4DR5T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr5T00
4DV7T 3T1HT 5LMUT 4JI4T 4DV0T 4DV3T 1I94T 1HNXT 2ZM6T 4LF8T 2UUAT 4JI3T 1N34T 4DR2T 4JV5T 2VQFT 2UUBT 2UXDT 4X62T 3OTOT 4LF5T 4DUZT 1XMQT 1FJGT 1N33T 1XMOT 1HNZT 4JI0T 5IWAT 4B3MT 2UU9T 4JI6T 4OX9T 1XNQT 4DR6T 1IBLT 1HNWT 4JI2T 1J5ET 4LF9T 4DR3T 4KHPT 4K0KT 4LF6T 4B3ST 4LFCT 4JYAT 4JI1T 4DUYT 4DR7T 3T1YT 2E5LT 4JI7T 4JI8T 4DV6T 4JI5T 4NXMT 2F4VT 4AQYT 4NXNT 1N36T 5LMNT 2UXBT 1IBMT 4DV1T 4X65T 2VQET 4DR5T 4DR1T 4B3TT 4LFBT 2UXCT 4X66T 4GKJT 4B3RT 5BR8T 4LF4T 1IBKT 1HR0T 4LFAT 4DV4T 4LF7T 1N32T 4GKKT 4DV5T 4DV2T 2HHHT 4YY3T 2UUCT 1XNRT 4YHHT 4X64T 4DR4T
chains in the Genus database with same CATH superfamily
3BQKA 2JQHA 3AE4A 2W66A 4YSZA 4IHJE 3FHNA 5J2TE 4KHZF 2V6YB 5LMUT 2LSGA 3ZT7A 4I50E 2X0HA 4PK5A 4IREA 2ZM6T 2FBWA 3RF1A 2LJLA 3FXDB 3N9PA 1HNZT 2W67A 2H7VC 4JI0T 5ABEA 4X5TA 5ETWA 3QB5A 4QXHB 2W61A 3LSVA 2UXNB 5AQGB 2BVMA 3CVRA 2C5KT 2DLRA 5EK2A 2J47A 4XZCA 4HFVA 3UFGA 2P9BA 3DP7A 2XY8B 3QNUA 4GK0E 2KXPB 5LJMA 4ZS3A 3FBLA 4YJ3E 4H9PC 1HX8A 2WZHA 2KNDA 2G0UA 4XBFB 4B3TT 1Y64B 3V5UA 4LF7T 4BJMA 4DO0A 3RX6A 5LYJE 1MNEA 4UF0A 3L3PA 4O2BE 4P1NA 2HN1A 2CM0A 4DV7T 3ETUA 3I9YA 4GYRA 4JI3T 1QLBA 4HFIA 2XPKA 3MZKB 2BS3A 1WRDA 5J1GA 4JUYA 2UU9T 2CXLA 3ZKRA 2XQ6A 4JI6T 2WS3A 2H3RA 3X1DA 3ZCJA 1HX1B 1BR2A 2LOPA 4HEAA 4TWFA 3PUGA 4F8HA 4EEDA 3LFMA 5FY0A 3QOFA 5L3DB 4CZZB 3TLWA 3A5XA 3GA8A 4NXNT 5JDNA 3IEEA 4DV1T 1VOMA 2XAFB 1WCRA 3AE3A 1FEWA 2PBIA 2XUEA 2BG9C 3V5SA 4O4HE 3AAIA 2D2SA 3U78A 2LSYA 3AAAB 3AEAA 4KUMB 5AQRB 5JDGA 3LK3B 3NBXX 2L9QA 3EDUA 4JI4T 3C64A 5ADXL 1OEDB 3FB2A 2V7MA 2EHOC 4AQGA 3VRAA 4DBRA 1ZKEA 3J7Yq 3IBPA 5HEGA 5ABGA 5HXHA 2YU1A 2NW9A 3AECA 2AE9A 5FKYA 3H3MA 3ZMSB 2M6IA 4NIQA 5J2UE 1ZEEA 4KHPT 2XAQB 5L4HA 2XQYA 2XM1A 3AE7A 4AQFA 2E8IA 3R6NA 2IIUA 4A5XA 2FUPA 2XSBA 3PE0A 4ZXLA 3PUYF 4H63H 2BDEA 2X9WA 4HGAA 1T8BA 2KINB 2LSJA 4DR5T 4ISTA 3QC9A 4OYKA 3C51A 3WAKA 4GKJT 2WCAA 3RC3A 3AXJA 3P4WA 4DV2T 3B57A 1LVFA 3AEGA 4UF0B 2E9XD 3B13A 2XQ7A 4U2ZA 1DU2A 5CA0E 4EZ4A 5F8PA 4PNIA 4TV8E 4NUVA 5JRCB 4ZZCA 3IA3A 3RQWA 3KDSE 3FBZA 4DV3T 3RIAA 3ZPOA 3CKDA 1ZOYA 2V8SV 3KV6A 2V7JA 5M4YA 1I6ZA 3ZMVB 2CBIA 5LNKA 3FZHB 3LBXA 3AA6B 3P4QA 4Z91A 1WYCA 3F2EA 2DWGA 2SPCA 5AFUL 1X79A 3WAJA 1M7KA 5DQWA 1R8IA 3EI0A 2N2NA 4UVAB 3GMIA 2ACZA 2XAGB 3AEFA 4CI2B 4JLEA 4OHFA 2Q9QC 4M1PA 4DR7T 3T1YT 2NWBA 2E5LT 4UELA 4JI7T 3ZCIA 5JDHA 5LGNB 2WMOA 4UXNB 1D0XA 4WBNE 4NXMT 4EYYR 1HG5A 2D0UA 1HCIA 5FL1A 3UFEA 2UXBT 5CJ5A 3ZEFB 2JMHA 4U31A 3N9LA 3Q5WA 4H9RC 3PJAJ 2CE7A 4DMVA 2HPJA 5AQQB 4E7SA 2DHRA 4Z8XA 2JQKA 3HKEE 2Y6XA 4X64T 4IGUA 3AE6A 4MFRA 5EZYE 1Z8UA 4QX8B 3UQ7A 2ZMAA 4ILAA 4F6RC 1FIOA 2WDVA 3JCFA 4AI6A 5L47A 3Q5EA 3AE5A 2I0MA 3MXZA 2N1GA 2K48A 2V7IA 4OX9T 2ZM2A 4EXTA 4PJJA 1NWMX 3FZFB 4V1Av 3AE9A 4LF6T 1MMAA 5FVKA 3R84B 2KLQA 3ZYLA 2E9XC 4YFSA 4HFBA 2LOSA 5LG4A 2OV9A 5L4EA 2BG9A 5AQJB 2C0SA 3UU5A 2RA1A 4A56A 3G06A 5LHIB 2ES0A 4ZI2C 4P09A 2NR4A 4LF4T 3ANWB 2WAUA 