4DR6I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr6I00
4JI2I 2HK2A 1FI4A 4DV1E 4KQVA 4KHPI 2F4VI 5LMNI 3QT5A 1Z0VA 4WUCA 1HNZI 4JI5I 4YY3I 4LF6E 4FWHA 4JI1I 4JI6I 4DPUA 4OX9E 4DUYE 2ZM6E 4AQYI 3LPSA 1J5EI 4DPXA 2UUAE 5IWAI 2UUBE 4JI4E 4DR5I 2UUCI 4DR6I 4P52A 4B3ME 4LF4E 3JAMQ 4WUDA 3ZKDA 3HULA 4K0KE 4PRXA 1Z0TA 4JV5I 5GMDA 2AJ4A 4JYAI 1MU5A 4NXNE 4DPTA 1QZRA 4X65E 4DV7I 3B8HA 4JI0E 1OJ4A 3B82A 1B63A 4LF5E 4RPFA 4DUZE 4YHHI 1HR0E 1XHKA 4X64I 3WU3A 3PYDA 5FLXQ 3D4JA 4LF7E 4DR2E 3PYGA 3K17A 3JAMC 2UXCI 1ZM9A 1IBME 4LFBI 1IBLE 3PYFA 1A6FA 4DV0E 1N0UA 1FKAE 4JI7I 3J7AM 2X7IA 1NZ0A 4X62I 3J81Q 2V2VA 2VQFE 4DV5E 2BV3A 1N32E 1ZXMA 1HNXE 4B3SE 3ZZTA 4URLA 1FWKA 4DV2E 4MYUA 4GKJE 1Z0CA 3ZM7A 5IT9Q 1RREA 5FLXC 2ZITA 1N33E 2UU9E 4DR1I 3OTOE 1H7UA 1XMQI 3J81C 4DPYA 5A2QQ 3T1HE 1XNRE 4DV3I 4ZVIA 3WU6A 1N34E 1ZM3A 4B3RI 1Z0BA 4ED4A 3T1YI 2BM1A 4B3TE 4HACA 1PIEA 2UXDE 4I3HA 4DV6E 1XMOE 2VQEE 4K0KI 1N36E 1Z5CA 2VF3A 5A2QC 4X66I 2UXBE 4X65I 4NXME 2ZBKB 4JI8E 4JI0I 3B78A 1XNQI 1PKPA 4PRVA 1ZM2A 1FNMA 1HR0I 3J7AG 2R42A 4DR3E 5BR8E 4JI2E 4R1FA 1EI1A 4DR2I 3LNUA 4Z7YA 4KHPE 4UTGA 2F4VE 4DV0I 5LMNE 1MG7A 1Z5BA 4WUBA 4FWGA 1HNZE 1Z0WA 1HNXI 4B3SI 4YY3E 3LTOA 1H7SA 5GMEA 4UT4A 2HHHE 4GKKI 1Z5AA 2DEJA 1HNWE 4HY1A 1ZM4A 2UU9I 4AQYE 1FJGI 1J5EE 3QT8A 4EMDA 3V5RA 2WW4A 4DU7A 2EFGA 2UUCE 1IBKE 4FN5A 4DR7I 4LFAE 3CWVA 1XNRI 2V34A 4DV1I 1PVGA 1N34I 3Q1QA 4JYAE 2LJPA 4HACB 5LMUE 4USMA 3F0NA 1WUUA 1ZXNA 2UXDI 3WU4A 1D6TA 4YHHE 4LF6I 1RR9A 3QT6A 1DARA 4DV4E 4OX9I 1KIJA 3GONA 2UXCE 3WU5A 2UXBI 2A2CA 4DUYI 1N0VC 2ZM6I 4LF9E 2A2DA 4JI8I 2OI2A 5IT9C 1NHHA 2UUAI 4DR4E 2UUBI 3V2UC 2J7KA 4JI4I 1UEKA 1Z59A 2NPFA 4X62E 1ELOA 5LL6R 2BM0A 4DR3I 1NHJA 5BR8I 4B3MI 3H4LA 4LF4I 4JI3E 4USKA 2HFUA 4NXNI 3PYEA 2X36A 4DR1E 1EA6A 4LFCE 4LF8E 1KKHA 4XTJA 2E5LE 4DUZI 1XMQE 4LF5I 1S16A 2XEXA 3J80Q 1I94E 2HKEA 4HYMA 2HHHI 4LF7I 4DV3E 1HNWI 4HXZA 1IBMI 1FWLA 1IBLI 4DXLA 2V8PA 4B3RE 4FW9A 2V2ZA 2VQFI 3T1YE 4DV5I 4P7AA 1IBKI 4JI5E 1N32I 3QT7A 4LFAI 1H74A 1B62A 1NHIA 1Z0GA 3ZKBA 4DV2I 4JI1E 4DU8A 3J80C 4JI6E 4GKJI 1KTVA 4X66E 1N33I 1H72C 2HFSA 2Q2EB 5LMUI 1XNQE 3OTOI 5IWAE 2GS8A 4DR5E 1U2RA 3ZZUA 2HKJA 4DR6E 3T1HI 4DV4I 2R3VA 2HK3A 2CZ9A 4JV5E 4Z7CA 4LF9I 4MYTA 3M6AA 1H73A 4DR4I 1K47A 1VISA 4PU9A 4DV7E 1MX0A 4B3TI 4DPWA 4DV6I 4JI3I 4X64E 1XMOI 2DEIA 3ZZ0A 2V2QA 2VQEI 1BKNA 5L3JA 4GKKE 1N36I 4LFBE 4NXMI 1FJGE 2E1RA 1Z0EA 4FWDA 4LFCI 3K1JA 4JI7E 4LF8I 4M1KA 2E5LI 1KVKA 1S4EA 1I94I 4DR7E 4JG4A
chains in the Genus database with same CATH superfamily
