4DR6I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr6I00
3T1YE 4B3MI 1VISA 2BV3A 4DR7E 3V5RA 4K0KE 3QT8A 4FW9A 4JI2I 1HR0E 5IT9Q 4JI6I 1FJGE 4DXLA 1N0UA 4YY3E 4FWDA 4JI3I 4DR4E 1H73A 5BR8I 2UUAI 2HFUA 4MYTA 2HHHE 4DUZI 1IBKI 4P7AA 2UXCI 4JI1E 3J80C 5L3JA 4LF6I 4RPFA 5FLXC 4HACB 4DV2E 3V2UC 2VQFE 4LFBI 4B3RI 1MG7A 1RREA 2A2DA 4X65I 4JG4A 1XMQE 1FKAE 1IBME 1J5EE 4GKJI 1ZXMA 4YHHI 2UUCI 1ZM3A 1XHKA 4LF7E 3M6AA 4LF9I 4FWHA 2F4VI 3PYDA 1EA6A 1HNZE 4DR3I 1IBKE 3ZZTA 1N32I 2ZITA 3JAMQ 4HYMA 1XMOI 4B3TE 2R3VA 4JYAE 1I94I 1NHJA 4DV0E 4DV5I 4JI4E 5GMEA 1H74A 3T1HI 4DV4E 1Z0VA 3GONA 2Q2EB 3T1YI 2V2QA 4JI8E 4DR7I 1FWLA 1KVKA 4DV6E 3OTOE 4JV5E 4DR1I 4YHHE 1PIEA 1FI4A 4K0KI 2E1RA 1XNQE 2F4VE 1N32E 1HR0I 2AJ4A 1Z0BA 1FJGI 4X62E 3B8HA 4JI7E 3F0NA 4YY3I 1H7SA 4PRVA 4B3SE 4UT4A 2V8PA 1N34E 3HULA 2HHHI 4FN5A 4JI0E 4DR1E 4FWGA 4LF5E 1Z0WA 2VQEI 5A2QQ 4JI1I 2BM1A 1Z5AA 1Z5BA 1OJ4A 3QT7A 1HNWI 1KIJA 1N36E 4DV2I 2CZ9A 2VQFI 4R1FA 2X36A 4WUCA 2R42A 4HXZA 2A2CA 1QZRA 1XMQI 1IBMI 1J5EI 1N0VC 3WU6A 2DEJA 4HACA 4LF7I 1B62A 1HNZI 1IBLI 4LF4I 2V2ZA 2VQEE 4B3TI 2ZBKB 4JYAI 1NZ0A 3B78A 4DR6E 1HNWE 4DV1E 2UUBE 4DV0I 4JI4I 1S16A 4DV4I 3J81Q 5LMUE 4PU9A 1D6TA 1A6FA 1KTVA 3LPSA 4JI8I 4Z7CA 4KHPI 5IT9C 3ZKDA 4UTGA 4DV6I 3OTOI 4JV5I 4NXME 1XNQI 1U2RA 1IBLE 5IWAI 4LF4E 4OX9E 1NHHA 3LNUA 3QT6A 4DV7E 3D4JA 4X66E 4DPUA 2X7IA 4X62I 4AQYE 3Q1QA 4JI7I 4DPWA 4I3HA 3PYFA 4B3SI 4DPXA 2HKJA 1N34I 1Z0EA 1NHIA 1H72C 4KHPE 2J7KA 4JI0I 4LF5I 4NXNE 1Z0TA 4WUBA 2UXDE 4JI5I 5IWAE 3WU4A 2BM0A 1N36I 3J7AG 2ZM6E 4URLA 2E5LI 4Z7YA 1S4EA 4DV3E 3JAMC 2V34A 1B63A 1ELOA 1ZM2A 4PRXA 3PYGA 2HK2A 4USMA 1ZM4A 4JI5E 4X64E 4LFAI 4DR6I 1Z5CA 4DV1I 2UUBI 4DU8A 2HFSA 3J80Q 4WUDA 1N33E 1PVGA 5LMUI 1EI1A 2E5LE 3QT5A 4XTJA 4KQVA 3B82A 4DPYA 2UU9E 1FWKA 5FLXQ 4DR2E 2NPFA 2UXBE 4GKKE 4NXMI 4HY1A 2DEIA 3ZZ0A 2WW4A 1XNRI 1WUUA 3LTOA 4LF8E 3PYEA 1HNXE 4OX9I 5LMNE 2EFGA 4DV7I 1DARA 4X66I 4DUYE 4LFAE 4AQYI 4DR5E 4DU7A 3ZM7A 2HK3A 4B3ME 1MX0A 4LFCI 5A2QC 2HKEA 1Z0GA 2GS8A 2LJPA 1H7UA 1Z0CA 4JI2E 4NXNI 4JI6E 1FNMA 1XNRE 1BKNA 2UXDI 3K1JA 4P52A 2V2VA 4M1KA 4DPTA 2OI2A 4JI3E 1Z59A 2ZM6I 5GMDA 5BR8E 2UUAE 2VF3A 4LFCE 4DV3I 3ZKBA 4DUZE 2UXCE 3H4LA 3J81C 4ED4A 4ZVIA 4LF6E 4X64I 4LFBE 4B3RE 1K47A 3ZZUA 1N33I 4MYUA 4X65E 4USKA 4GKJE 1UEKA 1MU5A 2UU9I 1ZM9A 3WU5A 2UUCE 4LF9E 4DR2I 2UXBI 5LL6R 4DR3E 1RR9A 4GKKI 1PKPA 3K17A 4EMDA 3J7AM 1XMOE 3CWVA 4LF8I 1ZXNA 2XEXA 1I94E 1HNXI 5LMNI 1KKHA 4DV5E 3T1HE 3WU3A 4DUYI 4DR5I 4DR4I
chains in the Genus database with same CATH superfamily
