4DR5T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr5T00
3OTOT 1N34T 4JI8T 1XMOT 3T1YT 4B3RT 4GKKT 1HNWT 4LF4T 4DV5T 4DV6T 1IBLT 4JYAT 4X64T 4DR4T 1HNXT 2UXCT 1IBMT 4OX9T 4DV1T 2E5LT 2UUCT 4DR2T 4DUYT 2UXDT 4JI3T 2UU9T 4GKJT 4DUZT 5BR8T 1XNQT 4LF6T 2UXBT 1XMQT 1HR0T 4B3MT 4DV4T 4DV3T 1N33T 4DR3T 2VQET 4LF9T 4JI4T 4LF7T 1HNZT 2HHHT 4LF8T 4YHHT 4K0KT 4JI1T 4LFBT 4LFCT 4X65T 4NXNT 2VQFT 4DV0T 4B3TT 4JI5T 4X66T 4KHPT 4JI2T 5LMUT 4NXMT 4JV5T 1XNRT 4DV2T 4LF5T 1I94T 1FJGT 4JI7T 5IWAT 2F4VT 1N32T 4DR6T 4JI0T 2UUBT 4YY3T 4JI6T 4DR1T 5LMNT 2ZM6T 4B3ST 4DR5T 1IBKT 4X62T 1N36T 1J5ET 2UUAT 4DV7T 4AQYT 4LFAT 3T1HT 4DR7T
chains in the Genus database with same CATH superfamily
1N34T 2XQ6A 5HCJA 3ZCJA 3I1AA 5LNKA 2CLYC 3RKOA 4ERRA 1D0XA 4CI3B 1XDOA 2ODUA 4HTEA 5FKYA 4ADZA 4ZZCA 5LP6E 2JIWA 2LRKA 2MTQA 3CWZB 1HNWT 2BVMA 4DBQA 3EVYA 1IBLT 4LF4T 2E9XA 3SFDA 1KEYA 2J62A 3PUZF 4Q25A 2JQ9A 3ZMZB 4MLKA 4Z90A 2LHNA 2XJ7A 3Q5EA 3TLVA 3NRXA 3JADA 1WCRA 3M65A 4KI0F 2KNDA 2H7OA 2WQYA 2PJQA 2XPKA 4GIWA 3SWHA 5F3JA 2DCFA 4KHZF 3CK6A 4O4JE 3TLSA 3AEEA 3ZYLA 4ANJA 1Y01A 2XAJB 4ZI3D 2X9WA 1OEDA 1KK7A 2X9XA 4DR2T 3PTRB 1J1JA 2E8IA 3PUXF 4ILAA 3O9XA 2FUPA 2W2UA 5LHGB 1UURA 2XZEA 4YHJA 2NTXA 1LKXA 4EIWA 3QOFA 2LLYA 2KZ7B 2MYSA 4GKJT 3IF8B 5BR8T 2N1GA 4K0UA 2V8SV 2WDRA 3PJAA 2W00A 4I50E 1S94A 3LG7A 3I9WA 2Y8DA 5AQUB 2Y48B 3RYHE 5FY1A 2Q9QC 2QA7A 4ISSA 4DIDB 5J2UE 2X68A 4TZ4C 4UF0A 5LBQB 4YJ3E 1KNRA 3FXDB 3PUYF 5IYZE 5ABFA 2KXPB 5LJMA 2K48A 2UXNB 2HN2A 4H9PC 5IUXA 4TUYE 3UQ7A 5EK2A 1IJ5A 4M1PA 3RRWA 5LHIB 2LM2A 2V5DA 3J7Yq 3AXJB 4HFEA 1UX5A 1D0YA 3IEEA 4B3MT 2EHOB 3TLTA 2LRLA 5HXSA 4WNKA 2V1DB 5L3DB 4XZCA 1N33T 4HFBA 4H9OC 3RYIE 3RPUA 2DWGA 3N9MA 2X0YA 4YTPA 1Z8UA 1QLBA 5L4EA 4JI4T 4OFZA 1UGOA 5LA6E 3PUWF 1JNRA 3V5UA 2ACZA 1NEKA 3I0OA 3PV0F 1Z0PA 3FBLA 3NZPA 2MBGA 5JDLA 4KHPT 1W0AA 1D1CA 3A5XA 4HKAA 4G63A 2WWUA 2Q9QA 3EHZA 2MAWA 4UEMA 3FZKB 2XHEB 4JI1T 1ZKEA 4LFBT 2DHRA 2XQ4A 5FL0A 5JVDE 5ABEA 2W4XA 4X65T 1L0VA 1KNPA 3R6NA 3K1SA 3N5LA 3SOLA 2SPCA 3QUJA 2VQFT 3WAKA 3ZLIA 4TN7B 2Y6XA 2KSRA 4YSXA 3SRZA 3N9NA 4JI2T 4C90A 5FXVA 4IHJE 5HEJA 5L2LA 3LK42 3FZHB 3ZEFB 4JV5T 5JDQA 5GONE 2BS4A 4IE0A 2D0TA 4ZOLE 4AXPA 4GOUA 2C5KT 3AB3B 3H3AA 3MA9A 3K3QC 4CN6A 3AE3A 4IE4A 1ZHCA 1OEDC 1YD8G 5LGTB 3AA6B 4ZZBA 4JI0T 3HKEE 4UIGA 4X1IE 5HXCA 1D1AA 3OVUA 4XAXB 2KMFA 2Q9QB 2DLRA 4JI6T 5AQGB 3FBZA 5L3EB 3B57A 3RIFA 4WBOA 4P0BA 1H7CA 2LOSA 4AISA 4DR5T 1HNZT 2D5UA 5JRCB 2IAKA 5JR9C 1XZYA 5M4YA 3LSVA 4AQFC 2XTLA 2E2AA 5FVKA 2CE7A 4KX6A 3SS1A 2NOXA 2YU2A 3NZQA 2K5BB 2UXXB 4ZEYA 2X66A 3AA1B 3AVRA 1JNZA 3ZCIA 3VRAA 3LK3B 2EHOA 3ZJ1A 2X51A 3FZMB 2P9BA 4IE5A 2KWIB 2XM2A 2CEAA 4YTNA 5LYJE 4JI8T 4U31A 3Q2MA 3P7IA 4IL9A 5FY0A 4GKKT 1HG5A 3ANWA 3QNUA 4DV5T 4I0UA 4HWCA 2CXFA 4IREA 4DR4T 2D0UA 2W61A 5LJNA 1FMVA 1G8XA 1FMWA 4COFA 1NAFA 2J1DG 4IIJE 1SE7A 2WU5A 4PJNA 2A2FX 4PK4A 2AXDS 2UXCT 2LSYA 3C50A 1KNZA 4H9SE 2KLQA 3PUVF 1E7PA 2WCAA 3QB5K 3Q5WA 4A5XA 4DV1T 4UXNB 