3U1YA 4JI2I 4IS9A 2HK2A 4IFDF 1UDOA 1FI4A 4DV1E 4ISAA 4KQVA 4KHPI 2F4VI 5LMNI 3QT5A 1Z0VA 3K85A 4WUCA 3H1CA 1HNZI 2IERA 4JI5I 3DD6A 4BA2A 4YY3I 4LF6E 4FWHA 3GCMA 4IZKB 1UDQA 4OO1F 4JI1I 4JI6I 1UDSA 4DPUA 5JEAA 4OX9E 5C0XD 4DUYE 2ZM6E 2BA1D 4AQYI 4IFDE 3LPSA 1J5EI 4DPXA 2UUAE 5IWAI 2UUBE 2O3ZA 4JI4E 5C0XB 2VESA 4DR5I 4IFDC 3U1KA 2UUCI 4DR6I 4P52A 4B3ME 4LF4E 3JAMQ 4WUDA 3ZKDA 3HULA 4K0KE 4PRXA 1Z0TA 4JV5I 3NZKA 5GMDA 4BA1B 2AJ4A 4JYAI 1MU5A 4NXNE 4IZKA 4DPTA 4J3DA 1QZRA 4X65E 3B4TA 3P3CA 2PNZB 3HKMA 4DV7I 3B8HA 5EL9A 4JI0E 2AE8A 1OJ4A 3B82A 1B63A 2IOPA 4RPFA 3L7ZB 4DUZE 4LF5E 4YHHI 1HR0E 1XHKA 2IESA 4X64I 3WU3A 5C0XA 3PYDA 2NN6F 5FLXQ 3D4JA 4LF7E 2O1VA 4DR2E 2O1WA 3PYGA 3K17A 3JAMC 2UXCI 1ZM9A 1IBME 4LFBI 3CDIA 1IBLE 3PYFA 1A6FA 4DV0E 1N0UA 1FKAE 3Q6NA 2C39A 4BA1A 4JI7I 3J7AM 2X7IA 1NZ0A 4AIMA 4X62I 3J81Q 2V2VA 1E3PA 2VQFE 4DV5E 2BV3A 2PNZA 1N32E 1ZXMA 4IZJD 1HNXE 4B3SE 3ZZTA 2BA0D 4URLA 1FWKA 1Y6ZA 3L7ZA 2PO0B 4DV2E 4MYUA 4GKJE 1Z0CA 4IZJB 3ZM7A 5IT9Q 1RREA 5FLXC 2ZITA 1N33E 5FWKA 5JEAF 2UU9E 4LCFA 4DR1I 4BA2B 3OTOE 5K36A 1H7UA 1XMQI 3M85D 3HJCA 2O1TA 3J81C 4MDTA 4DPYA 5A2QQ 3T1HE 2BA0G 2WP8A 1XNRE 4DV3I 1XXEA 4ZVIA 3WU6A 1N34E 1OYRA 1P42A 1ZM3A 2PO0A 4IZJA 4B3RI 1UDNA 1Z0BA 4ED4A 2BR2A 3T1YI 2BM1A 2JEAA 4B3TE 4HACA 1PIEA 4MU0A 3CDJA 2UXDE 4I3HA 3P3EA 4DV6E 1XMOE 3M7NG 3M85G 2VQEE 4K0KI 3P76A 2Z5BA 4IFDD 5C0XF 1N36E 1Z5CA 2VF3A 5A2QC 4X66I 2UXBE 4X65I 4NXME 2ZBKB 4QNKA 4JI8E 5DRQA 4JI0I 3B78A 1XNQI 4IFDB 1PKPA 4PRVA 1ZM2A 1FNMA 1E3HA 5ELWA 1HR0I 3J7AG 1RHYA 2R42A 4DR3E 5BR8E 4LCGA 4JI2E 4MU4A 4R1FA 1EI1A 4DR2I 3LNUA 4Z7YA 2C39B 2Z5CB 4KHPE 4UTGA 2F4VE 4OO1E 4DV0I 5LMNE 1MG7A 4LPFA 1Z5BA 5DRPA 2JT2A 2BA1G 4WUBA 4FWGA 4LOMA 4FW3A 4FW6A 1HNZE 4OO1C 1Z0WA 1HNXI 4B3SI 4IFDA 4YY3E 3PS2A 3LTOA 1H7SA 5GMEA 5K36D 4UT4A 2HHHE 4GKKI 1Z5AA 2DEJA 4AM3A 1HNWE 4HY1A 1ZM4A 2UU9I 4AQYE 5K36B 1FJGI 3P3GA 1J5EE 3QT8A 1HK7A 4EMDA 3V5RA 2Z5CA 2WW4A 4DU7A 2EFGA 4OKGA 2UUCE 2WP8B 1VI7A 1IBKE 4FN5A 4DR7I 4LFAE 3CWVA 1XNRI 2V34A 4DV1I 1PVGA 1N34I 3Q1QA 1Y4UA 4JYAE 3PRYA 4FW4A 2LJPA 2NN6E 2BR2B 2JEAB 4HACB 5LMUE 4USMA 3F0NA 1WUUA 3P06A 3PS3A 1ZXNA 2NN6C 2UXDI 2JEBB 3WU4A 1D6TA 4YHHE 4LF6I 2Z5BB 1RR9A 3QT6A 2JE6B 1Y5YA 2GO4A 1DARA 4DV4E 4OX9I 1KIJA 3GONA 2UXCE 3WU5A 2UXBI 2A2CA 4DUYI 1N0VC 2ZM6I 4LF9E 2A2DA 4JI8I 2OI2A 2PO1A 5IT9C 1NHHA 2UUAI 4DR4E 2UUBI 3V2UC 2J7KA 2CG9A 4JI4I 1UEKA 1Z59A 2NPFA 4X62E 1ELOA 5LL6R 5JEAE 2BM0A 4DR3I 1NHJA 2Z5EA 5BR8I 4B3MI 2GQ0A 3H4LA 4LF4I 4JI3E 2JEBA 4USKA 5JEAC 2C38B 2WNRA 2HFUA 4FW7A 4NXNI 2JE6A 3PYEA 3UHMA 2O1UA 1USUA 4AIDA 2X36A 4DR1E 1Y4SA 1EA6A 4LFCE 4LF8E 1KKHA 2PNMA 4XTJA 2E5LE 4DUZI 1XMQE 4LF5I 2PO2A 1S16A 2XEXA 3J80Q 1I94E 2HKEA 4HYMA 2HHHI 4LF7I 4U3DA 4OO1D 4DV3E 1HNWI 2GO3A 4HXZA 4GQUA 2J65A 1IBMI 1FWLA 1IBLI 4MU1A 4DXLA 2V8PA 2C38A 3KRNA 3GMEA 4OO1B 5C0XE 4B3RE 4FW9A 2V2ZA 2C37B 2VQFI 3T1YE 4DV5I 4P7AA 4QNJA 1IBKI 4JI5E 1N32I 5C0XC 3QT7A 5K36F 5DNXA 4LFAI 1H74A 1B62A 1R6LA 1NHIA 1Z0GA 3ZKBA 4DV2I 3J80C 1YHCA 4DU8A 