3T1YE 4B3MI 4QNKA 1HK7A 1VISA 2BV3A 4DR7E 2GO3A 2IERA 3V5RA 4LOMA 4K0KE 5K36D 3QT8A 4MU3A 2BR2B 2JT2A 4FW9A 2Z5BB 4JI2I 1HR0E 5IT9Q 2JE6B 4JI6I 1FJGE 4J3DA 1OYPA 4OO1C 4DXLA 1N0UA 4YY3E 1YHCA 4FWDA 2GQ0A 4JI3I 4DR4E 1H73A 5BR8I 2UUAI 2HFUA 4MYTA 4LPFA 2HHHE 3M85G 5DNXA 4IFDA 4DUZI 1IBKI 4FW7A 4IZKB 4OZEA 4P7AA 2UXCI 4JI1E 3J80C 5L3JA 4N3OA 4LF6I 4RPFA 5FLXC 2CVEA 4MQYA 4HACB 4DV2E 3V2UC 3UHMA 2VQFE 4LFBI 4B3RI 1MG7A 1RREA 2JEBB 2A2DA 4X65I 4JG4A 1XMQE 1FKAE 1IBME 1J5EE 4GKJI 3P3GA 4MU4A 2O3ZA 1ZXMA 4YHHI 2UUCI 1ZM3A 1XHKA 5C0XA 4LF7E 3M6AA 4LF9I 4FWHA 2F4VI 3PYDA 4U3BA 1EA6A 1HNZE 4DR3I 1IBKE 3ZZTA 1N32I 2WP8A 2ZITA 3JAMQ 4HYMA 1XMOI 4B3TE 5JEAC 1E3PA 2R3VA 4JYAE 2C37A 3K85A 5C0XD 1I94I 1NHJA 4DV0E 4DV5I 4JI4E 5GMEA 1H74A 4LCHA 3T1HI 4DV4E 1Z0VA 4IFDE 3GONA 3B4TA 2Q2EB 1Y60A 3T1YI 4IZJA 2V2QA 4JI8E 4DR7I 1FWLA 4AIMA 1KVKA 4DV6E 3OTOE 4JV5E 4DR1I 4YHHE 4GQUA 1PIEA 1FI4A 4K0KI 2E1RA 2BA1D 3H1CA 1XNQE 2F4VE 1N32E 1HR0I 2AJ4A 4IZJD 1Z0BA 4OKGA 2Z5CB 5DRRA 2AE8A 1FJGI 2IOQA 2BR2A 1RHYA 4X62E 3B8HA 4JI7E 5C0XE 3F0NA 4YY3I 1H7SA 1OYSA 4PRVA 4B3SE 4UT4A 2JE6A 1XXEA 2V8PA 2PNMA 1UDSA 3L7ZA 1N34E 3HULA 2HHHI 4FN5A 4JI0E 4DR1E 2PO1B 4FWGA 3GLLA 4LF5E 3M7NG 1Z0WA 3PRYA 2VQEI 5A2QQ 4JI1I 1OYRA 3GMEA 2BM1A 5K36C 1Z5AA 1Y4UA 1Z5BA 1OJ4A 3QT7A 1HNWI 4IZKA 1KIJA 3U1KA 1N36E 2WNRB 5DRQA 4DV2I 5DNLA 2CZ9A 2VQFI 3M7ND 4R1FA 2X36A 4WUCA 2R42A 4HXZA 2A2CA 1QZRA 1XMQI 1IBMI 1J5EI 1N0VC 3WU6A 2DEJA 4HACA 4LF7I 4OO1F 5K36B 2C38B 1B62A 2JEBA 2F1DA 1HNZI 1IBLI 4LF4I 2V2ZA 1Y4SA 2VQEE 4B3TI 1R6MA 4OO1B 2ZBKB 4JYAI 1NZ0A 3B78A 4DR6E 2PO0B 1HNWE 4DV1E 2UUBE 4DV0I 2NN6C 4JI4I 1S16A 2IESA 4DV4I 4IFDD 3J81Q 3M85D 5LMUE 4PU9A 1D6TA 1A6FA 1KTVA 5DROA 3LPSA 2VESA 4JI8I 2BA0G 4Z7CA 4KHPI 1Y5YA 5IT9C 1USUA 3ZKDA 4UTGA 4DV6I 3OTOI 4JV5I 2NN6F 5EKWA 4QNJA 4NXME 4LCFA 1XNQI 1U2RA 2PO2A 2Z5EA 2NN6B 1IBLE 5IWAI 4LF4E 4OX9E 1NHHA 3LNUA 3QT6A 4DV7E 3D4JA 4X66E 4DPUA 2X7IA 4X62I 4AQYE 3Q1QA 4JI7I 4FW4A 4DPWA 4I3HA 3PYFA 3Q6MA 5C0XC 4B3SI 4DPXA 1R6LA 2HKJA 4MDTA 4NBQA 1N34I 1Z0EA 5JEAF 3P3EA 1P42A 1NHIA 1H72C 4KHPE 5FWKA 2J7KA 2JEAA 4JI0I 4LF5I 5DRPA 4NXNE 5JEAB 1Z0TA 4WUBA 2UXDE 4JI5I 3DD6A 4BA1B 5IWAE 1Y6ZA 3WU4A 4IS9A 2BM0A 1E3HA 1N36I 3J7AG 2Z5BA 2ZM6E 4URLA 3NZKA 2E5LI 2WP8B 4Z7YA 1S4EA 4DV3E 4U3DA 3JAMC 4AM3A 3P76A 2WNRA 2V34A 1B63A 3P06A 1ELOA 4ISAA 1ZM2A 3GCMA 4PRXA 2C39B 3PYGA 4MU0A 2HK2A 4USMA 1ZM4A 2C38A 4X64E 4JI5E 4LFAI 4DR6I 1Z5CA 4DV1I 2UUBI 4DU8A 2HFSA 3J80Q 4WUDA 1N33E 1USVA 1PVGA 5LMUI 4OO1A 1EI1A 3QT5A 4XTJA 2E5LE 4KQVA 4BA2B 3B82A 4DPYA 2UU9E 2PO0A 5K36F 2PNZB 1FWKA 5FLXQ 4DR2E 2NPFA 2UXBE 4GKKE 4NXMI 4HY1A 1UDOA 2CGEA 1VI7A 2DEIA 3PS1A 3ZZ0A 4OO1D 2WW4A 2J65A 1XNRI 1WUUA 3LTOA 4LCGA 3L7ZB 4LF8E 1YH8A 4FW5A 2O1WA 3PYEA 1HNXE 4OX9I 5LMNE 2EFGA 4DV7I 1DARA 4X66I 1UDNA 4DUYE 4LFAE 3P3CA 4AQYI 4MU1A 4DR5E 4DU7A 3ZM7A 2HK3A 2NN6A 4B3ME 1MX0A 4LFCI 4IFDC 5A2QC 2HKEA 3U1YA 1Z0GA 3Q6NA 3PS3A 2GS8A 5K36E 2LJPA 1H7UA 1Z0CA 4JI2E 4NXNI 2NN6D 2CG9A 4JI6E 1FNMA 4IFDF 4OO1E 