3SFEA 1EZ3A 5HCMA 4AQFA 3RIUA 1LVKA 3AVSA 5C8YE 4TV9E 5FXXA 1X9BA 3M3ZB 4LMLA 4ZI7E 4JI3T 1J5WA 4O4IE 5KXJA 5AQHB 3UUXB 3ETUA 2WP9A 2QYWA 3C51A 4WYVA 5CA1E 1XNQT 2VL0A 4G2AA 1ZEEA 5C2TA 4WBNE 3WAJA 3B13A 5HEUA 2BG9E 3AEAA 2HPLA 4O8SA 3C4WA 4I43B 4EYYR 4IT4A 3CIRA 4PW8A 4NIQA 3K3NA 3ZYKA 1D0ZA 1HG2A 4ILBA 4CXXA 4WW0A 1YKEB 3AE1A 4ZI2C 2CCQA 1WFDA 3U78A 3IA3A 3N9PA 2XAGB 1VRBA 3AA0B 2WU2A 3JC6D 1XMQT 1HR0T 3FZLB 2YOEA 5AQLB 5F8PA 2NWBA 3OBVE 4QXCB 5L3BB 4DV4T 2K24A 1YQ4A 5BMVE 2WM9A 2BKOA 2R6GF 5LGUB 1HF8A 2BZBA 4GYRA 4UF0B 3RQWA 3UU6A 1T72A 1D1BA 4AIUA 4DR3T 1E1HB 5F5WA 2VQET 5FMNA 2LSKA 4PK6A 4TV8E 4JI7T 3KV4A 5JRCA 3ZMTB 4CXYA 2XY8B 3PE0A 5EK4A 4HWFA 3RI5A 4A56A 3ZT5A 4ASKA 2W0GA 3PJAJ 4YFSA 3I9YA 1MMDA 2WS3A 2XQ8A 4LF8T 3ZKRA 3UU3A 3OPCA 4YHHT 3P4SA 4QH4A 5KX5E 2H7VC 4O4LE 2I59A 2RA1A 3GN5A 2OV9A 2BVLA 3T8OA 1WR0A 5HXRA 4DV0T 4AKHA 3UUBA 1MIYA 1Y64B 1VCTA 2LM9A 4JI5T 4DVDA 4ZHQE 5ABFB 2BG9C 2DWKA 5LMUT 4NXMT 4A97A 1IZNB 4L0RA 1S35A 5AQSB 1ZV4X 1HFAA 1BR2A 1NENA 1HX8A 2ACXA 2HH7A 2M6BA 2L3LA 2XQ3A 3E0ZA 2LSJA 3KBUA 5HEHA 4ZI3C 3RYCE 3AEGA 3UUNA 4EOZB 2ZLYA 3DP7A 5DABA 2QGSA 1OEDE 3KFWX 3QC9A 4IL4A 2XSAA 3J9X1 3UT5E 3RH3A 1N32T 3N9OA 4HFIA 5LG3A 3IHRA 1O3XA 2YKSA 3P4WA 2V6XA 5AFUL 2N9DA 4QWNB 2CXLA 4AKRB 3ZYMA 4CI2B 3UFEA 4YY3T 2CBIA 4PJJA 2L9QA 1BR1A 4O2BE 4DR1T 5LMNT 2E9XB 3HKCE 2WWVA 4B3ST 2CBJA 2E5VA 2LKHA 5JTGA 5L3CB 2IIUA 4JBWF 4ZS3A 3GN5B 1WRDA 4UV9B 3AA7B 3ZMVB 2WMOA 2E9XD 4TX5A 3L3PA 2XSBA 5FXZA 4AKIA 2V26A 5J1GA 3CX7B 1J5ET 2LJLA 2XQ9A 1T8BA 4HFVA 1WYBA 2H88A 1YW0A 3GMIA 4A98A 2NW9A 3ZSTA 4EZ4A 2PBIA 4YT0A 2FJBA 3H3MA 3T1HT 5LB7B 2FJEA 2XASB 2PG8A 2VL8A 1VCSA 3NKZA 1SHZC 1W0BA 5L47A 2WDQA 2BG9A 3RKGA 3PU8A 4X1YE 1XMOT 2V7JA 4B3RT 3A7MA 3W15B 4JYAT 2YDSA 4DV6T 5HAXA 2ES0A 2RPAA 4OHFA 1XWMA 3D0TA 1MMAA 1MNDA 2KT9A 4X1KE 3RIUC 2B76A 3OJAA 1M7KA 3O1IA 3VR8A 5EK3A 2IMLA 3UFGA 2X9HA 3KINB 4KP3C 2H89A 4UELA 5AQQB 2IW5B 4C91A 3LBXB 2X0HA 2LSGA 1IBMT 3OYZA 4U2ZA 3NVOA 3UQ4A 3HI2A 4H9NC 5ADXL 3AEDA 2E5LT 2UUCT 3VHLA 4EZHA 3C4ZA 4DUYT 2C0SA 3EI0A 4ISTA 3Q5DA 3RGLA 1GQEA 2VKDA 4YJ2E 4ILCA 4PFOA 1IAPA 3AECA 2I6HA 2X9YA 2X67A 5LG4A 1YKHB 2ODVA 2WBLA 5CFBA 1E2AA 5JDHA 3DTOA 3FXEB 5C3JA 3HL6A 3A8YC 3MKDA 4J2CA 1YXRA 3ONLC 4IE7A 3S4UA 3NRYA 2DI4A 4KUMB 3O1HA 3ZT6A 3ZMUB 1MIWA 2VKJA 2W66A 3N9QA 5HEOA 5HEGA 1FEWA 2KINB 4YSZA 3Q5XA 4CI1B 5FVLA 4LF6T 4O4HE 1AJ3A 4QX8B 4PJMA 4FJOA 3ZPOA 3RHWA 5AQTB 1BR0A 3RLFF 3P4QA 1HCIA 4B6XA 4H63H 2WZIA 4HE8A 5J2TE 4PFPA 4AKGA 5CJ5A 4TNVA 2W63A 3EAMA 4DV3T 3MJXA 2VVSA 2XM1A 1US7B 2XQ5A 3L8RA 4U2YA 4IDOA 2IC6A 3Q9DA 4KMCA 2W67A 5AQPB 3UU5A 3JAEA 2ZM0A 3VU7H 3AAIA 3AXJA 3VRBA 1BR4A 1LVFA 3BQLA 4FI5A 4QKNA 4ILUA 5LCYA 2FBWA 3CMLA 4P0AA 1UUSA 1M62A 3ETVA 2NW8A 2JRKA 4L9IA 5DQVA 3HKBE 4KBMB 4UVAB 3ZC1A 3FB2A 4CN4A 4LF7T 3N2GE 3RQUA 3JCFA 2CLYB 3ONJA 3PUAA 3AE8A 5A1LA 4BA9A 2X0LB 4HWHA 4IE6A 4CN1A 4YLHA 4K0KT 2BKNA 2V7LA 5L3FB 5FNVE 4LFCT 1MMGA 4BJMA 5HWXA 2LT3A 3RC3A 3NWIA 3JC6C 