4NBQA 4JI1E 4JI6E 4GKJI 1KTVA 4FW5A 2F1DA 4X66E 1N33I 1H72C 2HFSA 2Q2EB 5LMUI 2CGEA 1XNQE 3OTOI 5IWAE 2GS8A 2IOQA 4DR5E 4OO1A 1U2RA 3ZZUA 2HKJA 4N3OA 4DR6E 2C37A 3T1HI 4DV4I 2R3VA 2CVEA 2HK3A 2NN6D 2CZ9A 3Q6MA 2PO1B 1OYPA 4JV5E 5EKWA 4Z7CA 3PS1A 5K36E 1R6MA 4LF9I 4MYTA 3M6AA 4MQYA 1H73A 4DR4I 1K47A 2NN6B 1VISA 4PU9A 4DV7E 4LCHA 1MX0A 5K36C 1YH8A 1OYSA 4B3TI 4DPWA 2WNRB 4DV6I 4JI3I 4X64E 1XMOI 2DEIA 3ZZ0A 2V2QA 2VQEI 1BKNA 5L3JA 4GKKE 1Y60A 1N36I 1USVA 2PNLA 4MU3A 5DRRA 3GLLA 4LFBE 4NXMI 1FJGE 5JEAD 2PO2B 2E1RA 1Z0EA 4LFCI 4FWDA 5DROA 3K1JA 4JI7E 4LF8I 4M1KA 2E5LI 1KVKA 5DNLA 3M7ND 1S4EA 2NN6A 1I94I 4OZEA 5JEAB 4DR7E 4U3BA 4JG4A
chains in the Genus database with same CATH topology
4JI2I 2HK2A 1FI4A 4DV1E 4KQVA 4KHPI 2F4VI 5LMNI 3QT5A 1Z0VA 3K85A 4WUCA 1HNZI 4JI5I 4YY3I 4LF6E 4FWHA 4IZKB 4JI1I 4JI6I 4DPUA 4OX9E 4DUYE 2ZM6E 4AQYI 3LPSA 1J5EI 4DPXA 2UUAE 5IWAI 2UUBE 4JI4E 4DR5I 2UUCI 4DR6I 4P52A 4B3ME 4LF4E 3JAMQ 4WUDA 3ZKDA 3HULA 4K0KE 4PRXA 1Z0TA 4JV5I 5GMDA 2AJ4A 4JYAI 1MU5A 4NXNE 4IZKA 4DPTA 1QZRA 4X65E 4DV7I 3B8HA 4JI0E 1OJ4A 3B82A 1B63A 2IOPA 4RPFA 4DUZE 4LF5E 4YHHI 1HR0E 1XHKA 4X64I 3WU3A 3PYDA 5FLXQ 3D4JA 4LF7E 2O1VA 4DR2E 2O1WA 3PYGA 3K17A 3JAMC 2UXCI 1ZM9A 1IBME 4LFBI 1IBLE 3PYFA 1A6FA 4DV0E 1N0UA 1FKAE 3Q6NA 4JI7I 3J7AM 2X7IA 1NZ0A 4X62I 3J81Q 2V2VA 2VQFE 4DV5E 2BV3A 1N32E 1ZXMA 4IZJD 1HNXE 4B3SE 3ZZTA 4URLA 1FWKA 1Y6ZA 4DV2E 4MYUA 4GKJE 1Z0CA 4IZJB 3ZM7A 5IT9Q 1RREA 5FLXC 2ZITA 1N33E 5FWKA 2UU9E 4DR1I 3OTOE 1H7UA 1XMQI 3HJCA 2O1TA 3J81C 4DPYA 5A2QQ 3T1HE 1XNRE 4DV3I 4ZVIA 3WU6A 1N34E 1ZM3A 4IZJA 4B3RI 1Z0BA 4ED4A 3T1YI 2BM1A 4B3TE 4HACA 1PIEA 2UXDE 4I3HA 4DV6E 1XMOE 2VQEE 4K0KI 2Z5BA 1N36E 1Z5CA 2VF3A 5A2QC 4X66I 2UXBE 4X65I 4NXME 2ZBKB 4JI8E 4JI0I 3B78A 1XNQI 1PKPA 4PRVA 1ZM2A 1FNMA 1HR0I 3J7AG 2R42A 4DR3E 5BR8E 4JI2E 4R1FA 1EI1A 4DR2I 3LNUA 4Z7YA 2Z5CB 4KHPE 4UTGA 2F4VE 4DV0I 5LMNE 1MG7A 1Z5BA 4WUBA 4FWGA 1HNZE 1Z0WA 1HNXI 4B3SI 4YY3E 3LTOA 1H7SA 5GMEA 4UT4A 2HHHE 4GKKI 1Z5AA 2DEJA 1HNWE 4HY1A 1ZM4A 2UU9I 4AQYE 1FJGI 1J5EE 3QT8A 1HK7A 4EMDA 3V5RA 2Z5CA 2WW4A 4DU7A 2EFGA 2UUCE 1IBKE 4FN5A 4DR7I 4LFAE 3CWVA 1XNRI 2V34A 4DV1I 1PVGA 1N34I 3Q1QA 1Y4UA 4JYAE 3PRYA 2LJPA 4HACB 5LMUE 4USMA 3F0NA 1WUUA 3P06A 1ZXNA 2UXDI 3WU4A 1D6TA 4YHHE 4LF6I 2Z5BB 1RR9A 3QT6A 1DARA 4DV4E 4OX9I 1KIJA 3GONA 2UXCE 3WU5A 2UXBI 2A2CA 4DUYI 2ZM6I 1N0VC 4LF9E 2A2DA 4JI8I 2OI2A 5IT9C 1NHHA 2UUAI 4DR4E 2UUBI 3V2UC 2J7KA 2CG9A 4JI4I 1UEKA 1Z59A 2NPFA 4X62E 1ELOA 5LL6R 2BM0A 4DR3I 1NHJA 2Z5EA 5BR8I 4B3MI 2GQ0A 3H4LA 4LF4I 4JI3E 4USKA 2HFUA 4NXNI 3PYEA 2O1UA 1USUA 2X36A 4DR1E 1Y4SA 1EA6A 4LFCE 4LF8E 1KKHA 2PNMA 4XTJA 2E5LE 4DUZI 1XMQE 4LF5I 1S16A 2XEXA 3J80Q 1I94E 2HKEA 4HYMA 2HHHI 4LF7I 4DV3E 1HNWI 4HXZA 1IBMI 1FWLA 1IBLI 4DXLA 2V8PA 4B3RE 