4DR6J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr6J00
3T1HJ 4DR1J 4DR7J 4B3SJ 3OTOJ 1HR0J 1FJGJ 2ZM6J 4LF6J 4LF9J 4DR4J 2UXDJ 4NEZA 2KVQE 4X62J 4NXMJ 1N32J 3J80U 1XMOJ 4KY3A 4LF7J 4DR2J 2VQEJ 3R2DJ 5LMUJ 5LMNJ 3W1YC 4LF8J 4V1Ak 4JI2J 4JI3J 4JV5J 5A2QU 5AJ3J 5FLXU 4DUZJ 4X64J 4GKJJ 4OX9J 4NEYA 1J5EJ 4AQYJ 4KYZA 2E5LJ 3J81U 1XNQJ 4JI0J 4RJVA 1IBKJ 1XNRJ 4B3MJ 1IBMJ 3T1YJ 3R2CJ 5BR8J 2UU9J 4LF4J 4B3TJ 4YY3J 4KHPJ 5LM7E 2VQFJ 1IBLJ 2MQ8A 2HHHJ 2UXBJ 2KL8A 4DV0J 3D3BJ 4X66J 2F4VJ 1N34J 3JAMU 4DV4J 1N33J 3J7AN 5IT9U 1HNZJ 4GKKJ 2MTLA 3IMQJ 4DR6J 2UXCJ 4DV7J 4JYAJ 4DV5J 4JI6J 1HNXJ 1HNWJ 2UUBJ 4JI4J 4JI5J 3D3CJ 4X65J 4DV1J 4NXNJ 4LFBJ 4LF5J 4DV6J 2MEWA 2UUCJ 4PWWA 1N36J 2UUAJ 5IWAJ 4DV2J 4B3RJ 4JI7J 4K0KJ 4HHUA 1XMQJ 4DUYJ 1I94J 4DV3J 4JI1J 4JI8J 4LFCJ 4DR5J 4LFAJ 4YHHJ 4DR3J
chains in the Genus database with same CATH superfamily
1PYOB 2RKIB 5FIIA 3D6MB 2FHJA 2VFUA 1S1UA 1FNMA 3G6YA 4ZS6A 3TAMB 3LPEA 4OYMA 4DV4F 2R2RA 1NK6A 4YMEA 2OD4A 2AT1B 3CJKB 2KXNB 1EAYC 2L9DA 7FDRA 1S6UA 2FPHX 5L38A 3ICLA 5KFRA 4ATNA 1YITS 1UAWA 5C2CA 3RGIA 3T1YJ 4NLGA 2J6TA 5I42B 1TL3A 2C1EB 3KJVA 3ZZPA 2XY5A 3NL0A 4F0MA 2HBYB 4M5KA 9ATCB 1U2FA 2QMUB 4C97A 4EZ6A 3B78A 2QO3A 1TL1A 5AE1A 1WSRA 3QJLA 1HNVB 3PO5A 2CQ2A 1FD2A 1U02A 4RBUA 2CQCA 3WQPA 4X4NA 3RB4A 4LF4F 4IG0B 5GAGI 1ZS6A 2UUAJ 1FVSA 2LEAA 5B0BA 4F50A 2Z8QA 3GWCA 5KT5A 2OPPB 4GKKF 2B0GA 3L7UA 1KRPA 2J0SD 2QX0A 1JXVA 1UL3A 1VCTA 3FSXA 2CQ4A 2MY7A 2ZH9A 5F0UA 3NGKA 5KOXA 3FSIA 5CCLA 3UWTA 2JX2A 1RSCA 3PYDA 3OR1A 3ZZTA 2GFFA 4OX9J 2FVPA 2DISA 3CMQA 2BZ2A 1MWQA 3HPOA 4TQRA 1WC3A 3AD7C 2C2KB 3VHQA 1KS2A 1WEYA 3D6FB 4FYXB 1TKZB 2V50A 5L1LA 2C42A 2FUG9 4LREA 2FIUA 2J5AA 2MXYA 4Q44A 2DHGA 2UV8G 3BH6B 3IWXA 2RD5C 2DRDA 3W2VB 4PYAA 2XZWA 3QRPA 2XULA 3D0HE 5EDWA 3D9BA 3QZ7A 3OXLA 3BREA 1I1GA 2R2SA 2XMVA 1K44A 1D9AA 4EO6A 5EGYA 3ET6A 2QC3A 3PX6A 1RTIB 2F63A 3HCXA 4HACB 3BS9A 3TX0A 1YZ6A 3LGMA 1FESA 1HBUA 2C2EA 2HGLA 1VC6A 5B0CA 2GCFA 1FJEB 5DDQC 1GT8A 2QLJB 3ENQA 4DV7F 4DLEA 4H54A 1CC8A 5F3TA 3CWJA 4I6YA 3NGDA 1YJRA 4PAAA 3SXLA 4RUAA 1VRTA 3C46A 1F3FA 4OZJA 4KGKA 1D0EA 2EFNA 3RR7A 3NMAA 4UW2A 2ROGA 3QRQA 1F3VA 2V4JA 1V9OA 4TN2A 9RUBA 4IDKA 2M2BA 3DLKB 1TTHB 3GJSB 4OYWA 2Z30B 1VC5A 3BYPA 2JEJA 2APOA 1VQ6S 1ZOTA 1U7LA 2GA7A 2HZVA 3HXMA 5CZVA 3CCVS 2LDYA 3CMES 1AT1B 1WTFA 3PO4A 5DDPC 2JVRA 4P7VA 5CZXA 1PYSB 3NBPA 2AU0A 4LF7J 4ZVGA 3PDNA 3DMJA 1Y5IB 4V19J 3DLJA 2PEBA 2E1MC 3UI3A 4OIXA 1P1TA 1SV5B 4ZLLA 1OYDA 1RT6B 4JP8A 4KFBB 4JI0J 1N0UA 4DR4F 5KFSA 1R0AA 5A6WA 1TMJA 1TUGB 3AOBA 2GJFA 4JI8F 3G6VA 2BDPA 3KLIB 2LECA 3ZZUA 2H5JB 4RW9B 2WBRA 4MTPA 4F3MA 3OXFA 4CZCA 4NX9A 3TAQA 2V34A 2YXLA 1SKWA 3ISZA 4O4GA 2E66A 5GMEA 3JSBA 4LR9A 1U49A 3P4UB 1FT8A 4OX6A 1S7HA 2A6OA 4DR6F 3CCSS 3M9OB 3FSYA 1VQ4S 4G1QB 2VASA 4UUXA 4DSIA 1NAQA 2WOMA 4HHHA 3OLAA 2HK3A 3DC2A 2GIFA 1Z2LA 4I4BA 2XNQA 4DSLA 2AEMA 4C8MA 1UJ5A 1RT1A 2V68A 3I4PA 4MYTA 1LW0A 3C66A 2HAIA 5E3QA 3JQKA 5IWAF 3BZQA 1YIJS 4B3RF 2CWXA 2XY7A 2SXLA 5I3PA 3MM6B 4I6AA 2OO4A 1IQZA 1RP5A 4Q7AA 4FF2A 3H0PA 3LP0A 2EEYA 3D1QA 3OTBA 3L95X 5A2QY 2YNFB 4RU2A 3FFIA 3PX0A 3WIUA 1EJ7L 2YNHB 3ZNJ1 3T1YF 1DTTB 1UJ6A 3ELHA 3I0SA 3OV7A 4O3OA 1KWMA 2JVOA 3HLUA 5ETTA 3LAKA 4HDHA 4CO4A 2AW0A 1TUWA 3LP2B 3MURP 1M5SA 2DCUB 1NDPA 2HIYA 3M2UB 2OUGA 1S9GA 4AYBD 4J9MA 3RBZA 4I7FA 1NU4A 3DFEA 2BANB 2BA9A 5E2QA 2DGUA 3M8PA 4CYUA 2EBEA 4NEZA 1N32J 2DR6A 3T6JA 1RWWB 1O51A 3HJVA 2M4MA 1CQNA 3KG4A 3CVKA 3KUGA 1NUEA 5HN0A 5LSOA 3AA8A 2CKWA 4ZN1A 3KDOA 2DGXA 1RK8A 2FJBB 1RT2A 4ED4A 3BN7A 4F4YA 4YB7A 2C2RA 4MYUA 2CQBA 3I96A 5KG2A 2GQ2A 3Q0AA 2VA2A 1ZA2B 3K8WA 4CLZA 3I56S 4OX9F 1HWJA 3N5BA 2LQBA 3DGVA 3N6MA 1ZPWX 1O8BA 3BH7B 4X65J 3T5KA 2FZCB 3PEHA 2J7UA 4ETXA 1UZDA 1KOOA 1BWVA 2JLEA 2K3KA 2KXHA 2EWHA 3OJUA 4WFYA 4AE5A 4LFCJ 2V2ZA 2RJZA 2EVZA 2N82B 2HHSA 2R7XA 4HKQA 2DHSA 3WC2A 3UD3P 4J9VA 4PQAA 3TVYA 2CPXA 4PXCA 1RCOB 3C16B 3IG1A 3PRVA 1NCLA 5CYMB 4QYRA 2D3O1 2OIHA 4X4OA 3ZZRA 3RB3A 1WSVA 3ITHB 1SXLA 2KT2A 4NEYA 2YPZA 4WKYA 4W98A 1QD1A 2JSXA 3MPDA 1M1GA 3BBFA 4ES3A 1YZ7A 3GIMA 2G9OA 2DNMA 2B56A 4HVZA 5BYRA 2QG9B 5IT9U 1X60A 4J9KA 2WB4A 2E1RA 3N28A 4CRJA 2CFXA 4QCLA 1HBMB 3QMQA 3EZ5A 4DR2F 3DI6B 2WAQD 3QRRA 2YKMA 2E9ZA 8AT1B 3CD5A 1RTHA 2CPDA 3M1VA 2NXUA 4M5MA 1T9VA 2DIVA 2LA4A 3LW5C 5JMNA 3QQCD 2DEJA 1B70B 1QLNA 1RI7A 4IQXA 2MKJA 4U7UD 4JB8B 1QSSA 1S1UB 1J5OA 2ZDPA 1T8EA 4U67Q 1HNZF 4P2MA 2HVIA 2ABYA 3MD3A 4JBCA 4KGMA 5HMYA 4WBFA 4QOTA 4QW9A 1TL7A 5IC6B 2RQ4A 2XSJA 3RAXA 1RBOB 5H9EJ 1TKDA 3MI7X 3ZTOA 4LF7F 5KFUA 3P3DA 3TA2A 1TL3B 1S59A 1P9QC 4ZVUB 1RABB 4ERDA 1JJ4A 2XEXA 3HM9A 4B3SF 4O3SA 4U96A 4JI0F 3GIRA 3D3CJ 4DSJA 4ED8A 2I2YA 1TL1B 4I2QA 3KJQB 1IKWA 2XM3A 3OL6A 4EFAC 1K8AT 3MEEA 2ZZTA 3FCWA 3O8WA 5CYJA 4RNMA 3NS5A 1JNZB 2V8PA 2EFVA 4NWBA 1MSWD 3HHDA 1AXQA 2DNPA 4K59A 3DLLQ 1DARA 2J9DA 1ROFA 1YKWA 1RLDA 2Y8WA 2C2OB 3QYYA 2JL9A 5F9LA 3ZZ0A 4KRWA 3GIIA 1TQLA 2WZ1A 1KBRA 2XYPB 1UFWA 4KV8A 1XQIA 3KMQA 1XR7A 5H9EK 2ROPA 4C4WA 1XERA 3U02A 1RE1B 2CNKB 2DXEA 2F4VJ 2B3TB 1JLEA 2YWWA 4J9PA 3SQOP 2IBKA 2VPYB 4NMXA 3NWGA 3KDNA 1B0PA 1F2HA 1BQNA 1HL6A 5LMNF 2V4RA 1W2IA 4ECXA 1CJUB 1HWLA 3QBCA 2X3DA 4LR8A 5B7WA 3AOCA 2YKQA 1Q5YA 2LKZA 3ET6B 1IVZA 3EGWB 1X4DA 4LVNP 4FBTA 3G6ES 1OSDA 5M2PA 1RU1A 2IBOA 2MKKA 1HKAA 3ZO7A 2XY6A 3R2DJ 1WI6A 1RBAA 1HBUB 4MT1A 1QAIA 2DITA 1KSPA 2RU9A 2D1CA 3IR6B 4TU9A 3NKYA 1U6FA 4NMLA 5F8IA 3K89A 2J9EA 3CDUA 5CABA 3PG9A 4DS5A 4CIOA 3R5AA 1VRTB 4LFAF 1VK8A 3UNYA 4XK8C 3W60A 2LU1A 2R4FA 3MOJB 1HQEA 1UPPA 1NNDA 4MIAA 2V4JB 2CVEA 2FTRA 4KGZB 1JLGA 3WBZA 2CQHA 3DXBA 4IDKB 1EKSA 1NSQA 4ZPVR 3KKFA 1YJ7A 1HQ2A 2XHWA 4U8YA 2ZJPQ 1Q8BA 3M9MB 2R7UA 3DDIA 1N52B 2O3DA 4DR7J 4DX6A 3OFEA 2V0NA 3B54A 4OI1A 4X65F 2LEBA 4FXVA 2DNKA 2RSQA 2KG1A 3UVJA 3R1HA 4RLEA 5F41A 4HH1A 2CJXB 3NBPB 4DUZJ 1DFDA 5F8GA 2R7SA 4NZ7A 2QLXA 1WG1A 2OPQA 1UWAA 3ILOA 5E0OA 4NA3A 3QSYB 2DPJA 1SB6A 4KGVB 4ILLA 2COLA 2DH9A 2WSCC 1IN0A 2XYGB 1R0AB 1U4BA 2HLTA 1LK7A 3DRPA 2ZBIA 1KD1T 2UVRA 1D9FA 4TQSA 2HS3A 1R89A 4UOFA 2HHPA 3CJ2A 4RW7A 5HVHA 3OLBA 5GADU 2VICA 4FNIA 4O4GB 5KFNA 2RS2A 3NCRA 4USIA 1WEZA 1QM9A 1P6TA 3OTOJ 4J7CA 3A13A 4Y6IA 5C5JA 2CPIA 3L09A 3L4BC 2HWTA 1ZETA 2LA6A 2MZRA 2CNLB 3NWRA 1RWOB 4LF8J 1GAOA 1CQMA 3MM9A 2NS1B 2WOMB 2HBQB 1WG4A 3BGUA 3MPWA 1FX4A 3BDEA 1T9YA 3HK2A 3TJ8A 2VPWB 4XPCA 4LQ9A 4JUZA 5GAEU 5F0WA 2HHTA 1RT1B 2G0CA 2XS2A 4A46A 4M94A 2GW8A 1S1TA 2L9WA 4IH6A 3MUVP 2R7WA 2GGPB 5DZ6A 1NEEA 3MWBA 2EPIA 3NY0A 5D77A 1IR1A 3LP0B 1RACB 3IM9A 2IRYA 2P6SA 4GVBA 3FFIB 1YJTA 2LMIA 1FTRA 4HT7A 2FDNA 1IKVA 3I0SB 2XTJP 1BUXA 5GMDA 4TXSA 2OFGX 2W4CA 3BPDA 3MMBA 4F4AA 3C19A 2PIIA 3QAUA 1S9GB 5E3PA 1N5YA 3W8PA 4I7FB 4ILRA 1XTZA 3L7PA 3IC1A 3M8PB 4CYUB 4NLUA 1R43A 2XCPA 2AJ0A 3CDAA 2XLKA 2CNNB 1KDNA 3F56A 2OSQA 2MPUA 4RZRA 2FLPA 4RWXA 3V4MA 1X7VA 5J2NA 1HNWF 4P2FA 1M0SA 1TKTA 2YKAA 1VQNS 2MZJA 1VQMS 1RHMB 5A8WA 2EFPA 1RT2B 3G82A 2YQ0A 2LLZA 2OTJS 2KRBA 2AGQA 4LF1A 3Q2TC 3NOCA 2BKOA 2XWYA 3PVXA 2IM0A 3MCOA 4U7CA 1ZBTA 3N01A 2PE8A 2ZOGA 1WUUA 3HDSA 2OD6A 1UW4A 2O66A 1PAUB 5EX0A 4G1IA 4IO9Q 3HKWA 1M90T 1YJ9S 4FS1A 1OWXA 1FF2A 4ECQA 1K0TA 2CZVC 1XK8A 3CJ3A 5HMZA 3B4MA 3UR3C 2Y1LB 2W2OP 4M5DA 1RUSA 3MXHP 2IHR1 1FCAA 1DBDA 3LP1A 3M05A 3HVTA 2RE1A 4CO1A 3NRBA 1EP4A 5KFJA 1WC5A 3IG1B 4WFZA 2FLNA 3MCSA 4NLSA 3IWLA 5ETRA 1UEVA 1RTJA 1WOPA 2OMLA 4DV6F 1R8CA 3KOAA 3VCDA 4USKA 4NCAA 