4U7IA 2NTYA 3UQ4A 5JVDE 3PV0F 4DV5T 3EABA 3CQCB 2K3WA 3ZT6A 4X1KE 4IL4A 2MYSA 4YHHT 3M65A 4IE7A 2EHOA 2V6XA 3NZQA 3UU6A 1G8XA 3ZSTA 3NRXA 5HEUA 3SS1A 5L2LA 3ZLIA 4ZI3D 2V1DB 4COFA 1D1AA 1SHZC 1UCUA 3LBXB 5AQIB 3LDQB 2CXDA 2J62A 4DVDA 2V5DA 2ODVA 5FXWA 2QGSA 4CN4A 2VB6A 2WU5A 4JI2T 2IMLA 3H37A 1U4QA 4UV9B 4P0BA 1MIWA 3EDVA 3ABVA 3U3IA 1T7SA 3GN5A 3RIUC 4K0KT 1FMVA 3L8RA 3VKHA 3AB3B 4O4LE 2PG8A 4YXDA 1NENA 5JH7E 4WNKA 3ZYKA 2VVSA 1EZ3A 3EVYA 4BAYB 1T72A 4EB6E 4QXCB 2X0YA 5DABA 3MA9A 3OYZA 3SRZA 5AQFB 4KBMB 2XM2A 5HWXA 2VWAA 3PUVF 4AXPA 5FNVE 1NEKA 2OA5A 1WR0A 3PUSA 3RKGA 2KSRA 4GOUA 2BS4A 3H3AA 2WMNA 2HHHT 2CMRA 3RIFA 2GK9A 3ONLC 5L3GB 4A97A 4WW0A 3CX8B 4DR4T 2VKJA 3HL6A 5IHYA 1YKHB 2AXDS 2NP9A 2QYWA 3PURA 1HNXT 3N5LA 1MIVA 4JV5T 1OXZA 4EZHA 5ABFA 3M3ZB 3I0OA 2VVNA 2V7LA 3MJXA 1XMOT 1UUSA 4G2AA 3F31A 1IJ6A 4ZI7E 2LKHA 4OFZA 2Q9QA 3UTKA 2OLTA 2FJEA 2CRBA 2WQYA 2RPAA 1LRZA 2BVLA 4IIJE 2CXFA 2WDQA 2XJ7A 2R6GF 4ILBA 4UR9A 2MOZA 3ZT5A 2VKOA 3CWZB 4EAHA 2QRXA 4X1YE 3P7IA 3JC6D 1MMDA 2I6HA 4GIWA 3S4UA 4ASKA 4U3CA 2XAHB 1JNRA 2RP4A 4L9IA 3N2KE 3NKZA 1YD8G 3EAMA 3AAEB 4HWHA 5FXZA 5BR8T 2I59A 4UEMA 1L0VA 4H9QC 3C4WA 1CUNA 3PTRB 5E0OA 4U33A 5IYZE 3FZLB 4YTMA 2EHOB 4I0UA 5IUXA 2YINA 5LBQB 3O9XA 2XQ9A 2VURA 1JNZA 2XQ3A 3VR9A 3QUJA 4H9OC 4DUZT 1XMQT 1FJGT 2FJDA 5HWYA 1XNQT 4I55E 4ZS2A 4LMLA 4JBWF 3P4RA 3P50A 3N9OA 4H9NC 5F3JA 2E9XA 1HFAA 1YQ3A 4AKGA 3E22E 1WYBA 4PFPA 3UU3A 1W0AA 3CQXC 1S94A 3L39A 4QX7B 3UUMA 3K3NA 3K3OA 4AIUA 3C98B 4AQYT 3O1IA 4L0RA 1E7PA 2LKGA 2XASB 1YW0A 2A2FX 5AQLB 3MACA 3AVSA 3W15B 4HFHA 4IDQA 3WI3A 5LA6E 4HN9A 3D0TA 3ZYMA 4B3RT 5HXEA 2LHNA 4U72A 2IHR1 3OJAA 2LHRA 3KVBA 2X67A 3RPUA 4P0AA 1H7CA 2HH7A 5EK3A 3PUAA 2BG9E 4YSXA 5L3CB 4TX5A 4QHOA 3I0QA 4PW8A 1OEDC 1XWMA 5LCYA 4B6XA 1XDOA 3RLFF 3PUZF 4ZZBA 1US7B 2BZBA 2W0GA 5ABFB 2WWVA 2CWYA 5LGUB 1IJ5A 5CB4E 1CHUA 2LT3A 2E5VA 2J4GA 3N9MA 5IWAT 3ETVA 4UVBB 4C90A 4KP3C 3P4SA 2ZM0A 2K9AA 2Q9QB 3LK42 2DWKA 5H6RB 1HG2A 4NUUA 3CQGB 2CLYC 5LHHB 4DNDA 4G63A 2KT9A 4IE0A 4HWFA 4L5GA 3A8YC 3AEDA 3JAFA 5JR9C 4AKRB 1HF8A 5HXRA 2VKHA 1IZNB 1U5PA 2CCQA 1MNDA 5FY7A 3HI2A 2LLYA 3AE1A 1S35A 1Y01A 5FY1A 4ANJA 4YLHA 4TN7B 4C91A 4QH1A 1XZYA 1BR4A 5HCJA 4O4JE 3SWHA 3ZC1A 2QA7A 2A9UA 4YHJA 3OKQA 3CMLA 3HKCE 1AJ3A 2UUBT 3KV4A 3OTOT 4LF5T 4HKAA 3ZJ2A 4AKLA 3UULA 4MBQA 5KX5E 2WB5A 4U74A 4EIWA 1J5ET 3ZSSA 1BR1A 3QK6A 1HS7A 3VRBA 3K3QC 4JEUB 2C5IT 2Y8DA 5HXSA 3O1HA 5HYAA 4UV8B 4YTNA 2L8KA 3ZMTB 3K8PC 2YEVC 2WY2A 2DNXA 5LMNT 5A1LA 2XQ4A 2YDSA 4HWIB 5KDMC 5L3EB 4DR1T 2FJAA 3KBTA 2L3LA 4ILUA 2BKPA 5JREA 5JQGE 3PU3A 4FI5A 3LG7A 1HR0T 3JAEA 4TZ4C 3ZJ1A 2BS2A 3C50A 5AQNB 2DCFA 3UUNA 5LXTE 4CI3B 4MALA 5AQSB 1XNRT 4A98A 3AA7B 2JQQA 2IDOB 3T1HT 4TNWA 3AXJB 4DV0T 3PJAA 1I94T 2VASA 2K5BB 3NVOA 4LF8T 2UUAT 5AQKB 3SFEA 2W62A 5LP6E 2UXDT 3RRWA 2BKNA 2QVAA 2Y48B 4U7YA 4UVCB 2CHOA 2LEHA 4DR6T 3B5MA 1UURA 4AQFC 3RYFE 5LGTB 4CXXA 4QH4A 4EGWA 3RKOA 4LFCT 1FMWA 3TKLB 1YQ4A 4QXBB 1KK7A 4DIDB 2MTQA 