1XNRE 1BKNA 2UXDI 3K1JA 4P52A 2V2VA 4M1KA 3HKMA 2OI2A 4DPTA 5JEAA 2BA0D 4JI3E 4IFDB 1Z59A 2O1TA 2PNLA 2ZM6I 5GMDA 5BR8E 2UUAE 4BA1A 2VF3A 4LFCE 2Z5CA 4DV3I 5ELWA 3ZKBA 4DUZE 5JEAD 4AIDA 2UXCE 3H4LA 3PS2A 3J81C 4ED4A 5C0XF 2NN6E 3KRNA 4ZVIA 5EL9A 2BA1G 4LF6E 4X64I 2PO1A 2C39A 5C0XB 2GO4A 4LFBE 4B3RE 1K47A 3ZZUA 1N33I 1UDQA 4MYUA 2PO2B 4X65E 4USKA 4GKJE 1UEKA 1MU5A 3CDJA 2UU9I 1ZM9A 3WU5A 2UUCE 4LF9E 4DR2I 2UXBI 5LL6R 2C37B 4DR3E 1RR9A 4FW3A 4GKKI 4BA2A 5JEAE 1PKPA 3K17A 4EMDA 3HJCA 3J7AM 1XMOE 3CWVA 2PNZA 2IOPA 2O1VA 4LF8I 2O1UA 4IZJB 1ZXNA 2XEXA 1I94E 1HNXI 5LMNI 1KKHA 3CDIA 4DV5E 3T1HE 5K36A 3WU3A 2JEAB 4DUYI 4FW6A 4DR5I 4DR4I
chains in the Genus database with same CATH topology
3T1YE 4B3MI 1HK7A 1VISA 2BV3A 4DR7E 3V5RA 4K0KE 3QT8A 4FW9A 2Z5BB 4JI2I 1HR0E 5IT9Q 4JI6I 1FJGE 4DXLA 1N0UA 4YY3E 4FWDA 2GQ0A 4JI3I 4DR4E 1H73A 5BR8I 2UUAI 2HFUA 4MYTA 2HHHE 4DUZI 1IBKI 4IZKB 4P7AA 2UXCI 4JI1E 3J80C 5L3JA 4N3OA 4LF6I 4RPFA 5FLXC 4HACB 4DV2E 3V2UC 2VQFE 4LFBI 4B3RI 1MG7A 1RREA 2A2DA 4X65I 4JG4A 1XMQE 1FKAE 1IBME 1J5EE 4GKJI 1ZXMA 4YHHI 2UUCI 1ZM3A 1XHKA 4LF7E 3M6AA 4LF9I 4FWHA 2F4VI 3PYDA 1EA6A 1HNZE 4DR3I 1IBKE 3ZZTA 1N32I 2ZITA 3JAMQ 4HYMA 1XMOI 4B3TE 2R3VA 4JYAE 3K85A 1I94I 1NHJA 4DV0E 4DV5I 4JI4E 5GMEA 1H74A 3T1HI 4DV4E 1Z0VA 3GONA 2Q2EB 3T1YI 4IZJA 2V2QA 4JI8E 4DR7I 1FWLA 1KVKA 4DV6E 3OTOE 4JV5E 4DR1I 4YHHE 1PIEA 1FI4A 4K0KI 2E1RA 1XNQE 2F4VE 1N32E 1HR0I 2AJ4A 4IZJD 1Z0BA 2Z5CB 1FJGI 2IOQA 4X62E 3B8HA 4JI7E 3F0NA 4YY3I 1H7SA 4PRVA 4B3SE 4UT4A 2V8PA 2PNMA 1N34E 3HULA 2HHHI 4FN5A 4JI0E 4DR1E 4FWGA 4LF5E 1Z0WA 3PRYA 2VQEI 5A2QQ 4JI1I 2BM1A 1Z5AA 1Y4UA 1Z5BA 1OJ4A 3QT7A 1HNWI 4IZKA 1KIJA 1N36E 4DV2I 2CZ9A 2VQFI 4R1FA 2X36A 4WUCA 2R42A 4HXZA 2A2CA 1QZRA 1XMQI 1IBMI 1J5EI 1N0VC 3WU6A 2DEJA 4HACA 4LF7I 1B62A 1HNZI 1IBLI 4LF4I 2V2ZA 1Y4SA 2VQEE 4B3TI 2ZBKB 4JYAI 1NZ0A 3B78A 4DR6E 1HNWE 4DV1E 2UUBE 4DV0I 4JI4I 1S16A 4DV4I 3J81Q 5LMUE 4PU9A 1D6TA 1A6FA 1KTVA 3LPSA 4JI8I 4Z7CA 4KHPI 5IT9C 1USUA 3ZKDA 4UTGA 4DV6I 3OTOI 4JV5I 4NXME 1XNQI 1U2RA 2Z5EA 1IBLE 5IWAI 4LF4E 4OX9E 1NHHA 3LNUA 3QT6A 4DV7E 3D4JA 4X66E 4DPUA 2X7IA 4X62I 4AQYE 3Q1QA 4JI7I 4DPWA 4I3HA 3PYFA 3Q6MA 4B3SI 4DPXA 2HKJA 1N34I 1Z0EA 1NHIA 1H72C 4KHPE 5FWKA 2J7KA 4JI0I 4LF5I 4NXNE 1Z0TA 4WUBA 2UXDE 4JI5I 5IWAE 1Y6ZA 3WU4A 2BM0A 1N36I 3J7AG 2Z5BA 2ZM6E 4URLA 2E5LI 4Z7YA 1S4EA 4DV3E 3JAMC 2V34A 1B63A 3P06A 1ELOA 1ZM2A 4PRXA 3PYGA 2HK2A 4USMA 1ZM4A 4JI5E 4X64E 4LFAI 4DR6I 1Z5CA 4DV1I 2UUBI 4DU8A 2HFSA 3J80Q 4WUDA 1N33E 1USVA 1PVGA 5LMUI 1EI1A 3QT5A 4XTJA 2E5LE 4KQVA 3B82A 4DPYA 2UU9E 1FWKA 5FLXQ 4DR2E 2NPFA 2UXBE 4GKKE 4NXMI 4HY1A 2CGEA 2DEIA 3ZZ0A 2WW4A 1XNRI 1WUUA 3LTOA 4LF8E 2O1WA 3PYEA 1HNXE 4OX9I 5LMNE 2EFGA 4DV7I 1DARA 4X66I 4DUYE 4LFAE 4AQYI 4DR5E 4DU7A 3ZM7A 2HK3A 