1K1QA 5BR8J 1R27B 4CTAA 3CCTA 4EYIB 1VBKA 4KHPJ 4OL8A 4K4UA 3N9UC 3FVYA 4EZ9A 5K8PA 4DR1F 2ZHBA 5JVHQ 4ECSA 2KU7A 3FBFA 4USWA 5IT0A 4URGA 1X4EA 4G65A 3GCXP 3DKDA 4P52A 3UPFA 2F4FA 3PACA 1UEKA 4M5LA 2M8HA 2BKNA 4UZCA 1FTCA 1KVKA 4HHUA 1CVJA 2YKMB 1U8SA 1WHVA 3F73A 3KXDA 3H59A 1AUSL 2BQ3A 4KH0B 3H5UA 1UW9A 1RTDA 1RTHB 5KFYA 4DN0A 2VPZB 4ER8A 3QJPA 3M1VB 4B9TA 4OI2A 1JLBA 2GMLA 3A3NB 2FVSA 3NGTA 4ZLJA 5JJBA 2D74B 1NKCA 3M30A 2WK4A 2KDOA 3RBEA 1J5OB 4YN3B 1RA7A 2ZKTA 1ACMB 1VIOA 1Y7PA 2PMHA 5D4LA 2BABA 4NLPA 2PGCA 1TL7B 2OGUA 3ZTQA 2AX1A 2MY8A 2R2TA 2IM2A 1IQTA 1TV6B 1EKRA 2XSJB 1H3DA 3KLEA 3OFFA 1RDRA 3J7A1 4MAKA 5J2PA 2F1FA 3BQ2A 1PJ6A 1YX2A 1RCXB 3B8HA 4DL0C 1T03A 4WE1A 2Q3PA 3ISND 2GMHA 1E6YA 4FYWB 3KLFA 3X1LB 4ANEA 4LBIA 1W7WA 4DV2J 1BHNA 4PWDA 2KYZA 4OZ3A 5GAHU 1IKWB 4YQWA 1FWLA 5E5NA 5J1EA 1MN7A 4N8OA 4YHHJ 1NDCA 4ZPCA 3MEEB 3GIJA 1VLYA 1WD6A 2Q43A 2OLWA 2UXBF 4IQMA 1V5VA 4EBDA 4KR0B 3HHEA 4DQSA 5ETLA 2MZ1A 1Y5LB 5CHCB 2Q66A 2IMWP 5LT5A 3MEKA 1X5OA 2WVBA 1VR6A 1QY7A 4Q43A 3JTOA 2Z2YB 4DF4A 3GCWP 3CC7S 2ZH1A 3PY8A 1W25A 2RT3A 3NNAA 2AHOB 4LF8F 1VJWA 2JLGA 3EICA 2DHHA 2MJNA 2K7JA 2QN6B 4DPUA 4CLTA 1FHTA 2IJRA 3D0IE 5HO4A 1H72C 1JLEB 1XC9A 4CQ1A 3PEJA 4J90A 5KFPA 2J0QD 2W4DA 3GIKA 1KHVA 2KT3A 5KFZA 1BQNB 1W26A 3TUJC 1XJWB 5KFMA 5KFKA 4RNFA 5J2MA 4E8UA 3R97A 2HNYA 1B4SA 3QT7A 5IS2A 1NDKA 3A8KA 5BYSA 3RU0A 4KY3A 4FZVA 2CUYA 4G6VB 3IS9A 2DR7A 3CCUS 4WWSA 3TZZA 3AXKA 3GFYA 4F02A 1U48A 4QU6A 2J8SA 3QAEA 3RR8A 2C3YA 2AGOA 2YH1A 5IM0B 2UU9J 4ZDNA 4YDDB 1PC4A 1MNEA 4U7UK 4QQBA 3IGVA 2O67A 1RHUB 5C24A 1OIAA 4DSFA 5F8NA 1P27B 2RRAA 1WELA 2NSCA 4DCOB 1SUQB 3OSNA 3T9NA 2ZZNA 2AGPA 2W8LA 3Q24A 2XLJA 1PGZA 1HQEB 2H3EB 2UUCJ 3OFGA 2LVWA 3H4DA 1R8BA 1Y3JA 1RXOB 4C8KA 1JLGB 1SQEA 2ZJRQ 4J5OA 4C48A 3M8ZA 4IO1A 1UVNA 4L74A 2BXJA 3PXGa 3R7BB 5HSPA 1XMOJ 3HFVA 2Y9HA 1KLNA 3FC9A 5KFEA 1UETA 2PI5A 3PW4A 4KAIA 4BBYA 2KFNA 3SCJE 4ECZA 1GMWA 3UVJB 4OLPA 3H5XA 3EYZA 1FWPA 2UVWA 2AYBA 1JJCB 2H5EA 4N41A 2E1AA 3BQ1A 4IOCQ 3UNGC 2JEGA 3TUZC 3AHPA 3UCGA 3FNNA 3Q8UA 3K57A 3Q8VA 3LPYA 3BO4A 3NMRA 2JOQA 3HI9A 2HHQA 3Q8QB 3DCAA 5D4NA 3K59A 3DRPB 5IT4A 1PYTA 4OHZA 3PKMA 4RUCA 2CZ4A 1HI0P 4LF2A 2R9LA 3RG6A 4F3QA 2CJYB 4RW7B 4XTTA 4WTOB 5IZHA 4JI1J 3W62A 4DR5J 3N0VA 4GC6A 1W2BR 2I6WA 3GYXB 2HGNA 1JJ2R 3M7VA 4K2XA 3JS9A 5E3CA 4A4JA 1AB8A 2JC1A 4K5RA 3NP5A 3MM9B 5KT4A 3CE8A 1U1KA 1XNQJ 2NPIA 4L72B 2Y0BB 3QIPA 1YLXA 1OPZA 1U09A 3CCRS 4J9RA 2H65B 2FVCA 2C2DA 4B9VA 5J2QA 1FJ7A 4DQQA 5D0HA 5CH7B 4P71A 1S1TB 3KLGA 3K5PA 2V8VA 2CPHA 2NUUG 4DU7A 1TZ0A 4QPXA 2V2KA 1LFWA 2AJ1A 4DV1J 3CJ4A 1WC0A 4ED2A 2B8QA 1ZTTA 1UWBA 3BYRA 2GVZA 1HBOA 2R3VA 2CQDA 1IKVB 4RU9A 5CXTA 3D6TB 2B9WA 3VAGA 2L9NA 1FKPA 3VAHA 3WDOA 3MMBB 3I9ZA 4UQGA 3BQ0A 3CTRA 1WHWA 3W5XA 4DV2F 2N4DA 1N5YB 5CAAA 2JH3A 3CMAS 2BW7A 2W7OA 1T9UA 4ID5A 2HFZA 3ZFVA 3BSNA 1S79A 4R0JA 1VQPS 3KHHA 4KE5A 4GKJJ 3J81j 2AJFE 4DX5A 4ZVSB 4P2XA 2J0XA 1LW2A 2B5JA 2MHEA 5J2NB 1LV5A 2VC1A 2OKQA 1TKTB 4MMOA 5J1PA 3QGIA 5A8WB 1B3TA 3KK3B 3G82B 1I5OB 4FVMA 3W8GA 3HHLA 1ZZFA 1ZAXA 1P1LA 3EX7B 1SQFA 1SKSA 3OW2R 1NKBA 4AFFA 1VQ5S 3CJSA 3MM8A 2DHXA 3MUMP 2DKOB 2DGOA 1V3ZA 4A8FA 1FD8A 2W24A 1VLOA 4FN5A 4MJKA 4QYZK 3EVWA 3UN5A 1VRUA 3H98A 2GIRA 4AQYF 4F67A 2ZNYA 4WCEQ 2H4WB 4YY3F 1RAIB 4M5DB 4RL1A 5KFBA 2Z0GA 4NLTA 1YBTA 1VJQA 3LP1B 5D0GA 3HVTB 4IKAA 5LMUJ 2CZ9A 3THVA 5LSRA 2XLIA 4DZ6A 1REVA 4A48A 1NBEB 1EP4B 4C98A 3NGSA 3KG1A 2ZC3A 4DQPA 3TX8A 3UQSA 4NLRA 2OEJA 1FRLA 4QWAA 3H2VE 4IFYA 3RB6A 1KNZA 4NLDA 5IQQA 5AXKA 4K0KF 1SVDA 4QR1A 2V67A 1EIYB 2G4BA 4CTAB 2QRRA 5EN1A 3MHYA 1VBZA 4BWJA 2YNGA 2G13A 2FZGB 2UUBJ 1N48A 4NCBA 1N5SA 3TUIC 4LSNA 3PW2A 5H1SV 2BJ8A 2YX7A 2DGTA 3SSSA 4I56A 4NRTA 4HLBA 3G9CA 3R6GB 3KUHA 1AZSA 1K0VA 2ZM6J 2JLFA 1RTDB 1G1XA 4WU3A 3HVRA 5CD4A 3H90A 1JLBB 3Q8YA 5K9FA 2IDEA 4JOUA 5EHHA 3M30B 1TK5A 2POKA 1M5HA 2E5LJ 1PSDA 4WU2A 4YR3A 1DQAA 1S7IA 2GJ2A 1U1PA 3BM7A 3NG8A 3M8RA 3PIOQ 5D8HB 5F8HA 1U2RA 2KHDA 3UCUP 1V6HA 1RISA 4QWDA 3TJAA 2RDIA 4HACA 2NYHA 1ZH5A 4JYAJ 1WI8A 3KLEB 2YWEA 2ILZA 3BR9A 5J2PB 2EK1A 2KM8B 3BBCA 1S72S 4OYIA 3K58A 1YI2S 5DJBA 1T03B 5HJXA 4WE1B 4Q5VA 2QFJA 2MKHA 3PYGA 1E6YB 1ICEB 3KLFB 3PIPQ 2LDIA 2QGFB 2CVIA 1S1XA 2IVFB 2QLFB 4PWDB 1NH7A 5HANA 3UDLA 2V2VA 4ED7A 3D5MA 5J1EB 2A3JA 4LF6J 1SC4B 1LWFA 4L73A 1JLCA 3S6EA 2IIHA 1L5UA 1KKHA 5I4MA 4QPTA 3DN9A 4JI1F 3DLGA 2HZCA 1Y9OA 3LAMA 3OQ2A 1BLUA 1BY9A 1RAFB 3A12A 1S49A 2IRUA 3PYFA 2CRLA 3T5JA 2KI2A 1RT7A 4ZHRA 1Q53A 3T6BA 1FNOA 3DXSX 2X7IA 1XMQF 3DRXA 3M2VA 2OTLS 4FF3A 5KFDA 1WWHA 4DV4J 3I87A 3J7AN 4USVA 2HEKA 4ZCMA 3D2WA 2R42A 3M6UA 3SCKE 4Z37A 4A47A 1Y10A 2BMBA 1XNQF 4NI2A 3LOUA 3TOQA 1WNEA 1PKUA 1T0TV 2J6UA 2VIHA 2OPSA 2RH3A 2WONA 3OD2A 3CCQS 4MKBA 2GHVC 3LANA 2AF6A 2K06A 2U2FA 1X5PA 4LIWA 1NJYA 2ALYB 4HDGA 3SV3A 4PG7A 2ACYA 4OFZA 3CO9A 3BV8A 2ZHOA 3R5JB 1RBLA 5J2MB 2H9ZA 2RRNA 4DV1F 2HNYB 2UUTA 4ZA1A 1KTQA 3LWLA 1WOOA 1C0UA 4MKYA 3U7JA 4FDFA 3K5OA 2FHMA 2ZBCA 4DV5F 1IR0A 3O2IA 2EG2A 4KJIA 3IS9B 5I3QA 1X4FA 1PILA 4X4UA 3F41A 2ZBRA 2DNNA 2ZFHA 4PXBA 3MEGA 4BDPA 3C14A 1APSA 2G2YA 5LM7E 2IJFA 3EWGA 2BE7D 1HW9A 1RWMB 2YNIA 2DGSA 1S6QA 4P75A 2W9BA 3VGSA 4PCQA 4GKJF 2C28A 4F2SA 4B9MA 3UN2A 3KHRA 5C24B 1C1CA 1K73T 3G86A 4LJMA 2OEMA 1CG2A 1RHQB 1GXUA 2N7YA 4H4KC 1N36J 3KLHA 3NAHA 3BBBA 2I38A 1FO1A 2GNKA 2HS0A 3RJMB 2XBPA 1KTVA 2BOAA 2YPYA 2CPEA 2BEFA 2YKPA 4LRBA 4J9NA 1N5VA 3SFGA 1S1VA 2F7VA 4Q8FA 4F04B 4ZN3A 2HQFA 3W1YC 4F2RA 1S12A 4FYVB 3QWPA 2NREA 3VAIA 1CLFA 2RILA 2IYGA 3KHLA 1FE0A 2YNHA 2YQ3A 3J7YI 4EU0A 1G3OA 1XNRJ 3PRBA 1KC8T 1X0PA 3RW6A 3AT1B 1QTMA 4C8OA 1FFWB 2HVZA 5DO2A 4Z2XA 1AROP 2MGZB 3CDBA 4DV7J 4EBEA 3PJWA 5KG6A 4X4SA 2W2NP 2W2QP 1MROA 2QA2A 2QMWA 5HVGA 4F4WA 2LXFA 1B7FA 1ITPA 1S0VA 2D9OA 2KKHA 5KFIA 2MQOA 2NZCA 5KOWA 2EK6A 4WF9Q 2UUBF 3ADAC 4KO0A 4X62J 5E41A 2BRLA 5HMWA 1VMBA 5D4OA 1UVIA 3WC0A 3N5FA 1UEUA 1SPBP 2QSWA 5KFQA 2MSSA 2DNOA 1RGVA 2RAQA 5CA5A 5D6GA 1U2CA 4F0HA 1YRUA 2KHCA 2WVFA 4ZIVA 1HI8A 1IUJA 4FBUA 2UP1A 2J0WA 3QIPB 4WYLA 3AJ2A 1WOSA 3PYEA 4OZ0A 2ZUAA 3Q83A 4F26A 4TU7A 4DPOA 2G2OA 3CNQP 3SI8A 3K5MA 5J2QB 2R8JA 1F6TA 3SQGA 4J91A 4X4TA 3D66A 4NA2A 2GMJA 3KLGB 4B3OA 1F5BA 4LBHA 2XZDB 2VQEF 3ENWA 2H5IB 4I6WA 3TJ9A 3VAMA 3BB5A 4P10A 2ASYA 1WC1A 1UVKA 1ZPVA 4ANDA 3CCES 2OPRA 1D9DA 2ZH4A 4JI8J 4ILMA 1UA0A 4O3QA 1UWBB 3EUNA 1MLAA 3NOGA 4DL6A 1S99A 2WVEA 4AL5A 1HBOB 3M6VA 4DI6A 4ICLA 1IBLF 4KH1B 1HI1A 3R7NB 4MKAA 2AKWB 3BSCA 2HBRB 2E1CA 2CAJA 2C3UA 3EDQB 2DO4A 4UQTA 4Y2KA 4ID5B 3UD5A 1NK5A 4XAKA 1Q5VA 4DL5A 3CW2C 4LF6F 2K2PA 1RHKB 1NK8A 3M32A 2K7KA 1LW2B 3S1TA 2B5JB 3KUEA 2HMIA 2HGMA 5KT6A 4HHJA 2IC3A 5KG3A 2YTCA 3H7HB 2WSEC 4KBIA 2I1RA 4C0OC 1BQMB 3GJQB 2W8KA 2FY1A 2MTLA 3K7RA 3PR4A 3ENVA 1M5VC 2P6TA 3HHLB 3RRHA 4JI4J 3GU0A 3MM8B 2M3DA 2RS8A 5IWAJ 4B3RJ 2B4PA 2DNYA 2O1PA 1SIZA 1BQXA 2F65A 1S97A 5ETOA 4C8NA 1VRUB 4J9QA 5GAGU 1M1HA 3KNGA 2B8PA 3RB0A 4WXWA 1T05B 2PSZA 3DLBA 3CSKA 1PC5A 4X66F 1WF2A 3TWZA 2VDHA 5DG7A 2Y0SD 2J7KA 3MCNA 4F3OA 2HQCA 2WHOA 1REVB 4DCJB 1VIXA 2BJ3A 2WB1D 1RTZA 2R8HA 1D3WA 4ECWA 1V3SA 4B17A 2GHWA 4A8SA 4IFYB 4UZBA 1UVMA 2X1BA 4ZPWR 3TEGA 2VG6A 3VALA 4NXMF 1ELOA 2ASJA 4LR7A 4TYAA 1C4AA 1CC7A 2ASLA 2YNGB 1RA6A 2A1BA 3DDNA 3E8OA 1GMVA 4KB7A 1Q86T 4LSNB 3WX8A 2KRRA 2NXJA 1Y4ZB 2P9GA 4UUWA 5DM6Q 2QA4G 2PD1A 4USMA 3T1HJ 5M2UA 1TK8A 2CPFA 1AZSB 4M63A 2EI5A 3KTQA 1FI4A 4L3KA 3R1LA 