3RYIE 3UU4A 5EK4A 2KZ7B 1XDPA 1GQEA 3AA0B 2V5CA 4CXWA 2BKOA 1G73A 1N36T 4HFDA 1IBMT 2PFVA 4X65T 3J9X1 2XQAA 1UK5A 3O1JA 2WBLA 2JQ9A 1X9BA 5CA1E 4TWHA 3Q5XA 1IAPA 2JRKA 1OEDA 3ZMZB 1NAFA 3MK7C 4PK6A 1V9DA 5JDLA 2B76A 2WDRA 2W00A 4CQIA 2YK0A 3VHLA 2ZM8A 2WU2A 5J0ZA 3BQLA 4H63V 4EV6A 4PJMA 5LBMA 3HR0A 5LJNA 2E2AA 2LSIA 4GK5E 3P4PA 2Z6EA 1D1BA 4H9SE 4OK0A 4WZXA 2EHOD 3LJCA 3BK9A 4O2AE 2YDQA 3ZMUB 3NZPA 1HNWT 2KWHA 5LB7B 3T8OA 2BBHA 4DMWA 3HKBE 4NPPA 2ACXA 5JR9A 2XHEB 3PUXF 1D0YA 2LRLA 4LMKA 3HKDE 4DUYT 3EUHA 4LMJA 2KMFA 3I9WA 3N2GE 3AE8A 4ISSA 3ZN1B 3BQIA 4QWNB 1HTJF 1O3XA 4J2CA 4OYJA 4X1IE 2X0LB 2ODUA 1WR6A 4N78D 5JRCA 2YOEA 4HE8A 2J1DG 3C4XA 1N32T 4GKKT 3IHRA 1KNPA 4GYSA 4YY3T 5F5WA 2UUCT 2X66A 4ILCA 2X9XA 3UU8A 2BG9B 4Q25A 5AQPB 4IT4A 5AQHB 4IL9A 4I4TE 4BJNA 2A72A 2X9HA 1WLXA 4ZI3C 4FJOA 3IF8B 2VL0A 2VQFT 4EYUA 1KEYA 1W09A 1W0BA 3Q9DA 1N33T 5CFBA 3N9QA 3ONXA 4B3MT 5AQTB 3KV9A 2XSAA 2JMKA 2WP9A 3SFDA 2PJQA 2XQ8A 3KINB 4LF9T 1D0ZA 2IAKA 4B3ST 3AVRA 2KWIB 3N2OA 2V26A 4E7ZA 4JI1T 4KMCA 5FMNA 4DV6T 2Q9QD 3MKDA 4JI5T 5CGMA 5HXCA 4UIGA 2N9DA 4TUYE 5FL0A 3GN5B 5LG3A 3RHWA 5HEOA 3ZN0B 2D5UA 4YT0A 2NW8A 3CX6B 2YDRA 3CX7B 3UT5E 2JIWA 3E0ZA 4LFBT 2H88A 4Z90A 5FVLA 4AKHA 3AEEA 2IC9A 2M67A 3UUBA 1SA0E 3QB5K 3C4ZA 5HEHA 3OYXA 2X51A 4PJLA 4WYVA 3TLVA 3UUXB 2CBJA 5LHGB 2IUBA 1J5WA 2BBJA 5HAXA 3VKGA 3NWIA 2IC6A 3TLTA 2ZLYA 1B7TA 1SE7A 1N34T 3Q2MA 1LVKA 5AQUB 3A7MA 3FXEB 4DBQA 2M6BA 3RC8A 3ZC0A 2CLYB 4TWDA 2HPLA 5L3BB 3FZKB 4KX6A 2VL8A 2UXXB 4IDNA 3RGLA 4PAGA 5C8YE 3N9NA 5JR9B 4HWDA 1UX4A 3FZMB 3PDYA 1KFYA 4IE6A 4CXYA 5H6QB 2LM9A 2CPTA 1MMNA 2NW7A 5C3JA 4CI1B 3PUWF 4XAXB 4JEHB 3RIUA 5FYMA 2H89A 3JC6C 2JJ9A 3ANWA 2F4VT 3DJBA 3KV5A 1VCTA 5FXXA 1VRBA 3OVUA 2LSKA 4MHCA 3JADA 3LK2B 2H7OA 2DL1A 1QSDA 1ZP0A 3GWHA 2XQ5A 3I1AA 5GONE 3EHZA 5TAOA 3KBUA 3RQUA 3E08A 4U2YA 3F57A 3KFWX 5JDMA 4ZI2D 5JDQA 3RYHE 3PU8A 4WBOA 1ZV4X 4PK4A 1MIYA 3TLSA 4YJ2E 2V6YA 1Z0PA 1LKXA 5L3FB 1KNZA 2MAWA 2D0TA 1OEDE 3VU7H 4X62T 2WWUA 1KF6A 5FP3A 4K0UA 2NOXA 4TNVA 4O4IE 1KNRA 1IBLT 4EOZB 5HCMA 1UGOA 4EEBA 5KXJA 1D1CA 3DTOA 1E2AA 2YU2A 5LOVE 2FJBA 2X9YA 1MMGA 2JPFA 5HEJA 2XAJB 5DQVA 5FXVA 4JI8T 2VKDA 3CPZA 4HWCA 2NTXA 2WM9A 3AA1B 2B1EA 5BMVE 4AKIA 2YN6A 2MPKA 2LRKA 4HFEA 3SOLA 4ERRA 2E9XB 4HTEA 5C2TA 1SUMB 1J1JA 2XTLA 2MBGA 4O8SA 3AEBA 3RRCA 2W2UA 4CN1A 4CN6A 4X66T 5AQVB 2CHNA 4YTPA 4KI0F 3RYCE 1IBKT 4LFAT 4DV4T 4I43B 3VR8A 2PTFA 4MLKA 1T98A 3RI5A 3AE2A 5DJQC 5ABHA 1YKEB 3TLUA 4IDOA 1ZHCA 3P8CD 4ZEYA 4QH5A 4PJNA 3OPCA 2LM2A 4DR2T 5KMGP 2CA5A 4IDZA 2K24A 2X68A 2YKSA 3Q5DA 3KVAA 3PUQA 5JDFA 1WFDA 5AQMB 1VCSA 4YSYA 1W9RA 2VK9A 2WZIA 5AQOB 3O4XE 1UX5A 2D9DA 4PFOA 4DR3T 3ONJA 4QKNA 4JYAT 1BR0A 3NRYA 2DI4A 4HFCA 4TV9E 4ZHQE 3CK6A 1YXRA 3RH3A 2W4XA 2CWOA 2V7KA 3CIRA 2WSSV 3ESLA 1M62A 2A3DA 1OWAA 4X20E 2VQET 2C5JA 4IDPA 4AISA 4ADZA 1QUUA 4ZOLE 2UXCT 2HN2A 2IW5B 5JTGA 4IE5A 3L09A 2CEAA 3K1SA 4BA9A 1E1HB 2W63A 2LE8A 4IE4A 2XZEA 3OBVE 3HA4A
