4DR5T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr5T00
1HR0T 2UXDT 2UUCT 4GKJT 4DR7T 4DV1T 1HNXT 4DR2T 2UXBT 4LF4T 5IWAT 4X64T 4KHPT 1XMOT 4LF7T 4JI5T 4DV6T 1N36T 4JV5T 4GKKT 1XNQT 4JI2T 3T1HT 1XNRT 4LF8T 4NXNT 4DR3T 1N32T 1I94T 4DV0T 1HNZT 5LMNT 4DR4T 2UU9T 4X65T 4OX9T 1FJGT 1N33T 4JI8T 2VQET 1HNWT 1XMQT 4AQYT 4LFCT 4DV4T 5LMUT 4LF6T 4K0KT 4B3ST 4NXMT 4DV7T 4JI0T 2E5LT 2UXCT 1IBKT 2HHHT 4B3RT 4JI1T 4JI3T 4DV5T 3OTOT 4LF5T 4LFBT 4DUZT 1IBLT 4B3TT 3T1YT 2UUBT 4DV2T 4LF9T 1IBMT 4JI6T 2F4VT 4DUYT 4YHHT 4B3MT 4JYAT 4X62T 2UUAT 5BR8T 4JI7T 4DR6T 4JI4T 4YY3T 4DV3T 1N34T 4DR5T 2ZM6T 2VQFT 4X66T 4DR1T 1J5ET 4LFAT
chains in the Genus database with same CATH superfamily
2I6HA 2A9UA 3ETVA 2CHNA 4U7YA 3P50A 3AEAA 5LJNA 1I6ZA 2VL0A 2H89A 4XBFB 3MA9A 3OYXA 2UXBT 4X1YE 3AVRA 1NENA 2EHOA 3Q2MA 3I0QA 5KDMC 3IHRA 4KP3C 4E7ZA 4IGUA 2BG9C 3KVAA 5AQRB 2CBJA 2XPKA 4C90A 5EK4A 4LF8T 4U7IA 3PUZF 2CRBA 2UU9T 5HEJA 4EAHA 2WWVA 5AQLB 1XMQT 4EEBA 5HXRA 4CXXA 3ZKRA 4TV9E 2CXLA 5JR9C 5H6RB 2L3LA 1IBKT 3ZYMA 3I9YA 4B3RT 4U31A 4ISSA 3ESLA 3JC6C 2CEAA 4J2CA 2VKDA 1D1AA 5JQGE 5AQQB 1WR0A 2WDQA 2IDOB 3LSVA 1MNDA 4UV9B 2E8IA 4O8SA 4O2BE 4HFBA 3FHNA 4DR5T 3KVBA 3AE5A 3AE8A 5HEOA 4WW0A 2BKPA 3M3ZB 2BS3A 2H88A 2W00A 2WQYA 4O4JE 4ZI2D 3UTKA 4PJJA 4BA9A 2XQ8A 3UFGA 2HPLA 3AAIA 5J2UE 1T7SA 4NUUA 4IE7A 5HEUA 1YKHB 1KNZA 3CVRA 3GN5A 2W67A 4PJNA 4CN6A 2X0LB 4HFVA 4GIWA 2XQ9A 2MTQA 4PW8A 2MPKA 2VQET 1KK7A 2CXFA 2AE9A 2XZEA 3AB3B 4AQFA 1LVFA 5L3CB 1SE7A 4A98A 2QA7A 3RQWA 2E9XC 1HS7A 4UXNB 1MIYA 2BG9A 3N2KE 5ABGA 4JI3T 4IDZA 3Q5WA 3UU4A 3C4ZA 4B3TT 1NAFA 3C51A 1SUMB 3PUYF 4QH5A 5BMVE 4JI4T 3AA0B 2PG8A 5AQGB 3VR8A 3CX8B 2W66A 1WCRA 4DR1T 2XAGB 4L9IA 2XQ6A 3RIAA 3PUWF 5CJ5A 2Q9QD 4I0UA 2UUCT 3P4QA 5CA1E 1CHUA 4DR2T 1U4QA 1L0VA 3TKLB 5C3JA 5JDNA 1XMOT 4PNIA 4DV6T 4QXHB 3AAEB 4P09A 3UULA 2QVAA 1XNRT 5HXEA 3ZT7A 5LMNT 3T8OA 2LRLA 5JDHA 4AKRB 4ILBA 4X65T 3LJCA 3W15B 1HG5A 4FJOA 3R6NA 5AQHB 5ADXL 4NXMT 3UU6A 5AQMB 2XAHB 4EZ4A 1NEKA 5FVLA 5AQPB 3RLFF 4LFBT 2BKOA 2KT9A 2ACXA 2L8KA 2LSJA 3M65A 3RIUC 3P4SA 1FMVA 4B6XA 2HPJA 4YHHT 5LP6E 3NKZA 1VOMA 2RP4A 2QYWA 2V5CA 5ETWA 2B1EA 2IIUA 4UVAB 2W4XA 2CBIA 3IEEA 3ZCIA 4XAXB 3B5MA 4YTNA 4DV1T 4EIWA 2V6XA 4OK0A 4H9OC 1KF6A 5ABEA 1MMGA 3HL6A 3L8RA 4IREA 3V5UA 4E7SA 2KZ7B 4NXNT 2BDEA 4ZI7E 2NW7A 2C5KT 2CM0A 2ZM0A 5AQSB 3AA6B 3AE6A 3P4WA 2LSGA 3PU8A 3L09A 5DQVA 2BG9E 3ANWB 3UQ4A 3EVYA 5EK2A 2V8SV 2JPFA 3WAKA 1QLBA 4NIQA 2YOEA 3J7Yq 1AJ3A 2N1GA 4YFSA 5AQJB 4LF9T 2NOXA 3AE3A 4QX8B 5DQWA 5L4EA 3FXDB 4JYAT 1YW0A 3PUVF 2E2AA 3SOLA 3AXJA 3FB2A 4JEHB 3IF8B 1EZ3A 3FBZA 4ZZCA 4IE4A 4H9SE 4L5GA 4AKGA 4KX6A 3E0ZA 4IE5A 3ONJA 5IYZE 4UEMA 4IL9A 1W09A 4HN9A 4QXCB 3QNUA 4BJMA 3JADA 3LK42 4P1NA 2LKGA 2IAKA 2W61A 4CXWA 2DHRA 3AE2A 3QOFA 4PJLA 4I4TE 5CFBA 4JI5T 5JDMA 3AEBA 3CQCB 3N9PA 2L9QA 4IT4A 4I43B 4DR3T 1N32T 3ZEFB 2Z6EA 3VR9A 2WCAA 2IC6A 1IJ5A 4QH4A 3CK6A 1BR1A 5J2TE 1YD8G 4LF6T 3V5SA 1UX5A 1VCTA 2BZBA 4ADZA 3OKQA 1ZKEA 