4Y0FA 3K0JA 3TR5A 1N36F 2L48A 5HJYA 3DDKA 3MZIA 1JKHA 1KQFB 2E44A 1Q16B 4JI3J 5A2QU 2FJVA 2GQQA 3ZTSA 3FRZA 1FRMA 3CD6S 1FX2A 4N8NA 3C3LA 2A0FB 3RRGA 4MFBA 2IRXA 4Q45A 3VR1A 1MMNA 4USJC 2VODA 5T7LB 1CJUA 2VA3A 4W90B 2E7WA 2UV8A 2OAUA 3S7RA 2N3LA 1URRA 2XGQA 4IH7A 5KFTA 4TY8A 4DL3A 1NRKA 4M5JA 4L6V3 4K2JA 3C15A 5THWA 4ES2A 2FGCA 1RU2A 1XNRF 1HMVA 2DNGA 2QL7B 1KOHA 4CLUA 4BWMA 1Z4UA 3TNVA 4YFUA 1NDLA 2BJ7A 4CT8A 2EFOA 4QJVA 2L3MA 3MPVA 3A8JA 2RU3A 3SEOA 4CM0A 3KK2A 4LIRA 4CLPA 4DN9A 1Q7YT 2E7XA 1IBKF 5DETA 4LBPA 2PDAA 3M8YA 1H6KX 1S1XB 3MR2A 3SFUA 1VGYA 3EPIA 4J9SA 1P9YA 5KT2A 3D1OA 4DR2J 2I8EA 3CD0A 3G8TA 1LWFB 2AYGA 3H2LA 1JLCB 5HQLA 2E1PA 4PRFA 4LT6A 3FJ2A 3PJXA 1NB7A 3DLGB 1TP7A 1T9WA 4X62F 4WJBA 4CDIA 4WIQA 3CIMA 1RT7B 2C3PA 3MTJA 4ZHRB 2X1FA 4BCAA 2EFQA 3MECA 1S77D 1R0CB 1HNZJ 3FUYA 1QE1A 3M2VB 2DB1A 3R8YA 3MM7A 1VYAA 2RNEA 3U27A 4FXDA 1S48A 4OJGA 2Q1LA 4NI2B 4NRUA 1OY6A 3RZAA 2LQ5A 1GX6A 1F9FA 4P74A 2OPSB 2WONB 1UZHA 1J2VA 2ZBPA 3SSQA 3LALA 3TZXA 2RB7A 4CLFA 2FC8A 4B3SJ 2MMYA 2UXDJ 4W92B 2FQQB 2QMXA 1AA1B 3MD1A 4K4SA 2PO4A 4PKDB 1NJXA 2HNZA 3GILA 2VJVA 1R8HA 1EETA 4F36A 4FKXA 3CJQA 1C0UB 2E5IA 1RKJA 1VISA 2MQLA 4RUBA 1O0PA 4A8MP 2ZH7A 2ZWPA 4RUHA 2BW2A 4B3TJ 1RAOA 1FKOA 1EQMA 1HWUA 3MEGB 3C14B 4XIUA 3A4TA 4Q0BA 1RWXB 4DHVA 2AYMA 2YNIB 2ZUGA 4HTJA 1S6QB 2JNJA 1JNRB 2W9BB 2V9WA 4CM2A 4MK9A 1C1CB 3TZWA 3L3CA 3DM2A 2OP5A 1ZA1B 2B43A 4WK3A 3GLJA 2R8GA 2GO9A 3T9ZA 3DU5A 3KLHB 3P49B 4QR0A 4DR3J 4CO3A 4JI4F 3VZIA 1LWEA 2HQGA 1NJZA 4ZVEA 4KKOA 5E7OB 2HHWA 1N33F 2FGOA 1S0OA 1F5AA 5LMNJ 2GGPA 2EC0A 2MKCA 1OQ3A 1S1VB 3RAMA 4X64J 5D0RA 2MKSA 1XR5A 3POTA 3MMAA 4LUBA 4B9NA 3CUNA 2LU2A 3GG1A 4C8LA 1Z1ZA 2V6AA 3P45B 4OYPA 2CDQA 4DPYA 3JQMA 2CYYA 3E51A 4RW6A 1S6PA 1U0HA 4DUYF 2W4PA 4NL5A 2K3IA 1NHVA 3ETMA 4YOEA 3MOZA 1KFSA 5KFHA 2LXUA 2CWKA 2B4VA 3OJSA 2C22A 2DNRA 2LQJA 3HZEA 3V5RA 2HVEA 3HZGA 3TI0A 1K1SA 3PNIA 4CT9A 1NKEA 4IFVB 3R6LB 4UOCA 3PFOA 3ISNC 1MROB 1T11A 2AWZA 5E3AA 5DZ7A 4LFAJ 4DDFA 1UMJA 5HP1A 2MKYA 2YWKA 4URQU 3BO3A 3GE9A 3MAAA 3AAWB 5L1JA 3IXQA 3SCIE 2J8AA 1JX4A 5KFCA 1OPIA 2RMLA 3EMTA 2XS7A 4KO0B 2ALZA 3C6TA 4V1Ak 1H2TZ 3GFHA 4Y00A 1TR0A 2J7WA 1JXLA 4X4VA 1LWCA 3VZHA 2HWHA 3T1HF 4LFBF 3R9LA 1H0HB 4ZPAA 4ZPBA 8RUCA 3PCOB 3QATA 2VD3A 1VOMA 2MDAA 1DLOA 3UCZP 4JI3F 3ZTRA 4U8VA 2XO7A 1FJGF 3G2XA 3PJ9A 1NPRA 2FJAB 4Z7YA 3SQGB 1FDNA 4ZP8A 2VFVA 2VJUA 5DG8A 4B3OB 4ELUA 2DGVA 2LCWA 3ENAA 5HL7Q 5D78A 2O01C 1FNXH 1R8PA 1RWVB 5A8RA 5B08A 3GQCA 3VGVA 3WHIA 4U6PA 2H1YA 2OPRB 3SZ2A 3JB9k 3V6HA 1AUDA 1U26A 1B7YB 3I5BA 1NSPA 1U6BA 4M5HA 3BR8A 3M8QA 1XN9A 3AQOA 4ICLB 5KFVA 3CIZA 1CBKA 2MLZA 2GAGC 4OI4A 3CDWA 3IO1A 2G0IA 4ELVA 1BWEA 1SCJB 1M5OC 5AE3A 1N0VC 3NAIA 3E01A 2B9XA 4XO0A 3GV8B 4DL2A 3IFEA 1DAXA 3R7SB 5CQGA 2QYGA 3FQLA 3AFGA 2VQFJ 1DQ8A 3M32B 2YH0A 1MU2A 2XYHB 2HMIB 5IOLA 1AYEA 3TQ1A 2M8DB 4OHXA 2IC3B 5FLXY 4NLYA 5G4DA 1UTAA 3QIDA 2FY8A 2P5VA 4DS4A 1WHYA 3FMBA 1PAEX 2AYEA 1S9FA 3JTNA 3PTWA 1VC0A 3HMJG 4ENOA 1QJHA 1SJ4P 4WZQA 1URNA 1NHKL 2QL9B 4RNOA 1F9EB 3GP9A 5KG7A 4GC7A 1Q0NA 2Y3YA 4YB1P 2PA8D 4OJHA 1TV6A 4NLWA 3P96A 3R5GA 4FYYB 2BM1A 2XS5A 1CS4A 4YEAA 4NXNF 1XWLA 2WW4A 4KGXB 3HSGA 4E2FB 2UXDF 3D0GE 1Q81T 5KFGA 2Z57B 3AA9A 1P8GA 4USUA 1X5SA 3D3BJ 2XI3A 4X84A 5A0YA 2VOOA 2A18A 1KP6A 5KFLA 3D6HB 2BM0A 1L3VA 3DLHA 1HNWJ 1FDDA 4JI5J 1FWKA 2VG6B 1X9MA 2IFXA 1FVQA 1FXRA 4B3TF 3SCLE 4PWWA 2Y1JA 2BE9B 2DRBA 1FEHA 5H9FJ 1TAUA 3AB4B 2W9CA 2LEPA 2VG5A 5KG0A 1WKLA 3RBXA 1JQGA 4HI2A 3FZBA 1HD1A 4Q2LA 4HT5A 1X4GA 4DZDA 2ZVSA 5ETSA 4QBUA 4M5NA 2W2MP 3I5AA 3SV4A 4LRFA 4ZP9A 3G71S 4JI2J 4DQRA 4EUVA 3BGRA 3IRWP 1JKHB 1FRXA 4DR3F 1H73A 1JXEA 4ECUA 3G8QA 3CB4A 4E0DA 3JSRA 2MQMA 1WJ9A 1NJIT 2L08A 4MFBB 4HEA9 4O3PA 3BN4A 1H2VZ 4X64F 1WHXA 2XI2A 1Y3KA 2RQCA 1RJJA 4TY8B 3MEDA 2HW3A 3MAQA 1HNXJ 1VQYA 4OYXA 4PQUA 4DV6J 3C15B 1Q78A 1D8YA 5DGAA 2DK2A 4L75A 5H9FK 1HMVB 4GMKA 5B0FA 3BJYA 4Z7CA 2W9AA 1PJ7A 2F8MA 2VBWA 2BKPA 1H7XA 4DR1J 4DFKA 2NYIA 3KK2B 5IM0A 1Y00A 4H4MA 4OYZA 1MWZA 2CG4A 2CA9A 5HK4A 1PG5B 4Y28C 3CCWA 4OX8A 2BJEA 1UFLA 1SUQA 2GV1A 3DRRA 5ETPA 1AFJA 3DOKA 2CQIA 2OMOA 2WBMA 2V94A 4DX7A 1ZM2A 3FCHA 1VRQC 2Y1IA 2ZH5A 2CG8A 2CADA 1JLQA 2D7SA 1PJ5A 2VONA 5HROA 4WFXA 2UXCJ 2KVIA 2CNOB 3MECB 1QE1B 2AQ4A 1VFJA 2VH7A 2LQ9A 4DXLA 5T14A 4CNYA 3MM7B 3AQPA 3FBBA 2KZZA 4I69A 3AY0A 2XWXA 4O3RA 2M52A 4HYKA 3OBIA 1VBXA 3H40A 3US5A 3GSIA 1Q79A 3N79A 4P73A 3T19A 3RRKA 2BBEA 4RW4A 4IUFA 4RNHA 4R25A 1YJUA 3PFEA 3MR3A 4TYBA 1N34F 1RLCL 3AB2B 3D1HA 2FVRA 1MG7A 5EWGA 1F1BB 2IY5B 2HNZB 4PXDA 3PX4A 1EETB 4UOHA 6AT1B 3KK1A 2BACA 3IWNC 4QIVA 4DL4A 1REGX 2M9KA 4PWUA 2UXBJ 4S0MA 1FKOB 2OELA 2V2QA 4PUOA 2ZE2A 4I2PA 1SQGA 5B0DA 4PXEA 1IXKA 4Q0BB 1MMLA 2NQPA 5KFAA 3TYTA 1RWPB 1HARA 3HF5A 5L46A 3MCMA 1IM6A 2VQFF 4QWBA 3QFHA 2N4CA 3DM2B 4B02A 1WG5A 4OHWA 4ZJQA 2E9RX 4EO8A 1SH0A 1WORA 3S8SA 3VTIA 3E2EA 4Y2CA 3R27A 1LWEB 1RAEB 4G3IA 4BC7A 2C3MA 2GHPA 2F40A 4KKOB 1H98A 4OZNA 4ZIWA 2HHUA 3MPYA 5B0GA 3O6QA 1LEOA 1HHTP 2BJDA 2DNLA 5T41A 3FBCA 2EC2A 3POTB 3MMAB 1GXLA 2R7TA 1S9EA 3OHBA 3HSDA 2KJVA 1U8WA 3MR7A 3CCZA 3BKUA 4O0NA 4RW6B 1S6PB 3LQVA 1U0HB 3NNCA 2CDRB 2KXFA 4USHA 4DBQA 3GR0A 3NGUA 2HLUA 5D0EA 4I1TA 5C2GA 1YG0A 2ZEJA 3VGTA 2NUHA 2PFDA 2R2UA 4R8UA 2HFVA 4NZ6A 4ZMMA 3D54A 1RAHB 1UJ4A 2MYFA 3PHEA 5ETNA 1KQKA 1GXTA 3IBCB 1XMBA 4DCPB 4JI5F 3QGPA 3W66A 3TP2A 5K5MA 5HP1B 1C0TB 3OTDA 3HX9A 2DEIA 2MQQA 3MAAB 3KK3A 3V6KA 3CC4S 1RAJA 4LRAA 4FPRA 1T3NA 1FEEA 3C6TB 2W01A 3AODA 5LXRA 1OSCA 2MZQA 1RHJB 2M7SA 4V19X 2ADBA 1PBAA 1LWCB 1FJCA 5CD4H 4ES1A 2GVDB 2X1AA 2H54B 4WFNQ 2DY9A 5GVQA 2CIMA 4JI2F 2RQMA 3CJ5A 1DLOB 3VQTA 2MZTA 2CXEA 2ILYA 1NXIA 1N56A 2MLXA 1CSJA 2W7AA 3H2UB 2B4OA 3TVZA 4HR2A 1VI7A 2JJ4D 1VDHA 1L3UA 4WP9A 4OZ5A 1S1WA 4K4ZA 1B99A 2KB2A 3GYNA 4I64A 2EW9A 5B0EA 1C2PA 5K8NA 3UDVA 2R8IA 5A8RB 4DF8A 3QNWB 2ZKUA 1HNXF 3QLHA 1Q8IA 3KMSA 4ZPTR 4F4XA 2JEFA 2UZAA 2DXDA 1N4LA 2BJ9A 4LQ3A 5ETKA 1C1BA 1HNIA 4JV5J 3CPWR 3M8QB 3RYLA 2G0JA 1YQHA 3G87A 3THPA 2JWNA 1JLAA 3HSZA 4D3GA 5U47A 4OHVA 4HI1A 2IAJA 3E01B 4RW8A 3IRXA 3ZZZA 4O23A 2CQ0A 5K14A 1GTEA 2CQ3A 2DXFA 2KO1A 2HIQA 3BDPA 4UF4A 1MU2B 3UD4P 3EE3A 4DU8A 1FRIA 2AEJA 2X51A 2IVYA 1CJKA 3DOLA 2HYIB 5DLGA 2OHDA 4JI7J 4PG8A 1A0OB 4DG1A 2D9PA 2VB6A 2FJEB 2UXCF 2E29A 1IR2A 2VBZA 4CO0A 4B3MF 2GO8A 4TNOA 2ADCA 3DHXA 2OH2A 5L9NA 4DV0F 2QE5A 5HVFA 5EWFA 4NYOA 3CCJS 4TVAB 2YVSA 3O44A 2B7BB 1UVJA 4MK7A 3A8IA 3NLCA 2HPUA 1M5KC 3S01A 1TAQA 2AP6A 4QWCA 3T5HA 1CS4B 3MPUB 5FD1A 2P9CA 3PKYA 4ECTA 1TK0A 4OHYA 1CJTA 2EXUA 1X31C 1TKXB 1JJHA 4PR6A 3VAKA 3HT3A 3DNCA 5A0YB 3MMCA 1UPMB 4CH0S 2W7PA 4UT4A 1VQLS 3H42A 3IAM9 3CJ8A 4I68A 4HH0A 3JSMA 2PI4A 1I94J 1VQ9S 5IQ6A 1X4HA 2D3ZA 2W9CB 5HLFA 4F4ZA 2VG5B 1MWYA 1KQSR 3MM5A 4KIAA 2YX1A 2HSEB 3QO9B 4OLOA 5IC4B 4QIWD 4I67A 4IRDA 5HQ8A 2ZITA 5I3UA 2OEKA 2JHEA 4AQYJ 5BXIA 1KEKA 3BGRB 4RJVA 2UUAF 1QAJA 3C2PA 3ILIA 4YY3J 1GX5A 3KWMA 1U25A 4FXWA 1TU0B 2VZ9A 3OTCA 1NK9A 3JXOA 3Q2SC 4O44A 2DGQA 1TMMA 2FLOA 4O4RA 3MEDB 4J9OA 4PQUB 2JEIA 5C7PA 1Q82T 1S76D 3LUYA 2LP4A 4N76A 4K0KJ 1FERA 2XB2D 2W2PP 3PHTA 1LXJA 4ZVRB 2YWGA 4WFBQ 2ZBQA 1QTNB 1I3OB 4C8ZA 1NJWA 2EKYA 3CO0P 4XDDA 3HULA 4W4MA 4J9LA 1R6YA 4ED3A 2ZOFA 4YDXA 2KT5A 1HWKA 2ASDA 3OTEA 1F5CA 1S10A 2HRUA 1HYSA 4H4MB 4A8OA 3C6UB 3I31A 4X4RA 1Q7LB 2ZDOA 3MFIA 2VHGA 1N6QA 3MMJA 3DRRB 1GFWB 4KQZA 3DOKB 2ATLA 4MIWA 2FHJD 3GMGA 2MQ8A 