chains in the Genus database with same CATH topology
4DV7T 3T1HT 5LMUT 4JI4T 4DV0T 4DV3T 1I94T 1HNXT 2ZM6T 4LF8T 2UUAT 4JI3T 1N34T 4DR2T 4JV5T 2VQFT 2UUBT 2UXDT 4X62T 3OTOT 4LF5T 4DUZT 1XMQT 1FJGT 1N33T 1XMOT 1HNZT 4JI0T 5IWAT 4B3MT 2UU9T 4JI6T 4OX9T 1XNQT 4DR6T 1IBLT 1HNWT 4JI2T 1J5ET 4LF9T 4DR3T 4KHPT 4K0KT 4LF6T 4B3ST 4LFCT 4JYAT 4JI1T 4DUYT 4DR7T 3T1YT 2E5LT 4JI7T 4JI8T 4DV6T 4JI5T 4NXMT 2F4VT 4AQYT 4NXNT 1N36T 5LMNT 2UXBT 1IBMT 4DV1T 4X65T 2VQET 4DR5T 4DR1T 4B3TT 4LFBT 2UXCT 4X66T 4GKJT 4B3RT 5BR8T 4LF4T 1IBKT 1HR0T 4LFAT 4DV4T 4LF7T 1N32T 4GKKT 4DV5T 4DV2T 2HHHT 4YY3T 2UUCT 1XNRT 4YHHT 4X64T 4DR4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 T;  3T1H T;  5LMU T;  4JI4 T;  4DV0 T;  4DV3 T;  1I94 T;  1HNX T;  2ZM6 T;  4LF8 T;  2UUA T;  4JI3 T;  1N34 T;  4DR2 T;  4JV5 T;  2VQF T;  2UUB T;  2UXD T;  4X62 T;  3OTO T;  4LF5 T;  4DUZ T;  1XMQ T;  1FJG T;  1N33 T;  1XMO T;  1HNZ T;  4JI0 T;  5IWA T;  4B3M T;  2UU9 T;  4JI6 T;  4OX9 T;  1XNQ T;  4DR6 T;  1IBL T;  1HNW T;  4JI2 T;  1J5E T;  4LF9 T;  4DR3 T;  4KHP T;  4K0K T;  4LF6 T;  4B3S T;  4LFC T;  4JYA T;  4JI1 T;  4DUY T;  4DR7 T;  3T1Y T;  2E5L T;  4JI7 T;  4JI8 T;  4DV6 T;  4JI5 T;  4NXM T;  2F4V T;  4AQY T;  4NXN T;  1N36 T;  5LMN T;  2UXB T;  1IBM T;  4DV1 T;  4X65 T;  2VQE T;  4DR5 T;  4DR1 T;  4B3T T;  4LFB T;  2UXC T;  4X66 T;  4GKJ T;  4B3R T;  5BR8 T;  4LF4 T;  1IBK T;  1HR0 T;  4LFA T;  4DV4 T;  4LF7 T;  1N32 T;  4GKK T;  4DV5 T;  4DV2 T;  2HHH T;  4YY3 T;  2UUC T;  1XNR T;  4YHH T;  4X64 T;  4DR4 T; 
#chains in the Genus database with same CATH topology
 3BQK A;  2JQH A;  3AE4 A;  2W66 A;  4YSZ A;  4IHJ E;  3FHN A;  5J2T E;  4KHZ F;  2V6Y B;  5LMU T;  2LSG A;  3ZT7 A;  4I50 E;  2X0H A;  4PK5 A;  4IRE A;  2ZM6 T;  2FBW A;  3RF1 A;  2LJL A;  3FXD B;  3N9P A;  1HNZ T;  2W67 A;  2H7V C;  4JI0 T;  5ABE A;  4X5T A;  5ETW A;  3QB5 A;  4QXH B;  2W61 A;  3LSV A;  2UXN B;  5AQG B;  2BVM A;  3CVR A;  2C5K T;  2DLR A;  5EK2 A;  2J47 A;  4XZC A;  4HFV A;  3UFG A;  2P9B A;  3DP7 A;  2XY8 B;  3QNU A;  4GK0 E;  2KXP B;  5LJM A;  4ZS3 A;  3FBL A;  4YJ3 E;  4H9P C;  1HX8 A;  2WZH A;  2KND A;  2G0U A;  4XBF B;  4B3T T;  1Y64 B;  3V5U A;  4LF7 T;  4BJM A;  4DO0 A;  3RX6 A;  5LYJ E;  1MNE A;  4UF0 A;  3L3P A;  4O2B E;  4P1N A;  2HN1 A;  2CM0 A;  4DV7 T;  3ETU A;  3I9Y A;  4GYR A;  4JI3 T;  1QLB A;  4HFI A;  2XPK A;  3MZK B;  2BS3 A;  1WRD A;  5J1G A;  4JUY A;  2UU9 T;  2CXL A;  3ZKR A;  2XQ6 A;  4JI6 T;  2WS3 A;  2H3R A;  3X1D A;  3ZCJ A;  1HX1 B;  1BR2 A;  2LOP A;  4HEA A;  4TWF A;  3PUG A;  4F8H A;  4EED A;  3LFM A;  5FY0 A;  3QOF A;  5L3D B;  4CZZ B;  3TLW A;  3A5X A;  3GA8 A;  4NXN T;  5JDN A;  3IEE A;  4DV1 T;  1VOM A;  2XAF B;  1WCR A;  3AE3 A;  1FEW A;  2PBI A;  2XUE A;  2BG9 C;  3V5S A;  4O4H E;  3AAI A;  2D2S A;  3U78 A;  2LSY A;  3AAA B;  3AEA A;  4KUM B;  5AQR B;  5JDG A;  3LK3 B;  3NBX X;  2L9Q A;  3EDU A;  4JI4 T;  3C64 A;  5ADX L;  1OED B;  3FB2 A;  2V7M