4FW9A 2V2ZA 2VQFI 3T1YE 4DV5I 4P7AA 1IBKI 4JI5E 1N32I 3QT7A 4LFAI 1H74A 1B62A 1NHIA 1Z0GA 3ZKBA 4DV2I 3J80C 4DU8A 4JI1E 4JI6E 4GKJI 1KTVA 4X66E 1N33I 1H72C 2HFSA 2Q2EB 5LMUI 2CGEA 1XNQE 3OTOI 5IWAE 2GS8A 2IOQA 4DR5E 1U2RA 3ZZUA 2HKJA 4N3OA 4DR6E 3T1HI 4DV4I 2R3VA 2HK3A 2CZ9A 3Q6MA 4JV5E 4Z7CA 4LF9I 4MYTA 3M6AA 1H73A 4DR4I 1K47A 1VISA 4PU9A 4DV7E 1MX0A 4B3TI 4DPWA 4DV6I 4JI3I 4X64E 1XMOI 2DEIA 3ZZ0A 2V2QA 2VQEI 1BKNA 5L3JA 4GKKE 1N36I 1USVA 2PNLA 4LFBE 4NXMI 1FJGE 2E1RA 1Z0EA 4FWDA 4LFCI 3K1JA 4JI7E 4LF8I 4M1KA 2E5LI 1KVKA 1S4EA 1I94I 4DR7E 4JG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 I;  2HK2 A;  1FI4 A;  4DV1 E;  4KQV A;  4KHP I;  2F4V I;  5LMN I;  3QT5 A;  1Z0V A;  4WUC A;  1HNZ I;  4JI5 I;  4YY3 I;  4LF6 E;  4FWH A;  4JI1 I;  4JI6 I;  4DPU A;  4OX9 E;  4DUY E;  2ZM6 E;  4AQY I;  3LPS A;  1J5E I;  4DPX A;  2UUA E;  5IWA I;  2UUB E;  4JI4 E;  4DR5 I;  2UUC I;  4DR6 I;  4P52 A;  4B3M E;  4LF4 E;  3JAM Q;  4WUD A;  3ZKD A;  3HUL A;  4K0K E;  4PRX A;  1Z0T A;  4JV5 I;  5GMD A;  2AJ4 A;  4JYA I;  1MU5 A;  4NXN E;  4DPT A;  1QZR A;  4X65 E;  4DV7 I;  3B8H A;  4JI0 E;  1OJ4 A;  3B82 A;  1B63 A;  4LF5 E;  4RPF A;  4DUZ E;  4YHH I;  1HR0 E;  1XHK A;  4X64 I;  3WU3 A;  3PYD A;  5FLX Q;  3D4J A;  4LF7 E;  4DR2 E;  3PYG A;  3K17 A;  3JAM C;  2UXC I;  1ZM9 A;  1IBM E;  4LFB I;  1IBL E;  3PYF A;  1A6F A;  4DV0 E;  1N0U A;  1FKA E;  4JI7 I;  3J7A M;  2X7I A;  1NZ0 A;  4X62 I;  3J81 Q;  2V2V A;  2VQF E;  4DV5 E;  2BV3 A;  1N32 E;  1ZXM A;  1HNX E;  4B3S E;  3ZZT A;  4URL A;  1FWK A;  4DV2 E;  4MYU A;  4GKJ E;  1Z0C A;  3ZM7 A;  5IT9 Q;  1RRE A;  5FLX C;  2ZIT A;  1N33 E;  2UU9 E;  4DR1 I;  3OTO E;  1H7U A;  1XMQ I;  3J81 C;  4DPY A;  5A2Q Q;  3T1H E;  1XNR E;  4DV3 I;  4ZVI A;  3WU6 A;  1N34 E;  1ZM3 A;  4B3R I;  1Z0B A;  4ED4 A;  3T1Y I;  2BM1 A;  4B3T E;  4HAC A;  1PIE A;  2UXD E;  4I3H A;  4DV6 E;  1XMO E;  2VQE E;  4K0K I;  1N36 E;  1Z5C A;  2VF3 A;  5A2Q C;  4X66 I;  2UXB E;  4X65 I;  4NXM E;  2ZBK B;  4JI8 E;  4JI0 I;  3B78 A;  1XNQ I;  1PKP A;  4PRV A;  1ZM2 A;  1FNM A;  1HR0 I;  3J7A G;  2R42 A;  4DR3 E;  5BR8 E;  4JI2 E;  4R1F A;  1EI1 A;  4DR2 I;  3LNU A;  4Z7Y A;  4KHP E;  4UTG A;  2F4V E;  4DV0 I;  5LMN E;  1MG7 A;  1Z5B A;  4WUB A;  4FWG A;  1HNZ E;  1Z0W A;  1HNX I;  4B3S I;  4YY3 E;  3LTO A;  1H7S A;  5GME A;  4UT4 A;  2HHH E;  4GKK I;  1Z5A A;  2DEJ A;  1HNW E;  4HY1 A;  1ZM4 A;  2UU9 I;  4AQY E;  1FJG I;  1J5E E;  3QT8 A;  4EMD A;  3V5R A;  2WW4 A;  4DU7 A;  2EFG A;  2UUC E;  1IBK E;  4FN5 A;  4DR7 I;  4LFA E;  3CWV A;  1XNR I;  2V34 A;  4DV1 I;  1PVG A;  1N34 I;  3Q1Q A;  4JYA E;  2LJP A;  4HAC B;  5LMU E;  4USM A;  3F0N A;  1WUU A;  1ZXN A;  2UXD I;  3WU4 A;  1D6T A;  4YHH E;  4LF6 I;  1RR9 A;  