3CIRA 2X0YA 3OTOT 1W0BA 2P9BA 3NRYA 2LRKA 5LGNB 2MYSA 5KX5E 2LHNA 4ASKA 2LM2A 1E7PA 4JI7T 2XAFB 1DU2A 2EHOD 3PTRB 2VQFT 2LHRA 1OEDB 3Q5XA 1ZHCA 1J5ET 4LFAT 3C4WA 3BQKA 1R8IA 4QX7B 2QRXA 3K8PC 4HFHA 4KMCA 4ZHQE 2LM9A 2BBJA 2X66A 3ZSSA 4LF4T 4GOUA 2LKHA 4HGAA 3LFMA 1J1JA 2JMKA 3ZYLA 4KHPT 3KBUA 4LMJA 2CE7A 2UXNB 3AE9A 2LJLA 1KEYA 1I94T 5L3DB 3AEEA 5JVDE 1HNWT 2X0HA 5L47A 3S4UA 1WFDA 4WYVA 1MIWA 4B3ST 2D2SA 5IHYA 5LNKA 3VKGA 4JEUB 4HFCA 4IL4A 5L3FB 4NUVA 5JRCA 1JNRA 3LG7A 5EZYE 5L3BB 2KMFA 3KDSE 1VRBA 3K1SA 4ZI2C 2XQ4A 2PTFA 4B3MT 4ZOLE 2OV9A 3RPUA 2KNDA 2C5IT 3K3NA 4YJ2E 4AKHA 3ZMUB 3A5XA 1SHZC 3QUJA 4TWFA 3UUMA 5HEHA 2WDRA 4ILUA 4EEDA 3Q5EA 1S35A 5HXHA 3ZMTB 3SWHA 3ZMZB 2JIWA 4MHCA 4N78D 5HWYA 1BR4A 5FMNA 4DNDA 5LG3A 3PURA 1T8BA 3FZKB 5FY1A 5L4HA 2V7JA 2Y6XA 3HKCE 3HI2A 3LBXB 4U2YA 1FEWA 2FJAA 4PFOA 3MK7C 4IIJE 4CN1A 2DNXA 2XJ7A 5HAXA 2V6YB 3P7IA 3KBTA 2V7KA 1FIOA 3SFDA 2ZLYA 2ZM8A 3G06A 3AA1B 3ZYKA 3FZFB 1WRDA 3HR0A 5FL1A 4PAGA 3AA7B 4OYKA 3PU3A 1HG2A 4I55E 5JDLA 5AQTB 5M4YA 4DUZT 3RHWA 2Q9QC 4JBWF 5LJMA 1OEDC 2CLYB 3NRXA 2V1DB 1LVKA 3MACA 3PUAA 2LLYA 5L2LA 1B7TA 2K3WA 2M6IA 1NWMX 2K24A 4IDQA 4MBQA 3UT5E 2J1DG 5ABFA 1YQ4A 4F6RC 4DR7T 2MAWA 3WI3A 3A7MA 3DP7A 4TNVA 2K9AA 4X1KE 2WZHA 1HNXT 1M62A 5JR9A 4O2AE 4UF0A 4UVCB 3RYIE 5LBQB 4I50E 1Y01A 2JQKA 1MMAA 4HWDA 5HXCA 3F31A 4IDOA 2OLTA 3C98B 4PK6A 2FUPA 4JUYA 4CI1B 4A56A 2KWHA 3P4PA 2ACZA 3ZJ1A 4JI0T 4H63H 2DL1A 1CUNA 2HHHT 4HWHA 3TLWA 3MZKB 3RI5A 5F5WA 2WY2A 4G63A 5FKYA 5AQKB 2JQ9A 1XWMA 2EHOB 4HE8A 4DUYT 2DCFA 2IMLA 4Z90A 3Q5DA 5C8YE 3KV4A 3BK9A 4TWHA 1N34T 3UUBA 3CX7B 2WMOA 2ZM6T 2J62A 4AKLA 3R84B 3RX6A 2DWGA 3I0OA 2JRKA 3C64A 2LSIA 3NBXX 3AE4A 2LE8A 2Q9QA 1IAPA 1G8XA 4EYYR 3EI0A 4YSYA 2E9XA 5GONE 3UU3A 5EK3A 5FYMA 5CGMA 3LK3B 4LMKA 4CZZB 3BQLA 3CQXC 2YKSA 1KFYA 3GMIA 4GYSA 4COFA 2X9WA 4LFCT 5DJQC 2ODVA 4K0KT 4H63V 3RKOA 2K5BB 4UV8B 4H9QC 3PUGA 2XSAA 5J1GA 3K3OA 2XUEA 2XAQB 3OVUA 3L39A 2A3DA 1D0XA 1Y64B 2CLYC 3UUNA 1X9BA 4O4HE 1VCSA 4UELA 1SA0E 2PFVA 3AEDA 5CB4E 1HX1B 2XSBA 3GN5B 3HKDE 4OYJA 2NTXA 3ZT5A 1V9DA 2K48A 3CPZA 4X5TA 2CHOA 1WR6A 3C4XA 4P0BA 5LA6E 3I9WA 2UXDT 2BBHA 2CWOA 3HKBE 3B57A 2SPCA 2WBLA 2BG9B 4ILAA 2A2FX 2WDVA 1T72A 2WS3A 2XQ3A 5LOVE 4HFDA 4JV5T 2D5UA 4A97A 3TLSA 4BAYB 3RQUA 4GKKT 5L3GB 3T1HT 4EV6A 2BVMA 3RIUA 1KNPA 4YLHA 3I1AA 1ZOYA 1HX8A 1N33T 1UCUA 4OFZA 3EHZA 3FZMB 2X68A 2RPAA 1XZYA 3N9NA 2EHOC 2XQYA 3AE1A 3UQ7A 3ZC0A 3QB5K 3KINB 5AQFB 2XY8B 2IW5B 2W0GA 4IDPA 2XQ5A 1LRZA 4HKAA 2LOPA 2C5JA 1D0YA 1WYBA 4AXPA 2BVLA 2GK9A 1UUSA 2UUAT 5FXZA 4A5XA 5LBMA 5HXSA 2CXDA 3SS1A 3OBVE 4U2ZA 4Z8XA 5HEGA 3AEGA 4MALA 3ZSTA 2R6GF 5A1LA 3ZN1B 2JQQA 5LG4A 4QHOA 3GA8A 2WU2A 5C2TA 2FJEA 1X79A 2KWIB 3RKGA 2VKOA 2XAJB 1UURA 4CXYA 5JREA 4TN7B 4UR9A 3CX6B 2WM9A 4C91A 3AVSA 4HWCA 4WBOA 1MIVA 2LOSA 4P0AA 4H9RC 2NW9A 3VHLA 5AQOB 4WZXA 2FJDA 3MKDA 4EXTA 4DV4T 4WNKA 3X1DA 3ONLC 4DV7T 4OHFA 4ZS2A 1HFAA 3N9QA 2NWBA 2IC9A 2WAUA 3NZPA 3PE0A 3FZHB 3E08A 4DMWA 5KMGP 