A;  2EHO C;  4AQG A;  3VRA A;  4DBR A;  1ZKE A;  3J7Y q;  3IBP A;  5HEG A;  5ABG A;  5HXH A;  2YU1 A;  2NW9 A;  3AEC A;  2AE9 A;  5FKY A;  3H3M A;  3ZMS B;  2M6I A;  4NIQ A;  5J2U E;  1ZEE A;  4KHP T;  2XAQ B;  5L4H A;  2XQY A;  2XM1 A;  3AE7 A;  4AQF A;  2E8I A;  3R6N A;  2IIU A;  4A5X A;  2FUP A;  2XSB A;  3PE0 A;  4ZXL A;  3PUY F;  4H63 H;  2BDE A;  2X9W A;  4HGA A;  1T8B A;  2KIN B;  2LSJ A;  4DR5 T;  4IST A;  3QC9 A;  4OYK A;  3C51 A;  3WAK A;  4GKJ T;  2WCA A;  3RC3 A;  3AXJ A;  3P4W A;  4DV2 T;  3B57 A;  1LVF A;  3AEG A;  4UF0 B;  2E9X D;  3B13 A;  2XQ7 A;  4U2Z A;  1DU2 A;  5CA0 E;  4EZ4 A;  5F8P A;  4PNI A;  4TV8 E;  4NUV A;  5JRC B;  4ZZC A;  3IA3 A;  3RQW A;  3KDS E;  3FBZ A;  4DV3 T;  3RIA A;  3ZPO A;  3CKD A;  1ZOY A;  2V8S V;  3KV6 A;  2V7J A;  5M4Y A;  1I6Z A;  3ZMV B;  2CBI A;  5LNK A;  3FZH B;  3LBX A;  3AA6 B;  3P4Q A;  4Z91 A;  1WYC A;  3F2E A;  2DWG A;  2SPC A;  5AFU L;  1X79 A;  3WAJ A;  1M7K A;  5DQW A;  1R8I A;  3EI0 A;  2N2N A;  4UVA B;  3GMI A;  2ACZ A;  2XAG B;  3AEF A;  4CI2 B;  4JLE A;  4OHF A;  2Q9Q C;  4M1P A;  4DR7 T;  3T1Y T;  2NWB A;  2E5L T;  4UEL A;  4JI7 T;  3ZCI A;  5JDH A;  5LGN B;  2WMO A;  4UXN B;  1D0X A;  4WBN E;  4NXM T;  4EYY R;  1HG5 A;  2D0U A;  1HCI A;  5FL1 A;  3UFE A;  2UXB T;  5CJ5 A;  3ZEF B;  2JMH A;  4U31 A;  3N9L A;  3Q5W A;  4H9R C;  3PJA J;  2CE7 A;  4DMV A;  2HPJ A;  5AQQ B;  4E7S A;  2DHR A;  4Z8X A;  2JQK A;  3HKE E;  2Y6X A;  4X64 T;  4IGU A;  3AE6 A;  4MFR A;  5EZY E;  1Z8U A;  4QX8 B;  3UQ7 A;  2ZMA A;  4ILA A;  4F6R C;  1FIO A;  2WDV A;  3JCF A;  4AI6 A;  5L47 A;  3Q5E A;  3AE5 A;  2I0M A;  3MXZ A;  2N1G A;  2K48 A;  2V7I A;  4OX9 T;  2ZM2 A;  4EXT A;  4PJJ A;  1NWM X;  3FZF B;  4V1A v;  3AE9 A;  4LF6 T;  1MMA A;  5FVK A;  3R84 B;  2KLQ A;  3ZYL A;  2E9X C;  4YFS A;  4HFB A;  2LOS A;  5LG4 A;  2OV9 A;  5L4E A;  2BG9 A;  5AQJ B;  2C0S A;  3UU5 A;  2RA1 A;  4A56 A;  3G06 A;  5LHI B;  2ES0 A;  4ZI2 C;  4P09 A;  2NR4 A;  4LF4 T;  3ANW B;  2WAU A;  4U7I A;  2NTY A;  3UQ4 A;  5JVD E;  3PV0 F;  4DV5 T;  3EAB A;  3CQC B;  2K3W A;  3ZT6 A;  4X1K E;  4IL4 A;  2MYS A;  4YHH T;  3M65 A;  4IE7 A;  2EHO A;  2V6X A;  3NZQ A;  3UU6 A;  1G8X A;  3ZST A;  3NRX A;  5HEU A;  3SS1 A;  5L2L A;  3ZLI A;  4ZI3 D;  2V1D B;  4COF A;  1D1A A;  1SHZ C;  1UCU A;  3LBX B;  5AQI B;  3LDQ B;  2CXD A;  2J62 A;  4DVD A;  2V5D A;  2ODV A;  5FXW A;  2QGS A;  4CN4 A;  2VB6 A;  2WU5 A;  4JI2 T;  2IML A;  3H37 A;  1U4Q A;  4UV9 B;  4P0B A;  1MIW A;  3EDV A;  3ABV A;  3U3I A;  1T7S A;  3GN5 A;  3RIU C;  4K0K T;  1FMV A;  3L8R A;  3VKH A;  3AB3 B;  4O4L E;  2PG8 A;  4YXD A;  1NEN A;  5JH7 E;  4WNK A;  3ZYK A;  2VVS A;  1EZ3 A;  3EVY A;  4BAY B;  1T72 A;  4EB6 E;  4QXC B;  2X0Y A;  5DAB A;  3MA9 A;  3OYZ A;  3SRZ A;  5AQF B;  4KBM B;  2XM2 A;  5HWX A;  2VWA A;  3PUV F;  4AXP A;  5FNV E;  1NEK A;  2OA5 A;  1WR0 A;  3PUS A;  3RKG A;  2KSR A;  4GOU A;  2BS4 A;  3H3A A;  2WMN A;  