4B3ME 1MX0A 4LFCI 5A2QC 2HKEA 1Z0GA 3Q6NA 2GS8A 2LJPA 1H7UA 1Z0CA 4JI2E 4NXNI 2CG9A 4JI6E 1FNMA 1XNRE 1BKNA 2UXDI 3K1JA 4P52A 2V2VA 4M1KA 4DPTA 2OI2A 4JI3E 1Z59A 2O1TA 2PNLA 2ZM6I 5GMDA 5BR8E 2UUAE 2VF3A 4LFCE 2Z5CA 4DV3I 3ZKBA 4DUZE 2UXCE 3H4LA 3J81C 4ED4A 4ZVIA 4LF6E 4X64I 4LFBE 4B3RE 1K47A 3ZZUA 1N33I 4MYUA 4X65E 4USKA 4GKJE 1UEKA 1MU5A 2UU9I 1ZM9A 3WU5A 2UUCE 4LF9E 4DR2I 2UXBI 5LL6R 4DR3E 1RR9A 4GKKI 1PKPA 3K17A 4EMDA 3HJCA 3J7AM 1XMOE 3CWVA 2IOPA 2O1VA 4LF8I 2O1UA 4IZJB 1ZXNA 2XEXA 1I94E 1HNXI 5LMNI 1KKHA 4DV5E 3T1HE 3WU3A 4DUYI 4DR5I 4DR4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y E;  4B3M I;  1VIS A;  2BV3 A;  4DR7 E;  3V5R A;  4K0K E;  3QT8 A;  4FW9 A;  4JI2 I;  1HR0 E;  5IT9 Q;  4JI6 I;  1FJG E;  4DXL A;  1N0U A;  4YY3 E;  4FWD A;  4JI3 I;  4DR4 E;  1H73 A;  5BR8 I;  2UUA I;  2HFU A;  4MYT A;  2HHH E;  4DUZ I;  1IBK I;  4P7A A;  2UXC I;  4JI1 E;  3J80 C;  5L3J A;  4LF6 I;  4RPF A;  5FLX C;  4HAC B;  4DV2 E;  3V2U C;  2VQF E;  4LFB I;  4B3R I;  1MG7 A;  1RRE A;  2A2D A;  4X65 I;  4JG4 A;  1XMQ E;  1FKA E;  1IBM E;  1J5E E;  4GKJ I;  1ZXM A;  4YHH I;  2UUC I;  1ZM3 A;  1XHK A;  4LF7 E;  3M6A A;  4LF9 I;  4FWH A;  2F4V I;  3PYD A;  1EA6 A;  1HNZ E;  4DR3 I;  1IBK E;  3ZZT A;  1N32 I;  2ZIT A;  3JAM Q;  4HYM A;  1XMO I;  4B3T E;  2R3V A;  4JYA E;  1I94 I;  1NHJ A;  4DV0 E;  4DV5 I;  4JI4 E;  5GME A;  1H74 A;  3T1H I;  4DV4 E;  1Z0V A;  3GON A;  2Q2E B;  3T1Y I;  2V2Q A;  4JI8 E;  4DR7 I;  1FWL A;  1KVK A;  4DV6 E;  3OTO E;  4JV5 E;  4DR1 I;  4YHH E;  1PIE A;  1FI4 A;  4K0K I;  2E1R A;  1XNQ E;  2F4V E;  1N32 E;  1HR0 I;  2AJ4 A;  1Z0B A;  1FJG I;  4X62 E;  3B8H A;  4JI7 E;  3F0N A;  4YY3 I;  1H7S A;  4PRV A;  4B3S E;  4UT4 A;  2V8P A;  1N34 E;  3HUL A;  2HHH I;  4FN5 A;  4JI0 E;  4DR1 E;  4FWG A;  4LF5 E;  1Z0W A;  2VQE I;  5A2Q Q;  4JI1 I;  2BM1 A;  1Z5A A;  1Z5B A;  1OJ4 A;  3QT7 A;  1HNW I;  1KIJ A;  1N36 E;  4DV2 I;  2CZ9 A;  2VQF I;  4R1F A;  2X36 A;  4WUC A;  2R42 A;  4HXZ A;  2A2C A;  1QZR A;  1XMQ I;  1IBM I;  1J5E I;  1N0V C;  3WU6 A;  2DEJ A;  4HAC A;  4LF7 I;  1B62 A;  1HNZ I;  1IBL I;  4LF4 I;  2V2Z A;  2VQE E;  4B3T I;  2ZBK B;  4JYA I;  1NZ0 A;  3B78 A;  4DR6 E;  1HNW E;  4DV1 E;  2UUB E;  4DV0 I;  4JI4 I;  1S16 A;  4DV4 I;  3J81 Q;  5LMU E;  4PU9 A;  1D6T A;  1A6F A;  1KTV A;  3LPS A;  4JI8 I;  4Z7C A;  4KHP I;  5IT9 C;  3ZKD A;  4UTG A;  4DV6 I;  3OTO I;  4JV5 I;  4NXM E;  1XNQ I;  1U2R A;  1IBL E;  5IWA I;  4LF4 E;  4OX9 E;  1NHH A;  3LNU A;  3QT6 A;  4DV7 E;  3D4J A;  4X66 E;  4DPU A;  2X7I A;  4X62 I;  4AQY E;  3Q1Q A;  4JI7 I;  4DPW A;  4I3H A;  3PYF A;  4B3S I;  4DPX A;  2HKJ A;  1N34 I;  1Z0E A;  1NHI A;  1H72 C;  4KHP E;  2J7K A;  4JI0 I;  4LF5 I;  4NXN E;  1Z0T A;  4WUB A;  