3QT6 A;  1DAR A;  4DV4 E;  4OX9 I;  1KIJ A;  3GON A;  2UXC E;  3WU5 A;  2UXB I;  2A2C A;  4DUY I;  1N0V C;  2ZM6 I;  4LF9 E;  2A2D A;  4JI8 I;  2OI2 A;  5IT9 C;  1NHH A;  2UUA I;  4DR4 E;  2UUB I;  3V2U C;  2J7K A;  4JI4 I;  1UEK A;  1Z59 A;  2NPF A;  4X62 E;  1ELO A;  5LL6 R;  2BM0 A;  4DR3 I;  1NHJ A;  5BR8 I;  4B3M I;  3H4L A;  4LF4 I;  4JI3 E;  4USK A;  2HFU A;  4NXN I;  3PYE A;  2X36 A;  4DR1 E;  1EA6 A;  4LFC E;  4LF8 E;  1KKH A;  4XTJ A;  2E5L E;  4DUZ I;  1XMQ E;  4LF5 I;  1S16 A;  2XEX A;  3J80 Q;  1I94 E;  2HKE A;  4HYM A;  2HHH I;  4LF7 I;  4DV3 E;  1HNW I;  4HXZ A;  1IBM I;  1FWL A;  1IBL I;  4DXL A;  2V8P A;  4B3R E;  4FW9 A;  2V2Z A;  2VQF I;  3T1Y E;  4DV5 I;  4P7A A;  1IBK I;  4JI5 E;  1N32 I;  3QT7 A;  4LFA I;  1H74 A;  1B62 A;  1NHI A;  1Z0G A;  3ZKB A;  4DV2 I;  4JI1 E;  4DU8 A;  3J80 C;  4JI6 E;  4GKJ I;  1KTV A;  4X66 E;  1N33 I;  1H72 C;  2HFS A;  2Q2E B;  5LMU I;  1XNQ E;  3OTO I;  5IWA E;  2GS8 A;  4DR5 E;  1U2R A;  3ZZU A;  2HKJ A;  4DR6 E;  3T1H I;  4DV4 I;  2R3V A;  2HK3 A;  2CZ9 A;  4JV5 E;  4Z7C A;  4LF9 I;  4MYT A;  3M6A A;  1H73 A;  4DR4 I;  1K47 A;  1VIS A;  4PU9 A;  4DV7 E;  1MX0 A;  4B3T I;  4DPW A;  4DV6 I;  4JI3 I;  4X64 E;  1XMO I;  2DEI A;  3ZZ0 A;  2V2Q A;  2VQE I;  1BKN A;  5L3J A;  4GKK E;  1N36 I;  4LFB E;  4NXM I;  1FJG E;  2E1R A;  1Z0E A;  4FWD A;  4LFC I;  3K1J A;  4JI7 E;  4LF8 I;  4M1K A;  2E5L I;  1KVK A;  1S4E A;  1I94 I;  4DR7 E;  4JG4 A; 
#chains in the Genus database with same CATH topology
 3U1Y A;  4JI2 I;  4IS9 A;  2HK2 A;  4IFD F;  1UDO A;  1FI4 A;  4DV1 E;  4ISA A;  4KQV A;  4KHP I;  2F4V I;  5LMN I;  3QT5 A;  1Z0V A;  3K85 A;  4WUC A;  3H1C A;  1HNZ I;  2IER A;  4JI5 I;  3DD6 A;  4BA2 A;  4YY3 I;  4LF6 E;  4FWH A;  3GCM A;  4IZK B;  1UDQ A;  4OO1 F;  4JI1 I;  4JI6 I;  1UDS A;  4DPU A;  5JEA A;  4OX9 E;  5C0X D;  4DUY E;  2ZM6 E;  2BA1 D;  4AQY I;  4IFD E;  3LPS A;  1J5E I;  4DPX A;  2UUA E;  5IWA I;  2UUB E;  2O3Z A;  4JI4 E;  5C0X B;  2VES A;  4DR5 I;  4IFD C;  3U1K A;  2UUC I;  4DR6 I;  4P52 A;  4B3M E;  4LF4 E;  3JAM Q;  4WUD A;  3ZKD A;  3HUL A;  4K0K E;  4PRX A;  1Z0T A;  4JV5 I;  3NZK A;  5GMD A;  4BA1 B;  2AJ4 A;  4JYA I;  1MU5 A;  4NXN E;  4IZK A;  4DPT A;  4J3D A;  1QZR A;  4X65 E;  3B4T A;  3P3C A;  2PNZ B;  3HKM A;  4DV7 I;  3B8H A;  5EL9 A;  4JI0 E;  2AE8 A;  1OJ4 A;  3B82 A;  1B63 A;  2IOP A;  4RPF A;  3L7Z B;  4DUZ E;  4LF5 E;  4YHH I;  1HR0 E;  1XHK A;  2IES A;  4X64 I;  3WU3 A;  5C0X A;  3PYD A;  2NN6 F;  5FLX Q;  3D4J A;  4LF7 E;  2O1V A;  4DR2 E;  2O1W A;  3PYG A;  3K17 A;  3JAM C;  2UXC I;  1ZM9 A;  1IBM E;  4LFB I;  3CDI A;  1IBL E;  3PYF A;  1A6F A;  4DV0 E;  1N0U A;  1FKA E;  3Q6N A;  2C39 A;  4BA1 A;  4JI7 I;  3J7A M;  2X7I A;  1NZ0 