4DR6I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr6I00
1Z0GA 1Z0WA 1NHJA 4JYAE 4R1FA 3WU3A 4LFCE 1Z0VA 4B3RE 1IBLI 4X66E 2UXDI 2V34A 4JI2I 2R3VA 1N34I 3JAMQ 4X65I 2X7IA 4DV2I 4LFBE 4YY3I 2E5LE 2UUAI 3J81Q 4X65E 1J5EI 1N0UA 4DR1E 2UUCI 1WUUA 3F0NA 5LMUE 1HNWI 1I94E 4X62E 4AQYE 4GKKI 1D6TA 4MYTA 4LF5E 4FW9A 4P52A 4JI6E 4K0KE 2UU9I 3T1HE 4YHHI 3J7AM 3WU6A 4JI8I 3V2UC 2Q2EB 3JAMC 1PKPA 1Z0EA 2DEJA 3ZZTA 4X64E 3HULA 1XHKA 1XNQI 4B3TI 3T1HI 3H4LA 4HYMA 5IWAI 3LTOA 1MX0A 2AJ4A 1FJGE 4DR7E 4DV6E 4MYUA 2V2QA 1NHHA 4URLA 4DR2I 3PYDA 3J7AG 4KHPE 3V5RA 1OJ4A 2UXCE 4JV5I 2OI2A 2EFGA 2BV3A 1FJGI 4DU8A 1ELOA 4OX9I 1FNMA 3B8HA 4UTGA 3GONA 1HNXI 1IBLE 4DPXA 1Z5BA 1MG7A 4X62I 4DV0I 2R42A 4B3TE 1S4EA 3K1JA 5BR8I 4WUBA 4XTJA 1H72C 4Z7CA 2F4VE 5A2QC 4DV1I 2E1RA 4LF8I 4WUCA 2LJPA 4I3HA 3ZKBA 4USMA 1H73A 1FWLA 3PYGA 4JI1E 2ZBKB 1H7SA 4USKA 5LMUI 4B3SI 2GS8A 2WW4A 4DV5E 4DV1E 1DARA 4LF6I 1ZXMA 2ZITA 1N33I 2ZM6I 4B3RI 4PRVA 1ZM3A 4JI0E 4WUDA 4M1KA 4JI4E 2BM0A 4LF4I 4DR2E 4DR6E 5FLXQ 2VQFI 1I94I 1EA6A 5LL6R 4DV7I 3ZKDA 2ZM6E 3D4JA 1EI1A 4DR5E 2HFSA 1IBKE 3PYEA 4DR4I 4HY1A 4JV5E 5LMNE 1N32I 1IBKI 1HNZE 4LF9I 4KQVA 1B63A 4B3MI 1U2RA 4Z7YA 3WU5A 1XMOE 4NXMI 1IBMI 4HACA 2HKJA 4JI5E 3QT6A 1N33E 1QZRA 2V2VA 1A6FA 1Z0CA 3PYFA 2UXBI 4DV7E 5BR8E 2VQEI 3ZZUA 3WU4A 1Z0TA 2HK2A 2UXBE 1Z59A 1N36E 4KHPI 4DPYA 2UXDE 1KTVA 1NZ0A 2V8PA 1KVKA 1PIEA 5L3JA 1B62A 2VQEE 2XEXA 4LF7I 1VISA 1Z5CA 1H74A 1HNXE 1XNRE 3QT5A 4B3ME 4DV5I 1H7UA 1FKAE 4FWHA 1N32E 1IBME 3OTOI 1KIJA 1ZXNA 4JYAI 3QT8A 4JI0I 4LF9E 2UU9E 4DR3E 4LF8E 1BKNA 4NXNE 4ZVIA 1XMQE 4JI5I 4JI3I 4OX9E 1PVGA 5A2QQ 4DXLA 1FWKA 2HK3A 4FWDA 2DEIA 5IT9Q 2HHHE 1XMQI 4DV2E 3LPSA 1XNQE 4DV4E 1NHIA 2UUAE 4DUYI 4DV0E 4LF5I 2V2ZA 4UT4A 4DV6I 4FN5A 5FLXC 4PRXA 4JI4I 3CWVA 4DR6I 1MU5A 3ZM7A 2UXCI 2X36A 2F4VI 4LF7E 4DPUA 3OTOE 4DU7A 3B78A 4YY3E 2A2DA 3T1YI 3K17A 4JI8E 1XNRI 4JI2E 1J5EE 4LF4E 3J80Q 5IT9C 3J81C 1Z5AA 4LFAI 1RREA 4DPTA 1KKHA 2VF3A 3B82A 4PU9A 4GKJE 1N36I 4DPWA 4YHHE 4JI7I 1ZM9A 1ZM4A 4HACB 3ZZ0A 1ZM2A 4NXME 3LNUA 4JI7E 4LFAE 4DV3I 3Q1QA 4GKJI 4K0KI 1HR0E 4DUZI 5IWAE 2UUBE 4ED4A 1S16A 1HR0I 4P7AA 4DR5I 2UUCE 1N34E 4EMDA 4DV3E 4X64I 2HHHI 2CZ9A 5LMNI 1Z0BA 2E5LI 1K47A 4HXZA 4NXNI 2UUBI 4DUZE 4DR1I 2A2CA 4X66I 2HFUA 4AQYI 4GKKE 4RPFA 5GMEA 1RR9A 4LFBI 4JG4A 4LFCI 4DUYE 4JI1I 2J7KA 1XMOI 4LF6E 3M6AA 2BM1A 3T1YE 1N0VC 4B3SE 1FI4A 4JI3E 4DR4E 5GMDA 4DR3I 2VQFE 2NPFA 1HNZI 2HKEA 4FWGA 4DV4I 4JI6I 4DR7I 3QT7A 1HNWE 3J80C 1UEKA
chains in the Genus database with same CATH superfamily