2HHH T;  2CMR A;  3RIF A;  2GK9 A;  3ONL C;  5L3G B;  4A97 A;  4WW0 A;  3CX8 B;  4DR4 T;  2VKJ A;  3HL6 A;  5IHY A;  1YKH B;  2AXD S;  2NP9 A;  2QYW A;  3PUR A;  1HNX T;  3N5L A;  1MIV A;  4JV5 T;  1OXZ A;  4EZH A;  5ABF A;  3M3Z B;  3I0O A;  2VVN A;  2V7L A;  3MJX A;  1XMO T;  1UUS A;  4G2A A;  3F31 A;  1IJ6 A;  4ZI7 E;  2LKH A;  4OFZ A;  2Q9Q A;  3UTK A;  2OLT A;  2FJE A;  2CRB A;  2WQY A;  2RPA A;  1LRZ A;  2BVL A;  4IIJ E;  2CXF A;  2WDQ A;  2XJ7 A;  2R6G F;  4ILB A;  4UR9 A;  2MOZ A;  3ZT5 A;  2VKO A;  3CWZ B;  4EAH A;  2QRX A;  4X1Y E;  3P7I A;  3JC6 D;  1MMD A;  2I6H A;  4GIW A;  3S4U A;  4ASK A;  4U3C A;  2XAH B;  1JNR A;  2RP4 A;  4L9I A;  3N2K E;  3NKZ A;  1YD8 G;  3EAM A;  3AAE B;  4HWH A;  5FXZ A;  5BR8 T;  2I59 A;  4UEM A;  1L0V A;  4H9Q C;  3C4W A;  1CUN A;  3PTR B;  5E0O A;  4U33 A;  5IYZ E;  3FZL B;  4YTM A;  2EHO B;  4I0U A;  5IUX A;  2YIN A;  5LBQ B;  3O9X A;  2XQ9 A;  2VUR A;  1JNZ A;  2XQ3 A;  3VR9 A;  3QUJ A;  4H9O C;  4DUZ T;  1XMQ T;  1FJG T;  2FJD A;  5HWY A;  1XNQ T;  4I55 E;  4ZS2 A;  4LML A;  4JBW F;  3P4R A;  3P50 A;  3N9O A;  4H9N C;  5F3J A;  2E9X A;  1HFA A;  1YQ3 A;  4AKG A;  3E22 E;  1WYB A;  4PFP A;  3UU3 A;  1W0A A;  3CQX C;  1S94 A;  3L39 A;  4QX7 B;  3UUM A;  3K3N A;  3K3O A;  4AIU A;  3C98 B;  4AQY T;  3O1I A;  4L0R A;  1E7P A;  2LKG A;  2XAS B;  1YW0 A;  2A2F X;  5AQL B;  3MAC A;  3AVS A;  3W15 B;  4HFH A;  4IDQ A;  3WI3 A;  5LA6 E;  4HN9 A;  3D0T A;  3ZYM A;  4B3R T;  5HXE A;  2LHN A;  4U72 A;  2IHR 1;  3OJA A;  2LHR A;  3KVB A;  2X67 A;  3RPU A;  4P0A A;  1H7C A;  2HH7 A;  5EK3 A;  3PUA A;  2BG9 E;  4YSX A;  5L3C B;  4TX5 A;  4QHO A;  3I0Q A;  4PW8 A;  1OED C;  1XWM A;  5LCY A;  4B6X A;  1XDO A;  3RLF F;  3PUZ F;  4ZZB A;  1US7 B;  2BZB A;  2W0G A;  5ABF B;  2WWV A;  2CWY A;  5LGU B;  1IJ5 A;  5CB4 E;  1CHU A;  2LT3 A;  2E5V A;  2J4G A;  3N9M A;  5IWA T;  3ETV A;  4UVB B;  4C90 A;  4KP3 C;  3P4S A;  2ZM0 A;  2K9A A;  2Q9Q B;  3LK4 2;  2DWK A;  5H6R B;  1HG2 A;  4NUU A;  3CQG B;  2CLY C;  5LHH B;  4DND A;  4G63 A;  2KT9 A;  4IE0 A;  4HWF A;  4L5G A;  3A8Y C;  3AED A;  3JAF A;  5JR9 C;  4AKR B;  1HF8 A;  5HXR A;  2VKH A;  1IZN B;  1U5P A;  2CCQ A;  1MND A;  5FY7 A;  3HI2 A;  2LLY A;  3AE1 A;  1S35 A;  1Y01 A;  5FY1 A;  4ANJ A;  4YLH A;  4TN7 B;  4C91 A;  4QH1 A;  1XZY A;  1BR4 A;  5HCJ A;  4O4J E;  3SWH A;  3ZC1 A;  2QA7 A;  2A9U A;  4YHJ A;  3OKQ A;  3CML A;  3HKC E;  1AJ3 A;  2UUB T;  3KV4 A;  3OTO T;  4LF5 T;  4HKA A;  3ZJ2 A;  4AKL A;  3UUL A;  4MBQ A;  5KX5 E;  2WB5 A;  4U74 A;  4EIW A;  1J5E T;  3ZSS A;  1BR1 A;  3QK6 A;  1HS7 A;  3VRB A;  3K3Q C;  4JEU B;  2C5I T;  2Y8D A;  5HXS A;  3O1H A;  5HYA A;  4UV8 B;  4YTN A;  2L8K A;  3ZMT B;  3K8P C;  2YEV C;  2WY2 A;  2DNX A;  5LMN T;  5A1L A;  2XQ4 A;  2YDS A;  4HWI B;  5KDM C;  5L3E B;  4DR1 T;  2FJA A;  3KBT A;  2L3L A;  4ILU A;  2BKP A;  5JRE A;  5JQG E;  3PU3 A;  4FI5 A;  3LG7 A;  1HR0 T;  3JAE A;  4TZ4 