3N6LA 2ZD1A 4DEZA 2M5YA 4F0KA 3NGRA 2KN4A 4OJ3A 1HBNA 4PEOA 3OT9A 1IKXA 1JLQB 2NLWA 3TARA 1JK9B 1N88A 4JI6J 3W3SA 1JB0C 5HROB 2VU5A 3C8YA 2GQCA 2DNZA 4RBVA 3I4HX 1R31A 2CQPA 4B9LA 3GJRB 4ED6A 4XPEA 3Q89A 5F8LA 3JQJA 3FMWA 2Q6CA 2WSFC 4K8RA 4RW4B 1Z2ZA 4WP8A 2RUGA 2R7OA 2PMWA 3T3FA 1ZTWA 2DH8A 2DYAA 1V3RA 5C42A 4P6QA 3KHGA 4M5IA 1XBWA 2MGZA 1NO8A 3QGGA 2MZSA 1IKYA 2DIUA 4RPFA 2XO6A 3Q8RB 3HVWA 3TQEA 3ZZYA 2AJQA 4ZVOB 5EUHA 5LXYA 2M0GB 3QT5A 2Q6BA 3KK1B 5D15A 1YJVA 5K8MA 2VBYA 4JV5F 1NK7A 3CDEA 3EVOA 4DQIA 3Q86A 4BC9A 3FCVA 3OSPA 1B64A 4C2MA 2VFTA 5LL6d 5LJ3Y 4PUOB 2ZE2B 4I2PB 3NS7B 2K8GA 2LYVA 2CPJA 3UO0A 2MEWA 4EWTA 5G0RA 5K20B 3MGJA 1FRHA 2RDJA 3KJVB 1ZAVA 3V81A 1QDUB 1XMQJ 1KLMA 2G2ZA 5HAOA 4X2BA 5ITHA 4OZ2A 4QW8A 3PW5A 3HKZD 5DG9A 2RRBA 4GRSA 2XMWA 3Q8SB 5HQMA 1FDBA 3HHKA 4WYWA 2OSRA 4DPWA 2V8HA 4A8WA 4ED0A 1OS5A 4JI7F 1NMEB 3GFXA 4U95A 4X4PA 1YJNS 2HNDA 2M88A 4ECYA 1DTQA 4OV6A 2MLYA 3J81U 1FFGB 3W64A 3GV7B 2V8DA 1AW0A 4L76A 3KNAA 2F5GA 4UY85 1HQUA 2XNRA 1RT3A 2MHNA 2WTFA 2PA3A 2HHHJ 2DR5A 1S9EB 3SSRA 3OR1B 2XC9A 2GZOA 4DLGA 4ZCIA 3V4IA 1WF1A 4K4TA 1QVGR 4ZLPA 4DV5J 4TLQA 1SC6A 4F25A 4FYDA 3AD9C 1A6LA 3AD8C 2GS8A 1RADB 2CQGA 2ERRA 1FK9A 3VVTA 2BOPA 4ZJLA 1X9WA 1IWAA 4IRCA 2AZ3A 4CLWA 4R8UB 3MF5A 3SYZA 3TANA 3IM8A 1K47A 1ZAWA 3P6YC 2ZVIA 4EEYA 1TFYA 4C7QA 3NCQA 4BLGA 3ONQA 4NLVA 4N56A 1X9SA 1NK0A 1KR4A 1O6XA 3EVMA 1I94F 1BQMA 3RBDA 1OY9A 1VHIA 5E3RA 4K50A 4CLYA 1Q95G 2JFKA 4QWEA 2FJWA 2EFGA 4ELTA 1TELA 2PC6A 3TRGA 2YWFA 2VL1A 4DJBA 2JC0A 4M1KA 2FB0A 1UA1A 4LRCA 1SJ1A 4G1PA 2NXCA 4C3KA 2HRTA 1RWUA 4N7TA 2XMTA 1N32F 1T05A 3AJDA 4XDCA 3IR7B 1LFPA 1ZM4A 3BKTA 1HFEL 6FD1A 1SL2A 3B4DA 3D4JA 2C2ZB 4ZJOA 3I0RA 2D3UA 1I6JA 1X4AA 4F7VA 2KH9A 5L1IA 1S1WB 1R3NA 4PG5A 3H4BA 1U1RA 5IT9Y 4FS2A 2KZMA 4OJ1A 1GQEA 2HKEA 4NYPA 3Q22A 3UDEA 3IAS9 4NCGA 4KHRA 3QLHB 4NYZA 1U1MA 1LKZA 3V2UC 2H51B 3GTYX 4NASA 5AT1B 1C1BB 1HNIB 5HBMA 2I9SA 1S57A 1IM4A 4CI0B 2QT7A 4PPZA 1JLAB 3LGHA 4Y65A 4LFCF 3R3TA 1YVFA 1QSYA 3BGFA 1Q1KA 2IAJB 4RW8B 3DMJB 3IRXB 4QR2A 2I0XA 5RUBA 4ZCLA 5K14B 4ZVFA 4EBCA 4OQJA 4IR9A 1U0SA 3I32A 4B9SA 3LGNA 1T9TA 3H8YA 2Y8YA 3OVSA 1SL0A 1MMDA 4EYHB 2XMAA 3F44A 1CJKB 3DOLB 2C3OA 3PW7A 4DG1B 4JV1A 3BO2A 4JI6F 1VQOS 4ZK7M 2IYIA 2ZOMA 1X0FA 5T7LA 3H25A 2D3OR 2GAHC 3GONA 3GR1A 4NLOA 3TEHB 4YR0A 2VQEJ 2F9DA 2QLBB 4RR5A 2J76E 3KG0A 1MW7A 3BF4A 5KG5A 2A6MA 4OZLA 2XQCA 4OI3A 2NPFA 3CCMS 2MQNA 3G4SS 4OX7A 2ZC4A 5DDOC 3ILJA 2KM8C 1SJRA 1F9HA 5IV3A 3J81Y 5HI7A 3GSDA 4WPAA 1IBLJ 2QLWA 1S0NA 1I51B 3SIPB 4EGLA 1X5TA 3OR2A 3KFWX 3VQSA 1A7GE 2VV5A 1NSKL 4GO7X 5GADI 1CJTB 3EGVA 4NOHA 2CJAA 1LW0B 3DLEA 1JLFA 1CJVA 2BVZA 4ZPDA 4AL6A 1SC3B 2Z56B 4ZP6A 3MMCB 5FDLA 3MDFA 4Q8EA 2U1AA 1SJQA 2ZWOA 4FF4A 4OMFG 2RF2A 4DFMA 2RHSB 4C11A 4A8YA 3CGIA 3ZNUA 4IR1A 2OFHX 4DV3J 2RUSA 1F60B 2FVQA 4KPYA 3JSMB 1T7PA 3JYTA 2FC9A 1NPKA 3G8SA 1U6ZA 5HLFB 4RX6A 1FXDA 2EKNA 5HATA 3MM5B 4AXJA 1WKKA 5GAEI 3G96A 4DOZA 3CD7A 2KYXA 1WTBA 5A8KA 1RT4A 1VQKS 5I3UB 5F9NA 2E9TA 2QA1A 2FJXA 1KVJA 3CJRA 1WC6A 2DRAA 3I82A 1NZAA 2DD8S 2CQ1A 4AD6A 4TY9A 1YJWS 4J9UE 4IG3A 2JFDA 4X66J 1KQGB 3U1LA 1KFDA 4CLKA 3Q8PB 3EXYA 3CEDA 1FRKA 2ZH2A 1YRXA 4Y3CA 5AE2A 1E6VA 3AH6A 1S4EA 1JWWA 3BSAA 4GO5X 4LSLA 3V6DA 2ZHAA 3R5DA 4BS2A 3LTOA 1GTHA 2PN6A 3DGPA 4O44B 4UY8T 2HHHF 1FXLA 2ZNZA 3EGNA 1T94A 3OXGA 4OI6A 2RIJA 1L3KA 4BHQA 2Y1RI 1S0MA 4M5GA 4TLRA 4Y2MA 5L9XA 4NXMJ 5BYQA 4NPOA 2F4VF 2QJ3A 4DUTA 3W7BA 2YBVA 5KFOA 3ZZOA 2XZTB 3FEYB 3UFCX 5DQHA 1IWGA 1HYSB 4EMDA 2BYCA 1UP1A 3TUPA 4MK8A 4CWBA 1RT5A 3CULA 3FZ2A 1OY8A 4CLLA 1N6QB 2CJQA 3EZOA 5DM7Q 3J7YU 1SJFA 3THTA 4R5PA 3HP6A 2I5JA 2ZD1B 1M1KT 1HBNB 2IA0A 4I0WA 1IKXB 3BEGB 2ACMA 1TL4A 1G6BA 2IPOB 2CPYA 3W9HA 2E7VA 2E5HA 3VWSA 1F2GA 4CH1A 3MUTP 3LA0A 2AD9A 1R6VA 2QIFA 3QWUA 4WZMA 2A10A 2Z2MA 2GIQA 2V9KA 4KTQA 4QIFA 1X4CA 3BGOP 2MB0B 1NSAA 1FDAA 3H5YA 1VQ7S 3CCLS 2YQ1A 5ETVA 2HQIA 5C42B 2BRKA 4K4XA 4KC5A 4DX8H 1IBKJ 1IKYB 3AXMA 1SKUB 1HPZA 4IFVA 4DMZA 3UN3A 5IFMA 1NPPA 1K9MT 4DR7F 2KG0A 2OI2A 2BQRA 2DCLA 1RZMA 4R0EA 2KFYA 2HRYA 4OI0A 5MLCV 4LF5J 1PCAA 3G6XA 2WRMA 3NEKA 3CT9A 4DUZF 2V4QA 4DFJA 2UUWA 5G0RB 4H4OA 3M2RA 2YKOA 1VK3A 2CJBA 1BC6A 2HHVA 3V81B 1KLMB 2DBBA 2R7VA 3GJTB 5AXMA 3F0NA 2M70A 4NLQA 4PYDA 4QU7A 5F8JA 3IN5A 4PG4A 1Q8LA 1OMSA 4I2QB 1Y0HA 1RYSA 2HK2A 2ROEA 3HFKA 2NZ4A 4NZ0A 4ZOSA 1WKJA 2RDDA 2HNDB 4EI2A 4P7TA 1BE4A 1DTQB 1R0BG 1DURA 5DGBA 4L3NA 5A76A 3T5LA 2NSBA 1IBCB 3W63A 2BV3A 1HQUB 3SMZA 1EX8A 1RT3B 2EBGA 4WFAQ 5ETMA 1WEXA 3OTOF 1OO0B 3CXCR 2HG4A 3A3OB 2GC8A 2XMJA 4KV8B 3FEXB 3ILLA 3K8VA 2WVCA 4OZ1A 5L8RC 1PO6A 5GAHI 3V4IB 5ETQA 2ZH8A 3TAPA 3DYAA 4Y2IA 1UVLA 1YTYA 1UKUA 1EQ0A 3TO8A 1SJ3P 3MR5A 4E98A 1QSLA 3KYLA 1FK9B 4Y2AA 5BJRA 2B7CB 2CJ9A 1S4FA 3KLVA 1VQSA 5J1NA 2IVMA 2BX6A 4P9SA 4FVCA 3DRSA 3O1LA 2LXIA 3UDCA 1RYRA 4U9RA 2FHKA 2MKIA 4OYBA 2IJNA 4DV3F 4MKVA 1QUPA 1ZYQA 3QFWA 4J37A 1QAXA 1D1UA 1J27A 3HHLC 3ETOA 3JSYA 2R8KA 3H5SA 4A8XA 2FHOB 2VG7A 3W9JA 3OUYA 4KSEB 3W2WA 4B08A 3QZ8A 3DHWC 2HS4A 1YK9A 3I5CA 1EHWA 3MFHA 1D8ZA 4YB5A 1QVFR 1V5IB 1N33J 2DGWA 1L3SA 2UVUA 1L3TA 2F3JA 2FD2A 1VBYA 4PABA 3IBWA 3RUBL 2QA4S 2QEXS 2BE2A 1ZM3A 2DPIA 2NXEA 3FBEA 2DO0A 1GNKA 3PZPA 2XGPA 3IGNA 3EZUA 1KVIA 4DUYJ 2AJ4A 5KT7A 1SIWB 1R7IA 4C6AA 1SH2A 5D3GA 3I0RB 1SL1A 5SUHA 2B9EA 5EX3A 1KHWA 3R5BA 3BSOA 2L41A 3K5NA 4K4WA 4H4KA 1T9XA 3VGUA 3L9ZA 3GV5B 4LF9J 1FE4A 4ECRA 3MAHA 3A1YG 1U1QA 2F8HA 1HLWA 1YHQS 1D09B 3CF5Q 3FQKA 4K7QA 5KFXA 4NCGB 1BMQB 4DSEA 4CLSA 4Q2MA 2MJUA 1S5ZA 2CPZA 4IH5A 1YDLA 3RW7A 4ITSA 4AUKA 2DHAA 3GZ7A 1OJ4A 4CCHA 1WDTA 4A8KA 5HBMB 1FFSB 1RKIA 5MAOA 2H4YB 2H48B 2K1RA 3W61A 1Y11A 1JIHA 1TVRA 1VHFA 2BJ1A 1RAAB 1G2EA 3CJTA 5HMXA 3DOMA 3EPGA 2BQUA 2DR9A 1XEZA 4FP9A 2OPQB 2QV6A 4LFBJ 3BKFA 3WX4A 1NM2A 5GMKa 2HFUA 2R7QA 1RQ0A 3EJMA 1RWKB 1HWIA 4OYAA 3D28A 2PEHA 1CEZA 1U47A 3FDSA 4LSZB 5BR8F 1AFIA 1FJGJ 2AIRB 1WC4A 3OVBA 4ETZA 4KHPF 2VDIA 2EG1A 1VS3A 5L39A 5DRKA 1N5TA 4HL9A 1HIYA 4ZVHA 1J5EJ 5SZTA 4DWIA 3R5CA 1OYEA 1IJEB 4GVLA 4NA1A 2JZ5A 2RQKA 3H20A 1FA0A 2VFSA 4IRKA 2DTJA 2HZAA 3OVAA 1U1OA 3IMQJ 3PRDA 3OR2B 4KHMA 3OHAA 2B6AA 2UVVA 2QL5B 4PPDA 2VKZG 2CJKA 3IP0A 3DLEB 1CJVB 1JLFB 4YB6A 4ZVPB 1WDDA 3EXCX 3T1AA 5FDLB 4WTYA 5C25A 2RF2B 4C11B 3I9V9 4RWWA 3LO3A 2A2DA 4USTA 3EDRB 1F0XA 3NS6A 4HTIA 4LF5F 2YKNA 3O5TB 3JYTB 4QYZJ 4GVBB 3LH2S 1X4BA 5AXLA 5IXUA 4FF1A 3K2YA 2X1GA 4UOGA 3TW0A 4YS2A 4QIGA 6FDRA 4B9UA 2F8EX 1CULA 3PW0A 3J7Z5 5A8KB 1RB0A 1TFWA 1QUVA 1H38A 1RT4B 3R2CJ 5CYQA 3P8BB 3LWMA 1XR6A 4KPCA 1M5PC 1IJFB 5KTQA 4YHHF 3JAMU 1N54B 3RAQA 5F3ZA 3AOAA 2AV5A 1C4CA 3PR5B 3U1NA 3HD2A 4IG3B 4OV1A 3KJFB 5B09A 3W9IA 1ZZNA 3W5YA 3BGLA 8ATCB 4NXNJ 1YWXA 4KT0C 3ZXWA 1E6VB 3P5TL 3SDEA 3AJ1A 4LSLB 3HO1A 3V6DB 4CH7A 1DHMA 3DGPB 2GJIA 2XCAA 2RKIA 2VF3A 2RHQB 5A6PA 1KN6A 5KG4A 3TAMA 2YX4A 1GK8A 2W25A 1HR0J 1RAGB 2HFOA 1FKAF 2G1DA 4NE9C 3W65A 3HJFA 1H2UX 3CJKA 5LOQA 2E5GA 1BXNA 5AJ3J 3EGZA 5FLXU 4K4YA 2ZJQQ 5M2RA 7FD1A 3M9NB 4F4KA 5I42A 2KJWA 3NNHA 1IBMJ 4DPXA 2VPXB 1U24A 2VUGA 1U1LA 1YGYA 3D68A 2B51A 1LNQA 1RT5B 2QYCA 1LWXA 1BGXT 4PZVA 5KFFA 3VVUA 2IDLA 5DLFA 1HNVA 2C2NA 5JXSA 2P9EA 4R5PB 1RTJB 4IG0A 2I5JB 3VV2B 1B0VA 4IYQA 4AT1B 4A8QA 1LXNA 2OPPA 3KJNB 4ZVTB 2O5DA 4CNZA 2FJDB 4TU8A 2P2CB 2IA6A 4IOAQ 1SH3A 3QT6A 2FZKB 5KFWA 3HT0A 5L1KA 2AZ1A 1HD0A 2V8GA 3P5BP 3HSJA 2LFVA 2NCKL 2HQDA 4ANCA 2UU9F 5DQIA 2KVQE 5F8MA 2J6SA 2DY1A 