3NZQA 4ZEYA 2NTYA 3N2GE 2ES0A 5H6QB 3EAMA 2BKNA 1XDPA 5FXWA 3P4RA 2X67A 3H3MA 4DR6T 4PK4A 2HH7A 1MMNA 3EDVA 2IHR1 2YINA 4AQFC 4DBRA 2J47A 5LGUB 2D9DA 3PJAJ 2YK0A 2LSKA 1HR0T 4GK5E 3N9OA 5IUXA 3RH3A 4HEAA 4KI0F 3ZJ2A 3GWHA 3Q9DA 5FY0A 2CPTA 4TZ4C 3U78A 3SFEA 5FXVA 3AAAB 2V5DA 2H7OA 1JNZA 4L0RA 3JAEA 4TWDA 5HWXA 5JDQA 5LCYA 2LSYA 2WZIA 4O4LE 3TLVA 3B13A 5HCMA 2XHEB 3RF1A 3AXJB 3HA4A 2VWAA 2VL8A 4AKIA 2N2NA 4U33A 2ZMAA 1IZNB 5LGTB 2B76A 2X9YA 3F2EA 2FJBA 1OXZA 3FXEB 4KUMB 5AQNB 2I59A 2X9HA 4EYUA 4AI6A 4ILCA 1YKEB 3RRWA 4JI1T 4LF5T 1QUUA 5AQUB 4MFRA 2VVNA 2Y8DA 3N9LA 4TV8E 3EDUA 4PJMA 3C50A 5FNVE 2OA5A 4ANJA 2RA1A 1E2AA 4V1Av 3K3QC 2D0UA 1MNEA 1YXRA 1HCIA 2AXDS 2IUBA 3N2OA 4TX5A 1J5WA 4AIUA 4X66T 4PK5A 3OJAA 3JC6D 2LEHA 3RC3A 2XQ7A 3PV0F 3ANWA 3O1IA 3RGLA 4PFPA 5LYJE 1UK5A 3PUXF 4AQGA 1LKXA 4GK0E 3O9XA 3ETUA 2X9XA 3EABA 2BS2A 4YSXA 1N36T 3ZC1A 4HTEA 3BQIA 2V26A 3IBPA 1OWAA 4YHJA 3O4XE 4MLKA 2WU5A 5JH7E 4ZXLA 3UU8A 4DVDA 2JJ9A 4K0UA 1M7KA 3ABVA 4EB6E 1GQEA 5J0ZA 4YXDA 3QK6A 2HN2A 2DWKA 4Z91A 4HFEA 1KNRA 2UXXB 3J9X1 3DTOA 2VKHA 3N5LA 3RYFE 5TAOA 5FL0A 4DV2T 2NR4A 1IBMT 3ONXA 3ZT6A 2H3RA 4WBNE 3KV9A 5JDFA 2E5VA 3WAJA 4X62T 4HFIA 2KLQA 1U5PA 2J4GA 2E9XD 4YTPA 3OPCA 1QSDA 2XTLA 3KV5A 2VK9A 3O1JA 2DLRA 2V7IA 3ZMSB 2CCQA 4CI3B 5JDGA 1W0AA 5DABA 2VASA 1HTJF 4X1IE 2FBWA 4ZS3A 1WYCA 4UVBB 2WP9A 3OYZA 2VURA 4U72A 4U3CA 4YJ3E 5JRCB 3VKHA 3LDQB 4UIGA 5HYAA 5IWAT 2YU2A 4YSZA 4LF7T 5HCJA 3SRZA 4JI2T 3PUSA 1BR2A 2YEVC 1HNZT 4ZI3C 1OEDA 4OX9T 1T98A 3O1HA 4FI5A 2NW8A 1IJ6A 3IA3A 3ZLIA 4DIDB 1XDOA 4DO0A 5LB7B 3A8YC 3HKEE 2CA5A 2LT3A 2MOZA 4QH1A 5LHIB 5LHHB 5AQVB 1D1CA 3CMLA 2XM1A 2WSSV 4DMVA 2UUBT 3UU5A 1ZV4X 3UUXB 4JI6T 3F57A 4U74A 3AE7A 3PJAA 4YT0A 3RIFA 1D0ZA 3VRAA 3QB5A 2H7VC 2QGSA 4M1PA 4ZI3D 3RYCE 1FMWA 3UFEA 2M67A 2V7LA 3H3AA 4KBMB 4GKJT 4Q25A 3FBLA 1G73A 3PUQA 2Y48B 4HWFA 2JQHA 5L3EB 2YDQA 2NP9A 2YDRA 4TNWA 4EGWA 4X64T 1HF8A 4IE0A 4AISA 2XASB 3MXZA 4ZZBA 2W62A 2W2UA 3KFWX 2C0SA 4F8HA 3NWIA 5ABHA 4DV0T 2X51A 3NVOA 4QKNA 2PBIA 4BJNA 5F3JA 1H7CA 1E1HB 4EOZB 4HWIB 1WLXA 3VU7H 4X20E 4IE6A 2CMRA 4CQIA 4CN4A 4IHJE 4DBQA 3TLUA 2KSRA 2E5LT 3DJBA 2ZM2A 5ABFB 5FP3A 1UX4A 2D0TA 5E0OA 5KXJA 3RYHE 2G0UA 2ODUA 4O4IE 2XQAA 4DV5T 2KXPB 3RC8A 1IBLT 2YN6A 4ISTA 2KINB 5JR9B 5JTGA 3LBXA 4UF0B 3JCFA 3ZPOA 2CWYA 4G2AA 4QXBB 3U3IA 5F8PA 2F4VT 2MBGA 2WB5A 5FVKA 5BR8T 1Z0PA 2XM2A 2VKJA 3CWZB 1Z8UA 4CI2B 1W9RA 3MJXA 4YY3T 4DV3T 4ERRA 2A72A 2V6YA 3TLTA 2VVSA 3QC9A 4EZHA 2PJQA 3LK2B 2V7MA 3FZLB 2BS4A 1UGOA 5AFUL 4IDNA 3D0TA 1ZP0A 2M6BA 3AECA 2VB6A 3H37A 3ZCJA 1YQ3A 4LMLA 1XNQT 3JAFA 5AQIB 1O3XA 4DR4T 3CQGB 1MMDA 1OEDE 1FJGT 3ZMVB 4JI8T 4AQYT 5LHGB 3AEFA 5LMUT 2YDSA 3RRCA 3N9MA 2UXCT 2I0MA 3CKDA 3PDYA 5CA0E 2WWUA 1ZEEA 2N9DA 3L3PA 4NPPA 2Q9QB 5FY7A 2JMHA 3VRBA 2DI4A 4TUYE 2E9XB 3T1YT 4H9NC 3ZN0B 4YTMA 2WMNA 4KHZF 4QWNB 4XZCA 2YU1A 3EUHA 1US7B 5FXXA 2HN1A 2W63A 3KV6A 4JLEA 3E22E 1D1BA 4H9PC 4GYRA 5LXTE 1BR0A 1S94A 3P8CD
