q12 A;  2B63 G;  1Y1V G;  5EAY A;  2KBN A;  4IJH A;  4K0K Q;  3KF8 B;  2RF4 A;  2RHQ B;  4GKJ Q;  1PA6 A;  3UDF A;  3CCJ A;  1UE6 A;  4X6A H;  1QZH A;  1AE3 A;  3TRE A;  1U5K A;  3NEM A;  3M85 A;  1O7I A;  3J80 c;  1TXY A;  4JI5 Q;  4X65 Q;  1Q46 A;  2UXB L;  1GVP A;  2UUB Q;  2FXQ A;  4A76 A;  3ZJY C;  4C3H H;  4GN5 A;  2R93 H;  1HJP A;  5GAE C;  2Q2T A;  3DM3 A;  1KHI A;  4TQU S;  4PZ6 A;  3KOJ A;  3RZD H;  4A3F H;  4YWL A;  1N8R C;  1N32 L;  3RLF A;  3ER0 A;  1IYJ B;  3TS2 A;  5HGQ A;  5JJI A;  4DR2 L;  3I4O A;  1Q1B A;  2N49 A;  3CMA A;  3T1H Q;  2E5L L;  2MFI A;  1TWA H;  2JA7 G;  3I4M G;  1OXX K;  1V1Q A;  4GNX B;  1W3S A;  3TS0 A;  1YIT A;  1VQC A;  2IHF A;  1HNX Q;  5JJL A;  5HY6 A;  2YV5 A;  3AFP A;  5M3F G;  1MKH A;  1XPU A;  2PQA B;  2JA8 G;  4OWT B;  3STB C;  4A3M H;  4JI0 Q;  2Q2I A;  1XPR A;  1PH5 A;  1VQ9 A;  2JK8 A;  3PUZ A;  3TQY A;  1G51 A;  1JJC B;  2ZJQ A;  4JI6 L;  4QQB X;  2ALY B;  4OWX B;  2AHO B;  3PSI A;  3KLW A;  2E2J H;  4LFB L;  2QEX A;  4EQ5 A;  4LFA L;  1C9O A;  4B3M Q;  3K7A H;  1PV4 A;  1X6O A;  1N34 Q;  1VQJ A;  4XTC S;  1PHJ A;  4BBS H;  2DUD A;  1XJV A;  4LF9 L;  4UY8 C;  2C35 B;  4UPA A;  4BY1 G;  4A3D H;  5M5Y H;  1KRT A;  3A74 A;  1UE5 A;  1IBL Q;  3UE0 A;  1N33 L;  1CUK A;  3OTO Q;  2UU9 L;  2K5H A;  2ZTE A;  4P71 A;  2AWO A;  4QJF A;  1VQE A;  4BBR G;  4LF8 L;  4DR6 Q;  5IE8 A;  2IY5 B;  4PG3 A;  1LUZ A;  5GQO A;  1L0W A;  3U58 A;  1IZ6 A;  1KAW A;  5C0X G;  4A3G G;  4IPH A;  3A5U A;  1J6Q A;  1I3Q H;  3M7N A;  4A3B G;  1UEB A;  1PVO A;  4AYB E;  2Q2H A;  3J81 j;  4MNO A;  1S40 A;  4JYA L;  4GOP A;  5IP9 G;  3L2P A;  1P8L A;  4JBK A;  4LF5 L;  2OTJ A;  4YCW A;  2YYZ A;  3W1G A;  1PYB A;  2N78 A;  3HOY G;  2V1C C;  1QUQ B;  3D31 A;  5C4J H;  2UXB Q;  2PI2 A;  3B6Y A;  4JI8 L;  1VQ4 A;  3CCM A;  1YI2 A;  2HT1 A;  2VZA A;  4JI5 L;  3STB D;  2H5X A;  3HFZ B;  4OWW B;  4AQY L;  2D0O A;  1KQS A;  4LF4 Q;  1WFQ A;  2WB1 G;  2B3G A;  3NBH B;  1N32 Q;  1DGS A;  1D7Q A;  2D0P A;  1ASY A;  1X54 A;  1Y1V H;  5IYB G;  3NEN A;  1VQH A;  2WAQ E;  4QL5 A;  1MJC A;  5ELN A;  4LF6 L;  4B3R L;  4DR3 L;  1I50 H;  4HID A;  4ALP A;  4GLX A;  3GTO H;  3G71 A;  3PO3 G;  4B3S Q;  5LMU L;  2K4K A;  1VQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...