4M8LA 3ZC4A 2FYXA 1BD6A 2HQ3A 1WACA 4KYZA 2J9CA 5LSLA 3HVAA 2DJWA 4LF9F 2UUCF 2Z4PA 2PT0A 1TKZA 3HHNB 4YP3A 3CJ0A 3EM1A 4D3HA 3DRYA 3FEZA 4N47A 2KL8A 1HPZB 2DH7A 4WXOA 2VBXA 2BUNA 4NLXA 3W2VA 4TKTA 3Q23A 2V63A 1U1NA 3TA1A 2V69A 3WZ0A 2X3GA 2MSTA 5CCMA 1XMOF 3GB0A 5KG1A 1HA1A 2KFZA 1C0TA 1PBUA 3W5ZA 2RVJA 1RTIA 4WKRA 2ZZMA 2XG8A 3U1MA 3FRYA 2VOPA 1XIQA 3UW1A 4H4OB 3QT8A 3K5LA 5JUMA 3M2RB 3IBFB 4F8RA 5AXNA 4YR2A 3J80U 2DVIA 2GVDA 2BR0A 1CPZA 1HW8A 1NK4A 3VAJA 1Y5NB 2Q79A 2C2MB 3X3UA 4MIBA 4WP3A 4LMZA 3IA0A 3LF0A 2E5JA 4ZLNA 3B6BA 3A3PB 4EK2A 4RBTA 2KTQA 1LK5A 5FJ4A 1JMTA 4CO5A 4C3LA 4DR5F 1N34J 1YRTA 4LRDA 2ZH6A 3I6PA 2WW8A 3QJJA 3T41A 5LJ5Y 4C9DA 1J5EF 3PV8A 3DLKA 1TL5A 5DDRC 3JAMY 1RWNB 1NHUA 5DQGA 2PFFB 1SKRA 3E3XA 2VC0A 3M4XA 4CO2A 3DYAB 2Z2LA 4LVOP 3HD1A 2HAFA 3PM9A 1EARA 2LQ8A 1ZM9A 4O0IA 3ZTPA 2P8IA 2QFIA 5EWEA 2WCXA 2B4UA 1GH8A 3NCPA 1SV5A 3DRSB 1RT6A 1LQ9A 4KFBA 2HURA 2XMKA 4JV2A 4X4QA 1SBRA 2B9YA 2NXNA 5KT3A 1S6OA 1R8AA 4N77A 3KLIA 4LF4J 3FGVA 2DT9A 3M6WA 4ZP7A 2VG7B 3OUYB 4Y34A 3TA0A 3JTPA 3W2WB 4RW9A 4UTGA 1KONA 2PMZD 4ZKAA 4GKKJ 1T3OA 1H74A 1T95A 3TZYA 1GMWD 3OPKA 4DSKA 5IV4A 3J7ZT 1LOUA 2VFRA 3WIVA 2BE2B 1T02A 1DZ5A 4O3NA 2DNQA 2DR8A 3L7OA 4G1QA 3V6JA 4RKUC 2AEFA 1B0TA 2AMCB 4JV0A 5D3GB 1NZ8A 4DL7A 1X8DA 2D69A 2Z58B 4WIIA 1N5QA 2Z2ZA 3QPIA 2QSFA 1TKXA 2HHXA 1DJ0A 1DRZA 1QAYA 4C8YA 1Q8KA 1U45A 4MH8A 1HR0F 1FRJA 3MM6A 4ED5A 1O5JA 1MN9A 4K4VA 3GFZA 3GG0A 2ZH3A 1SI9A 3OL9A 1G7CB 2NR0A 2YNFA 5AJ3F 2W1BA 4RO0A 2HFNA 1UCNA 1WF0A 2K1RB 1DTTA 3OFHA 1ULRA 3IR5B 1EB0A 3N6NA 2AJ2A 3VF0B 3DU6A 1TVRB 3MTKA 3UR0A 3ULHA 1IBMF 3QO9A 3LP2A 5LMUF 3M8SA 3DOMB 2HVDA 3M2UA 1YBUA 4C0BA 2J9DE 3HFZB 2HFSA 3D67A 2JRSA 4QZVB 5B0AA 2BANA 1UFKA 3M8WA 3CC2S 4ZITA 1RHRB 2R7RA 4ZVQB 2VKRA 1HHSA 2DNHA 1GEHA 3MR6A 2MQPA 1A9NB 1NB2A 3N4WA 4AXIA 5JVGQ 1SC1B 3J80Y 4FNHA 3RTVA 4OYOA 3I55S 4IOBA 2GX8A 4DPTA 3B82A 2FLLA 3GPAA 3D7SB 5KAKA 2WVDA 1GMUA 4ECVA 5DS7A 2JDJA 1HHQA 4URSA 4C0HA 3SBMA 1VQ8S 2XSFA 4C3MA 4WK1A 1EZZB 1H7WA 3FKBA 2XMUA 3A8EA 3QSIA 2ZM6F 2QTWA 5K8OA 3VAFA 2HBZB 3GYGA 4P2SA 2B6AB 4M95A 5E33A 1NH8A 2YWHA 3C6UA 3UE2A 2V5HG 3FK4A 3K17A 4N5SA 3QGHA 2QZ8A 2E5LF 3HHLD 3C16A 1TUVA 1G4CA 5CYMA 5C25B 4DR4J 5ADZA 4QIEA 5D4PA 3ITHA 2YY3A 4DFPA 2YKNB 4ZCKA 4JYAF 4K5SA 2GVZB 2G1HA 1YSJA 4ALZA 2IM3A 3NXZA 2N3OA 1CULB 1FKPB 1Q4RA 3TVKA 4B3MJ 3O3LA 3OL7A 2AX0A 4DV0J 3BPSP 4ID8A 4ED1A 5CYQB 1DY3A 4PG6A 4DR6J 1HBMA 2XMMA 1PIEA 2A2CA 3DI6A 3OL8A 2HVHA 1OQ6A 4RNNA 2N7CA 3M6XA 4FKYA 4CP5A 1DQ9A 4FPIA 1N8RT 7AT1B 2IM1A 2IMOA 1YBAA 4YUDA 4AL7A 2D41A 4P72A 2OJ3A 3SDEB 1NLKL 2XHCA 2ATCB 2F9JA 2HWIA
chains in the Genus database with same CATH topology
3T1HJ 4DR1J 4DR7J 4B3SJ 3OTOJ 1HR0J 1FJGJ 2ZM6J 4LF6J 4LF9J 4DR4J 2UXDJ 4NEZA 2KVQE 4X62J 4NXMJ 1N32J 3J80U 1XMOJ 4KY3A 4LF7J 4DR2J 2VQEJ 3R2DJ 5LMUJ 5LMNJ 3W1YC 4LF8J 4V1Ak 4JI2J 4JI3J 4JV5J 5A2QU 5AJ3J 5FLXU 4DUZJ 4X64J 4GKJJ 4OX9J 4NEYA 1J5EJ 4AQYJ 4KYZA 2E5LJ 3J81U 1XNQJ 4JI0J 4RJVA 1IBKJ 1XNRJ 4B3MJ 1IBMJ 3T1YJ 3R2CJ 5BR8J 2UU9J 4LF4J 4B3TJ 4YY3J 4KHPJ 5LM7E 2VQFJ 1IBLJ 2MQ8A 2HHHJ 2UXBJ 2KL8A 4DV0J 3D3BJ 4X66J 2F4VJ 1N34J 3JAMU 4DV4J 1N33J 3J7AN 5IT9U 1HNZJ 4GKKJ 2MTLA 3IMQJ 4DR6J 2UXCJ 4DV7J 4JYAJ 4DV5J 4JI6J 1HNXJ 1HNWJ 2UUBJ 4JI4J 4JI5J 3D3CJ 4X65J 4DV1J 4NXNJ 4LFBJ 4LF5J 4DV6J 2MEWA 2UUCJ 4PWWA 1N36J 2UUAJ 5IWAJ 4DV2J 4B3RJ 4JI7J 4K0KJ 4HHUA 1XMQJ 4DUYJ 1I94J 4DV3J 4JI1J 4JI8J 4LFCJ 4DR5J 4LFAJ 4YHHJ 4DR3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H J;  4DR1 J;  4DR7 J;  4B3S J;  3OTO J;  1HR0 J;  1FJG J;  2ZM6 J;  4LF6 J;  4LF9 J;  4DR4 J;  2UXD J;  4NEZ A;  2KVQ E;  4X62 J;  4NXM J;  1N32 J;  3J80 U;  1XMO J;  4KY3 A;  4LF7 J;  4DR2 J;  2VQE J;  3R2D J;  5LMU J;  5LMN J;  3W1Y C;  4LF8 J;  4V1A k;  4JI2 J;  4JI3 J;  4JV5 J;  5A2Q U;  5AJ3 J;  5FLX U;  4DUZ J;  4X64 J;  4GKJ J;  4OX9 J;  4NEY A;  1J5E J;  4AQY J;  4KYZ A;  2E5L J;  3J81 U;  1XNQ J;  4JI0 J;  4RJV A;  1IBK J;  1XNR J;  4B3M J;  1IBM J;  3T1Y J;  3R2C J;  5BR8 J;  2UU9 J;  4LF4 J;  4B3T J;  4YY3 J;  4KHP J;  5LM7 E;  2VQF J;  1IBL J;  2MQ8 A;  2HHH J;  2UXB J;  2KL8 A;  4DV0 J;  3D3B J;  4X66 J;  2F4V J;  1N34 J;  3JAM U;  4DV4 J;  1N33 J;  3J7A N;  5IT9 U;  1HNZ J;  4GKK J;  2MTL A;  3IMQ J;  4DR6 J;  2UXC J;  4DV7 J;  4JYA J;  4DV5 J;  4JI6 J;  1HNX J;  1HNW J;  2UUB J;  4JI4 J;  4JI5 J;  3D3C J;  4X65 J;  4DV1 J;  4NXN J;  4LFB J;  4LF5 J;  4DV6 J;  2MEW A;  2UUC J;  4PWW A;  1N36 J;  2UUA J;  5IWA J;  4DV2 J;  4B3R J;  4JI7 J;  4K0K J;  4HHU A;  1XMQ J;  4DUY J;  1I94 J;  4DV3 J;  4JI1 J;  4JI8 J;  4LFC J;  4DR5 J;  4LFA J;  4YHH J;  4DR3 J; 
#chains in the Genus database with same CATH topology
 1PYO B;  2RKI B;  5FII A;  3D6M B;  2FHJ A;  2VFU A;  1S1U A;  1FNM A;  3G6Y A;  4ZS6 A;  3TAM B;  3LPE A;  4OYM A;  4DV4 F;  2R2R A;  1NK6 A;  4YME A;  2OD4 A;  2AT1 B;  3CJK B;  2KXN B;  1EAY C;  2L9D A;  7FDR A;  1S6U A;  2FPH X;  5L38 A;  3ICL A;  5KFR A;  4ATN A;  1YIT S;  1UAW A;  5C2C A;  3RGI A;  3T1Y J;  4NLG A;  2J6T A;  5I42 B;  1TL3 A;  2C1E B;  3KJV A;  3ZZP A;  2XY5 A;  3NL0 A;  4F0M A;  2HBY B;  4M5K A;  9ATC B;  1U2F A;  2QMU B;  4C97 A;  4EZ6 A;  3B78 A;  2QO3 A;  1TL1 A;  5AE1 A;  1WSR A;  3QJL A;  1HNV B;  3PO5 A;  2CQ2 A;  1FD2 A;  1U02 A;  4RBU A;  2CQC A;  3WQP A;  4X4N A;  3RB4 A;  4LF4 F;  4IG0 B;  5GAG I;  1ZS6 A;  2UUA J;  1FVS A;  2LEA A;  5B0B A;  4F50 A;  2Z8Q A;  3GWC A;  5KT5 A;  2OPP B;  4GKK F;  2B0G A;  3L7U A;  1KRP A;  2J0S D;  2QX0 A;  1JXV A;  1UL3 A;  1VCT A;  3FSX A;  2CQ4 A;  2MY7 A;  2ZH9 A;  5F0U A;  3NGK A;  5KOX A;  3FSI A;  5CCL A;  3UWT A;  2JX2 A;  1RSC A;  3PYD A;  3OR1 A;  3ZZT A;  2GFF A;  4OX9 J;  2FVP A;  2DIS A;  3CMQ A;  2BZ2 A;  1MWQ A;  3HPO A;  4TQR A;  1WC3 A;  3AD7 C;  2C2K B;  3VHQ A;  1KS2 A;  1WEY A;  3D6F B;  4FYX B;  1TKZ B;  2V50 A;  5L1L A;  2C42 A;  2FUG 9;  4LRE A;  2FIU A;  2J5A A;  2MXY A;  4Q44 A;  2DHG A;  2UV8 G;  3BH6 B;  3IWX A;  2RD5 C;  2DRD A;  3W2V B;  4PYA A;  2XZW A;  3QRP A;  2XUL A;  3D0H E;  5EDW A;  3D9B A;  3QZ7 A;  3OXL A;  3BRE A;  1I1G A;  2R2S A;  2XMV A;  1K44 A;  1D9A A;  4EO6 A;  5EGY A;  3ET6 A;  2QC3 A;  3PX6 A;  1RTI B;  2F63 A;  3HCX A;  4HAC B;  3BS9 A;  3TX0 A;  1YZ6 A;  3LGM A;  1FES A;  1HBU A;  2C2E A;  2HGL A;  1VC6 A;  5B0C A;  2GCF A;  1FJE B;  5DDQ C;  1GT8 A;  2QLJ B;  3ENQ A;  4DV7 F;  4DLE A;  4H54 A;  1CC8 A;  5F3T A;  3CWJ A;  4I6Y A;  3NGD A;  1YJR A;  4PAA A;  3SXL A;  4RUA A;  1VRT A;  3C46 A;  1F3F A;  4OZJ A;  4KGK A;  1D0E A;  2EFN A;  3RR7 A;  3NMA A;  4UW2 A;  2ROG A;  3QRQ A;  1F3V A;  2V4J A;  1V9O A;  4TN2 A;  9RUB A;  4IDK A;  2M2B A;  3DLK B;  1TTH B;  3GJS B;  4OYW A;  2Z30 B;  1VC5 A;  3BYP A;  2JEJ A;  2APO A;  1VQ6 S;  1ZOT A;  1U7L A;  2GA7 A;  2HZV A;  3HXM A;  5CZV A;  3CCV S;  2LDY A;  3CME S;  1AT1 B;  1WTF A;  3PO4 A;  5DDP C;  2JVR A;  4P7V A;  5CZX A;  1PYS B;  3NBP A;  2AU0 A;  4LF7 J;  4ZVG A;  3PDN A;  3DMJ A;  1Y5I B;  4V19 J;  3DLJ A;  2PEB A;  2E1M C;  3UI3 A;  4OIX A;  1P1T A;  1SV5 B;  4ZLL A;  1OYD A;  1RT6 B;  4JP8 A;  4KFB B;  4JI0 J;  1N0U A;  4DR4 F;  5KFS A;  1R0A A;  5A6W A;  1TMJ A;  1TUG B;  3AOB A;  2GJF A;  4JI8 F;  3G6V A;  2BDP A;  3KLI B;  2LEC A;  3ZZU A;  2H5J B;  4RW9 B;  2WBR A;  4MTP A;  4F3M A;  3OXF A;  4CZC A;  4NX9 A;  