C;  3ZJ1 A;  2BS2 A;  3C50 A;  5AQN B;  2DCF A;  3UUN A;  5LXT E;  4CI3 B;  4MAL A;  5AQS B;  1XNR T;  4A98 A;  3AA7 B;  2JQQ A;  2IDO B;  3T1H T;  4TNW A;  3AXJ B;  4DV0 T;  3PJA A;  1I94 T;  2VAS A;  2K5B B;  3NVO A;  4LF8 T;  2UUA T;  5AQK B;  3SFE A;  2W62 A;  5LP6 E;  2UXD T;  3RRW A;  2BKN A;  2QVA A;  2Y48 B;  4U7Y A;  4UVC B;  2CHO A;  2LEH A;  4DR6 T;  3B5M A;  1UUR A;  4AQF C;  3RYF E;  5LGT B;  4CXX A;  4QH4 A;  4EGW A;  3RKO A;  4LFC T;  1FMW A;  3TKL B;  1YQ4 A;  4QXB B;  1KK7 A;  4DID B;  2MTQ A;  3RYI E;  3UU4 A;  5EK4 A;  2KZ7 B;  1XDP A;  1GQE A;  3AA0 B;  2V5C A;  4CXW A;  2BKO A;  1G73 A;  1N36 T;  4HFD A;  1IBM T;  2PFV A;  4X65 T;  3J9X 1;  2XQA A;  1UK5 A;  3O1J A;  2WBL A;  2JQ9 A;  1X9B A;  5CA1 E;  4TWH A;  3Q5X A;  1IAP A;  2JRK A;  1OED A;  3ZMZ B;  1NAF A;  3MK7 C;  4PK6 A;  1V9D A;  5JDL A;  2B76 A;  2WDR A;  2W00 A;  4CQI A;  2YK0 A;  3VHL A;  2ZM8 A;  2WU2 A;  5J0Z A;  3BQL A;  4H63 V;  4EV6 A;  4PJM A;  5LBM A;  3HR0 A;  5LJN A;  2E2A A;  2LSI A;  4GK5 E;  3P4P A;  2Z6E A;  1D1B A;  4H9S E;  4OK0 A;  4WZX A;  2EHO D;  3LJC A;  3BK9 A;  4O2A E;  2YDQ A;  3ZMU B;  3NZP A;  1HNW T;  2KWH A;  5LB7 B;  3T8O A;  2BBH A;  4DMW A;  3HKB E;  4NPP A;  2ACX A;  5JR9 A;  2XHE B;  3PUX F;  1D0Y A;  2LRL A;  4LMK A;  3HKD E;  4DUY T;  3EUH A;  4LMJ A;  2KMF A;  3I9W A;  3N2G E;  3AE8 A;  4ISS A;  3ZN1 B;  3BQI A;  4QWN B;  1HTJ F;  1O3X A;  4J2C A;  4OYJ A;  4X1I E;  2X0L B;  2ODU A;  1WR6 A;  4N78 D;  5JRC A;  2YOE A;  4HE8 A;  2J1D G;  3C4X A;  1N32 T;  4GKK T;  3IHR A;  1KNP A;  4GYS A;  4YY3 T;  5F5W A;  2UUC T;  2X66 A;  4ILC A;  2X9X A;  3UU8 A;  2BG9 B;  4Q25 A;  5AQP B;  4IT4 A;  5AQH B;  4IL9 A;  4I4T E;  4BJN A;  2A72 A;  2X9H A;  1WLX A;  4ZI3 C;  4FJO A;  3IF8 B;  2VL0 A;  2VQF T;  4EYU A;  1KEY A;  1W09 A;  1W0B A;  3Q9D A;  1N33 T;  5CFB A;  3N9Q A;  3ONX A;  4B3M T;  5AQT B;  3KV9 A;  2XSA A;  2JMK A;  2WP9 A;  3SFD A;  2PJQ A;  2XQ8 A;  3KIN B;  4LF9 T;  1D0Z A;  2IAK A;  4B3S T;  3AVR A;  2KWI B;  3N2O A;  2V26 A;  4E7Z A;  4JI1 T;  4KMC A;  5FMN A;  4DV6 T;  2Q9Q D;  3MKD A;  4JI5 T;  5CGM A;  5HXC A;  4UIG A;  2N9D A;  4TUY E;  5FL0 A;  3GN5 B;  5LG3 A;  3RHW A;  5HEO A;  3ZN0 B;  2D5U A;  4YT0 A;  2NW8 A;  3CX6 B;  2YDR A;  3CX7 B;  3UT5 E;  2JIW A;  3E0Z A;  4LFB T;  2H88 A;  4Z90 A;  5FVL A;  4AKH A;  3AEE A;  2IC9 A;  2M67 A;  3UUB A;  1SA0 E;  3QB5 K;  3C4Z A;  5HEH A;  3OYX A;  2X51 A;  4PJL A;  4WYV A;  3TLV A;  3UUX B;  2CBJ A;  5LHG B;  2IUB A;  1J5W A;  2BBJ A;  5HAX A;  3VKG A;  3NWI A;  2IC6 A;  3TLT A;  2ZLY A;  1B7T A;  1SE7 A;  1N34 T;  3Q2M A;  1LVK A;  5AQU B;  3A7M A;  3FXE B;  4DBQ A;  2M6B A;  3RC8 A;  3ZC0 A;  2CLY B;  4TWD A;  2HPL A;  5L3B B;  3FZK B;  4KX6 A;  2VL8 A;  2UXX B;  4IDN A;  3RGL A;  4PAG A;  5C8Y E;  3N9N A;  5JR9 B;  4HWD A;  1UX4 A;  3FZM B;  3PDY A;  1KFY A;  4IE6 A;  4CXY A;  5H6Q B;  2LM9 A;  2CPT A;  1MMN A;  2NW7 A;  