1Z0GA 2GO3A 1Z0WA 1NHJA 4JYAE 4R1FA 3WU3A 3P06A 4LFCE 2GO4A 1Z0VA 2NN6B 3GLLA 4B3RE 3Q6NA 2J65A 4OZEA 4BA1A 1IBLI 4X66E 2JEAA 2UXDI 1Y4UA 2V34A 4JI2I 3CDJA 2R3VA 1N34I 3JAMQ 4X65I 2X7IA 4DV2I 4LFBE 4YY3I 4BA2B 2E5LE 2UUAI 1Y5YA 3J81Q 4X65E 1P42A 1J5EI 1N0UA 4DR1E 2UUCI 1WUUA 3F0NA 5LMUE 3P76A 1HNWI 1I94E 4X62E 4AQYE 2O3ZA 4GKKI 2CGEA 1D6TA 4MYTA 5K36C 4LF5E 2C38A 4FW9A 4OO1B 4P52A 2O1WA 4JI6E 4K0KE 1Y4SA 2UU9I 3T1HE 1XXEA 4YHHI 3M85D 2Z5EA 3J7AM 3WU6A 4JI8I 1OYSA 5JEAF 3V2UC 2Q2EB 3JAMC 1PKPA 1Z0EA 4IZJA 2DEJA 3ZZTA 4X64E 5C0XB 3HULA 4IS9A 1XHKA 1XNQI 2IESA 4B3TI 3T1HI 4U3DA 2O1TA 3H4LA 4HYMA 5IWAI 3LTOA 1MX0A 2AJ4A 1FJGE 4DR7E 4DV6E 4MYUA 5DNLA 2V2QA 2BA1D 1NHHA 1Y60A 4URLA 4DR2I 2PNZB 3PYDA 3J7AG 2NN6D 3V5RA 4KHPE 1OJ4A 2UXCE 3PS3A 4AM3A 4JV5I 2OI2A 5JEAB 2EFGA 2CG9A 2BV3A 4MDTA 5FWKA 1FJGI 4DU8A 1ELOA 4OX9I 3M7NG 1FNMA 2PNLA 3B8HA 4UTGA 3GONA 3U1KA 1HNXI 2BR2B 1IBLE 4OO1E 4N3OA 4DPXA 1Z5BA 2NN6A 1MG7A 4X62I 1VI7A 3GMEA 2BA0G 4QNJA 4DV0I 2R42A 2O1VA 4B3TE 1S4EA 3K1JA 3KRNA 1YH8A 2WNRA 5BR8I 4WUBA 4XTJA 1H72C 4IFDB 2PO0A 4Z7CA 2F4VE 2WNRB 5A2QC 4DV1I 2E1RA 4LF8I 2GQ0A 2LJPA 4WUCA 4I3HA 3ZKBA 4USMA 1H73A 1FWLA 3PYGA 4JI1E 2ZBKB 1H7SA 5DRQA 4IZKA 5K36D 4USKA 5LMUI 4B3SI 5JEAE 2GS8A 2WW4A 4OO1D 4DV5E 5DRRA 4DV1E 1DARA 4LF6I 4IZKB 2IERA 1ZXMA 2ZITA 1N33I 5JEAA 2ZM6I 4B3RI 2C37B 4PRVA 1ZM3A 4JI0E 4WUDA 2JEBB 4M1KA 4FW4A 4JI4E 2BM0A 4LF4I 4DR2E 4DR6E 2NN6E 5FLXQ 2JEBA 2VQFI 1I94I 1HK7A 5LL6R 1EA6A 2C39B 2CVEA 4DV7I 3ZKDA 2ZM6E 4MQYA 5K36B 3D4JA 1EI1A 4NBQA 2PO2A 1OYRA 4MU4A 4DR5E 2HFSA 2JEAB 1IBKE 5DRPA 3PYEA 4DR4I 4IZJB 4HY1A 4JV5E 5LMNE 1N32I 1IBKI 1HNZE 4LF9I 2PNMA 4FW7A 1B63A 4KQVA 4B3MI 1U2RA 5JEAD 4LOMA 4Z7YA 3WU5A 3M85G 4OO1C 1XMOE 4NXMI 3HJCA 1IBMI 4J3DA 4HACA 2HKJA 4JI5E 2Z5CA 3QT6A 1N33E 1QZRA 2V2VA 1A6FA 1Z0CA 2F1DA 3PYFA 5DNXA 4AIMA 2UXBI 4FW6A 5BR8E 2VQEI 4DV7E 3B4TA 1USUA 3ZZUA 3U1YA 3GCMA 2BR2A 3WU4A 1Z0TA 2HK2A 2UXBE 1Z59A 5ELWA 1N36E 4KHPI 4DPYA 2WP8A 2BA1G 2UXDE 5EL9A 1KTVA 1NZ0A 1R6LA 2V8PA 1KVKA 1PIEA 5L3JA 1UDOA 4OO1A 1B62A 2PO1A 2VQEE 2XEXA 4LF7I 4FW3A 1VISA 1Z5CA 1H74A 1HNXE 1XNRE 3QT5A 2C38B 4DV5I 4B3ME 1H7UA 1FKAE 4FWHA 1N32E 1IBME 3OTOI 1KIJA 1ZXNA 3PS2A 4JYAI 1OYPA 3QT8A 4JI0I 4LF9E 2UU9E 4OKGA 4DR3E 4LF8E 3P3EA 1BKNA 4NXNE 4ZVIA 1XMQE 4JI5I 4JI3I 4OX9E 1PVGA 4BA1B 5A2QQ 3HKMA 4DXLA 1FWKA 4FWDA 2HK3A 2DEIA 1USVA 5IT9Q 2HHHE 2NN6C 4DV2E 2JT2A 1XMQI 3LPSA 1XNQE 4DV4E 1NHIA 4IFDE 2UUAE 4AIDA 4DUYI 4DV0E 4LF5I 2V2ZA 4LCHA 4UT4A 4DV6I 4FN5A 5FLXC 4PRXA 4JI4I 4ISAA 3CWVA 4DR6I 1MU5A 1R6MA 3ZM7A 2UXCI 2X36A 4QNKA 2F4VI 4LF7E 4DPUA 3OTOE 2AE8A 2Z5BB 4DU7A 3B78A 4MU3A 4YY3E 2A2DA 3T1YI 3K17A 4JI8E 1XNRI 4JI2E 1J5EE 4LF4E 3J80Q 5IT9C 3J81C 4LCFA 1YHCA 1Z5AA 3DD6A 4LFAI 1RREA 3PS1A 4DPTA 5C0XC 1KKHA 5C0XD 2VF3A 3B82A 4PU9A 4GKJE 3UHMA 1N36I 2O1UA 4DPWA 4YHHE 4JI7I 1ZM9A 5C0XE 1ZM4A 2VESA 4OO1F 5JEAC 5K36F 2PNZA 4HACB 3ZZ0A 1Y6ZA 1ZM2A 4NXME 3LNUA 4JI7E 4LFAE 1E3PA 4LCGA 4DV3I 3L7ZA 2PO1B 3Q1QA 4GKJI 4K0KI 2C37A 1HR0E 3PRYA 