3TAQ A;  2V34 A;  2YXL A;  1SKW A;  3ISZ A;  4O4G A;  2E66 A;  5GME A;  3JSB A;  4LR9 A;  1U49 A;  3P4U B;  1FT8 A;  4OX6 A;  1S7H A;  2A6O A;  4DR6 F;  3CCS S;  3M9O B;  3FSY A;  1VQ4 S;  4G1Q B;  2VAS A;  4UUX A;  4DSI A;  1NAQ A;  2WOM A;  4HHH A;  3OLA A;  2HK3 A;  3DC2 A;  2GIF A;  1Z2L A;  4I4B A;  2XNQ A;  4DSL A;  2AEM A;  4C8M A;  1UJ5 A;  1RT1 A;  2V68 A;  3I4P A;  4MYT A;  1LW0 A;  3C66 A;  2HAI A;  5E3Q A;  3JQK A;  5IWA F;  3BZQ A;  1YIJ S;  4B3R F;  2CWX A;  2XY7 A;  2SXL A;  5I3P A;  3MM6 B;  4I6A A;  2OO4 A;  1IQZ A;  1RP5 A;  4Q7A A;  4FF2 A;  3H0P A;  3LP0 A;  2EEY A;  3D1Q A;  3OTB A;  3L95 X;  5A2Q Y;  2YNF B;  4RU2 A;  3FFI A;  3PX0 A;  3WIU A;  1EJ7 L;  2YNH B;  3ZNJ 1;  3T1Y F;  1DTT B;  1UJ6 A;  3ELH A;  3I0S A;  3OV7 A;  4O3O A;  1KWM A;  2JVO A;  3HLU A;  5ETT A;  3LAK A;  4HDH A;  4CO4 A;  2AW0 A;  1TUW A;  3LP2 B;  3MUR P;  1M5S A;  2DCU B;  1NDP A;  2HIY A;  3M2U B;  2OUG A;  1S9G A;  4AYB D;  4J9M A;  3RBZ A;  4I7F A;  1NU4 A;  3DFE A;  2BAN B;  2BA9 A;  5E2Q A;  2DGU A;  3M8P A;  4CYU A;  2EBE A;  4NEZ A;  1N32 J;  2DR6 A;  3T6J A;  1RWW B;  1O51 A;  3HJV A;  2M4M A;  1CQN A;  3KG4 A;  3CVK A;  3KUG A;  1NUE A;  5HN0 A;  5LSO A;  3AA8 A;  2CKW A;  4ZN1 A;  3KDO A;  2DGX A;  1RK8 A;  2FJB B;  1RT2 A;  4ED4 A;  3BN7 A;  4F4Y A;  4YB7 A;  2C2R A;  4MYU A;  2CQB A;  3I96 A;  5KG2 A;  2GQ2 A;  3Q0A A;  2VA2 A;  1ZA2 B;  3K8W A;  4CLZ A;  3I56 S;  4OX9 F;  1HWJ A;  3N5B A;  2LQB A;  3DGV A;  3N6M A;  1ZPW X;  1O8B A;  3BH7 B;  4X65 J;  3T5K A;  2FZC B;  3PEH A;  2J7U A;  4ETX A;  1UZD A;  1KOO A;  1BWV A;  2JLE A;  2K3K A;  2KXH A;  2EWH A;  3OJU A;  4WFY A;  4AE5 A;  4LFC J;  2V2Z A;  2RJZ A;  2EVZ A;  2N82 B;  2HHS A;  2R7X A;  4HKQ A;  2DHS A;  3WC2 A;  3UD3 P;  4J9V A;  4PQA A;  3TVY A;  2CPX A;  4PXC A;  1RCO B;  3C16 B;  3IG1 A;  3PRV A;  1NCL A;  5CYM B;  4QYR A;  2D3O 1;  2OIH A;  4X4O A;  3ZZR A;  3RB3 A;  1WSV A;  3ITH B;  1SXL A;  2KT2 A;  4NEY A;  2YPZ A;  4WKY A;  4W98 A;  1QD1 A;  2JSX A;  3MPD A;  1M1G A;  3BBF A;  4ES3 A;  1YZ7 A;  3GIM A;  2G9O A;  2DNM A;  2B56 A;  4HVZ A;  5BYR A;  2QG9 B;  5IT9 U;  1X60 A;  4J9K A;  2WB4 A;  2E1R A;  3N28 A;  4CRJ A;  2CFX A;  4QCL A;  1HBM B;  3QMQ A;  3EZ5 A;  4DR2 F;  3DI6 B;  2WAQ D;  3QRR A;  2YKM A;  2E9Z A;  8AT1 B;  3CD5 A;  1RTH A;  2CPD A;  3M1V A;  2NXU A;  4M5M A;  1T9V A;  2DIV A;  2LA4 A;  3LW5 C;  5JMN A;  3QQC D;  2DEJ A;  1B70 B;  1QLN A;  1RI7 A;  4IQX A;  2MKJ A;  4U7U D;  4JB8 B;  1QSS A;  1S1U B;  1J5O A;  2ZDP A;  1T8E A;  4U67 Q;  1HNZ F;  4P2M A;  2HVI A;  2ABY A;  3MD3 A;  4JBC A;  4KGM A;  5HMY A;  4WBF A;  4QOT A;  4QW9 A;  1TL7 A;  5IC6 B;  2RQ4 A;  2XSJ A;  3RAX A;  1RBO B;  5H9E J;  1TKD A;  3MI7 X;  3ZTO A;  4LF7 F;  5KFU A;  3P3D A;  3TA2 A;  1TL3 B;  1S59 A;  1P9Q C;  4ZVU B;  1RAB B;  4ERD A;  1JJ4 A;  2XEX A;  3HM9 A;  4B3S F;  4O3S A;  4U96 A;  4JI0 F;  3GIR A;  3D3C J;  4DSJ A;  4ED8 A;  2I2Y A;  1TL1 B;  4I2Q A;  3KJQ B;  1IKW A;  2XM3 A;  3OL6 A;  4EFA C;  1K8A T;  3MEE A;  2ZZT A;  3FCW A;  3O8W A;  5CYJ A;  4RNM A;  3NS5 A;  1JNZ B;  2V8P A;  2EFV A;  4NWB A;  1MSW D;  3HHD A;  1AXQ A;  2DNP A;  4K59 A;  3DLL Q;  1DAR A;  2J9D A;  1ROF A;  1YKW A;  1RLD A;  2Y8W A;  2C2O B;  3QYY A;  2JL9 A;  5F9L A;  3ZZ0 A;  4KRW A;  3GII A;  1TQL A;  2WZ1 A;  1KBR A;  2XYP B;  1UFW A;  4KV8 A;  1XQI A;  3KMQ A;  1XR7 A;  5H9E K;  2ROP A;  4C4W A;  1XER A;  3U02 A;  1RE1 B;  2CNK B;  2DXE A;  2F4V J;  2B3T B;  1JLE A;  2YWW A;  4J9P A;  3SQO P;  2IBK A;  2VPY B;  4NMX A;  3NWG A;  3KDN A;  1B0P A;  1F2H A;  1BQN A;  1HL6 A;  5LMN F;  2V4R A;  1W2I A;  4ECX A;  1CJU B;  1HWL A;  3QBC A;  2X3D A;  4LR8 A;  5B7W A;  3AOC A;  2YKQ A;  1Q5Y A;  2LKZ A;  3ET6 B;  1IVZ A;  3EGW B;  1X4D A;  4LVN P;  4FBT A;  3G6E S;  1OSD A;  5M2P A;  1RU1 A;  2IBO A;  2MKK A;  1HKA A;  3ZO7 A;  2XY6 A;  3R2D J;  1WI6 A;  1RBA A;  1HBU B;  4MT1 A;  1QAI A;  2DIT A;  1KSP A;  2RU9 A;  2D1C A;  3IR6 B;  4TU9 A;  3NKY A;  1U6F A;  4NML A;  5F8I A;  3K89 A;  2J9E A;  3CDU A;  5CAB A;  3PG9 A;  4DS5 A;  4CIO A;  3R5A A;  1VRT B;  4LFA F;  1VK8 A;  3UNY A;  4XK8 C;  3W60 A;  2LU1 A;  2R4F A;  3MOJ B;  1HQE A;  1UPP A;  1NND A;  4MIA A;  2V4J B;  2CVE A;  2FTR A;  4KGZ B;  1JLG A;  3WBZ A;  2CQH A;  3DXB A;  4IDK B;  1EKS A;  1NSQ A;  4ZPV R;  3KKF A;  1YJ7 A;  1HQ2 A;  2XHW A;  4U8Y A;  2ZJP Q;  1Q8B A;  3M9M B;  2R7U A;  3DDI A;  1N52 B;  2O3D A;  4DR7 J;  4DX6 A;  3OFE A;  2V0N A;  3B54 A;  4OI1 A;  4X65 F;  2LEB A;  4FXV A;  2DNK A;  2RSQ A;  2KG1 A;  3UVJ A;  3R1H A;  4RLE A;  5F41 A;  4HH1 A;  2CJX B;  3NBP B;  4DUZ J;  1DFD A;  5F8G A;  2R7S A;  4NZ7 A;  2QLX A;  1WG1 A;  2OPQ A;  1UWA A;  3ILO A;  5E0O A;  4NA3 A;  3QSY B;  2DPJ A;  1SB6 A;  4KGV B;  4ILL A;  2COL A;  2DH9 A;  2WSC C;  1IN0 A;  2XYG B;  1R0A B;  1U4B A;  2HLT A;  1LK7 A;  3DRP A;  2ZBI A;  1KD1 T;  2UVR A;  1D9F A;  4TQS A;  2HS3 A;  1R89 A;  4UOF A;  2HHP A;  3CJ2 A;  4RW7 A;  5HVH A;  3OLB A;  5GAD U;  2VIC A;  4FNI A;  4O4G B;  5KFN A;  2RS2 A;  3NCR A;  4USI A;  1WEZ A;  1QM9 A;  1P6T A;  3OTO J;  4J7C A;  3A13 A;  4Y6I A;  5C5J A;  2CPI A;  3L09 A;  3L4B C;  2HWT A;  1ZET A;  2LA6 A;  2MZR A;  2CNL B;  3NWR A;  1RWO B;  4LF8 J;  1GAO A;  1CQM A;  3MM9 A;  2NS1 B;  2WOM B;  2HBQ B;  1WG4 A;  3BGU A;  3MPW A;  1FX4 A;  3BDE A;  1T9Y A;  3HK2 A;  3TJ8 A;  2VPW B;  4XPC A;  4LQ9 A;  4JUZ A;  5GAE U;  5F0W A;  2HHT A;  1RT1 B;  2G0C A;  2XS2 A;  4A46 A;  4M94 A;  2GW8 A;  1S1T A;  2L9W A;  4IH6 A;  3MUV P;  2R7W A;  2GGP B;  5DZ6 A;  1NEE A;  3MWB A;  2EPI A;  3NY0 A;  5D77 A;  1IR1 A;  3LP0 B;  1RAC B;  3IM9 A;  2IRY A;  2P6S A;  4GVB A;  3FFI B;  1YJT A;  2LMI A;  1FTR A;  4HT7 A;  2FDN A;  1IKV A;  3I0S B;  2XTJ P;  1BUX A;  5GMD A;  4TXS A;  2OFG X;  2W4C A;  3BPD A;  3MMB A;  4F4A A;  3C19 A;  2PII A;  3QAU A;  1S9G B;  5E3P A;  1N5Y A;  3W8P A;  4I7F B;  4ILR A;  1XTZ A;  3L7P A;  3IC1 A;  3M8P B;  4CYU B;  4NLU A;  1R43 A;  2XCP A;  2AJ0 A;  3CDA A;  2XLK A;  2CNN B;  1KDN A;  3F56 A;  2OSQ A;  2MPU A;  4RZR A;  2FLP A;  4RWX A;  3V4M A;  1X7V A;  5J2N A;  1HNW F;  4P2F A;  1M0S A;  1TKT A;  2YKA A;  1VQN S;  2MZJ A;  1VQM S;  1RHM B;  5A8W A;  2EFP A;  1RT2 B;  3G82 A;  2YQ0 A;  2LLZ A;  2OTJ S;  2KRB A;  2AGQ A;  4LF1 A;  3Q2T C;  3NOC A;  2BKO A;  2XWY A;  3PVX A;  2IM0 A;  3MCO A;  4U7C A;  1ZBT A;  3N01 A;  2PE8 A;  2ZOG A;  1WUU A;  3HDS A;  2OD6 A;  1UW4 A;  2O66 A;  1PAU B;  5EX0 A;  4G1I A;  4IO9 Q;  3HKW A;  1M90 T;  1YJ9 S;  4FS1 A;  1OWX A;  1FF2 A;  4ECQ A;  1K0T A;  2CZV C;  1XK8 A;  3CJ3 A;  5HMZ A;  3B4M A;  3UR3 C;  2Y1L B;  2W2O P;  4M5D A;  1RUS A;  3MXH P;  2IHR 1;  1FCA A;  1DBD A;  3LP1 A;  3M05 A;  3HVT A;  2RE1 A;  4CO1 A;  3NRB A;  1EP4 A;  5KFJ A;  1WC5 A;  3IG1 B;  4WFZ A;  2FLN A;  3MCS A;  4NLS A;  3IWL A;  5ETR A;  1UEV A;  1RTJ A;  1WOP A;  2OML A;  4DV6 F;  1R8C A;  3KOA A;  3VCD A;  4USK A;  4NCA A;  1K1Q A;  5BR8 J;  1R27 B;  4CTA A;  3CCT A;  4EYI B;  1VBK A;  4KHP J;  4OL8 A;  4K4U A;  3N9U C;  3FVY A;  4EZ9 A;  5K8P A;  4DR1 F;  2ZHB A;  5JVH Q;  4ECS A;  2KU7 A;  3FBF A;  4USW A;  5IT0 A;  4URG A;  1X4E A;  4G65 A;  3GCX P;  3DKD A;  4P52 A;  3UPF A;  2F4F A;  3PAC A;  1UEK A;  4M5L