chains in the Genus database with same CATH topology
1HR0T 2UXDT 2UUCT 4GKJT 4DR7T 4DV1T 1HNXT 4DR2T 2UXBT 4LF4T 5IWAT 4X64T 4KHPT 1XMOT 4LF7T 4JI5T 4DV6T 1N36T 4JV5T 4GKKT 1XNQT 4JI2T 3T1HT 1XNRT 4LF8T 4NXNT 4DR3T 1N32T 1I94T 4DV0T 1HNZT 5LMNT 4DR4T 2UU9T 4X65T 4OX9T 1FJGT 1N33T 4JI8T 2VQET 1HNWT 1XMQT 4AQYT 4LFCT 4DV4T 5LMUT 4LF6T 4K0KT 4B3ST 4NXMT 4DV7T 4JI0T 2E5LT 2UXCT 1IBKT 2HHHT 4B3RT 4JI1T 4JI3T 4DV5T 3OTOT 4LF5T 4LFBT 4DUZT 1IBLT 4B3TT 3T1YT 2UUBT 4DV2T 4LF9T 1IBMT 4JI6T 2F4VT 4DUYT 4YHHT 4B3MT 4JYAT 4X62T 2UUAT 5BR8T 4JI7T 4DR6T 4JI4T 4YY3T 4DV3T 1N34T 4DR5T 2ZM6T 2VQFT 4X66T 4DR1T 1J5ET 4LFAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 T;  2UXD T;  2UUC T;  4GKJ T;  4DR7 T;  4DV1 T;  1HNX T;  4DR2 T;  2UXB T;  4LF4 T;  5IWA T;  4X64 T;  4KHP T;  1XMO T;  4LF7 T;  4JI5 T;  4DV6 T;  1N36 T;  4JV5 T;  4GKK T;  1XNQ T;  4JI2 T;  3T1H T;  1XNR T;  4LF8 T;  4NXN T;  4DR3 T;  1N32 T;  1I94 T;  4DV0 T;  1HNZ T;  5LMN T;  4DR4 T;  2UU9 T;  4X65 T;  4OX9 T;  1FJG T;  1N33 T;  4JI8 T;  2VQE T;  1HNW T;  1XMQ T;  4AQY T;  4LFC T;  4DV4 T;  5LMU T;  4LF6 T;  4K0K T;  4B3S T;  4NXM T;  4DV7 T;  4JI0 T;  2E5L T;  2UXC T;  1IBK T;  2HHH T;  4B3R T;  4JI1 T;  4JI3 T;  4DV5 T;  3OTO T;  4LF5 T;  4LFB T;  4DUZ T;  1IBL T;  4B3T T;  3T1Y T;  2UUB T;  4DV2 T;  4LF9 T;  1IBM T;  4JI6 T;  2F4V T;  4DUY T;  4YHH T;  4B3M T;  4JYA T;  4X62 T;  2UUA T;  5BR8 T;  4JI7 T;  4DR6 T;  4JI4 T;  4YY3 T;  4DV3 T;  1N34 T;  4DR5 T;  2ZM6 T;  2VQF T;  4X66 T;  4DR1 T;  1J5E T;  4LFA T; 
#chains in the Genus database with same CATH topology
 2I6H A;  2A9U A;  3ETV A;  2CHN A;  4U7Y A;  3P50 A;  3AEA A;  5LJN A;  1I6Z A;  2VL0 A;  2H89 A;  4XBF B;  3MA9 A;  3OYX A;  2UXB T;  4X1Y E;  3AVR A;  1NEN A;  2EHO A;  3Q2M A;  3I0Q A;  5KDM C;  3IHR A;  4KP3 C;  4E7Z A;  4IGU A;  2BG9 C;  3KVA A;  5AQR B;  2CBJ A;  2XPK A;  4C90 A;  5EK4 A;  4LF8 T;  4U7I A;  3PUZ F;  2CRB A;  2UU9 T;  5HEJ A;  4EAH A;  2WWV A;  5AQL B;  1XMQ T;  4EEB A;  5HXR A;  4CXX A;  3ZKR A;  4TV9 E;  2CXL A;  5JR9 C;  5H6R B;  2L3L A;  1IBK T;  3ZYM A;  3I9Y A;  4B3R T;  4U31 A;  4ISS A;  3ESL A;  3JC6 C;  2CEA A;  4J2C A;  2VKD A;  1D1A A;  5JQG E;  5AQQ B;  1WR0 A;  2WDQ A;  2IDO B;  3LSV A;  1MND A;  4UV9 B;  2E8I A;  4O8S A;  4O2B E;  4HFB A;  3FHN A;  4DR5 T;  3KVB A;  3AE5 A;  3AE8 A;  5HEO A;  4WW0 A;  2BKP A;  3M3Z B;  2BS3 A;  2H88 A;  2W00 A;  2WQY A;  4O4J E;  4ZI2 D;  3UTK A;  4PJJ A;  4BA9 A;  2XQ8 A;  3UFG A;  2HPL A;  3AAI A;  5J2U E;  1T7S A;  4NUU A;  4IE7 A;  5HEU A;  1YKH B;  1KNZ A;  3CVR A;  3GN5 A;  2W67 A;  4PJN A;  4CN6 A;  2X0L B;  4HFV A;  4GIW A;  2XQ9 A;  2MTQ A;  4PW8 A;  2MPK A;  2VQE T;  1KK7 A;  2CXF A;  2AE9 A;  2XZE A;  3AB3 B;  4AQF A;  1LVF A;  5L3C B;  1SE7 A;  4A98 A;  2QA7 A;  3RQW A;  2E9X C;  1HS7 A;  4UXN B;  1MIY A;  2BG9 A;  3N2K E;  5ABG A;  4JI3 T;  4IDZ A;  3Q5W A;  3UU4 A;  3C4Z A;  4B3T T;  1NAF A;  3C51 A;  1SUM B;  3PUY F;  4QH5 A;  5BMV E;  4JI4 T;  3AA0 B;  2PG8 A;  5AQG B;  3VR8 A;  3CX8 B;  2W66 A;  1WCR A;  4DR1 T;  2XAG B;  4L9I A;  2XQ6 A;  3RIA A;  3PUW F;  5CJ5 A;  2Q9Q D;  4I0U A;  2UUC T;  3P4Q A;  5CA1 E;  1CHU A;  4DR2 T;  1U4Q A;  1L0V A;  3TKL B;  5C3J A;  5JDN A;  1XMO T;  4PNI A;  4DV6 T;  4QXH B;  3AAE B;  4P09 A;  3UUL A;  2QVA A;  1XNR T;  5HXE A;  3ZT7 A;  5LMN T;  3T8O A;  2LRL A;  5JDH A;  4AKR B;  4ILB A;  4X65 T;  3LJC A;  3W15 B;  1HG5 A;  4FJO A;  3R6N A;  5AQH B;  5ADX L;  4NXM T;  3UU6 A;  5AQM B;  2XAH B;  4EZ4 A;  1NEK A;  5FVL A;  5AQP B;  3RLF F;  4LFB T;  2BKO A;  2KT9 A;  2ACX A;  2L8K A;  2LSJ A;  3M65 A;  3RIU C;  3P4S A;  1FMV A;  4B6X A;  2HPJ A;  4YHH T;  5LP6 E;  3NKZ A;  1VOM A;  2RP4 A;  2QYW A;  2V5C A;  5ETW A;  2B1E A;  2IIU A;  4UVA B;  2W4X A;  2CBI A;  3IEE A;  3ZCI A;  4XAX B;  3B5M A;  4YTN A;  4DV1 T;  4EIW A;  2V6X A;  4OK0 A;  4H9O C;  1KF6 A;  5ABE A;  1MMG A;  3HL6 A;  3L8R A;  4IRE A;  3V5U A;  4E7S A;  2KZ7 B;  4NXN T;  2BDE A;  4ZI7 E;  2NW7 A;  2C5K T;  2CM0 A;  2ZM0 A;  5AQS B;  3AA6 B;  3AE6 A;  3P4W A;  2LSG A;  3PU8 A;  3L09 A;  5DQV A;  2BG9 E;  3ANW B;  3UQ4 A;  3EVY A;  5EK2 A;  2V8S V;  2JPF A;  3WAK A;  1QLB A;  4NIQ A;  2YOE A;  3J7Y q;  1AJ3 A;  2N1G A;  4YFS A;  5AQJ B;  4LF9 T;  2NOX A;  3AE3 A;  4QX8 B;  5DQW A;  5L4E A;  3FXD B;  4JYA T;  1YW0 A;  3PUV F;  2E2A A;  3SOL A;  3AXJ A;  3FB2 A;  4JEH B;  3IF8 B;  1EZ3 A;  3FBZ A;  4ZZC A;  4IE4 A;  4H9S E;  4L5G A;  4AKG A;  4KX6 A;  3E0Z A;  4IE5 A;  3ONJ A;  5IYZ E;  4UEM A;  4IL9 A;  1W09 A;  4HN9 A;  4QXC B;  3QNU A;  4BJM A;  3JAD A;  3LK4 2;  4P1N A;  2LKG A;  2IAK A;  2W61 A;  4CXW A;  2DHR A;  3AE2 A;  3QOF A;  4PJL A;  4I4T E;  5CFB A;  4JI5 T;  5JDM A;  3AEB A;  3CQC B;  3N9P A;  2L9Q A;  4IT4 A;  4I43 B;  4DR3 T;  1N32 T;  3ZEF B;  2Z6E A;  3VR9 A;  2WCA A;  2IC6 A;  1IJ5 A;  4QH4 A;  3CK6 A;  1BR1 A;  5J2T E;  1YD8 G;  4LF6 T;  3V5S A;  1UX5 A;  1VCT A;  2BZB A;  4ADZ A;  3OKQ A;  1ZKE A;  3CIR A;  2X0Y A;  3OTO T;  1W0B A;  2P9B A;  3NRY A;  2LRK A;  5LGN B;  2MYS A;  5KX5 E;  2LHN A;  4ASK A;  2LM2 A;  1E7P A;  4JI7 T;  2XAF B;  1DU2 A;  2EHO D;  3PTR B;  2VQF T;  2LHR A;  1OED B;  3Q5X A;  1ZHC A;  1J5E T;  4LFA T;  3C4W A;  3BQK A;  1R8I A;  4QX7 B;  2QRX A;  3K8P C;  4HFH A;  4KMC A;  4ZHQ E;  2LM9 A;  2BBJ A;  2X66 A;  3ZSS A;  4LF4 T;  4GOU A;  2LKH A;  4HGA A;  3LFM A;  1J1J A;  2JMK A;  3ZYL A;  4KHP T;  3KBU A;  4LMJ A;  2CE7 A;  2UXN B;  3AE9 A;  2LJL A;  1KEY A;  1I94 T;  5L3D B;  3AEE A;  5JVD E;  1HNW T;  2X0H A;  5L47 A;  3S4U A;  1WFD A;  4WYV A;  1MIW A;  4B3S T;  2D2S A;  5IHY A;  5LNK A;  3VKG A;  4JEU B;  4HFC A;  4IL4 A;  5L3F B;  4NUV A;  5JRC A;  1JNR A;  3LG7 A;  5EZY E;  5L3B B;  2KMF A;  3KDS E;  1VRB A;  3K1S A;  4ZI2 C;  2XQ4 A;  2PTF A;  4B3M T;  4ZOL E;  2OV9 A;  3RPU A;  2KND A;  2C5I T;  3K3N A;  4YJ2 E;  4AKH A;  3ZMU B;  3A5X A;  1SHZ C;  3QUJ A;  