2JE6B 4DUZI 1E3HA 2PO2B 5IWAE 5C0XA 2UUBE 4ED4A 1S16A 1HR0I 3H1CA 4P7AA 4DR5I 2UUCE 1N34E 4EMDA 3CDIA 4DV3E 4X64I 4IFDC 2HHHI 2CZ9A 5LMNI 2C39A 5EKWA 1Z0BA 2E5LI 1K47A 4GQUA 4HXZA 5K36A 4NXNI 3K85A 2UUBI 4DUZE 4DR1I 2A2CA 2Z5CB 3L7ZB 4X66I 2HFUA 4IFDA 4AQYI 4GKKE 1UDNA 4RPFA 5GMEA 4FW5A 1RR9A 4LFBI 3P3GA 4JG4A 4LFCI 3Q6MA 2BA0D 4DUYE 4JI1I 4MU1A 2J7KA 4LPFA 4IFDF 1XMOI 4BA2A 4LF6E 3M6AA 2BM1A 3T1YE 4IFDD 2NN6F 1N0VC 5K36E 4B3SE 2WP8B 1FI4A 5C0XF 3M7ND 4JI3E 2IOQA 4DR4E 2IOPA 5DROA 2JE6A 2Z5BA 5GMDA 4DR3I 2VQFE 2NPFA 1HNZI 1UDSA 2HKEA 4FWGA 4DV4I 1UDQA 4JI6I 4DR7I 1RHYA 3QT7A 1HNWE 4MU0A 2PO0B 4U3BA 3J80C 3P3CA 1UEKA 3NZKA 4IZJD
chains in the Genus database with same CATH topology
1Z0GA 1Z0WA 1NHJA 4JYAE 4R1FA 3WU3A 3P06A 4LFCE 1Z0VA 4B3RE 3Q6NA 1IBLI 4X66E 2UXDI 1Y4UA 2V34A 4JI2I 2R3VA 1N34I 3JAMQ 4X65I 2X7IA 4DV2I 4LFBE 4YY3I 2E5LE 2UUAI 3J81Q 4X65E 1J5EI 1N0UA 4DR1E 2UUCI 1WUUA 3F0NA 5LMUE 1HNWI 1I94E 4X62E 4AQYE 4GKKI 2CGEA 1D6TA 4MYTA 4LF5E 4FW9A 4P52A 2O1WA 4JI6E 4K0KE 1Y4SA 2UU9I 3T1HE 4YHHI 2Z5EA 3J7AM 3WU6A 4JI8I 3V2UC 2Q2EB 3JAMC 1PKPA 1Z0EA 4IZJA 2DEJA 3ZZTA 4X64E 3HULA 1XHKA 1XNQI 4B3TI 3T1HI 2O1TA 3H4LA 4HYMA 5IWAI 3LTOA 1MX0A 2AJ4A 1FJGE 4DR7E 4DV6E 4MYUA 2V2QA 1NHHA 4URLA 4DR2I 3PYDA 3J7AG 4KHPE 3V5RA 1OJ4A 2UXCE 4JV5I 2OI2A 2EFGA 2CG9A 2BV3A 5FWKA 1FJGI 4DU8A 1ELOA 4OX9I 1FNMA 2PNLA 3B8HA 4UTGA 3GONA 1HNXI 1IBLE 4N3OA 4DPXA 1Z5BA 1MG7A 4X62I 4DV0I 2R42A 2O1VA 4B3TE 1S4EA 3K1JA 5BR8I 4WUBA 4XTJA 1H72C 4Z7CA 2F4VE 5A2QC 4DV1I 2E1RA 4LF8I 2GQ0A 2LJPA 4WUCA 4I3HA 3ZKBA 4USMA 1H73A 1FWLA 3PYGA 4JI1E 2ZBKB 1H7SA 4IZKA 4USKA 5LMUI 4B3SI 2GS8A 2WW4A 4DV5E 4DV1E 1DARA 4LF6I 4IZKB 1ZXMA 2ZITA 1N33I 2ZM6I 4B3RI 4PRVA 1ZM3A 4JI0E 4WUDA 4M1KA 4JI4E 2BM0A 4LF4I 4DR2E 4DR6E 5FLXQ 2VQFI 1I94I 1HK7A 1EA6A 5LL6R 4DV7I 3ZKDA 2ZM6E 3D4JA 1EI1A 4DR5E 2HFSA 1IBKE 3PYEA 4DR4I 4IZJB 4HY1A 4JV5E 5LMNE 1N32I 1IBKI 1HNZE 4LF9I 2PNMA 4KQVA 1B63A 4B3MI 1U2RA 4Z7YA 3WU5A 1XMOE 4NXMI 3HJCA 1IBMI 4HACA 2HKJA 4JI5E 2Z5CA 3QT6A 1N33E 1QZRA 2V2VA 1A6FA 1Z0CA 3PYFA 2UXBI 4DV7E 5BR8E 2VQEI 1USUA 3ZZUA 3WU4A 1Z0TA 2HK2A 2UXBE 1Z59A 1N36E 4KHPI 4DPYA 2UXDE 1KTVA 1NZ0A 2V8PA 1KVKA 1PIEA 5L3JA 1B62A 2VQEE 2XEXA 4LF7I 1VISA 1Z5CA 1H74A 1HNXE 1XNRE 3QT5A 4B3ME 4DV5I 1H7UA 1FKAE 4FWHA 1N32E 1IBME 3OTOI 1KIJA 1ZXNA 4JYAI 3QT8A 4JI0I 4LF9E 2UU9E 4DR3E 4LF8E 1BKNA 4NXNE 4ZVIA 1XMQE 4JI5I 4JI3I 4OX9E 1PVGA 5A2QQ 4DXLA 1FWKA 2HK3A 4FWDA 2DEIA 1USVA 5IT9Q 2HHHE 1XMQI 4DV2E 3LPSA 1XNQE 4DV4E 1NHIA 2UUAE 4DUYI 4DV0E 4LF5I 2V2ZA 4UT4A 4DV6I 4FN5A 5FLXC 4PRXA 4JI4I 3CWVA 4DR6I 1MU5A 3ZM7A 2UXCI 2X36A 2F4VI 4LF7E 4DPUA 3OTOE 2Z5BB 4DU7A 3B78A 4YY3E 2A2DA 3T1YI 3K17A 4JI8E 1XNRI 4JI2E 1J5EE 4LF4E 3J80Q 5IT9C 3J81C 1Z5AA 4LFAI 1RREA 4DPTA 1KKHA 2VF3A 3B82A 