A;  4AIM A;  4X62 I;  3J81 Q;  2V2V A;  1E3P A;  2VQF E;  4DV5 E;  2BV3 A;  2PNZ A;  1N32 E;  1ZXM A;  4IZJ D;  1HNX E;  4B3S E;  3ZZT A;  2BA0 D;  4URL A;  1FWK A;  1Y6Z A;  3L7Z A;  2PO0 B;  4DV2 E;  4MYU A;  4GKJ E;  1Z0C A;  4IZJ B;  3ZM7 A;  5IT9 Q;  1RRE A;  5FLX C;  2ZIT A;  1N33 E;  5FWK A;  5JEA F;  2UU9 E;  4LCF A;  4DR1 I;  4BA2 B;  3OTO E;  5K36 A;  1H7U A;  1XMQ I;  3M85 D;  3HJC A;  2O1T A;  3J81 C;  4MDT A;  4DPY A;  5A2Q Q;  3T1H E;  2BA0 G;  2WP8 A;  1XNR E;  4DV3 I;  1XXE A;  4ZVI A;  3WU6 A;  1N34 E;  1OYR A;  1P42 A;  1ZM3 A;  2PO0 A;  4IZJ A;  4B3R I;  1UDN A;  1Z0B A;  4ED4 A;  2BR2 A;  3T1Y I;  2BM1 A;  2JEA A;  4B3T E;  4HAC A;  1PIE A;  4MU0 A;  3CDJ A;  2UXD E;  4I3H A;  3P3E A;  4DV6 E;  1XMO E;  3M7N G;  3M85 G;  2VQE E;  4K0K I;  3P76 A;  2Z5B A;  4IFD D;  5C0X F;  1N36 E;  1Z5C A;  2VF3 A;  5A2Q C;  4X66 I;  2UXB E;  4X65 I;  4NXM E;  2ZBK B;  4QNK A;  4JI8 E;  5DRQ A;  4JI0 I;  3B78 A;  1XNQ I;  4IFD B;  1PKP A;  4PRV A;  1ZM2 A;  1FNM A;  1E3H A;  5ELW A;  1HR0 I;  3J7A G;  1RHY A;  2R42 A;  4DR3 E;  5BR8 E;  4LCG A;  4JI2 E;  4MU4 A;  4R1F A;  1EI1 A;  4DR2 I;  3LNU A;  4Z7Y A;  2C39 B;  2Z5C B;  4KHP E;  4UTG A;  2F4V E;  4OO1 E;  4DV0 I;  5LMN E;  1MG7 A;  4LPF A;  1Z5B A;  5DRP A;  2JT2 A;  2BA1 G;  4WUB A;  4FWG A;  4LOM A;  4FW3 A;  4FW6 A;  1HNZ E;  4OO1 C;  1Z0W A;  1HNX I;  4B3S I;  4IFD A;  4YY3 E;  3PS2 A;  3LTO A;  1H7S A;  5GME A;  5K36 D;  4UT4 A;  2HHH E;  4GKK I;  1Z5A A;  2DEJ A;  4AM3 A;  1HNW E;  4HY1 A;  1ZM4 A;  2UU9 I;  4AQY E;  5K36 B;  1FJG I;  3P3G A;  1J5E E;  3QT8 A;  1HK7 A;  4EMD A;  3V5R A;  2Z5C A;  2WW4 A;  4DU7 A;  2EFG A;  4OKG A;  2UUC E;  2WP8 B;  1VI7 A;  1IBK E;  4FN5 A;  4DR7 I;  4LFA E;  3CWV A;  1XNR I;  2V34 A;  4DV1 I;  1PVG A;  1N34 I;  3Q1Q A;  1Y4U A;  4JYA E;  3PRY A;  4FW4 A;  2LJP A;  2NN6 E;  2BR2 B;  2JEA B;  4HAC B;  5LMU E;  4USM A;  3F0N A;  1WUU A;  3P06 A;  3PS3 A;  1ZXN A;  2NN6 C;  2UXD I;  2JEB B;  3WU4 A;  1D6T A;  4YHH E;  4LF6 I;  2Z5B B;  1RR9 A;  3QT6 A;  2JE6 B;  1Y5Y A;  2GO4 A;  1DAR A;  4DV4 E;  4OX9 I;  1KIJ A;  3GON A;  2UXC E;  3WU5 A;  2UXB I;  2A2C A;  4DUY I;  1N0V C;  2ZM6 I;  4LF9 E;  2A2D A;  4JI8 I;  2OI2 A;  2PO1 A;  5IT9 C;  1NHH A;  2UUA I;  4DR4 E;  2UUB I;  3V2U C;  2J7K A;  2CG9 A;  4JI4 I;  1UEK A;  1Z59 A;  2NPF A;  4X62 E;  1ELO A;  5LL6 R;  5JEA E;  2BM0 A;  4DR3 I;  1NHJ A;  2Z5E A;  5BR8 I;  4B3M I;  2GQ0 A;  3H4L A;  4LF4 I;  4JI3 E;  2JEB A;  4USK A;  5JEA C;  2C38 B;  2WNR A;  2HFU A;  4FW7 A;  4NXN I;  2JE6 A;  3PYE A;  3UHM A;  2O1U A;  1USU A;  4AID A;  2X36 A;  4DR1 E;  1Y4S A;  1EA6 A;  4LFC E;  4LF8 E;  1KKH A;  2PNM A;  4XTJ A;  2E5L E;  4DUZ I;  1XMQ E;  4LF5 I;  2PO2 A;  1S16 A;  2XEX