4JUYA 5AQVB 3RC8A 2YN6A 3FHNA 4HFHA 2KWHA 2WMNA 3AAAB 1WYCA 3RF1A 5ETWA 3UU8A 4B3TT 1U4QA 2BDEA 3CX8B 5HWYA 1U5PA 5LBMA 3JAFA 4X66T 2FJAA 4EB6E 5FXWA 3AE2A 5JDGA 2NW7A 2VWAA 2WY2A 3E22E 2OA5A 3N9LA 3P4RA 4U72A 5JR9A 5JDFA 5IWAT 4HWIB 3AE4A 4LF5T 2Q9QD 2VB6A 2H3RA 1XDPA 2DL1A 2NP9A 3C98B 4P09A 4U33A 4WZXA 3K8PC 5IHYA 1IJ6A 3LJCA 2M6IA 2LHRA 4O2AE 4QHOA 2A9UA 3MK7C 5AQFB 3TKLB 5LXTE 5JREA 4HFDA 4DR6T 2XQ7A 5CA0E 5HYAA 2UUBT 4UVCB 2XQYA 2JMKA 4H9QC 4EEBA 2MOZA 2Z6EA 3AE5A 3RX6A 1QUUA 3BK9A 2WZHA 4XBFB 4X5TA 4H9RC 1OWAA 2W62A 3V5SA 4MHCA 4NUVA 4AKLA 1FJGT 3PU3A 5LOVE 3R84B 4UVBB 2BG9B 4GK0E 5H6RB 3WI3A 4E7ZA 2VURA 5KDMC 4X62T 1KFYA 4ZXLA 2NR4A 3FZFB 3L09A 3ESLA 3C64A 2LOPA 3QB5A 3VKGA 1MIVA 2LE8A 2V6YB 3KDSE 3KV6A 4HGAA 4I4TE 4UV8B 3G06A 3KVAA 4UR9A 3ZJ2A 4DV7T 4AQYT 2OLTA 4LFAT 2IUBA 3AE7A 3QK6A 4U74A 4DR7T 3O4XE 4IDNA 1T98A 3ONXA 1MNEA 4YSYA 3OTOT 2NTYA 2CPTA 2YDRA 3BQIA 3T1YT 2PTFA 1SUMB 2A72A 4BJNA 3B5MA 3PURA 4U7YA 5FL1A 5EZYE 3TLWA 1WR6A 5JR9B 4X64T 2D2SA 2L8KA 2ZM8A 3CQCB 1YQ3A 2QVAA 3MACA 4QX7B 1I94T 1HNXT 2HPJA 3VKHA 1UK5A 1VOMA 4LMKA 3GA8A 3F57A 3MZKB 3CPZA 2XAQB 2EHOD 2YU1A 2LEHA 4EXTA 3AEBA 2EHOC 3LFMA 3F2EA 3HR0A 1HX1B 5HXEA 2WDVA 4OX9T 2CWOA 3ZT7A 4ZS2A 4ZI2D 3AE6A 1ZP0A 3PDYA 1G73A 2HN1A 4DMWA 4AI6A 2BKPA 2JQKA 2UXDT 1I6ZA 3AEFA 2UU9T 3KV5A 3OKQA 4NPPA 2BBJA 2D9DA 2V5CA 4X20E 4DUZT 4IDQA 2VKHA 3EABA 2QRXA 2VVNA 2F4VT 1T7SA 5JQGE 2BS2A 1B7TA 1CUNA 3CVRA 4BAYB 3F31A 5CGMA 2GK9A 2FJDA 2RP4A 1W09A 2M67A 2YDQA 1QSDA 2C5JA 2K9AA 4I55E 1R8IA 5ABHA 4YTMA 2V6YA 2JJ9A 2YINA 1OEDB 3DJBA 3RIAA 4IDPA 2J47A 2IC9A 2XAFB 4JEHB 4U3CA 5TAOA 3X1DA 4Z91A 4F6RC 4CZZB 2UXBT 4NUUA 3K3OA 2V7MA 2K3WA 4OK0A 1X79A 1LRZA 2CA5A 3E08A 1V9DA 2WB5A 3UUMA 3TLUA 4H63V 4LMJA 3AE9A 3EDVA 3EUHA 4PNIA 5E0OA 3VR9A 3UULA 4JLEA 2LKGA 3C4XA 4MBQA 1SA0E 4TWFA 5AQMB 3ABVA 2VK9A 3ZMSB 3P8CD 4MALA 3PUGA 5FP3A 4AQGA 3ANWB 4E7SA 2ZM2A 5JDMA 5LHHB 1DU2A 3ZC0A 3U3IA 4CQIA 4LF9T 5AQRB 3GWHA 5LGNB 5J0ZA 4F8HA 3HKDE 4P1NA 4QXHB 1KF6A 3ZN1B 3LK2B 3ZSSA 1ZOYA 3H37A 5AQKB 2I0MA 3LDQB 5DQWA 5JDNA 3BQKA 2HHHT 2AE9A 1OXZA 4TWDA 5L3GB 4HFCA 2JQHA 4YXDA 4QH5A 4V1Av 4GK5E 3HA4A 5HXHA 3N2KE 2V7KA 5AQIB 3PUQA 2BBHA 4NXNT 3RYFE 2DNXA 2WAUA 3PUSA 4IDZA 4PAGA 4TNWA 5FY7A 5H6QB 2XQAA 3CX6B 4TWHA 4N78D 3RRCA 3P4PA 4EGWA 1WLXA 2IDOB 4OYKA 4OYJA 2B1EA 4HWDA 4PJLA 4CXWA 5JH7E 1MMNA 2YEVC 3NBXX 4QXBB 1UX4A 2G0UA 4DO0A 5CB4E 2VASA 3O1JA 2E9XC 1XNRT 4DV2T 2JMHA 4MFRA 4Z8XA 4JEUB 2C5IT 4QH1A 3KBTA 4HN9A 4DNDA 1UCUA 4GYSA 3LBXA 1W9RA 3N2OA 3MXZA 2ZMAA 2CHNA 4EYUA 2V7IA 1HTJF 2CXDA 4DMVA 2VKOA 2N2NA 2BS3A 1CHUA 2JPFA 3KV9A 3KVBA 4HEAA 4EEDA 1HS7A 2CHOA 4PK5A 2ZM6T 4EAHA 5AQJB 2UUAT 5DJQC 3EDUA 2CM0A 2CMRA 5ABGA 3CQGB 3AAEB 3P50A 2A3DA 3UU4A 3ZN0B 1IBKT 4L5GA 4IGUA 2J4GA 3OYXA 2JQQA 3CKDA 2IHR1 3IBPA 2XAHB 5AQOB 5AQNB 2WSSV 1NWMX 2CWYA 2LSIA 2YK0A 5FYMA 5L4HA 1FIOA 4EV6A 2PFVA 3UTKA 1N36T 2XUEA 3CQXC 4DBRA 3I0QA 4U7IA 5KMGP 2CRBA 2MPKA 3L39A