4PU9A 4GKJE 1N36I 2O1UA 4DPWA 4YHHE 4JI7I 1ZM9A 1ZM4A 4HACB 3ZZ0A 1Y6ZA 1ZM2A 4NXME 3LNUA 4JI7E 4LFAE 4DV3I 3Q1QA 4GKJI 4K0KI 1HR0E 3PRYA 4DUZI 5IWAE 2UUBE 4ED4A 1S16A 1HR0I 4P7AA 4DR5I 2UUCE 1N34E 4EMDA 4DV3E 4X64I 2HHHI 2CZ9A 5LMNI 1Z0BA 2E5LI 1K47A 4HXZA 4NXNI 3K85A 2UUBI 4DUZE 4DR1I 2A2CA 2Z5CB 4X66I 2HFUA 4AQYI 4GKKE 4RPFA 5GMEA 1RR9A 4LFBI 4JG4A 4LFCI 3Q6MA 4DUYE 4JI1I 2J7KA 1XMOI 4LF6E 3M6AA 2BM1A 3T1YE 1N0VC 4B3SE 1FI4A 4JI3E 2IOQA 4DR4E 2IOPA 2Z5BA 5GMDA 4DR3I 2VQFE 2NPFA 1HNZI 2HKEA 4FWGA 4DV4I 4JI6I 4DR7I 3QT7A 1HNWE 3J80C 1UEKA 4IZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0G A;  1Z0W A;  1NHJ A;  4JYA E;  4R1F A;  3WU3 A;  4LFC E;  1Z0V A;  4B3R E;  1IBL I;  4X66 E;  2UXD I;  2V34 A;  4JI2 I;  2R3V A;  1N34 I;  3JAM Q;  4X65 I;  2X7I A;  4DV2 I;  4LFB E;  4YY3 I;  2E5L E;  2UUA I;  3J81 Q;  4X65 E;  1J5E I;  1N0U A;  4DR1 E;  2UUC I;  1WUU A;  3F0N A;  5LMU E;  1HNW I;  1I94 E;  4X62 E;  4AQY E;  4GKK I;  1D6T A;  4MYT A;  4LF5 E;  4FW9 A;  4P52 A;  4JI6 E;  4K0K E;  2UU9 I;  3T1H E;  4YHH I;  3J7A M;  3WU6 A;  4JI8 I;  3V2U C;  2Q2E B;  3JAM C;  1PKP A;  1Z0E A;  2DEJ A;  3ZZT A;  4X64 E;  3HUL A;  1XHK A;  1XNQ I;  4B3T I;  3T1H I;  3H4L A;  4HYM A;  5IWA I;  3LTO A;  1MX0 A;  2AJ4 A;  1FJG E;  4DR7 E;  4DV6 E;  4MYU A;  2V2Q A;  1NHH A;  4URL A;  4DR2 I;  3PYD A;  3J7A G;  4KHP E;  3V5R A;  1OJ4 A;  2UXC E;  4JV5 I;  2OI2 A;  2EFG A;  2BV3 A;  1FJG I;  4DU8 A;  1ELO A;  4OX9 I;  1FNM A;  3B8H A;  4UTG A;  3GON A;  1HNX I;  1IBL E;  4DPX A;  1Z5B A;  1MG7 A;  4X62 I;  4DV0 I;  2R42 A;  4B3T E;  1S4E A;  3K1J A;  5BR8 I;  4WUB A;  4XTJ A;  1H72 C;  4Z7C A;  2F4V E;  5A2Q C;  4DV1 I;  2E1R A;  4LF8 I;  4WUC A;  2LJP A;  4I3H A;  3ZKB A;  4USM A;  1H73 A;  1FWL A;  3PYG A;  4JI1 E;  2ZBK B;  1H7S A;  4USK A;  5LMU I;  4B3S I;  2GS8 A;  2WW4 A;  4DV5 E;  4DV1 E;  1DAR A;  4LF6 I;  1ZXM A;  2ZIT A;  1N33 I;  2ZM6 I;  4B3R I;  4PRV A;  1ZM3 A;  4JI0 E;  4WUD A;  4M1K A;  4JI4 E;  2BM0 A;  4LF4 I;  4DR2 E;  4DR6 E;  5FLX Q;  2VQF I;  1I94 I;  1EA6 A;  5LL6 R;  4DV7 I;  3ZKD A;  2ZM6 E;  3D4J A;  1EI1 A;  4DR5 E;  2HFS A;  1IBK E;  3PYE A;  4DR4 I;  4HY1 A;  4JV5 E;  5LMN E;  1N32 I;  1IBK I;  1HNZ E;  4LF9 I;  4KQV A;  1B63 A;  4B3M I;  1U2R A;  4Z7Y A;  3WU5 A;  1XMO E;  4NXM I;  1IBM I;  4HAC A;  2HKJ A;  4JI5 E;  3QT6 A;  1N33 E;  1QZR A;  2V2V A;  1A6F A;  1Z0C A;  3PYF A;  2UXB I;  4DV7 E;  5BR8 E;  2VQE I;  3ZZU A;  3WU4 A;  1Z0T A;  2HK2 A;  2UXB E;  1Z59 A;  1N36 E;  4KHP I;  4DPY A;  2UXD E;  1KTV A;  1NZ0 A;  2V8P A;  1KVK A;  1PIE A;  5L3J A;  1B62 A;  2VQE E;  2XEX A;  4LF7 I;  1VIS A;  1Z5C A;  1H74 A;  1HNX E;  1XNR E;  3QT5 A;  4B3M E;  4DV5 I;  1H7U A;  1FKA E;  4FWH A;  1N32 E;  