2UXD E;  4JI5 I;  5IWA E;  3WU4 A;  2BM0 A;  1N36 I;  3J7A G;  2ZM6 E;  4URL A;  2E5L I;  4Z7Y A;  1S4E A;  4DV3 E;  3JAM C;  2V34 A;  1B63 A;  1ELO A;  1ZM2 A;  4PRX A;  3PYG A;  2HK2 A;  4USM A;  1ZM4 A;  4JI5 E;  4X64 E;  4LFA I;  4DR6 I;  1Z5C A;  4DV1 I;  2UUB I;  4DU8 A;  2HFS A;  3J80 Q;  4WUD A;  1N33 E;  1PVG A;  5LMU I;  1EI1 A;  2E5L E;  3QT5 A;  4XTJ A;  4KQV A;  3B82 A;  4DPY A;  2UU9 E;  1FWK A;  5FLX Q;  4DR2 E;  2NPF A;  2UXB E;  4GKK E;  4NXM I;  4HY1 A;  2DEI A;  3ZZ0 A;  2WW4 A;  1XNR I;  1WUU A;  3LTO A;  4LF8 E;  3PYE A;  1HNX E;  4OX9 I;  5LMN E;  2EFG A;  4DV7 I;  1DAR A;  4X66 I;  4DUY E;  4LFA E;  4AQY I;  4DR5 E;  4DU7 A;  3ZM7 A;  2HK3 A;  4B3M E;  1MX0 A;  4LFC I;  5A2Q C;  2HKE A;  1Z0G A;  2GS8 A;  2LJP A;  1H7U A;  1Z0C A;  4JI2 E;  4NXN I;  4JI6 E;  1FNM A;  1XNR E;  1BKN A;  2UXD I;  3K1J A;  4P52 A;  2V2V A;  4M1K A;  4DPT A;  2OI2 A;  4JI3 E;  1Z59 A;  2ZM6 I;  5GMD A;  5BR8 E;  2UUA E;  2VF3 A;  4LFC E;  4DV3 I;  3ZKB A;  4DUZ E;  2UXC E;  3H4L A;  3J81 C;  4ED4 A;  4ZVI A;  4LF6 E;  4X64 I;  4LFB E;  4B3R E;  1K47 A;  3ZZU A;  1N33 I;  4MYU A;  4X65 E;  4USK A;  4GKJ E;  1UEK A;  1MU5 A;  2UU9 I;  1ZM9 A;  3WU5 A;  2UUC E;  4LF9 E;  4DR2 I;  2UXB I;  5LL6 R;  4DR3 E;  1RR9 A;  4GKK I;  1PKP A;  3K17 A;  4EMD A;  3J7A M;  1XMO E;  3CWV A;  4LF8 I;  1ZXN A;  2XEX A;  1I94 E;  1HNX I;  5LMN I;  1KKH A;  4DV5 E;  3T1H E;  3WU3 A;  4DUY I;  4DR5 I;  4DR4 I; 
#chains in the Genus database with same CATH topology
 3T1Y E;  4B3M I;  4QNK A;  1HK7 A;  1VIS A;  2BV3 A;  4DR7 E;  2GO3 A;  2IER A;  3V5R A;  4LOM A;  4K0K E;  5K36 D;  3QT8 A;  4MU3 A;  2BR2 B;  2JT2 A;  4FW9 A;  2Z5B B;  4JI2 I;  1HR0 E;  5IT9 Q;  2JE6 B;  4JI6 I;  1FJG E;  4J3D A;  1OYP A;  4OO1 C;  4DXL A;  1N0U A;  4YY3 E;  1YHC A;  4FWD A;  2GQ0 A;  4JI3 I;  4DR4 E;  1H73 A;  5BR8 I;  2UUA I;  2HFU A;  4MYT A;  4LPF A;  2HHH E;  3M85 G;  5DNX A;  4IFD A;  4DUZ I;  1IBK I;  4FW7 A;  4IZK B;  4OZE A;  4P7A A;  2UXC I;  4JI1 E;  3J80 C;  5L3J A;  4N3O A;  4LF6 I;  4RPF A;  5FLX C;  2CVE A;  4MQY A;  4HAC B;  4DV2 E;  3V2U C;  3UHM A;  2VQF E;  4LFB I;  4B3R I;  1MG7 A;  1RRE A;  2JEB B;  2A2D A;  4X65 I;  4JG4 A;  1XMQ E;  1FKA E;  1IBM E;  1J5E E;  4GKJ I;  3P3G A;  4MU4 A;  2O3Z A;  1ZXM A;  4YHH I;  2UUC I;  1ZM3 A;  1XHK A;  5C0X A;  4LF7 E;  3M6A A;  4LF9 I;  4FWH A;  2F4V I;  3PYD A;  4U3B A;  1EA6 A;  1HNZ E;  4DR3 I;  1IBK E;  3ZZT A;  1N32 I;  2WP8 A;  2ZIT A;  3JAM Q;  4HYM A;  1XMO I;  4B3T E;  5JEA C;  1E3P A;  2R3V A;  4JYA E;  2C37 A;  3K85 A;  5C0X D;  1I94 I;  1NHJ A;  4DV0 E;  4DV5 I;  4JI4 E;  5GME A;  1H74 A;  4LCH A;  3T1H I;  4DV4 E;  1Z0V A;  4IFD E;  3GON A;  3B4T A;  2Q2E B;  1Y60 A;  3T1Y I;  4IZJ A;  2V2Q A;  4JI8 E;  4DR7 I;  1FWL A;  4AIM A;  1KVK A;  4DV6 E;  3OTO E;  4JV5 E;  4DR1 I;  4YHH E;  4GQU A;  1PIE A;  1FI4 A;  4K0K I;  2E1R A;  2BA1 D;  3H1C A;  1XNQ E;  2F4V E;  1N32 E;  1HR0 I;  2AJ4 A;  4IZJ D;  1Z0B A;  4OKG A;  2Z5C B;  5DRR A;  2AE8 A;  1FJG I;  2IOQ A;  2BR2 A;  1RHY A;  4X62 E;  3B8H A;  4JI7 E;  5C0X E;  3F0N A;  4YY3 I;  1H7S A;  1OYS A;  4PRV A;  4B3S E;  4UT4 A;  2JE6 A;  1XXE A;  2V8P A;  2PNM A;  1UDS A;  3L7Z A;  1N34 E;  3HUL A;  2HHH I;  4FN5 A;  4JI0 E;  4DR1 E;  2PO1 B;  4FWG A;  3GLL A;  4LF5 E;  3M7N G;  1Z0W A;  3PRY A;  2VQE I;  5A2Q Q;  4JI1 I;  1OYR A;  3GME A;  2BM1 A;  5K36 C;  1Z5A A;  1Y4U A;  1Z5B A;  1OJ4 A;  3QT7 A;  1HNW I;  4IZK A;  1KIJ A;  3U1K A;  1N36 E;  2WNR B;  5DRQ A;  4DV2 I;  5DNL A;  2CZ9 A;  2VQF I;  3M7N D;  4R1F A;  2X36 A;  4WUC A;  2R42 A;  4HXZ A;  2A2C A;  1QZR A;  1XMQ I;  1IBM I;  1J5E I;  1N0V C;  3WU6 A;  2DEJ A;  4HAC A;  4LF7 I;  4OO1 F;  5K36 B;  2C38 B;  1B62 A;  2JEB A;  2F1D A;  1HNZ I;  1IBL I;  4LF4 I;  2V2Z A;  1Y4S A;  2VQE E;  4B3T I;  1R6M A;  4OO1 B;  2ZBK B;  4JYA I;  1NZ0 A;  3B78 A;  4DR6 E;  2PO0 B;  1HNW E;  4DV1 E;  2UUB E;  4DV0 I;  2NN6 C;  4JI4 I;  1S16 A;  2IES A;  4DV4 I;  4IFD D;  3J81 Q;  3M85 D;  5LMU E;  4PU9 A;  1D6T A;  1A6F A;  1KTV A;  5DRO A;  3LPS A;  2VES A;  4JI8 I;  2BA0 G;  4Z7C A;  4KHP I;  1Y5Y A;  5IT9 C;  1USU A;  3ZKD A;  4UTG A;  4DV6 I;  3OTO I;  4JV5 I;  2NN6 F;  5EKW A;  4QNJ A;  4NXM E;  4LCF A;  1XNQ I;  1U2R A;  2PO2 A;  2Z5E A;  2NN6 B;  1IBL E;  5IWA I;  4LF4 E;  4OX9 E;  1NHH A;  3LNU A;  3QT6 A;  4DV7 E;  3D4J A;  4X66 E;  4DPU A;  2X7I A;  4X62 I;  4AQY E;  3Q1Q A;  4JI7 I;  4FW4 A;  4DPW A;  4I3H A;  3PYF A;  3Q6M A;  5C0X C;  4B3S I;  4DPX A;  1R6L A;  2HKJ A;  4MDT A;  4NBQ A;  1N34 I;  1Z0E A;  5JEA F;  3P3E A;  1P42 A;  1NHI A;  1H72 C;  4KHP E;  5FWK A;  2J7K A;  2JEA A;  4JI0 I;  4LF5 I;  5DRP A;  4NXN E;  5JEA B;  1Z0T A;  4WUB A;  2UXD E;  4JI5 I;  3DD6 A;  4BA1 B;  5IWA E;  1Y6Z A;  3WU4 A;  4IS9 A;  2BM0 A;  1E3H A;  1N36 I;  3J7A G;  2Z5B A;  2ZM6 E;  4URL A;  3NZK A;  2E5L I;  2WP8 B;  4Z7Y A;  1S4E A;  4DV3 E;  4U3D A;  3JAM C;  4AM3 A;  3P76 A;  2WNR A;  2V34 A;  1B63 A;  3P06 A;  1ELO A;  4ISA A;  1ZM2 A;  3GCM A;  4PRX A;  2C39 B;  3PYG A;  4MU0 A;  2HK2 A;  4USM A;  1ZM4 A;  2C38 A;  4X64 E;  4JI5 E;  4LFA I;  4DR6 I;  1Z5C A;  4DV1 I;  2UUB I;  4DU8 A;  2HFS A;  3J80 Q;  4WUD A;  1N33 E;  1USV A;  1PVG A;  5LMU I;  4OO1 A;  1EI1 A;  3QT5 A;  4XTJ A;  2E5L E;  4KQV A;  4BA2 B;  3B82 A;  4DPY A;  2UU9 E;  2PO0 A;  5K36 F;  2PNZ B;  1FWK A;  5FLX Q;  4DR2 E;  2NPF A;  2UXB E;  4GKK E;  4NXM I;  4HY1 A;  1UDO A;  2CGE A;  1VI7 A;  2DEI A;  3PS1 A;  3ZZ0 A;  4OO1 D;  2WW4 