chains in the Genus database with same CATH topology
3OTOT 1N34T 4JI8T 1XMOT 3T1YT 4B3RT 4GKKT 1HNWT 4LF4T 4DV5T 4DV6T 1IBLT 4JYAT 4X64T 4DR4T 1HNXT 2UXCT 1IBMT 4OX9T 4DV1T 2E5LT 2UUCT 4DR2T 4DUYT 2UXDT 4JI3T 2UU9T 4GKJT 4DUZT 5BR8T 1XNQT 4LF6T 2UXBT 1XMQT 1HR0T 4B3MT 4DV4T 4DV3T 1N33T 4DR3T 2VQET 4LF9T 4JI4T 4LF7T 1HNZT 2HHHT 4LF8T 4YHHT 4K0KT 4JI1T 4LFBT 4LFCT 4X65T 4NXNT 2VQFT 4DV0T 4B3TT 4JI5T 4X66T 4KHPT 4JI2T 5LMUT 4NXMT 4JV5T 1XNRT 4DV2T 4LF5T 1I94T 1FJGT 4JI7T 5IWAT 2F4VT 1N32T 4DR6T 4JI0T 2UUBT 4YY3T 4JI6T 4DR1T 5LMNT 2ZM6T 4B3ST 4DR5T 1IBKT 4X62T 1N36T 1J5ET 2UUAT 4DV7T 4AQYT 4LFAT 3T1HT 4DR7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO T;  1N34 T;  4JI8 T;  1XMO T;  3T1Y T;  4B3R T;  4GKK T;  1HNW T;  4LF4 T;  4DV5 T;  4DV6 T;  1IBL T;  4JYA T;  4X64 T;  4DR4 T;  1HNX T;  2UXC T;  1IBM T;  4OX9 T;  4DV1 T;  2E5L T;  2UUC T;  4DR2 T;  4DUY T;  2UXD T;  4JI3 T;  2UU9 T;  4GKJ T;  4DUZ T;  5BR8 T;  1XNQ T;  4LF6 T;  2UXB T;  1XMQ T;  1HR0 T;  4B3M T;  4DV4 T;  4DV3 T;  1N33 T;  4DR3 T;  2VQE T;  4LF9 T;  4JI4 T;  4LF7 T;  1HNZ T;  2HHH T;  4LF8 T;  4YHH T;  4K0K T;  4JI1 T;  4LFB T;  4LFC T;  4X65 T;  4NXN T;  2VQF T;  4DV0 T;  4B3T T;  4JI5 T;  4X66 T;  4KHP T;  4JI2 T;  5LMU T;  4NXM T;  4JV5 T;  1XNR T;  4DV2 T;  4LF5 T;  1I94 T;  1FJG T;  4JI7 T;  5IWA T;  2F4V T;  1N32 T;  4DR6 T;  4JI0 T;  2UUB T;  4YY3 T;  4JI6 T;  4DR1 T;  5LMN T;  2ZM6 T;  4B3S T;  4DR5 T;  1IBK T;  4X62 T;  1N36 T;  1J5E T;  2UUA T;  4DV7 T;  4AQY T;  4LFA T;  3T1H T;  4DR7 T; 
#chains in the Genus database with same CATH topology
 1N34 T;  2XQ6 A;  5HCJ A;  3ZCJ A;  3I1A A;  5LNK A;  2CLY C;  3RKO A;  4ERR A;  1D0X A;  4CI3 B;  1XDO A;  2ODU A;  4HTE A;  5FKY A;  4ADZ A;  4ZZC A;  5LP6 E;  2JIW A;  2LRK A;  2MTQ A;  3CWZ B;  1HNW T;  2BVM A;  4DBQ A;  3EVY A;  1IBL T;  4LF4 T;  2E9X A;  3SFD A;  1KEY A;  2J62 A;  3PUZ F;  4Q25 A;  2JQ9 A;  3ZMZ B;  4MLK A;  4Z90 A;  2LHN A;  2XJ7 A;  3Q5E A;  3TLV A;  3NRX A;  3JAD A;  1WCR A;  3M65 A;  4KI0 F;  2KND A;  2H7O A;  2WQY A;  2PJQ A;  2XPK A;  4GIW A;  3SWH A;  5F3J A;  2DCF A;  4KHZ F;  3CK6 A;  4O4J E;  3TLS A;  3AEE A;  3ZYL A;  4ANJ A;  1Y01 A;  2XAJ B;  4ZI3 D;  2X9W A;  1OED A;  1KK7 A;  2X9X A;  4DR2 T;  3PTR B;  1J1J A;  2E8I A;  3PUX F;  4ILA A;  3O9X A;  2FUP A;  2W2U A;  5LHG B;  1UUR A;  2XZE A;  4YHJ A;  2NTX A;  1LKX A;  4EIW A;  3QOF A;  2LLY A;  2KZ7 B;  2MYS A;  4GKJ T;  3IF8 B;  5BR8 T;  2N1G A;  4K0U A;  2V8S V;  2WDR A;  3PJA A;  2W00 A;  4I50 E;  1S94 A;  3LG7 A;  3I9W A;  2Y8D A;  5AQU B;  2Y48 B;  3RYH E;  5FY1 A;  2Q9Q C;  2QA7 A;  4ISS A;  4DID B;  5J2U E;  2X68 A;  4TZ4 C;  4UF0 A;  5LBQ B;  4YJ3 E;  1KNR A;  3FXD B;  3PUY F;  5IYZ E;  5ABF A;  2KXP B;  5LJM A;  2K48 A;  2UXN B;  2HN2 A;  4H9P C;  5IUX A;  4TUY E;  3UQ7 A;  5EK2 A;  1IJ5 A;  4M1P A;  3RRW A;  5LHI B;  2LM2 A;  2V5D A;  3J7Y q;  3AXJ B;  4HFE A;  1UX5 A;  1D0Y A;  3IEE A;  4B3M T;  2EHO