1IBM E;  3OTO I;  1KIJ A;  1ZXN A;  4JYA I;  3QT8 A;  4JI0 I;  4LF9 E;  2UU9 E;  4DR3 E;  4LF8 E;  1BKN A;  4NXN E;  4ZVI A;  1XMQ E;  4JI5 I;  4JI3 I;  4OX9 E;  1PVG A;  5A2Q Q;  4DXL A;  1FWK A;  2HK3 A;  4FWD A;  2DEI A;  5IT9 Q;  2HHH E;  1XMQ I;  4DV2 E;  3LPS A;  1XNQ E;  4DV4 E;  1NHI A;  2UUA E;  4DUY I;  4DV0 E;  4LF5 I;  2V2Z A;  4UT4 A;  4DV6 I;  4FN5 A;  5FLX C;  4PRX A;  4JI4 I;  3CWV A;  4DR6 I;  1MU5 A;  3ZM7 A;  2UXC I;  2X36 A;  2F4V I;  4LF7 E;  4DPU A;  3OTO E;  4DU7 A;  3B78 A;  4YY3 E;  2A2D A;  3T1Y I;  3K17 A;  4JI8 E;  1XNR I;  4JI2 E;  1J5E E;  4LF4 E;  3J80 Q;  5IT9 C;  3J81 C;  1Z5A A;  4LFA I;  1RRE A;  4DPT A;  1KKH A;  2VF3 A;  3B82 A;  4PU9 A;  4GKJ E;  1N36 I;  4DPW A;  4YHH E;  4JI7 I;  1ZM9 A;  1ZM4 A;  4HAC B;  3ZZ0 A;  1ZM2 A;  4NXM E;  3LNU A;  4JI7 E;  4LFA E;  4DV3 I;  3Q1Q A;  4GKJ I;  4K0K I;  1HR0 E;  4DUZ I;  5IWA E;  2UUB E;  4ED4 A;  1S16 A;  1HR0 I;  4P7A A;  4DR5 I;  2UUC E;  1N34 E;  4EMD A;  4DV3 E;  4X64 I;  2HHH I;  2CZ9 A;  5LMN I;  1Z0B A;  2E5L I;  1K47 A;  4HXZ A;  4NXN I;  2UUB I;  4DUZ E;  4DR1 I;  2A2C A;  4X66 I;  2HFU A;  4AQY I;  4GKK E;  4RPF A;  5GME A;  1RR9 A;  4LFB I;  4JG4 A;  4LFC I;  4DUY E;  4JI1 I;  2J7K A;  1XMO I;  4LF6 E;  3M6A A;  2BM1 A;  3T1Y E;  1N0V C;  4B3S E;  1FI4 A;  4JI3 E;  4DR4 E;  5GMD A;  4DR3 I;  2VQF E;  2NPF A;  1HNZ I;  2HKE A;  4FWG A;  4DV4 I;  4JI6 I;  4DR7 I;  3QT7 A;  1HNW E;  3J80 C;  1UEK A; 
#chains in the Genus database with same CATH topology
 1Z0G A;  2GO3 A;  1Z0W A;  1NHJ A;  4JYA E;  4R1F A;  3WU3 A;  3P06 A;  4LFC E;  2GO4 A;  1Z0V A;  2NN6 B;  3GLL A;  4B3R E;  3Q6N A;  2J65 A;  4OZE A;  4BA1 A;  1IBL I;  4X66 E;  2JEA A;  2UXD I;  1Y4U A;  2V34 A;  4JI2 I;  3CDJ A;  2R3V A;  1N34 I;  3JAM Q;  4X65 I;  2X7I A;  4DV2 I;  4LFB E;  4YY3 I;  4BA2 B;  2E5L E;  2UUA I;  1Y5Y A;  3J81 Q;  4X65 E;  1P42 A;  1J5E I;  1N0U A;  4DR1 E;  2UUC I;  1WUU A;  3F0N A;  5LMU E;  3P76 A;  1HNW I;  1I94 E;  4X62 E;  4AQY E;  2O3Z A;  4GKK I;  2CGE A;  1D6T A;  4MYT A;  5K36 C;  4LF5 E;  2C38 A;  4FW9 A;  4OO1 B;  4P52 A;  2O1W A;  4JI6 E;  4K0K E;  1Y4S A;  2UU9 I;  3T1H E;  1XXE A;  4YHH I;  3M85 D;  2Z5E A;  3J7A M;  3WU6 A;  4JI8 I;  1OYS A;  5JEA F;  3V2U C;  2Q2E B;  3JAM C;  1PKP A;  1Z0E A;  4IZJ A;  2DEJ A;  3ZZT A;  4X64 E;  5C0X B;  3HUL A;  4IS9 A;  1XHK A;  1XNQ I;  2IES A;  4B3T I;  3T1H I;  4U3D A;  2O1T A;  3H4L A;  4HYM A;  5IWA I;  3LTO A;  1MX0 A;  2AJ4 A;  1FJG E;  4DR7 E;  4DV6 E;  4MYU A;  5DNL A;  2V2Q A;  2BA1 D;  1NHH A;  1Y60 A;  4URL A;  4DR2 I;  2PNZ B;  3PYD A;  3J7A G;  2NN6 D;  3V5R A;  4KHP E;  1OJ4 A;  2UXC E;  3PS3 A;  4AM3 A;  4JV5 I;  2OI2 A;  5JEA B;  2EFG A;  2CG9 A;  2BV3 A;  4MDT A;  5FWK