4TWF A;  3UUM A;  5HEH A;  2WDR A;  4ILU A;  4EED A;  3Q5E A;  1S35 A;  5HXH A;  3ZMT B;  3SWH A;  3ZMZ B;  2JIW A;  4MHC A;  4N78 D;  5HWY A;  1BR4 A;  5FMN A;  4DND A;  5LG3 A;  3PUR A;  1T8B A;  3FZK B;  5FY1 A;  5L4H A;  2V7J A;  2Y6X A;  3HKC E;  3HI2 A;  3LBX B;  4U2Y A;  1FEW A;  2FJA A;  4PFO A;  3MK7 C;  4IIJ E;  4CN1 A;  2DNX A;  2XJ7 A;  5HAX A;  2V6Y B;  3P7I A;  3KBT A;  2V7K A;  1FIO A;  3SFD A;  2ZLY A;  2ZM8 A;  3G06 A;  3AA1 B;  3ZYK A;  3FZF B;  1WRD A;  3HR0 A;  5FL1 A;  4PAG A;  3AA7 B;  4OYK A;  3PU3 A;  1HG2 A;  4I55 E;  5JDL A;  5AQT B;  5M4Y A;  4DUZ T;  3RHW A;  2Q9Q C;  4JBW F;  5LJM A;  1OED C;  2CLY B;  3NRX A;  2V1D B;  1LVK A;  3MAC A;  3PUA A;  2LLY A;  5L2L A;  1B7T A;  2K3W A;  2M6I A;  1NWM X;  2K24 A;  4IDQ A;  4MBQ A;  3UT5 E;  2J1D G;  5ABF A;  1YQ4 A;  4F6R C;  4DR7 T;  2MAW A;  3WI3 A;  3A7M A;  3DP7 A;  4TNV A;  2K9A A;  4X1K E;  2WZH A;  1HNX T;  1M62 A;  5JR9 A;  4O2A E;  4UF0 A;  4UVC B;  3RYI E;  5LBQ B;  4I50 E;  1Y01 A;  2JQK A;  1MMA A;  4HWD A;  5HXC A;  3F31 A;  4IDO A;  2OLT A;  3C98 B;  4PK6 A;  2FUP A;  4JUY A;  4CI1 B;  4A56 A;  2KWH A;  3P4P A;  2ACZ A;  3ZJ1 A;  4JI0 T;  4H63 H;  2DL1 A;  1CUN A;  2HHH T;  4HWH A;  3TLW A;  3MZK B;  3RI5 A;  5F5W A;  2WY2 A;  4G63 A;  5FKY A;  5AQK B;  2JQ9 A;  1XWM A;  2EHO B;  4HE8 A;  4DUY T;  2DCF A;  2IML A;  4Z90 A;  3Q5D A;  5C8Y E;  3KV4 A;  3BK9 A;  4TWH A;  1N34 T;  3UUB A;  3CX7 B;  2WMO A;  2ZM6 T;  2J62 A;  4AKL A;  3R84 B;  3RX6 A;  2DWG A;  3I0O A;  2JRK A;  3C64 A;  2LSI A;  3NBX X;  3AE4 A;  2LE8 A;  2Q9Q A;  1IAP A;  1G8X A;  4EYY R;  3EI0 A;  4YSY A;  2E9X A;  5GON E;  3UU3 A;  5EK3 A;  5FYM A;  5CGM A;  3LK3 B;  4LMK A;  4CZZ B;  3BQL A;  3CQX C;  2YKS A;  1KFY A;  3GMI A;  4GYS A;  4COF A;  2X9W A;  4LFC T;  5DJQ C;  2ODV A;  4K0K T;  4H63 V;  3RKO A;  2K5B B;  4UV8 B;  4H9Q C;  3PUG A;  2XSA A;  5J1G A;  3K3O A;  2XUE A;  2XAQ B;  3OVU A;  3L39 A;  2A3D A;  1D0X A;  1Y64 B;  2CLY C;  3UUN A;  1X9B A;  4O4H E;  1VCS A;  4UEL A;  1SA0 E;  2PFV A;  3AED A;  5CB4 E;  1HX1 B;  2XSB A;  3GN5 B;  3HKD E;  4OYJ A;  2NTX A;  3ZT5 A;  1V9D A;  2K48 A;  3CPZ A;  4X5T A;  2CHO A;  1WR6 A;  3C4X A;  4P0B A;  5LA6 E;  3I9W A;  2UXD T;  2BBH A;  2CWO A;  3HKB E;  3B57 A;  2SPC A;  2WBL A;  2BG9 B;  4ILA A;  2A2F X;  2WDV A;  1T72 A;  2WS3 A;  2XQ3 A;  5LOV E;  4HFD A;  4JV5 T;  2D5U A;  4A97 A;  3TLS A;  4BAY B;  3RQU A;  4GKK T;  5L3G B;  3T1H T;  4EV6 A;  2BVM A;  3RIU A;  1KNP A;  4YLH A;  3I1A A;  1ZOY A;  1HX8 A;  1N33 T;  1UCU A;  4OFZ A;  3EHZ A;  3FZM B;  2X68 A;  2RPA A;  1XZY A;  3N9N A;  2EHO C;  2XQY A;  3AE1 A;  3UQ7 A;  3ZC0 A;  3QB5 K;  3KIN B;  5AQF B;  2XY8 B;  2IW5 B;  2W0G A;  4IDP A;  2XQ5 A;  1LRZ A;  4HKA A;  2LOP A;  2C5J A;  1D0Y A;  1WYB A;  4AXP A;  2BVL A;  2GK9 A;  1UUS A;  2UUA T;  5FXZ A;  4A5X A;  5LBM A;  5HXS A;  2CXD A;  3SS1 A;  3OBV E;  4U2Z A;  4Z8X A;  5HEG A;  3AEG