A;  3J80 Q;  1I94 E;  2HKE A;  4HYM A;  2HHH I;  4LF7 I;  4U3D A;  4OO1 D;  4DV3 E;  1HNW I;  2GO3 A;  4HXZ A;  4GQU A;  2J65 A;  1IBM I;  1FWL A;  1IBL I;  4MU1 A;  4DXL A;  2V8P A;  2C38 A;  3KRN A;  3GME A;  4OO1 B;  5C0X E;  4B3R E;  4FW9 A;  2V2Z A;  2C37 B;  2VQF I;  3T1Y E;  4DV5 I;  4P7A A;  4QNJ A;  1IBK I;  4JI5 E;  1N32 I;  5C0X C;  3QT7 A;  5K36 F;  5DNX A;  4LFA I;  1H74 A;  1B62 A;  1R6L A;  1NHI A;  1Z0G A;  3ZKB A;  4DV2 I;  3J80 C;  1YHC A;  4DU8 A;  4NBQ A;  4JI1 E;  4JI6 E;  4GKJ I;  1KTV A;  4FW5 A;  2F1D A;  4X66 E;  1N33 I;  1H72 C;  2HFS A;  2Q2E B;  5LMU I;  2CGE A;  1XNQ E;  3OTO I;  5IWA E;  2GS8 A;  2IOQ A;  4DR5 E;  4OO1 A;  1U2R A;  3ZZU A;  2HKJ A;  4N3O A;  4DR6 E;  2C37 A;  3T1H I;  4DV4 I;  2R3V A;  2CVE A;  2HK3 A;  2NN6 D;  2CZ9 A;  3Q6M A;  2PO1 B;  1OYP A;  4JV5 E;  5EKW A;  4Z7C A;  3PS1 A;  5K36 E;  1R6M A;  4LF9 I;  4MYT A;  3M6A A;  4MQY A;  1H73 A;  4DR4 I;  1K47 A;  2NN6 B;  1VIS A;  4PU9 A;  4DV7 E;  4LCH A;  1MX0 A;  5K36 C;  1YH8 A;  1OYS A;  4B3T I;  4DPW A;  2WNR B;  4DV6 I;  4JI3 I;  4X64 E;  1XMO I;  2DEI A;  3ZZ0 A;  2V2Q A;  2VQE I;  1BKN A;  5L3J A;  4GKK E;  1Y60 A;  1N36 I;  1USV A;  2PNL A;  4MU3 A;  5DRR A;  3GLL A;  4LFB E;  4NXM I;  1FJG E;  5JEA D;  2PO2 B;  2E1R A;  1Z0E A;  4LFC I;  4FWD A;  5DRO A;  3K1J A;  4JI7 E;  4LF8 I;  4M1K A;  2E5L I;  1KVK A;  5DNL A;  3M7N D;  1S4E A;  2NN6 A;  1I94 I;  4OZE A;  5JEA B;  4DR7 E;  4U3B A;  4JG4 A; 
#chains in the Genus database with same CATH homology
 4JI2 I;  2HK2 A;  1FI4 A;  4DV1 E;  4KQV A;  4KHP I;  2F4V I;  5LMN I;  3QT5 A;  1Z0V A;  3K85 A;  4WUC A;  1HNZ I;  4JI5 I;  4YY3 I;  4LF6 E;  4FWH A;  4IZK B;  4JI1 I;  4JI6 I;  4DPU A;  4OX9 E;  4DUY E;  2ZM6 E;  4AQY I;  3LPS A;  1J5E I;  4DPX A;  2UUA E;  5IWA I;  2UUB E;  4JI4 E;  4DR5 I;  2UUC I;  4DR6 I;  4P52 A;  4B3M E;  4LF4 E;  3JAM Q;  4WUD A;  3ZKD A;  3HUL A;  4K0K E;  4PRX A;  1Z0T A;  4JV5 I;  5GMD A;  2AJ4 A;  4JYA I;  1MU5 A;  4NXN E;  4IZK A;  4DPT A;  1QZR A;  4X65 E;  4DV7 I;  3B8H A;  4JI0 E;  1OJ4 A;  3B82 A;  1B63 A;  2IOP A;  4RPF A;  4DUZ E;  4LF5 E;  4YHH I;  1HR0 E;  1XHK A;  4X64 I;  3WU3 A;  3PYD A;  5FLX Q;  3D4J A;  4LF7 E;  2O1V A;  4DR2 E;  2O1W A;  3PYG A;  3K17 A;  3JAM C;  2UXC I;  1ZM9 A;  1IBM E;  4LFB I;  1IBL E;  3PYF A;  1A6F A;  4DV0 E;  1N0U A;  1FKA E;  3Q6N A;  4JI7 I;  3J7A M;  2X7I A;  1NZ0 A;  4X62 I;  3J81 Q;  2V2V A;  2VQF E;  4DV5 E;  2BV3 A;  1N32 E;  1ZXM A;  4IZJ D;  1HNX E;  4B3S E;  3ZZT A;  4URL A;  1FWK A;  1Y6Z A;  4DV2 E;  4MYU A;  4GKJ E;  1Z0C A;  4IZJ B;  3ZM7 A;  5IT9 Q;  1RRE A;  5FLX C;  2ZIT A;  1N33 E;  5FWK A;  2UU9 E;  4DR1 I;  3OTO E;  1H7U A;  1XMQ I;  3HJC A;  2O1T A;  3J81 C;  4DPY A;  