5C3J A;  4CI1 B;  3PUW F;  4XAX B;  4JEH B;  3RIU A;  5FYM A;  2H89 A;  3JC6 C;  2JJ9 A;  3ANW A;  2F4V T;  3DJB A;  3KV5 A;  1VCT A;  5FXX A;  1VRB A;  3OVU A;  2LSK A;  4MHC A;  3JAD A;  3LK2 B;  2H7O A;  2DL1 A;  1QSD A;  1ZP0 A;  3GWH A;  2XQ5 A;  3I1A A;  5GON E;  3EHZ A;  5TAO A;  3KBU A;  3RQU A;  3E08 A;  4U2Y A;  3F57 A;  3KFW X;  5JDM A;  4ZI2 D;  5JDQ A;  3RYH E;  3PU8 A;  4WBO A;  1ZV4 X;  4PK4 A;  1MIY A;  3TLS A;  4YJ2 E;  2V6Y A;  1Z0P A;  1LKX A;  5L3F B;  1KNZ A;  2MAW A;  2D0T A;  1OED E;  3VU7 H;  4X62 T;  2WWU A;  1KF6 A;  5FP3 A;  4K0U A;  2NOX A;  4TNV A;  4O4I E;  1KNR A;  1IBL T;  4EOZ B;  5HCM A;  1UGO A;  4EEB A;  5KXJ A;  1D1C A;  3DTO A;  1E2A A;  2YU2 A;  5LOV E;  2FJB A;  2X9Y A;  1MMG A;  2JPF A;  5HEJ A;  2XAJ B;  5DQV A;  5FXV A;  4JI8 T;  2VKD A;  3CPZ A;  4HWC A;  2NTX A;  2WM9 A;  3AA1 B;  2B1E A;  5BMV E;  4AKI A;  2YN6 A;  2MPK A;  2LRK A;  4HFE A;  3SOL A;  4ERR A;  2E9X B;  4HTE A;  5C2T A;  1SUM B;  1J1J A;  2XTL A;  2MBG A;  4O8S A;  3AEB A;  3RRC A;  2W2U A;  4CN1 A;  4CN6 A;  4X66 T;  5AQV B;  2CHN A;  4YTP A;  4KI0 F;  3RYC E;  1IBK T;  4LFA T;  4DV4 T;  4I43 B;  3VR8 A;  2PTF A;  4MLK A;  1T98 A;  3RI5 A;  3AE2 A;  5DJQ C;  5ABH A;  1YKE B;  3TLU A;  4IDO A;  1ZHC A;  3P8C D;  4ZEY A;  4QH5 A;  4PJN A;  3OPC A;  2LM2 A;  4DR2 T;  5KMG P;  2CA5 A;  4IDZ A;  2K24 A;  2X68 A;  2YKS A;  3Q5D A;  3KVA A;  3PUQ A;  5JDF A;  1WFD A;  5AQM B;  1VCS A;  4YSY A;  1W9R A;  2VK9 A;  2WZI A;  5AQO B;  3O4X E;  1UX5 A;  2D9D A;  4PFO A;  4DR3 T;  3ONJ A;  4QKN A;  4JYA T;  1BR0 A;  3NRY A;  2DI4 A;  4HFC A;  4TV9 E;  4ZHQ E;  3CK6 A;  1YXR A;  3RH3 A;  2W4X A;  2CWO A;  2V7K A;  3CIR A;  2WSS V;  3ESL A;  1M62 A;  2A3D A;  1OWA A;  4X20 E;  2VQE T;  2C5J A;  4IDP A;  4AIS A;  4ADZ A;  1QUU A;  4ZOL E;  2UXC T;  2HN2 A;  2IW5 B;  5JTG A;  4IE5 A;  3L09 A;  2CEA A;  3K1S A;  4BA9 A;  1E1H B;  2W63 A;  2LE8 A;  4IE4 A;  2XZE A;  3OBV E;  3HA4 A; 
#chains in the Genus database with same CATH homology
 4DV7 T;  3T1H T;  5LMU T;  4JI4 T;  4DV0 T;  4DV3 T;  1I94 T;  1HNX T;  2ZM6 T;  4LF8 T;  2UUA T;  4JI3 T;  1N34 T;  4DR2 T;  4JV5 T;  2VQF T;  2UUB T;  2UXD T;  4X62 T;  3OTO T;  4LF5 T;  4DUZ T;  1XMQ T;  1FJG T;  1N33 T;  1XMO T;  1HNZ T;  4JI0 T;  5IWA T;  4B3M T;  2UU9 T;  4JI6 T;  4OX9 T;  1XNQ T;  4DR6 T;  1IBL T;  1HNW T;  4JI2 T;  1J5E T;  4LF9 T;  4DR3 T;  4KHP T;  4K0K T;  4LF6 T;  4B3S T;  4LFC T;  4JYA T;  4JI1 T;  4DUY T;  4DR7 T;  3T1Y T;  2E5L T;  4JI7 T;  4JI8 T;  4DV6 T;  4JI5 T;  4NXM T;  2F4V T;  4AQY T;  4NXN T;  1N36 T;  5LMN T;  2UXB T;  1IBM T;  4DV1 T;  4X65 T;  2VQE T;  4DR5 T;  4DR1 T;  4B3T T;  4LFB T;  2UXC T;  4X66 T;  4GKJ T;  4B3R T;  5BR8 T;  4LF4 T;  1IBK T;  1HR0 T;  4LFA T;  4DV4 T;  4LF7 T;  1N32 T;  4GKK T;  4DV5 T;  4DV2 T;  2HHH T;  4YY3 T;  2UUC T;  1XNR T;  4YHH T;  4X64 T;  4DR4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...