A;  1FJG I;  4DU8 A;  1ELO A;  4OX9 I;  3M7N G;  1FNM A;  2PNL A;  3B8H A;  4UTG A;  3GON A;  3U1K A;  1HNX I;  2BR2 B;  1IBL E;  4OO1 E;  4N3O A;  4DPX A;  1Z5B A;  2NN6 A;  1MG7 A;  4X62 I;  1VI7 A;  3GME A;  2BA0 G;  4QNJ A;  4DV0 I;  2R42 A;  2O1V A;  4B3T E;  1S4E A;  3K1J A;  3KRN A;  1YH8 A;  2WNR A;  5BR8 I;  4WUB A;  4XTJ A;  1H72 C;  4IFD B;  2PO0 A;  4Z7C A;  2F4V E;  2WNR B;  5A2Q C;  4DV1 I;  2E1R A;  4LF8 I;  2GQ0 A;  2LJP A;  4WUC A;  4I3H A;  3ZKB A;  4USM A;  1H73 A;  1FWL A;  3PYG A;  4JI1 E;  2ZBK B;  1H7S A;  5DRQ A;  4IZK A;  5K36 D;  4USK A;  5LMU I;  4B3S I;  5JEA E;  2GS8 A;  2WW4 A;  4OO1 D;  4DV5 E;  5DRR A;  4DV1 E;  1DAR A;  4LF6 I;  4IZK B;  2IER A;  1ZXM A;  2ZIT A;  1N33 I;  5JEA A;  2ZM6 I;  4B3R I;  2C37 B;  4PRV A;  1ZM3 A;  4JI0 E;  4WUD A;  2JEB B;  4M1K A;  4FW4 A;  4JI4 E;  2BM0 A;  4LF4 I;  4DR2 E;  4DR6 E;  2NN6 E;  5FLX Q;  2JEB A;  2VQF I;  1I94 I;  1HK7 A;  5LL6 R;  1EA6 A;  2C39 B;  2CVE A;  4DV7 I;  3ZKD A;  2ZM6 E;  4MQY A;  5K36 B;  3D4J A;  1EI1 A;  4NBQ A;  2PO2 A;  1OYR A;  4MU4 A;  4DR5 E;  2HFS A;  2JEA B;  1IBK E;  5DRP A;  3PYE A;  4DR4 I;  4IZJ B;  4HY1 A;  4JV5 E;  5LMN E;  1N32 I;  1IBK I;  1HNZ E;  4LF9 I;  2PNM A;  4FW7 A;  1B63 A;  4KQV A;  4B3M I;  1U2R A;  5JEA D;  4LOM A;  4Z7Y A;  3WU5 A;  3M85 G;  4OO1 C;  1XMO E;  4NXM I;  3HJC A;  1IBM I;  4J3D A;  4HAC A;  2HKJ A;  4JI5 E;  2Z5C A;  3QT6 A;  1N33 E;  1QZR A;  2V2V A;  1A6F A;  1Z0C A;  2F1D A;  3PYF A;  5DNX A;  4AIM A;  2UXB I;  4FW6 A;  5BR8 E;  2VQE I;  4DV7 E;  3B4T A;  1USU A;  3ZZU A;  3U1Y A;  3GCM A;  2BR2 A;  3WU4 A;  1Z0T A;  2HK2 A;  2UXB E;  1Z59 A;  5ELW A;  1N36 E;  4KHP I;  4DPY A;  2WP8 A;  2BA1 G;  2UXD E;  5EL9 A;  1KTV A;  1NZ0 A;  1R6L A;  2V8P A;  1KVK A;  1PIE A;  5L3J A;  1UDO A;  4OO1 A;  1B62 A;  2PO1 A;  2VQE E;  2XEX A;  4LF7 I;  4FW3 A;  1VIS A;  1Z5C A;  1H74 A;  1HNX E;  1XNR E;  3QT5 A;  2C38 B;  4DV5 I;  4B3M E;  1H7U A;  1FKA E;  4FWH A;  1N32 E;  1IBM E;  3OTO I;  1KIJ A;  1ZXN A;  3PS2 A;  4JYA I;  1OYP A;  3QT8 A;  4JI0 I;  4LF9 E;  2UU9 E;  4OKG A;  4DR3 E;  4LF8 E;  3P3E A;  1BKN A;  4NXN E;  4ZVI A;  1XMQ E;  4JI5 I;  4JI3 I;  4OX9 E;  1PVG A;  4BA1 B;  5A2Q Q;  3HKM A;  4DXL A;  1FWK A;  4FWD A;  2HK3 A;  2DEI A;  1USV A;  5IT9 Q;  2HHH E;  2NN6 C;  4DV2 E;  2JT2 A;  1XMQ I;  3LPS A;  1XNQ E;  4DV4 E;  1NHI A;  4IFD E;  2UUA E;  4AID A;  4DUY I;  4DV0 E;  4LF5 I;  2V2Z A;  4LCH A;  4UT4 A;  4DV6 I;  4FN5 A;  5FLX C;  4PRX A;  4JI4 I;  4ISA A;  3CWV A;  4DR6 I;  1MU5 A;  1R6M A;  3ZM7 A;  2UXC I;  2X36 A;  4QNK A;  2F4V I;  4LF7 E;  4DPU A;  3OTO E;  2AE8 A;  2Z5B B;  4DU7 A;  3B78 A;  4MU3 A;  4YY3 E;  2A2D A;  3T1Y I;  3K17 A;  4JI8 E;  1XNR I;  4JI2 E;  