A;  2M8H A;  2BKN A;  4UZC A;  1FTC A;  1KVK A;  4HHU A;  1CVJ A;  2YKM B;  1U8S A;  1WHV A;  3F73 A;  3KXD A;  3H59 A;  1AUS L;  2BQ3 A;  4KH0 B;  3H5U A;  1UW9 A;  1RTD A;  1RTH B;  5KFY A;  4DN0 A;  2VPZ B;  4ER8 A;  3QJP A;  3M1V B;  4B9T A;  4OI2 A;  1JLB A;  2GML A;  3A3N B;  2FVS A;  3NGT A;  4ZLJ A;  5JJB A;  2D74 B;  1NKC A;  3M30 A;  2WK4 A;  2KDO A;  3RBE A;  1J5O B;  4YN3 B;  1RA7 A;  2ZKT A;  1ACM B;  1VIO A;  1Y7P A;  2PMH A;  5D4L A;  2BAB A;  4NLP A;  2PGC A;  1TL7 B;  2OGU A;  3ZTQ A;  2AX1 A;  2MY8 A;  2R2T A;  2IM2 A;  1IQT A;  1TV6 B;  1EKR A;  2XSJ B;  1H3D A;  3KLE A;  3OFF A;  1RDR A;  3J7A 1;  4MAK A;  5J2P A;  2F1F A;  3BQ2 A;  1PJ6 A;  1YX2 A;  1RCX B;  3B8H A;  4DL0 C;  1T03 A;  4WE1 A;  2Q3P A;  3ISN D;  2GMH A;  1E6Y A;  4FYW B;  3KLF A;  3X1L B;  4ANE A;  4LBI A;  1W7W A;  4DV2 J;  1BHN A;  4PWD A;  2KYZ A;  4OZ3 A;  5GAH U;  1IKW B;  4YQW A;  1FWL A;  5E5N A;  5J1E A;  1MN7 A;  4N8O A;  4YHH J;  1NDC A;  4ZPC A;  3MEE B;  3GIJ A;  1VLY A;  1WD6 A;  2Q43 A;  2OLW A;  2UXB F;  4IQM A;  1V5V A;  4EBD A;  4KR0 B;  3HHE A;  4DQS A;  5ETL A;  2MZ1 A;  1Y5L B;  5CHC B;  2Q66 A;  2IMW P;  5LT5 A;  3MEK A;  1X5O A;  2WVB A;  1VR6 A;  1QY7 A;  4Q43 A;  3JTO A;  2Z2Y B;  4DF4 A;  3GCW P;  3CC7 S;  2ZH1 A;  3PY8 A;  1W25 A;  2RT3 A;  3NNA A;  2AHO B;  4LF8 F;  1VJW A;  2JLG A;  3EIC A;  2DHH A;  2MJN A;  2K7J A;  2QN6 B;  4DPU A;  4CLT A;  1FHT A;  2IJR A;  3D0I E;  5HO4 A;  1H72 C;  1JLE B;  1XC9 A;  4CQ1 A;  3PEJ A;  4J90 A;  5KFP A;  2J0Q D;  2W4D A;  3GIK A;  1KHV A;  2KT3 A;  5KFZ A;  1BQN B;  1W26 A;  3TUJ C;  1XJW B;  5KFM A;  5KFK A;  4RNF A;  5J2M A;  4E8U A;  3R97 A;  2HNY A;  1B4S A;  3QT7 A;  5IS2 A;  1NDK A;  3A8K A;  5BYS A;  3RU0 A;  4KY3 A;  4FZV A;  2CUY A;  4G6V B;  3IS9 A;  2DR7 A;  3CCU S;  4WWS A;  3TZZ A;  3AXK A;  3GFY A;  4F02 A;  1U48 A;  4QU6 A;  2J8S A;  3QAE A;  3RR8 A;  2C3Y A;  2AGO A;  2YH1 A;  5IM0 B;  2UU9 J;  4ZDN A;  4YDD B;  1PC4 A;  1MNE A;  4U7U K;  4QQB A;  3IGV A;  2O67 A;  1RHU B;  5C24 A;  1OIA A;  4DSF A;  5F8N A;  1P27 B;  2RRA A;  1WEL A;  2NSC A;  4DCO B;  1SUQ B;  3OSN A;  3T9N A;  2ZZN A;  2AGP A;  2W8L A;  3Q24 A;  2XLJ A;  1PGZ A;  1HQE B;  2H3E B;  2UUC J;  3OFG A;  2LVW A;  3H4D A;  1R8B A;  1Y3J A;  1RXO B;  4C8K A;  1JLG B;  1SQE A;  2ZJR Q;  4J5O A;  4C48 A;  3M8Z A;  4IO1 A;  1UVN A;  4L74 A;  2BXJ A;  3PXG a;  3R7B B;  5HSP A;  1XMO J;  3HFV A;  2Y9H A;  1KLN A;  3FC9 A;  5KFE A;  1UET A;  2PI5 A;  3PW4 A;  4KAI A;  4BBY A;  2KFN A;  3SCJ E;  4ECZ A;  1GMW A;  3UVJ B;  4OLP A;  3H5X A;  3EYZ A;  1FWP A;  2UVW A;  2AYB A;  1JJC B;  2H5E A;  4N41 A;  2E1A A;  3BQ1 A;  4IOC Q;  3UNG C;  2JEG A;  3TUZ C;  3AHP A;  3UCG A;  3FNN A;  3Q8U A;  3K57 A;  3Q8V A;  3LPY A;  3BO4 A;  3NMR A;  2JOQ A;  3HI9 A;  2HHQ A;  3Q8Q B;  3DCA A;  5D4N A;  3K59 A;  3DRP B;  5IT4 A;  1PYT A;  4OHZ A;  3PKM A;  4RUC A;  2CZ4 A;  1HI0 P;  4LF2 A;  2R9L A;  3RG6 A;  4F3Q A;  2CJY B;  4RW7 B;  4XTT A;  4WTO B;  5IZH A;  4JI1 J;  3W62 A;  4DR5 J;  3N0V A;  4GC6 A;  1W2B R;  2I6W A;  3GYX B;  2HGN A;  1JJ2 R;  3M7V A;  4K2X A;  3JS9 A;  5E3C A;  4A4J A;  1AB8 A;  2JC1 A;  4K5R A;  3NP5 A;  3MM9 B;  5KT4 A;  3CE8 A;  1U1K A;  1XNQ J;  2NPI A;  4L72 B;  2Y0B B;  3QIP A;  1YLX A;  1OPZ A;  1U09 A;  3CCR S;  4J9R A;  2H65 B;  2FVC A;  2C2D A;  4B9V A;  5J2Q A;  1FJ7 A;  4DQQ A;  5D0H A;  5CH7 B;  4P71 A;  1S1T B;  3KLG A;  3K5P A;  2V8V A;  2CPH A;  2NUU G;  4DU7 A;  1TZ0 A;  4QPX A;  2V2K A;  1LFW A;  2AJ1 A;  4DV1 J;  3CJ4 A;  1WC0 A;  4ED2 A;  2B8Q A;  1ZTT A;  1UWB A;  3BYR A;  2GVZ A;  1HBO A;  2R3V A;  2CQD A;  1IKV B;  4RU9 A;  5CXT A;  3D6T B;  2B9W A;  3VAG A;  2L9N A;  1FKP A;  3VAH A;  3WDO A;  3MMB B;  3I9Z A;  4UQG A;  3BQ0 A;  3CTR A;  1WHW A;  3W5X A;  4DV2 F;  2N4D A;  1N5Y B;  5CAA A;  2JH3 A;  3CMA S;  2BW7 A;  2W7O A;  1T9U A;  4ID5 A;  2HFZ A;  3ZFV A;  3BSN A;  1S79 A;  4R0J A;  1VQP S;  3KHH A;  4KE5 A;  4GKJ J;  3J81 j;  2AJF E;  4DX5 A;  4ZVS B;  4P2X A;  2J0X A;  1LW2 A;  2B5J A;  2MHE A;  5J2N B;  1LV5 A;  2VC1 A;  2OKQ A;  1TKT B;  4MMO A;  5J1P A;  3QGI A;  5A8W B;  1B3T A;  3KK3 B;  3G82 B;  1I5O B;  4FVM A;  3W8G A;  3HHL A;  1ZZF A;  1ZAX A;  1P1L A;  3EX7 B;  1SQF A;  1SKS A;  3OW2 R;  1NKB A;  4AFF A;  1VQ5 S;  3CJS A;  3MM8 A;  2DHX A;  3MUM P;  2DKO B;  2DGO A;  1V3Z A;  4A8F A;  1FD8 A;  2W24 A;  1VLO A;  4FN5 A;  4MJK A;  4QYZ K;  3EVW A;  3UN5 A;  1VRU A;  3H98 A;  2GIR A;  4AQY F;  4F67 A;  2ZNY A;  4WCE Q;  2H4W B;  4YY3 F;  1RAI B;  4M5D B;  4RL1 A;  5KFB A;  2Z0G A;  4NLT A;  1YBT A;  1VJQ A;  3LP1 B;  5D0G A;  3HVT B;  4IKA A;  5LMU J;  2CZ9 A;  3THV A;  5LSR A;  2XLI A;  4DZ6 A;  1REV A;  4A48 A;  1NBE B;  1EP4 B;  4C98 A;  3NGS A;  3KG1 A;  2ZC3 A;  4DQP A;  3TX8 A;  3UQS A;  4NLR A;  2OEJ A;  1FRL A;  4QWA A;  3H2V E;  4IFY A;  3RB6 A;  1KNZ A;  4NLD A;  5IQQ A;  5AXK A;  4K0K F;  1SVD A;  4QR1 A;  2V67 A;  1EIY B;  2G4B A;  4CTA B;  2QRR A;  5EN1 A;  3MHY A;  1VBZ A;  4BWJ A;  2YNG A;  2G13 A;  2FZG B;  2UUB J;  1N48 A;  4NCB A;  1N5S A;  3TUI C;  4LSN A;  3PW2 A;  5H1S V;  2BJ8 A;  2YX7 A;  2DGT A;  3SSS A;  4I56 A;  4NRT A;  4HLB A;  3G9C A;  3R6G B;  3KUH A;  1AZS A;  1K0V A;  2ZM6 J;  2JLF A;  1RTD B;  1G1X A;  4WU3 A;  3HVR A;  5CD4 A;  3H90 A;  1JLB B;  3Q8Y A;  5K9F A;  2IDE A;  4JOU A;  5EHH A;  3M30 B;  1TK5 A;  2POK A;  1M5H A;  2E5L J;  1PSD A;  4WU2 A;  4YR3 A;  1DQA A;  1S7I A;  2GJ2 A;  1U1P A;  3BM7 A;  3NG8 A;  3M8R A;  3PIO Q;  5D8H B;  5F8H A;  1U2R A;  2KHD A;  3UCU P;  1V6H A;  1RIS A;  4QWD A;  3TJA A;  2RDI A;  4HAC A;  2NYH A;  1ZH5 A;  4JYA J;  1WI8 A;  3KLE B;  2YWE A;  2ILZ A;  3BR9 A;  5J2P B;  2EK1 A;  2KM8 B;  3BBC A;  1S72 S;  4OYI A;  3K58 A;  1YI2 S;  5DJB A;  1T03 B;  5HJX A;  4WE1 B;  4Q5V A;  2QFJ A;  2MKH A;  3PYG A;  1E6Y B;  1ICE B;  3KLF B;  3PIP Q;  2LDI A;  2QGF B;  2CVI A;  1S1X A;  2IVF B;  2QLF B;  4PWD B;  1NH7 A;  5HAN A;  3UDL A;  2V2V A;  4ED7 A;  3D5M A;  5J1E B;  2A3J A;  4LF6 J;  1SC4 B;  1LWF A;  4L73 A;  1JLC A;  3S6E A;  2IIH A;  1L5U A;  1KKH A;  5I4M A;  4QPT A;  3DN9 A;  4JI1 F;  3DLG A;  2HZC A;  1Y9O A;  3LAM A;  3OQ2 A;  1BLU A;  1BY9 A;  1RAF B;  3A12 A;  1S49 A;  2IRU A;  3PYF A;  2CRL A;  3T5J A;  2KI2 A;  1RT7 A;  4ZHR A;  1Q53 A;  3T6B A;  1FNO A;  3DXS X;  2X7I A;  1XMQ F;  3DRX A;  3M2V A;  2OTL S;  4FF3 A;  5KFD A;  1WWH A;  4DV4 J;  3I87 A;  3J7A N;  4USV A;  2HEK A;  4ZCM A;  3D2W A;  2R42 A;  3M6U A;  3SCK E;  4Z37 A;  4A47 A;  1Y10 A;  2BMB A;  1XNQ F;  4NI2 A;  3LOU A;  3TOQ A;  1WNE A;  1PKU A;  1T0T V;  2J6U A;  2VIH A;  2OPS A;  2RH3 A;  2WON A;  3OD2 A;  3CCQ S;  4MKB A;  2GHV C;  3LAN A;  2AF6 A;  2K06 A;  2U2F A;  1X5P A;  4LIW A;  1NJY A;  2ALY B;  4HDG A;  3SV3 A;  4PG7 A;  2ACY A;  4OFZ A;  3CO9 A;  3BV8 A;  2ZHO A;  3R5J B;  1RBL A;  5J2M B;  2H9Z A;  2RRN A;  4DV1 F;  2HNY B;  2UUT A;  4ZA1 A;  1KTQ A;  3LWL A;  1WOO A;  1C0U A;  4MKY A;  3U7J A;  4FDF A;  3K5O A;  2FHM A;  2ZBC A;  4DV5 F;  1IR0 A;  3O2I A;  2EG2 A;  4KJI A;  3IS9 B;  5I3Q A;  1X4F A;  1PIL A;  4X4U A;  3F41 A;  2ZBR A;  2DNN A;  2ZFH A;  4PXB A;  3MEG A;  4BDP A;  3C14 A;  1APS A;  2G2Y A;  5LM7 E;  2IJF A;  3EWG A;  2BE7 D;  1HW9 A;  1RWM