A;  4MAL A;  3ZST A;  2R6G F;  5A1L A;  3ZN1 B;  2JQQ A;  5LG4 A;  4QHO A;  3GA8 A;  2WU2 A;  5C2T A;  2FJE A;  1X79 A;  2KWI B;  3RKG A;  2VKO A;  2XAJ B;  1UUR A;  4CXY A;  5JRE A;  4TN7 B;  4UR9 A;  3CX6 B;  2WM9 A;  4C91 A;  3AVS A;  4HWC A;  4WBO A;  1MIV A;  2LOS A;  4P0A A;  4H9R C;  2NW9 A;  3VHL A;  5AQO B;  4WZX A;  2FJD A;  3MKD A;  4EXT A;  4DV4 T;  4WNK A;  3X1D A;  3ONL C;  4DV7 T;  4OHF A;  4ZS2 A;  1HFA A;  3N9Q A;  2NWB A;  2IC9 A;  2WAU A;  3NZP A;  3PE0 A;  3FZH B;  3E08 A;  4DMW A;  5KMG P;  3NZQ A;  4ZEY A;  2NTY A;  3N2G E;  2ES0 A;  5H6Q B;  3EAM A;  2BKN A;  1XDP A;  5FXW A;  3P4R A;  2X67 A;  3H3M A;  4DR6 T;  4PK4 A;  2HH7 A;  1MMN A;  3EDV A;  2IHR 1;  2YIN A;  4AQF C;  4DBR A;  2J47 A;  5LGU B;  2D9D A;  3PJA J;  2YK0 A;  2LSK A;  1HR0 T;  4GK5 E;  3N9O A;  5IUX A;  3RH3 A;  4HEA A;  4KI0 F;  3ZJ2 A;  3GWH A;  3Q9D A;  5FY0 A;  2CPT A;  4TZ4 C;  3U78 A;  3SFE A;  5FXV A;  3AAA B;  2V5D A;  2H7O A;  1JNZ A;  4L0R A;  3JAE A;  4TWD A;  5HWX A;  5JDQ A;  5LCY A;  2LSY A;  2WZI A;  4O4L E;  3TLV A;  3B13 A;  5HCM A;  2XHE B;  3RF1 A;  3AXJ B;  3HA4 A;  2VWA A;  2VL8 A;  4AKI A;  2N2N A;  4U33 A;  2ZMA A;  1IZN B;  5LGT B;  2B76 A;  2X9Y A;  3F2E A;  2FJB A;  1OXZ A;  3FXE B;  4KUM B;  5AQN B;  2I59 A;  2X9H A;  4EYU A;  4AI6 A;  4ILC A;  1YKE B;  3RRW A;  4JI1 T;  4LF5 T;  1QUU A;  5AQU B;  4MFR A;  2VVN A;  2Y8D A;  3N9L A;  4TV8 E;  3EDU A;  4PJM A;  3C50 A;  5FNV E;  2OA5 A;  4ANJ A;  2RA1 A;  1E2A A;  4V1A v;  3K3Q C;  2D0U A;  1MNE A;  1YXR A;  1HCI A;  2AXD S;  2IUB A;  3N2O A;  4TX5 A;  1J5W A;  4AIU A;  4X66 T;  4PK5 A;  3OJA A;  3JC6 D;  2LEH A;  3RC3 A;  2XQ7 A;  3PV0 F;  3ANW A;  3O1I A;  3RGL A;  4PFP A;  5LYJ E;  1UK5 A;  3PUX F;  4AQG A;  1LKX A;  4GK0 E;  3O9X A;  3ETU A;  2X9X A;  3EAB A;  2BS2 A;  4YSX A;  1N36 T;  3ZC1 A;  4HTE A;  3BQI A;  2V26 A;  3IBP A;  1OWA A;  4YHJ A;  3O4X E;  4MLK A;  2WU5 A;  5JH7 E;  4ZXL A;  3UU8 A;  4DVD A;  2JJ9 A;  4K0U A;  1M7K A;  3ABV A;  4EB6 E;  1GQE A;  5J0Z A;  4YXD A;  3QK6 A;  2HN2 A;  2DWK A;  4Z91 A;  4HFE A;  1KNR A;  2UXX B;  3J9X 1;  3DTO A;  2VKH A;  3N5L A;  3RYF E;  5TAO A;  5FL0 A;  4DV2 T;  2NR4 A;  1IBM T;  3ONX A;  3ZT6 A;  2H3R A;  4WBN E;  3KV9 A;  5JDF A;  2E5V A;  3WAJ A;  4X62 T;  4HFI A;  2KLQ A;  1U5P A;  2J4G A;  2E9X D;  4YTP A;  3OPC A;  1QSD A;  2XTL A;  3KV5 A;  2VK9 A;  3O1J A;  2DLR A;  2V7I A;  3ZMS B;  2CCQ A;  4CI3 B;  5JDG A;  1W0A A;  5DAB A;  2VAS A;  1HTJ F;  4X1I E;  2FBW A;  4ZS3 A;  1WYC A;  4UVB B;  2WP9 A;  3OYZ A;  2VUR A;  4U72 A;  4U3C A;  4YJ3 E;  5JRC B;  3VKH A;  3LDQ B;  4UIG A;  5HYA A;  5IWA T;  2YU2 A;  4YSZ A;  4LF7 T;  5HCJ A;  3SRZ A;  4JI2 T;  3PUS A;  1BR2 A;  2YEV C;  1HNZ T;  4ZI3 C;  1OED A;  4OX9 T;  1T98 A;  3O1H A;  4FI5 A;  2NW8 A;  1IJ6 A;  3IA3 A;  3ZLI A;  4DID B;  1XDO A;  4DO0 A;  5LB7 B;  3A8Y C;  3HKE E;  2CA5 A;  2LT3 A;  2MOZ A;  4QH1 A;  5LHI B;  