B;  3TLT A;  2LRL A;  5HXS A;  4WNK A;  2V1D B;  5L3D B;  4XZC A;  1N33 T;  4HFB A;  4H9O C;  3RYI E;  3RPU A;  2DWG A;  3N9M A;  2X0Y A;  4YTP A;  1Z8U A;  1QLB A;  5L4E A;  4JI4 T;  4OFZ A;  1UGO A;  5LA6 E;  3PUW F;  1JNR A;  3V5U A;  2ACZ A;  1NEK A;  3I0O A;  3PV0 F;  1Z0P A;  3FBL A;  3NZP A;  2MBG A;  5JDL A;  4KHP T;  1W0A A;  1D1C A;  3A5X A;  4HKA A;  4G63 A;  2WWU A;  2Q9Q A;  3EHZ A;  2MAW A;  4UEM A;  3FZK B;  2XHE B;  4JI1 T;  1ZKE A;  4LFB T;  2DHR A;  2XQ4 A;  5FL0 A;  5JVD E;  5ABE A;  2W4X A;  4X65 T;  1L0V A;  1KNP A;  3R6N A;  3K1S A;  3N5L A;  3SOL A;  2SPC A;  3QUJ A;  2VQF T;  3WAK A;  3ZLI A;  4TN7 B;  2Y6X A;  2KSR A;  4YSX A;  3SRZ A;  3N9N A;  4JI2 T;  4C90 A;  5FXV A;  4IHJ E;  5HEJ A;  5L2L A;  3LK4 2;  3FZH B;  3ZEF B;  4JV5 T;  5JDQ A;  5GON E;  2BS4 A;  4IE0 A;  2D0T A;  4ZOL E;  4AXP A;  4GOU A;  2C5K T;  3AB3 B;  3H3A A;  3MA9 A;  3K3Q C;  4CN6 A;  3AE3 A;  4IE4 A;  1ZHC A;  1OED C;  1YD8 G;  5LGT B;  3AA6 B;  4ZZB A;  4JI0 T;  3HKE E;  4UIG A;  4X1I E;  5HXC A;  1D1A A;  3OVU A;  4XAX B;  2KMF A;  2Q9Q B;  2DLR A;  4JI6 T;  5AQG B;  3FBZ A;  5L3E B;  3B57 A;  3RIF A;  4WBO A;  4P0B A;  1H7C A;  2LOS A;  4AIS A;  4DR5 T;  1HNZ T;  2D5U A;  5JRC B;  2IAK A;  5JR9 C;  1XZY A;  5M4Y A;  3LSV A;  4AQF C;  2XTL A;  2E2A A;  5FVK A;  2CE7 A;  4KX6 A;  3SS1 A;  2NOX A;  2YU2 A;  3NZQ A;  2K5B B;  2UXX B;  4ZEY A;  2X66 A;  3AA1 B;  3AVR A;  1JNZ A;  3ZCI A;  3VRA A;  3LK3 B;  2EHO A;  3ZJ1 A;  2X51 A;  3FZM B;  2P9B A;  4IE5 A;  2KWI B;  2XM2 A;  2CEA A;  4YTN A;  5LYJ E;  4JI8 T;  4U31 A;  3Q2M A;  3P7I A;  4IL9 A;  5FY0 A;  4GKK T;  1HG5 A;  3ANW A;  3QNU A;  4DV5 T;  4I0U A;  4HWC A;  2CXF A;  4IRE A;  4DR4 T;  2D0U A;  2W61 A;  5LJN A;  1FMV A;  1G8X A;  1FMW A;  4COF A;  1NAF A;  2J1D G;  4IIJ E;  1SE7 A;  2WU5 A;  4PJN A;  2A2F X;  4PK4 A;  2AXD S;  2UXC T;  2LSY A;  3C50 A;  1KNZ A;  4H9S E;  2KLQ A;  3PUV F;  1E7P A;  2WCA A;  3QB5 K;  3Q5W A;  4A5X A;  4DV1 T;  4UXN B;  3SFE A;  1EZ3 A;  5HCM A;  4AQF A;  3RIU A;  1LVK A;  3AVS A;  5C8Y E;  4TV9 E;  5FXX A;  1X9B A;  3M3Z B;  4LML A;  4ZI7 E;  4JI3 T;  1J5W A;  4O4I E;  5KXJ A;  5AQH B;  3UUX B;  3ETU A;  2WP9 A;  2QYW A;  3C51 A;  4WYV A;  5CA1 E;  1XNQ T;  2VL0 A;  4G2A A;  1ZEE A;  5C2T A;  4WBN E;  3WAJ A;  3B13 A;  5HEU A;  2BG9 E;  3AEA A;  2HPL A;  4O8S A;  3C4W A;  4I43 B;  4EYY R;  4IT4 A;  3CIR A;  4PW8 A;  4NIQ A;  3K3N A;  3ZYK A;  1D0Z A;  1HG2 A;  4ILB A;  4CXX A;  4WW0 A;  1YKE B;  3AE1 A;  4ZI2 C;  2CCQ A;  1WFD A;  3U78 A;  3IA3 A;  3N9P A;  2XAG B;  1VRB A;  3AA0 B;  2WU2 A;  3JC6 D;  1XMQ T;  1HR0 T;  3FZL B;  2YOE A;  5AQL B;  5F8P A;  2NWB A;  3OBV E;  4QXC B;  5L3B B;  4DV4 T;  2K24 A;  1YQ4 A;  5BMV E;  2WM9 A;  2BKO A;  2R6G F;  5LGU B;  1HF8 A;  2BZB A;  4GYR A;  4UF0 B;  3RQW A;  3UU6 A;  1T72 A;  1D1B A;  4AIU A;  4DR3 T;  1E1H B;  5F5W A;  2VQE T;  5FMN A;  2LSK A;  4PK6 A;  4TV8 E;  