1J5E E;  4LF4 E;  3J80 Q;  5IT9 C;  3J81 C;  4LCF A;  1YHC A;  1Z5A A;  3DD6 A;  4LFA I;  1RRE A;  3PS1 A;  4DPT A;  5C0X C;  1KKH A;  5C0X D;  2VF3 A;  3B82 A;  4PU9 A;  4GKJ E;  3UHM A;  1N36 I;  2O1U A;  4DPW A;  4YHH E;  4JI7 I;  1ZM9 A;  5C0X E;  1ZM4 A;  2VES A;  4OO1 F;  5JEA C;  5K36 F;  2PNZ A;  4HAC B;  3ZZ0 A;  1Y6Z A;  1ZM2 A;  4NXM E;  3LNU A;  4JI7 E;  4LFA E;  1E3P A;  4LCG A;  4DV3 I;  3L7Z A;  2PO1 B;  3Q1Q A;  4GKJ I;  4K0K I;  2C37 A;  1HR0 E;  3PRY A;  2JE6 B;  4DUZ I;  1E3H A;  2PO2 B;  5IWA E;  5C0X A;  2UUB E;  4ED4 A;  1S16 A;  1HR0 I;  3H1C A;  4P7A A;  4DR5 I;  2UUC E;  1N34 E;  4EMD A;  3CDI A;  4DV3 E;  4X64 I;  4IFD C;  2HHH I;  2CZ9 A;  5LMN I;  2C39 A;  5EKW A;  1Z0B A;  2E5L I;  1K47 A;  4GQU A;  4HXZ A;  5K36 A;  4NXN I;  3K85 A;  2UUB I;  4DUZ E;  4DR1 I;  2A2C A;  2Z5C B;  3L7Z B;  4X66 I;  2HFU A;  4IFD A;  4AQY I;  4GKK E;  1UDN A;  4RPF A;  5GME A;  4FW5 A;  1RR9 A;  4LFB I;  3P3G A;  4JG4 A;  4LFC I;  3Q6M A;  2BA0 D;  4DUY E;  4JI1 I;  4MU1 A;  2J7K A;  4LPF A;  4IFD F;  1XMO I;  4BA2 A;  4LF6 E;  3M6A A;  2BM1 A;  3T1Y E;  4IFD D;  2NN6 F;  1N0V C;  5K36 E;  4B3S E;  2WP8 B;  1FI4 A;  5C0X F;  3M7N D;  4JI3 E;  2IOQ A;  4DR4 E;  2IOP A;  5DRO A;  2JE6 A;  2Z5B A;  5GMD A;  4DR3 I;  2VQF E;  2NPF A;  1HNZ I;  1UDS A;  2HKE A;  4FWG A;  4DV4 I;  1UDQ A;  4JI6 I;  4DR7 I;  1RHY A;  3QT7 A;  1HNW E;  4MU0 A;  2PO0 B;  4U3B A;  3J80 C;  3P3C A;  1UEK A;  3NZK A;  4IZJ D; 
#chains in the Genus database with same CATH homology
 1Z0G A;  1Z0W A;  1NHJ A;  4JYA E;  4R1F A;  3WU3 A;  3P06 A;  4LFC E;  1Z0V A;  4B3R E;  3Q6N A;  1IBL I;  4X66 E;  2UXD I;  1Y4U A;  2V34 A;  4JI2 I;  2R3V A;  1N34 I;  3JAM Q;  4X65 I;  2X7I A;  4DV2 I;  4LFB E;  4YY3 I;  2E5L E;  2UUA I;  3J81 Q;  4X65 E;  1J5E I;  1N0U A;  4DR1 E;  2UUC I;  1WUU A;  3F0N A;  5LMU E;  1HNW I;  1I94 E;  4X62 E;  4AQY E;  4GKK I;  2CGE A;  1D6T A;  4MYT A;  4LF5 E;  4FW9 A;  4P52 A;  2O1W A;  4JI6 E;  4K0K E;  1Y4S A;  2UU9 I;  3T1H E;  4YHH I;  2Z5E A;  3J7A M;  3WU6 A;  4JI8 I;  3V2U C;  2Q2E B;  3JAM C;  1PKP A;  1Z0E A;  4IZJ A;  2DEJ A;  3ZZT A;  4X64 E;  3HUL A;  1XHK A;  1XNQ I;  4B3T I;  3T1H I;  2O1T A;  3H4L A;  4HYM A;  5IWA I;  3LTO A;  1MX0 A;  2AJ4 A;  1FJG E;  4DR7 E;  4DV6 E;  4MYU A;  2V2Q A;  1NHH A;  4URL A;  4DR2 I;  3PYD A;  3J7A G;  4KHP E;  3V5R A;  1OJ4 A;  2UXC E;  4JV5 I;  2OI2 A;  2EFG A;  2CG9 A;  2BV3 A;  5FWK A;  1FJG I;  4DU8 A;  1ELO A;  4OX9 I;  1FNM A;  2PNL A;  3B8H A;  4UTG A;  3GON A;  1HNX I;  1IBL E;  4N3O A;  4DPX A;  1Z5B A;  1MG7 A;  4X62 I;  4DV0 I;  2R42 A;  2O1V A;  4B3T E;  1S4E A;  3K1J A;  5BR8 I;  4WUB A;  4XTJ A;  1H72 C;  4Z7C A;  2F4V E;  5A2Q C;  4DV1 I;  2E1R A;  4LF8 I;  