A;  2J65 A;  1XNR I;  1WUU A;  3LTO A;  4LCG A;  3L7Z B;  4LF8 E;  1YH8 A;  4FW5 A;  2O1W A;  3PYE A;  1HNX E;  4OX9 I;  5LMN E;  2EFG A;  4DV7 I;  1DAR A;  4X66 I;  1UDN A;  4DUY E;  4LFA E;  3P3C A;  4AQY I;  4MU1 A;  4DR5 E;  4DU7 A;  3ZM7 A;  2HK3 A;  2NN6 A;  4B3M E;  1MX0 A;  4LFC I;  4IFD C;  5A2Q C;  2HKE A;  3U1Y A;  1Z0G A;  3Q6N A;  3PS3 A;  2GS8 A;  5K36 E;  2LJP A;  1H7U A;  1Z0C A;  4JI2 E;  4NXN I;  2NN6 D;  2CG9 A;  4JI6 E;  1FNM A;  4IFD F;  4OO1 E;  1XNR E;  1BKN A;  2UXD I;  3K1J A;  4P52 A;  2V2V A;  4M1K A;  3HKM A;  2OI2 A;  4DPT A;  5JEA A;  2BA0 D;  4JI3 E;  4IFD B;  1Z59 A;  2O1T A;  2PNL A;  2ZM6 I;  5GMD A;  5BR8 E;  2UUA E;  4BA1 A;  2VF3 A;  4LFC E;  2Z5C A;  4DV3 I;  5ELW A;  3ZKB A;  4DUZ E;  5JEA D;  4AID A;  2UXC E;  3H4L A;  3PS2 A;  3J81 C;  4ED4 A;  5C0X F;  2NN6 E;  3KRN A;  4ZVI A;  5EL9 A;  2BA1 G;  4LF6 E;  4X64 I;  2PO1 A;  2C39 A;  5C0X B;  2GO4 A;  4LFB E;  4B3R E;  1K47 A;  3ZZU A;  1N33 I;  1UDQ A;  4MYU A;  2PO2 B;  4X65 E;  4USK A;  4GKJ E;  1UEK A;  1MU5 A;  3CDJ A;  2UU9 I;  1ZM9 A;  3WU5 A;  2UUC E;  4LF9 E;  4DR2 I;  2UXB I;  5LL6 R;  2C37 B;  4DR3 E;  1RR9 A;  4FW3 A;  4GKK I;  4BA2 A;  5JEA E;  1PKP A;  3K17 A;  4EMD A;  3HJC A;  3J7A M;  1XMO E;  3CWV A;  2PNZ A;  2IOP A;  2O1V A;  4LF8 I;  2O1U A;  4IZJ B;  1ZXN A;  2XEX A;  1I94 E;  1HNX I;  5LMN I;  1KKH A;  3CDI A;  4DV5 E;  3T1H E;  5K36 A;  3WU3 A;  2JEA B;  4DUY I;  4FW6 A;  4DR5 I;  4DR4 I; 
#chains in the Genus database with same CATH homology
 3T1Y E;  4B3M I;  1HK7 A;  1VIS A;  2BV3 A;  4DR7 E;  3V5R A;  4K0K E;  3QT8 A;  4FW9 A;  2Z5B B;  4JI2 I;  1HR0 E;  5IT9 Q;  4JI6 I;  1FJG E;  4DXL A;  1N0U A;  4YY3 E;  4FWD A;  2GQ0 A;  4JI3 I;  4DR4 E;  1H73 A;  5BR8 I;  2UUA I;  2HFU A;  4MYT A;  2HHH E;  4DUZ I;  1IBK I;  4IZK B;  4P7A A;  2UXC I;  4JI1 E;  3J80 C;  5L3J A;  4N3O A;  4LF6 I;  4RPF A;  5FLX C;  4HAC B;  4DV2 E;  3V2U C;  2VQF E;  4LFB I;  4B3R I;  1MG7 A;  1RRE A;  2A2D A;  4X65 I;  4JG4 A;  1XMQ E;  1FKA E;  1IBM E;  1J5E E;  4GKJ I;  1ZXM A;  4YHH I;  2UUC I;  1ZM3 A;  1XHK A;  4LF7 E;  3M6A A;  4LF9 I;  4FWH A;  2F4V I;  3PYD A;  1EA6 A;  1HNZ E;  4DR3 I;  1IBK E;  3ZZT A;  1N32 I;  2ZIT A;  3JAM Q;  4HYM A;  1XMO I;  4B3T E;  2R3V A;  4JYA E;  3K85 A;  1I94 I;  1NHJ A;  4DV0 E;  4DV5 I;  4JI4 E;  5GME A;  1H74 A;  3T1H I;  4DV4 E;  1Z0V A;  3GON A;  2Q2E B;  3T1Y I;  4IZJ A;  2V2Q A;  4JI8 E;  4DR7 I;  1FWL A;  1KVK A;  4DV6 E;  3OTO E;  4JV5 E;  4DR1 I;  4YHH E;  1PIE A;  1FI4 A;  4K0K I;  2E1R A;  1XNQ E;  2F4V E;  1N32 E;  1HR0 I;  2AJ4 A;  4IZJ D;  1Z0B A;  2Z5C B;  1FJG I;  2IOQ A;  4X62 E;  3B8H A;  4JI7 E;  3F0N A;  4YY3 I;  1H7S A;  4PRV A;  4B3S E;  4UT4 A;  2V8P A;  2PNM A;  