4JI7 T;  3KV4 A;  5JRC A;  3ZMT B;  4CXY A;  2XY8 B;  3PE0 A;  5EK4 A;  4HWF A;  3RI5 A;  4A56 A;  3ZT5 A;  4ASK A;  2W0G A;  3PJA J;  4YFS A;  3I9Y A;  1MMD A;  2WS3 A;  2XQ8 A;  4LF8 T;  3ZKR A;  3UU3 A;  3OPC A;  4YHH T;  3P4S A;  4QH4 A;  5KX5 E;  2H7V C;  4O4L E;  2I59 A;  2RA1 A;  3GN5 A;  2OV9 A;  2BVL A;  3T8O A;  1WR0 A;  5HXR A;  4DV0 T;  4AKH A;  3UUB A;  1MIY A;  1Y64 B;  1VCT A;  2LM9 A;  4JI5 T;  4DVD A;  4ZHQ E;  5ABF B;  2BG9 C;  2DWK A;  5LMU T;  4NXM T;  4A97 A;  1IZN B;  4L0R A;  1S35 A;  5AQS B;  1ZV4 X;  1HFA A;  1BR2 A;  1NEN A;  1HX8 A;  2ACX A;  2HH7 A;  2M6B A;  2L3L A;  2XQ3 A;  3E0Z A;  2LSJ A;  3KBU A;  5HEH A;  4ZI3 C;  3RYC E;  3AEG A;  3UUN A;  4EOZ B;  2ZLY A;  3DP7 A;  5DAB A;  2QGS A;  1OED E;  3KFW X;  3QC9 A;  4IL4 A;  2XSA A;  3J9X 1;  3UT5 E;  3RH3 A;  1N32 T;  3N9O A;  4HFI A;  5LG3 A;  3IHR A;  1O3X A;  2YKS A;  3P4W A;  2V6X A;  5AFU L;  2N9D A;  4QWN B;  2CXL A;  4AKR B;  3ZYM A;  4CI2 B;  3UFE A;  4YY3 T;  2CBI A;  4PJJ A;  2L9Q A;  1BR1 A;  4O2B E;  4DR1 T;  5LMN T;  2E9X B;  3HKC E;  2WWV A;  4B3S T;  2CBJ A;  2E5V A;  2LKH A;  5JTG A;  5L3C B;  2IIU A;  4JBW F;  4ZS3 A;  3GN5 B;  1WRD A;  4UV9 B;  3AA7 B;  3ZMV B;  2WMO A;  2E9X D;  4TX5 A;  3L3P A;  2XSB A;  5FXZ A;  4AKI A;  2V26 A;  5J1G A;  3CX7 B;  1J5E T;  2LJL A;  2XQ9 A;  1T8B A;  4HFV A;  1WYB A;  2H88 A;  1YW0 A;  3GMI A;  4A98 A;  2NW9 A;  3ZST A;  4EZ4 A;  2PBI A;  4YT0 A;  2FJB A;  3H3M A;  3T1H T;  5LB7 B;  2FJE A;  2XAS B;  2PG8 A;  2VL8 A;  1VCS A;  3NKZ A;  1SHZ C;  1W0B A;  5L47 A;  2WDQ A;  2BG9 A;  3RKG A;  3PU8 A;  4X1Y E;  1XMO T;  2V7J A;  4B3R T;  3A7M A;  3W15 B;  4JYA T;  2YDS A;  4DV6 T;  5HAX A;  2ES0 A;  2RPA A;  4OHF A;  1XWM A;  3D0T A;  1MMA A;  1MND A;  2KT9 A;  4X1K E;  3RIU C;  2B76 A;  3OJA A;  1M7K A;  3O1I A;  3VR8 A;  5EK3 A;  2IML A;  3UFG A;  2X9H A;  3KIN B;  4KP3 C;  2H89 A;  4UEL A;  5AQQ B;  2IW5 B;  4C91 A;  3LBX B;  2X0H A;  2LSG A;  1IBM T;  3OYZ A;  4U2Z A;  3NVO A;  3UQ4 A;  3HI2 A;  4H9N C;  5ADX L;  3AED A;  2E5L T;  2UUC T;  3VHL A;  4EZH A;  3C4Z A;  4DUY T;  2C0S A;  3EI0 A;  4IST A;  3Q5D A;  3RGL A;  1GQE A;  2VKD A;  4YJ2 E;  4ILC A;  4PFO A;  1IAP A;  3AEC A;  2I6H A;  2X9Y A;  2X67 A;  5LG4 A;  1YKH B;  2ODV A;  2WBL A;  5CFB A;  1E2A A;  5JDH A;  3DTO A;  3FXE B;  5C3J A;  3HL6 A;  3A8Y C;  3MKD A;  4J2C A;  1YXR A;  3ONL C;  4IE7 A;  3S4U A;  3NRY A;  2DI4 A;  4KUM B;  3O1H A;  3ZT6 A;  3ZMU B;  1MIW A;  2VKJ A;  2W66 A;  3N9Q A;  5HEO A;  5HEG A;  1FEW A;  2KIN B;  4YSZ A;  3Q5X A;  4CI1 B;  5FVL A;  4LF6 T;  4O4H E;  1AJ3 A;  4QX8 B;  4PJM A;  4FJO A;  3ZPO A;  3RHW A;  5AQT B;  1BR0 A;  3RLF F;  3P4Q A;  1HCI A;  4B6X A;  4H63 H;  2WZI A;  4HE8 A;  5J2T E;  4PFP A;  4AKG A;  5CJ5 A;  4TNV A;  2W63 A;  3EAM A;  4DV3 T;  3MJX A;  2VVS A;  2XM1 A;  1US7 B;  2XQ5 A;  3L8R A;  4U2Y A;  4IDO A;  2IC6 A;  3Q9D A;  4KMC A;  2W67 A;  5AQP B;  3UU5 