5LHH B;  5AQV B;  1D1C A;  3CML A;  2XM1 A;  2WSS V;  4DMV A;  2UUB T;  3UU5 A;  1ZV4 X;  3UUX B;  4JI6 T;  3F57 A;  4U74 A;  3AE7 A;  3PJA A;  4YT0 A;  3RIF A;  1D0Z A;  3VRA A;  3QB5 A;  2H7V C;  2QGS A;  4M1P A;  4ZI3 D;  3RYC E;  1FMW A;  3UFE A;  2M67 A;  2V7L A;  3H3A A;  4KBM B;  4GKJ T;  4Q25 A;  3FBL A;  1G73 A;  3PUQ A;  2Y48 B;  4HWF A;  2JQH A;  5L3E B;  2YDQ A;  2NP9 A;  2YDR A;  4TNW A;  4EGW A;  4X64 T;  1HF8 A;  4IE0 A;  4AIS A;  2XAS B;  3MXZ A;  4ZZB A;  2W62 A;  2W2U A;  3KFW X;  2C0S A;  4F8H A;  3NWI A;  5ABH A;  4DV0 T;  2X51 A;  3NVO A;  4QKN A;  2PBI A;  4BJN A;  5F3J A;  1H7C A;  1E1H B;  4EOZ B;  4HWI B;  1WLX A;  3VU7 H;  4X20 E;  4IE6 A;  2CMR A;  4CQI A;  4CN4 A;  4IHJ E;  4DBQ A;  3TLU A;  2KSR A;  2E5L T;  3DJB A;  2ZM2 A;  5ABF B;  5FP3 A;  1UX4 A;  2D0T A;  5E0O A;  5KXJ A;  3RYH E;  2G0U A;  2ODU A;  4O4I E;  2XQA A;  4DV5 T;  2KXP B;  3RC8 A;  1IBL T;  2YN6 A;  4IST A;  2KIN B;  5JR9 B;  5JTG A;  3LBX A;  4UF0 B;  3JCF A;  3ZPO A;  2CWY A;  4G2A A;  4QXB B;  3U3I A;  5F8P A;  2F4V T;  2MBG A;  2WB5 A;  5FVK A;  5BR8 T;  1Z0P A;  2XM2 A;  2VKJ A;  3CWZ B;  1Z8U A;  4CI2 B;  1W9R A;  3MJX A;  4YY3 T;  4DV3 T;  4ERR A;  2A72 A;  2V6Y A;  3TLT A;  2VVS A;  3QC9 A;  4EZH A;  2PJQ A;  3LK2 B;  2V7M A;  3FZL B;  2BS4 A;  1UGO A;  5AFU L;  4IDN A;  3D0T A;  1ZP0 A;  2M6B A;  3AEC A;  2VB6 A;  3H37 A;  3ZCJ A;  1YQ3 A;  4LML A;  1XNQ T;  3JAF A;  5AQI B;  1O3X A;  4DR4 T;  3CQG B;  1MMD A;  1OED E;  1FJG T;  3ZMV B;  4JI8 T;  4AQY T;  5LHG B;  3AEF A;  5LMU T;  2YDS A;  3RRC A;  3N9M A;  2UXC T;  2I0M A;  3CKD A;  3PDY A;  5CA0 E;  2WWU A;  1ZEE A;  2N9D A;  3L3P A;  4NPP A;  2Q9Q B;  5FY7 A;  2JMH A;  3VRB A;  2DI4 A;  4TUY E;  2E9X B;  3T1Y T;  4H9N C;  3ZN0 B;  4YTM A;  2WMN A;  4KHZ F;  4QWN B;  4XZC A;  2YU1 A;  3EUH A;  1US7 B;  5FXX A;  2HN1 A;  2W63 A;  3KV6 A;  4JLE A;  3E22 E;  1D1B A;  4H9P C;  4GYR A;  5LXT E;  1BR0 A;  1S94 A;  3P8C D; 
#chains in the Genus database with same CATH homology
 1HR0 T;  2UXD T;  2UUC T;  4GKJ T;  4DR7 T;  4DV1 T;  1HNX T;  4DR2 T;  2UXB T;  4LF4 T;  5IWA T;  4X64 T;  4KHP T;  1XMO T;  4LF7 T;  4JI5 T;  4DV6 T;  1N36 T;  4JV5 T;  4GKK T;  1XNQ T;  4JI2 T;  3T1H T;  1XNR T;  4LF8 T;  4NXN T;  4DR3 T;  1N32 T;  1I94 T;  4DV0 T;  1HNZ T;  5LMN T;  4DR4 T;  2UU9 T;  4X65 T;  4OX9 T;  1FJG T;  1N33 T;  4JI8 T;  2VQE T;  1HNW T;  1XMQ T;  4AQY T;  4LFC T;  4DV4 T;  5LMU T;  4LF6 T;  4K0K T;  4B3S T;  4NXM T;  4DV7 T;  4JI0 T;  2E5L T;  2UXC T;  1IBK T;  2HHH T;  4B3R T;  4JI1 T;  4JI3 T;  4DV5 T;  3OTO T;  4LF5 T;  4LFB T;  4DUZ T;  1IBL T;  4B3T T;  3T1Y T;  2UUB T;  4DV2 T;  4LF9 T;  1IBM T;  4JI6 T;  2F4V T;  4DUY T;  4YHH T;  4B3M T;  4JYA T;  4X62 T;  2UUA T;  5BR8 T;  4JI7 T;  4DR6 T;  4JI4 T;  4YY3 T;  4DV3 T;  1N34 T;  4DR5 T;  2ZM6 T;  2VQF T;  4X66 T;  4DR1 T;  1J5E T;  4LFA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...