5A2Q Q;  3T1H E;  1XNR E;  4DV3 I;  4ZVI A;  3WU6 A;  1N34 E;  1ZM3 A;  4IZJ A;  4B3R I;  1Z0B A;  4ED4 A;  3T1Y I;  2BM1 A;  4B3T E;  4HAC A;  1PIE A;  2UXD E;  4I3H A;  4DV6 E;  1XMO E;  2VQE E;  4K0K I;  2Z5B A;  1N36 E;  1Z5C A;  2VF3 A;  5A2Q C;  4X66 I;  2UXB E;  4X65 I;  4NXM E;  2ZBK B;  4JI8 E;  4JI0 I;  3B78 A;  1XNQ I;  1PKP A;  4PRV A;  1ZM2 A;  1FNM A;  1HR0 I;  3J7A G;  2R42 A;  4DR3 E;  5BR8 E;  4JI2 E;  4R1F A;  1EI1 A;  4DR2 I;  3LNU A;  4Z7Y A;  2Z5C B;  4KHP E;  4UTG A;  2F4V E;  4DV0 I;  5LMN E;  1MG7 A;  1Z5B A;  4WUB A;  4FWG A;  1HNZ E;  1Z0W A;  1HNX I;  4B3S I;  4YY3 E;  3LTO A;  1H7S A;  5GME A;  4UT4 A;  2HHH E;  4GKK I;  1Z5A A;  2DEJ A;  1HNW E;  4HY1 A;  1ZM4 A;  2UU9 I;  4AQY E;  1FJG I;  1J5E E;  3QT8 A;  1HK7 A;  4EMD A;  3V5R A;  2Z5C A;  2WW4 A;  4DU7 A;  2EFG A;  2UUC E;  1IBK E;  4FN5 A;  4DR7 I;  4LFA E;  3CWV A;  1XNR I;  2V34 A;  4DV1 I;  1PVG A;  1N34 I;  3Q1Q A;  1Y4U A;  4JYA E;  3PRY A;  2LJP A;  4HAC B;  5LMU E;  4USM A;  3F0N A;  1WUU A;  3P06 A;  1ZXN A;  2UXD I;  3WU4 A;  1D6T A;  4YHH E;  4LF6 I;  2Z5B B;  1RR9 A;  3QT6 A;  1DAR A;  4DV4 E;  4OX9 I;  1KIJ A;  3GON A;  2UXC E;  3WU5 A;  2UXB I;  2A2C A;  4DUY I;  2ZM6 I;  1N0V C;  4LF9 E;  2A2D A;  4JI8 I;  2OI2 A;  5IT9 C;  1NHH A;  2UUA I;  4DR4 E;  2UUB I;  3V2U C;  2J7K A;  2CG9 A;  4JI4 I;  1UEK A;  1Z59 A;  2NPF A;  4X62 E;  1ELO A;  5LL6 R;  2BM0 A;  4DR3 I;  1NHJ A;  2Z5E A;  5BR8 I;  4B3M I;  2GQ0 A;  3H4L A;  4LF4 I;  4JI3 E;  4USK A;  2HFU A;  4NXN I;  3PYE A;  2O1U A;  1USU A;  2X36 A;  4DR1 E;  1Y4S A;  1EA6 A;  4LFC E;  4LF8 E;  1KKH A;  2PNM A;  4XTJ A;  2E5L E;  4DUZ I;  1XMQ E;  4LF5 I;  1S16 A;  2XEX A;  3J80 Q;  1I94 E;  2HKE A;  4HYM A;  2HHH I;  4LF7 I;  4DV3 E;  1HNW I;  4HXZ A;  1IBM I;  1FWL A;  1IBL I;  4DXL A;  2V8P A;  4B3R E;  4FW9 A;  2V2Z A;  2VQF I;  3T1Y E;  4DV5 I;  4P7A A;  1IBK I;  4JI5 E;  1N32 I;  3QT7 A;  4LFA I;  1H74 A;  1B62 A;  1NHI A;  1Z0G A;  3ZKB A;  4DV2 I;  3J80 C;  4DU8 A;  4JI1 E;  4JI6 E;  4GKJ I;  1KTV A;  4X66 E;  1N33 I;  1H72 C;  2HFS A;  2Q2E B;  5LMU I;  2CGE A;  1XNQ E;  3OTO I;  5IWA E;  2GS8 A;  2IOQ A;  4DR5 E;  1U2R A;  3ZZU A;  2HKJ A;  4N3O A;  4DR6 E;  3T1H I;  4DV4 I;  2R3V A;  2HK3 A;  2CZ9 A;  3Q6M A;  4JV5 E;  4Z7C A;  4LF9 I;  4MYT A;  3M6A A;  1H73 A;  4DR4 I;  1K47 A;  1VIS A;  4PU9 A;  4DV7 E;  1MX0 A;  4B3T I;  4DPW A;  4DV6 I;  4JI3 I;  4X64 E;  1XMO I;  2DEI A;  3ZZ0 A;  2V2Q A;  2VQE I;  1BKN A;  5L3J A;  4GKK E;  1N36 I;  1USV A;  2PNL A;  4LFB E;  4NXM I;  1FJG E;  2E1R A;  1Z0E A;  4FWD A;  4LFC I;  3K1J A;  4JI7 E;  4LF8 I;  4M1K A;  2E5L I;  1KVK A;  1S4E A;  1I94 I;  4DR7 E;  4JG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...