A;  3JAE A;  2ZM0 A;  3VU7 H;  3AAI A;  3AXJ A;  3VRB A;  1BR4 A;  1LVF A;  3BQL A;  4FI5 A;  4QKN A;  4ILU A;  5LCY A;  2FBW A;  3CML A;  4P0A A;  1UUS A;  1M62 A;  3ETV A;  2NW8 A;  2JRK A;  4L9I A;  5DQV A;  3HKB E;  4KBM B;  4UVA B;  3ZC1 A;  3FB2 A;  4CN4 A;  4LF7 T;  3N2G E;  3RQU A;  3JCF A;  2CLY B;  3ONJ A;  3PUA A;  3AE8 A;  5A1L A;  4BA9 A;  2X0L B;  4HWH A;  4IE6 A;  4CN1 A;  4YLH A;  4K0K T;  2BKN A;  2V7L A;  5L3F B;  5FNV E;  4LFC T;  1MMG A;  4BJM A;  5HWX A;  2LT3 A;  3RC3 A;  3NWI A;  3JC6 C;  4JUY A;  5AQV B;  3RC8 A;  2YN6 A;  3FHN A;  4HFH A;  2KWH A;  2WMN A;  3AAA B;  1WYC A;  3RF1 A;  5ETW A;  3UU8 A;  4B3T T;  1U4Q A;  2BDE A;  3CX8 B;  5HWY A;  1U5P A;  5LBM A;  3JAF A;  4X66 T;  2FJA A;  4EB6 E;  5FXW A;  3AE2 A;  5JDG A;  2NW7 A;  2VWA A;  2WY2 A;  3E22 E;  2OA5 A;  3N9L A;  3P4R A;  4U72 A;  5JR9 A;  5JDF A;  5IWA T;  4HWI B;  3AE4 A;  4LF5 T;  2Q9Q D;  2VB6 A;  2H3R A;  1XDP A;  2DL1 A;  2NP9 A;  3C98 B;  4P09 A;  4U33 A;  4WZX A;  3K8P C;  5IHY A;  1IJ6 A;  3LJC A;  2M6I A;  2LHR A;  4O2A E;  4QHO A;  2A9U A;  3MK7 C;  5AQF B;  3TKL B;  5LXT E;  5JRE A;  4HFD A;  4DR6 T;  2XQ7 A;  5CA0 E;  5HYA A;  2UUB T;  4UVC B;  2XQY A;  2JMK A;  4H9Q C;  4EEB A;  2MOZ A;  2Z6E A;  3AE5 A;  3RX6 A;  1QUU A;  3BK9 A;  2WZH A;  4XBF B;  4X5T A;  4H9R C;  1OWA A;  2W62 A;  3V5S A;  4MHC A;  4NUV A;  4AKL A;  1FJG T;  3PU3 A;  5LOV E;  3R84 B;  4UVB B;  2BG9 B;  4GK0 E;  5H6R B;  3WI3 A;  4E7Z A;  2VUR A;  5KDM C;  4X62 T;  1KFY A;  4ZXL A;  2NR4 A;  3FZF B;  3L09 A;  3ESL A;  3C64 A;  2LOP A;  3QB5 A;  3VKG A;  1MIV A;  2LE8 A;  2V6Y B;  3KDS E;  3KV6 A;  4HGA A;  4I4T E;  4UV8 B;  3G06 A;  3KVA A;  4UR9 A;  3ZJ2 A;  4DV7 T;  4AQY T;  2OLT A;  4LFA T;  2IUB A;  3AE7 A;  3QK6 A;  4U74 A;  4DR7 T;  3O4X E;  4IDN A;  1T98 A;  3ONX A;  1MNE A;  4YSY A;  3OTO T;  2NTY A;  2CPT A;  2YDR A;  3BQI A;  3T1Y T;  2PTF A;  1SUM B;  2A72 A;  4BJN A;  3B5M A;  3PUR A;  4U7Y A;  5FL1 A;  5EZY E;  3TLW A;  1WR6 A;  5JR9 B;  4X64 T;  2D2S A;  2L8K A;  2ZM8 A;  3CQC B;  1YQ3 A;  2QVA A;  3MAC A;  4QX7 B;  1I94 T;  1HNX T;  2HPJ A;  3VKH A;  1UK5 A;  1VOM A;  4LMK A;  3GA8 A;  3F57 A;  3MZK B;  3CPZ A;  2XAQ B;  2EHO D;  2YU1 A;  2LEH A;  4EXT A;  3AEB A;  2EHO C;  3LFM A;  3F2E A;  3HR0 A;  1HX1 B;  5HXE A;  2WDV A;  4OX9 T;  2CWO A;  3ZT7 A;  4ZS2 A;  4ZI2 D;  3AE6 A;  1ZP0 A;  3PDY A;  1G73 A;  2HN1 A;  4DMW A;  4AI6 A;  2BKP A;  2JQK A;  2UXD T;  1I6Z A;  3AEF A;  2UU9 T;  3KV5 A;  3OKQ A;  4NPP A;  2BBJ A;  2D9D A;  2V5C A;  4X20 E;  4DUZ T;  4IDQ A;  2VKH A;  3EAB A;  2QRX A;  2VVN A;  2F4V T;  1T7S A;  5JQG E;  2BS2 A;  1B7T A;  1CUN A;  3CVR A;  4BAY B;  3F31 A;  5CGM A;  2GK9 A;  2FJD A;  2RP4 A;  1W09 A;  2M67 A;  2YDQ A;  1QSD A;  2C5J A;  2K9A A;  4I55 E;  1R8I A;  5ABH A;  4YTM A;  2V6Y A;  2JJ9 A;  2YIN A;  1OED B;  3DJB A;  3RIA A;  4IDP A;  2J47 A;  2IC9 A;  2XAF B;  4JEH B;  4U3C A;  