2GQ0 A;  2LJP A;  4WUC A;  4I3H A;  3ZKB A;  4USM A;  1H73 A;  1FWL A;  3PYG A;  4JI1 E;  2ZBK B;  1H7S A;  4IZK A;  4USK A;  5LMU I;  4B3S I;  2GS8 A;  2WW4 A;  4DV5 E;  4DV1 E;  1DAR A;  4LF6 I;  4IZK B;  1ZXM A;  2ZIT A;  1N33 I;  2ZM6 I;  4B3R I;  4PRV A;  1ZM3 A;  4JI0 E;  4WUD A;  4M1K A;  4JI4 E;  2BM0 A;  4LF4 I;  4DR2 E;  4DR6 E;  5FLX Q;  2VQF I;  1I94 I;  1HK7 A;  1EA6 A;  5LL6 R;  4DV7 I;  3ZKD A;  2ZM6 E;  3D4J A;  1EI1 A;  4DR5 E;  2HFS A;  1IBK E;  3PYE A;  4DR4 I;  4IZJ B;  4HY1 A;  4JV5 E;  5LMN E;  1N32 I;  1IBK I;  1HNZ E;  4LF9 I;  2PNM A;  4KQV A;  1B63 A;  4B3M I;  1U2R A;  4Z7Y A;  3WU5 A;  1XMO E;  4NXM I;  3HJC A;  1IBM I;  4HAC A;  2HKJ A;  4JI5 E;  2Z5C A;  3QT6 A;  1N33 E;  1QZR A;  2V2V A;  1A6F A;  1Z0C A;  3PYF A;  2UXB I;  4DV7 E;  5BR8 E;  2VQE I;  1USU A;  3ZZU A;  3WU4 A;  1Z0T A;  2HK2 A;  2UXB E;  1Z59 A;  1N36 E;  4KHP I;  4DPY A;  2UXD E;  1KTV A;  1NZ0 A;  2V8P A;  1KVK A;  1PIE A;  5L3J A;  1B62 A;  2VQE E;  2XEX A;  4LF7 I;  1VIS A;  1Z5C A;  1H74 A;  1HNX E;  1XNR E;  3QT5 A;  4B3M E;  4DV5 I;  1H7U A;  1FKA E;  4FWH A;  1N32 E;  1IBM E;  3OTO I;  1KIJ A;  1ZXN A;  4JYA I;  3QT8 A;  4JI0 I;  4LF9 E;  2UU9 E;  4DR3 E;  4LF8 E;  1BKN A;  4NXN E;  4ZVI A;  1XMQ E;  4JI5 I;  4JI3 I;  4OX9 E;  1PVG A;  5A2Q Q;  4DXL A;  1FWK A;  2HK3 A;  4FWD A;  2DEI A;  1USV A;  5IT9 Q;  2HHH E;  1XMQ I;  4DV2 E;  3LPS A;  1XNQ E;  4DV4 E;  1NHI A;  2UUA E;  4DUY I;  4DV0 E;  4LF5 I;  2V2Z A;  4UT4 A;  4DV6 I;  4FN5 A;  5FLX C;  4PRX A;  4JI4 I;  3CWV A;  4DR6 I;  1MU5 A;  3ZM7 A;  2UXC I;  2X36 A;  2F4V I;  4LF7 E;  4DPU A;  3OTO E;  2Z5B B;  4DU7 A;  3B78 A;  4YY3 E;  2A2D A;  3T1Y I;  3K17 A;  4JI8 E;  1XNR I;  4JI2 E;  1J5E E;  4LF4 E;  3J80 Q;  5IT9 C;  3J81 C;  1Z5A A;  4LFA I;  1RRE A;  4DPT A;  1KKH A;  2VF3 A;  3B82 A;  4PU9 A;  4GKJ E;  1N36 I;  2O1U A;  4DPW A;  4YHH E;  4JI7 I;  1ZM9 A;  1ZM4 A;  4HAC B;  3ZZ0 A;  1Y6Z A;  1ZM2 A;  4NXM E;  3LNU A;  4JI7 E;  4LFA E;  4DV3 I;  3Q1Q A;  4GKJ I;  4K0K I;  1HR0 E;  3PRY A;  4DUZ I;  5IWA E;  2UUB E;  4ED4 A;  1S16 A;  1HR0 I;  4P7A A;  4DR5 I;  2UUC E;  1N34 E;  4EMD A;  4DV3 E;  4X64 I;  2HHH I;  2CZ9 A;  5LMN I;  1Z0B A;  2E5L I;  1K47 A;  4HXZ A;  4NXN I;  3K85 A;  2UUB I;  4DUZ E;  4DR1 I;  2A2C A;  2Z5C B;  4X66 I;  2HFU A;  4AQY I;  4GKK E;  4RPF A;  5GME A;  1RR9 A;  4LFB I;  4JG4 A;  4LFC I;  3Q6M A;  4DUY E;  4JI1 I;  2J7K A;  1XMO I;  4LF6 E;  3M6A A;  2BM1 A;  3T1Y E;  1N0V C;  4B3S E;  1FI4 A;  4JI3 E;  2IOQ A;  4DR4 E;  2IOP A;  2Z5B A;  5GMD A;  4DR3 I;  2VQF E;  2NPF A;  1HNZ I;  2HKE A;  4FWG A;  4DV4 I;  4JI6 I;  4DR7 I;  3QT7 A;  1HNW E;  3J80 C;  1UEK A;  4IZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...