1N34 E;  3HUL A;  2HHH I;  4FN5 A;  4JI0 E;  4DR1 E;  4FWG A;  4LF5 E;  1Z0W A;  3PRY A;  2VQE I;  5A2Q Q;  4JI1 I;  2BM1 A;  1Z5A A;  1Y4U A;  1Z5B A;  1OJ4 A;  3QT7 A;  1HNW I;  4IZK A;  1KIJ A;  1N36 E;  4DV2 I;  2CZ9 A;  2VQF I;  4R1F A;  2X36 A;  4WUC A;  2R42 A;  4HXZ A;  2A2C A;  1QZR A;  1XMQ I;  1IBM I;  1J5E I;  1N0V C;  3WU6 A;  2DEJ A;  4HAC A;  4LF7 I;  1B62 A;  1HNZ I;  1IBL I;  4LF4 I;  2V2Z A;  1Y4S A;  2VQE E;  4B3T I;  2ZBK B;  4JYA I;  1NZ0 A;  3B78 A;  4DR6 E;  1HNW E;  4DV1 E;  2UUB E;  4DV0 I;  4JI4 I;  1S16 A;  4DV4 I;  3J81 Q;  5LMU E;  4PU9 A;  1D6T A;  1A6F A;  1KTV A;  3LPS A;  4JI8 I;  4Z7C A;  4KHP I;  5IT9 C;  1USU A;  3ZKD A;  4UTG A;  4DV6 I;  3OTO I;  4JV5 I;  4NXM E;  1XNQ I;  1U2R A;  2Z5E A;  1IBL E;  5IWA I;  4LF4 E;  4OX9 E;  1NHH A;  3LNU A;  3QT6 A;  4DV7 E;  3D4J A;  4X66 E;  4DPU A;  2X7I A;  4X62 I;  4AQY E;  3Q1Q A;  4JI7 I;  4DPW A;  4I3H A;  3PYF A;  3Q6M A;  4B3S I;  4DPX A;  2HKJ A;  1N34 I;  1Z0E A;  1NHI A;  1H72 C;  4KHP E;  5FWK A;  2J7K A;  4JI0 I;  4LF5 I;  4NXN E;  1Z0T A;  4WUB A;  2UXD E;  4JI5 I;  5IWA E;  1Y6Z A;  3WU4 A;  2BM0 A;  1N36 I;  3J7A G;  2Z5B A;  2ZM6 E;  4URL A;  2E5L I;  4Z7Y A;  1S4E A;  4DV3 E;  3JAM C;  2V34 A;  1B63 A;  3P06 A;  1ELO A;  1ZM2 A;  4PRX A;  3PYG A;  2HK2 A;  4USM A;  1ZM4 A;  4JI5 E;  4X64 E;  4LFA I;  4DR6 I;  1Z5C A;  4DV1 I;  2UUB I;  4DU8 A;  2HFS A;  3J80 Q;  4WUD A;  1N33 E;  1USV A;  1PVG A;  5LMU I;  1EI1 A;  3QT5 A;  4XTJ A;  2E5L E;  4KQV A;  3B82 A;  4DPY A;  2UU9 E;  1FWK A;  5FLX Q;  4DR2 E;  2NPF A;  2UXB E;  4GKK E;  4NXM I;  4HY1 A;  2CGE A;  2DEI A;  3ZZ0 A;  2WW4 A;  1XNR I;  1WUU A;  3LTO A;  4LF8 E;  2O1W A;  3PYE A;  1HNX E;  4OX9 I;  5LMN E;  2EFG A;  4DV7 I;  1DAR A;  4X66 I;  4DUY E;  4LFA E;  4AQY I;  4DR5 E;  4DU7 A;  3ZM7 A;  2HK3 A;  4B3M E;  1MX0 A;  4LFC I;  5A2Q C;  2HKE A;  1Z0G A;  3Q6N A;  2GS8 A;  2LJP A;  1H7U A;  1Z0C A;  4JI2 E;  4NXN I;  2CG9 A;  4JI6 E;  1FNM A;  1XNR E;  1BKN A;  2UXD I;  3K1J A;  4P52 A;  2V2V A;  4M1K A;  4DPT A;  2OI2 A;  4JI3 E;  1Z59 A;  2O1T A;  2PNL A;  2ZM6 I;  5GMD A;  5BR8 E;  2UUA E;  2VF3 A;  4LFC E;  2Z5C A;  4DV3 I;  3ZKB A;  4DUZ E;  2UXC E;  3H4L A;  3J81 C;  4ED4 A;  4ZVI A;  4LF6 E;  4X64 I;  4LFB E;  4B3R E;  1K47 A;  3ZZU A;  1N33 I;  4MYU A;  4X65 E;  4USK A;  4GKJ E;  1UEK A;  1MU5 A;  2UU9 I;  1ZM9 A;  3WU5 A;  2UUC E;  4LF9 E;  4DR2 I;  2UXB I;  5LL6 R;  4DR3 E;  1RR9 A;  4GKK I;  1PKP A;  3K17 A;  4EMD A;  3HJC A;  3J7A M;  1XMO E;  3CWV A;  2IOP A;  2O1V A;  4LF8 I;  2O1U A;  4IZJ B;  1ZXN A;  2XEX A;  1I94 E;  1HNX I;  5LMN I;  1KKH A;  4DV5 E;  3T1H E;  3WU3 A;  4DUY I;  4DR5 I;  4DR4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...