5TAO A;  3X1D A;  4Z91 A;  4F6R C;  4CZZ B;  2UXB T;  4NUU A;  3K3O A;  2V7M A;  2K3W A;  4OK0 A;  1X79 A;  1LRZ A;  2CA5 A;  3E08 A;  1V9D A;  2WB5 A;  3UUM A;  3TLU A;  4H63 V;  4LMJ A;  3AE9 A;  3EDV A;  3EUH A;  4PNI A;  5E0O A;  3VR9 A;  3UUL A;  4JLE A;  2LKG A;  3C4X A;  4MBQ A;  1SA0 E;  4TWF A;  5AQM B;  3ABV A;  2VK9 A;  3ZMS B;  3P8C D;  4MAL A;  3PUG A;  5FP3 A;  4AQG A;  3ANW B;  4E7S A;  2ZM2 A;  5JDM A;  5LHH B;  1DU2 A;  3ZC0 A;  3U3I A;  4CQI A;  4LF9 T;  5AQR B;  3GWH A;  5LGN B;  5J0Z A;  4F8H A;  3HKD E;  4P1N A;  4QXH B;  1KF6 A;  3ZN1 B;  3LK2 B;  3ZSS A;  1ZOY A;  3H37 A;  5AQK B;  2I0M A;  3LDQ B;  5DQW A;  5JDN A;  3BQK A;  2HHH T;  2AE9 A;  1OXZ A;  4TWD A;  5L3G B;  4HFC A;  2JQH A;  4YXD A;  4QH5 A;  4V1A v;  4GK5 E;  3HA4 A;  5HXH A;  3N2K E;  2V7K A;  5AQI B;  3PUQ A;  2BBH A;  4NXN T;  3RYF E;  2DNX A;  2WAU A;  3PUS A;  4IDZ A;  4PAG A;  4TNW A;  5FY7 A;  5H6Q B;  2XQA A;  3CX6 B;  4TWH A;  4N78 D;  3RRC A;  3P4P A;  4EGW A;  1WLX A;  2IDO B;  4OYK A;  4OYJ A;  2B1E A;  4HWD A;  4PJL A;  4CXW A;  5JH7 E;  1MMN A;  2YEV C;  3NBX X;  4QXB B;  1UX4 A;  2G0U A;  4DO0 A;  5CB4 E;  2VAS A;  3O1J A;  2E9X C;  1XNR T;  4DV2 T;  2JMH A;  4MFR A;  4Z8X A;  4JEU B;  2C5I T;  4QH1 A;  3KBT A;  4HN9 A;  4DND A;  1UCU A;  4GYS A;  3LBX A;  1W9R A;  3N2O A;  3MXZ A;  2ZMA A;  2CHN A;  4EYU A;  2V7I A;  1HTJ F;  2CXD A;  4DMV A;  2VKO A;  2N2N A;  2BS3 A;  1CHU A;  2JPF A;  3KV9 A;  3KVB A;  4HEA A;  4EED A;  1HS7 A;  2CHO A;  4PK5 A;  2ZM6 T;  4EAH A;  5AQJ B;  2UUA T;  5DJQ C;  3EDU A;  2CM0 A;  2CMR A;  5ABG A;  3CQG B;  3AAE B;  3P50 A;  2A3D A;  3UU4 A;  3ZN0 B;  1IBK T;  4L5G A;  4IGU A;  2J4G A;  3OYX A;  2JQQ A;  3CKD A;  2IHR 1;  3IBP A;  2XAH B;  5AQO B;  5AQN B;  2WSS V;  1NWM X;  2CWY A;  2LSI A;  2YK0 A;  5FYM A;  5L4H A;  1FIO A;  4EV6 A;  2PFV A;  3UTK A;  1N36 T;  2XUE A;  3CQX C;  4DBR A;  3I0Q A;  4U7I A;  5KMG P;  2CRB A;  2MPK A;  3L39 A; 
#chains in the Genus database with same CATH homology
 3OTO T;  1N34 T;  4JI8 T;  1XMO T;  3T1Y T;  4B3R T;  4GKK T;  1HNW T;  4LF4 T;  4DV5 T;  4DV6 T;  1IBL T;  4JYA T;  4X64 T;  4DR4 T;  1HNX T;  2UXC T;  1IBM T;  4OX9 T;  4DV1 T;  2E5L T;  2UUC T;  4DR2 T;  4DUY T;  2UXD T;  4JI3 T;  2UU9 T;  4GKJ T;  4DUZ T;  5BR8 T;  1XNQ T;  4LF6 T;  2UXB T;  1XMQ T;  1HR0 T;  4B3M T;  4DV4 T;  4DV3 T;  1N33 T;  4DR3 T;  2VQE T;  4LF9 T;  4JI4 T;  4LF7 T;  1HNZ T;  2HHH T;  4LF8 T;  4YHH T;  4K0K T;  4JI1 T;  4LFB T;  4LFC T;  4X65 T;  4NXN T;  2VQF T;  4DV0 T;  4B3T T;  4JI5 T;  4X66 T;  4KHP T;  4JI2 T;  5LMU T;  4NXM T;  4JV5 T;  1XNR T;  4DV2 T;  4LF5 T;  1I94 T;  1FJG T;  4JI7 T;  5IWA T;  2F4V T;  1N32 T;  4DR6 T;  4JI0 T;  2UUB T;  4YY3 T;  4JI6 T;  4DR1 T;  5LMN T;  2ZM6 T;  4B3S T;  4DR5 T;  1IBK T;  4X62 T;  1N36 T;  1J5E T;  2UUA T;  4DV7 T;  4AQY T;  4LFA T;  3T1H T;  4DR7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...