B;  2YNI A;  2DGS A;  1S6Q A;  4P75 A;  2W9B A;  3VGS A;  4PCQ A;  4GKJ F;  2C28 A;  4F2S A;  4B9M A;  3UN2 A;  3KHR A;  5C24 B;  1C1C A;  1K73 T;  3G86 A;  4LJM A;  2OEM A;  1CG2 A;  1RHQ B;  1GXU A;  2N7Y A;  4H4K C;  1N36 J;  3KLH A;  3NAH A;  3BBB A;  2I38 A;  1FO1 A;  2GNK A;  2HS0 A;  3RJM B;  2XBP A;  1KTV A;  2BOA A;  2YPY A;  2CPE A;  2BEF A;  2YKP A;  4LRB A;  4J9N A;  1N5V A;  3SFG A;  1S1V A;  2F7V A;  4Q8F A;  4F04 B;  4ZN3 A;  2HQF A;  3W1Y C;  4F2R A;  1S12 A;  4FYV B;  3QWP A;  2NRE A;  3VAI A;  1CLF A;  2RIL A;  2IYG A;  3KHL A;  1FE0 A;  2YNH A;  2YQ3 A;  3J7Y I;  4EU0 A;  1G3O A;  1XNR J;  3PRB A;  1KC8 T;  1X0P A;  3RW6 A;  3AT1 B;  1QTM A;  4C8O A;  1FFW B;  2HVZ A;  5DO2 A;  4Z2X A;  1ARO P;  2MGZ B;  3CDB A;  4DV7 J;  4EBE A;  3PJW A;  5KG6 A;  4X4S A;  2W2N P;  2W2Q P;  1MRO A;  2QA2 A;  2QMW A;  5HVG A;  4F4W A;  2LXF A;  1B7F A;  1ITP A;  1S0V A;  2D9O A;  2KKH A;  5KFI A;  2MQO A;  2NZC A;  5KOW A;  2EK6 A;  4WF9 Q;  2UUB F;  3ADA C;  4KO0 A;  4X62 J;  5E41 A;  2BRL A;  5HMW A;  1VMB A;  5D4O A;  1UVI A;  3WC0 A;  3N5F A;  1UEU A;  1SPB P;  2QSW A;  5KFQ A;  2MSS A;  2DNO A;  1RGV A;  2RAQ A;  5CA5 A;  5D6G A;  1U2C A;  4F0H A;  1YRU A;  2KHC A;  2WVF A;  4ZIV A;  1HI8 A;  1IUJ A;  4FBU A;  2UP1 A;  2J0W A;  3QIP B;  4WYL A;  3AJ2 A;  1WOS A;  3PYE A;  4OZ0 A;  2ZUA A;  3Q83 A;  4F26 A;  4TU7 A;  4DPO A;  2G2O A;  3CNQ P;  3SI8 A;  3K5M A;  5J2Q B;  2R8J A;  1F6T A;  3SQG A;  4J91 A;  4X4T A;  3D66 A;  4NA2 A;  2GMJ A;  3KLG B;  4B3O A;  1F5B A;  4LBH A;  2XZD B;  2VQE F;  3ENW A;  2H5I B;  4I6W A;  3TJ9 A;  3VAM A;  3BB5 A;  4P10 A;  2ASY A;  1WC1 A;  1UVK A;  1ZPV A;  4AND A;  3CCE S;  2OPR A;  1D9D A;  2ZH4 A;  4JI8 J;  4ILM A;  1UA0 A;  4O3Q A;  1UWB B;  3EUN A;  1MLA A;  3NOG A;  4DL6 A;  1S99 A;  2WVE A;  4AL5 A;  1HBO B;  3M6V A;  4DI6 A;  4ICL A;  1IBL F;  4KH1 B;  1HI1 A;  3R7N B;  4MKA A;  2AKW B;  3BSC A;  2HBR B;  2E1C A;  2CAJ A;  2C3U A;  3EDQ B;  2DO4 A;  4UQT A;  4Y2K A;  4ID5 B;  3UD5 A;  1NK5 A;  4XAK A;  1Q5V A;  4DL5 A;  3CW2 C;  4LF6 F;  2K2P A;  1RHK B;  1NK8 A;  3M32 A;  2K7K A;  1LW2 B;  3S1T A;  2B5J B;  3KUE A;  2HMI A;  2HGM A;  5KT6 A;  4HHJ A;  2IC3 A;  5KG3 A;  2YTC A;  3H7H B;  2WSE C;  4KBI A;  2I1R A;  4C0O C;  1BQM B;  3GJQ B;  2W8K A;  2FY1 A;  2MTL A;  3K7R A;  3PR4 A;  3ENV A;  1M5V C;  2P6T A;  3HHL B;  3RRH A;  4JI4 J;  3GU0 A;  3MM8 B;  2M3D A;  2RS8 A;  5IWA J;  4B3R J;  2B4P A;  2DNY A;  2O1P A;  1SIZ A;  1BQX A;  2F65 A;  1S97 A;  5ETO A;  4C8N A;  1VRU B;  4J9Q A;  5GAG U;  1M1H A;  3KNG A;  2B8P A;  3RB0 A;  4WXW A;  1T05 B;  2PSZ A;  3DLB A;  3CSK A;  1PC5 A;  4X66 F;  1WF2 A;  3TWZ A;  2VDH A;  5DG7 A;  2Y0S D;  2J7K A;  3MCN A;  4F3O A;  2HQC A;  2WHO A;  1REV B;  4DCJ B;  1VIX A;  2BJ3 A;  2WB1 D;  1RTZ A;  2R8H A;  1D3W A;  4ECW A;  1V3S A;  4B17 A;  2GHW A;  4A8S A;  4IFY B;  4UZB A;  1UVM A;  2X1B A;  4ZPW R;  3TEG A;  2VG6 A;  3VAL A;  4NXM F;  1ELO A;  2ASJ A;  4LR7 A;  4TYA A;  1C4A A;  1CC7 A;  2ASL A;  2YNG B;  1RA6 A;  2A1B A;  3DDN A;  3E8O A;  1GMV A;  4KB7 A;  1Q86 T;  4LSN B;  3WX8 A;  2KRR A;  2NXJ A;  1Y4Z B;  2P9G A;  4UUW A;  5DM6 Q;  2QA4 G;  2PD1 A;  4USM A;  3T1H J;  5M2U A;  1TK8 A;  2CPF A;  1AZS B;  4M63 A;  2EI5 A;  3KTQ A;  1FI4 A;  4L3K A;  3R1L A;  4Y0F A;  3K0J A;  3TR5 A;  1N36 F;  2L48 A;  5HJY A;  3DDK A;  3MZI A;  1JKH A;  1KQF B;  2E44 A;  1Q16 B;  4JI3 J;  5A2Q U;  2FJV A;  2GQQ A;  3ZTS A;  3FRZ A;  1FRM A;  3CD6 S;  1FX2 A;  4N8N A;  3C3L A;  2A0F B;  3RRG A;  4MFB A;  2IRX A;  4Q45 A;  3VR1 A;  1MMN A;  4USJ C;  2VOD A;  5T7L B;  1CJU A;  2VA3 A;  4W90 B;  2E7W A;  2UV8 A;  2OAU A;  3S7R A;  2N3L A;  1URR A;  2XGQ A;  4IH7 A;  5KFT A;  4TY8 A;  4DL3 A;  1NRK A;  4M5J A;  4L6V 3;  4K2J A;  3C15 A;  5THW A;  4ES2 A;  2FGC A;  1RU2 A;  1XNR F;  1HMV A;  2DNG A;  2QL7 B;  1KOH A;  4CLU A;  4BWM A;  1Z4U A;  3TNV A;  4YFU A;  1NDL A;  2BJ7 A;  4CT8 A;  2EFO A;  4QJV A;  2L3M A;  3MPV A;  3A8J A;  2RU3 A;  3SEO A;  4CM0 A;  3KK2 A;  4LIR A;  4CLP A;  4DN9 A;  1Q7Y T;  2E7X A;  1IBK F;  5DET A;  4LBP A;  2PDA A;  3M8Y A;  1H6K X;  1S1X B;  3MR2 A;  3SFU A;  1VGY A;  3EPI A;  4J9S A;  1P9Y A;  5KT2 A;  3D1O A;  4DR2 J;  2I8E A;  3CD0 A;  3G8T A;  1LWF B;  2AYG A;  3H2L A;  1JLC B;  5HQL A;  2E1P A;  4PRF A;  4LT6 A;  3FJ2 A;  3PJX A;  1NB7 A;  3DLG B;  1TP7 A;  1T9W A;  4X62 F;  4WJB A;  4CDI A;  4WIQ A;  3CIM A;  1RT7 B;  2C3P A;  3MTJ A;  4ZHR B;  2X1F A;  4BCA A;  2EFQ A;  3MEC A;  1S77 D;  1R0C B;  1HNZ J;  3FUY A;  1QE1 A;  3M2V B;  2DB1 A;  3R8Y A;  3MM7 A;  1VYA A;  2RNE A;  3U27 A;  4FXD A;  1S48 A;  4OJG A;  2Q1L A;  4NI2 B;  4NRU A;  1OY6 A;  3RZA A;  2LQ5 A;  1GX6 A;  1F9F A;  4P74 A;  2OPS B;  2WON B;  1UZH A;  1J2V A;  2ZBP A;  3SSQ A;  3LAL A;  3TZX A;  2RB7 A;  4CLF A;  2FC8 A;  4B3S J;  2MMY A;  2UXD J;  4W92 B;  2FQQ B;  2QMX A;  1AA1 B;  3MD1 A;  4K4S A;  2PO4 A;  4PKD B;  1NJX A;  2HNZ A;  3GIL A;  2VJV A;  1R8H A;  1EET A;  4F36 A;  4FKX A;  3CJQ A;  1C0U B;  2E5I A;  1RKJ A;  1VIS A;  2MQL A;  4RUB A;  1O0P A;  4A8M P;  2ZH7 A;  2ZWP A;  4RUH A;  2BW2 A;  4B3T J;  1RAO A;  1FKO A;  1EQM A;  1HWU A;  3MEG B;  3C14 B;  4XIU A;  3A4T A;  4Q0B A;  1RWX B;  4DHV A;  2AYM A;  2YNI B;  2ZUG A;  4HTJ A;  1S6Q B;  2JNJ A;  1JNR B;  2W9B B;  2V9W A;  4CM2 A;  4MK9 A;  1C1C B;  3TZW A;  3L3C A;  3DM2 A;  2OP5 A;  1ZA1 B;  2B43 A;  4WK3 A;  3GLJ A;  2R8G A;  2GO9 A;  3T9Z A;  3DU5 A;  3KLH B;  3P49 B;  4QR0 A;  4DR3 J;  4CO3 A;  4JI4 F;  3VZI A;  1LWE A;  2HQG A;  1NJZ A;  4ZVE A;  4KKO A;  5E7O B;  2HHW A;  1N33 F;  2FGO A;  1S0O A;  1F5A A;  5LMN J;  2GGP A;  2EC0 A;  2MKC A;  1OQ3 A;  1S1V B;  3RAM A;  4X64 J;  5D0R A;  2MKS A;  1XR5 A;  3POT A;  3MMA A;  4LUB A;  4B9N A;  3CUN A;  2LU2 A;  3GG1 A;  4C8L A;  1Z1Z A;  2V6A A;  3P45 B;  4OYP A;  2CDQ A;  4DPY A;  3JQM A;  2CYY A;  3E51 A;  4RW6 A;  1S6P A;  1U0H A;  4DUY F;  2W4P A;  4NL5 A;  2K3I A;  1NHV A;  3ETM A;  4YOE A;  3MOZ A;  1KFS A;  5KFH A;  2LXU A;  2CWK A;  2B4V A;  3OJS A;  2C22 A;  2DNR A;  2LQJ A;  3HZE A;  3V5R A;  2HVE A;  3HZG A;  3TI0 A;  1K1S A;  3PNI A;  4CT9 A;  1NKE A;  4IFV B;  3R6L B;  4UOC A;  3PFO A;  3ISN C;  1MRO B;  1T11 A;  2AWZ A;  5E3A A;  5DZ7 A;  4LFA J;  4DDF A;  1UMJ A;  5HP1 A;  2MKY A;  2YWK A;  4URQ U;  3BO3 A;  3GE9 A;  3MAA A;  3AAW B;  5L1J A;  3IXQ A;  3SCI E;  2J8A A;  1JX4 A;  5KFC A;  1OPI A;  2RML A;  3EMT A;  2XS7 A;  4KO0 B;  2ALZ A;  3C6T A;  4V1A k;  1H2T Z;  3GFH A;  4Y00 A;  1TR0 A;  2J7W A;  1JXL A;  4X4V A;  1LWC A;  3VZH A;  2HWH A;  3T1H F;  4LFB F;  3R9L A;  1H0H B;  4ZPA A;  4ZPB A;  8RUC A;  3PCO B;  3QAT A;  2VD3 A;  1VOM A;  2MDA A;  1DLO A;  3UCZ P;  4JI3 F;  3ZTR A;  4U8V A;  2XO7 A;  1FJG F;  3G2X A;  3PJ9 A;  1NPR A;  2FJA B;  4Z7Y A;  3SQG B;  1FDN A;  4ZP8 A;  2VFV A;  2VJU A;  5DG8 A;  4B3O B;  4ELU A;  2DGV A;  2LCW A;  3ENA A;  5HL7 Q;  5D78 A;  2O01 C;  1FNX H;  1R8P A;  1RWV B;  5A8R A;  5B08 A;  3GQC A;  3VGV A;  3WHI A;  4U6P A;  2H1Y A;  2OPR B;  3SZ2 A;  3JB9 k;  3V6H A;  1AUD A;  1U26 A;  1B7Y B;  3I5B A;  1NSP A;  1U6B A;  4M5H A;  3BR8 A;  3M8Q A;  1XN9 A;  3AQO A;  4ICL B;  5KFV A;  3CIZ A;  1CBK A;  2MLZ A;  2GAG C;  4OI4 A;  3CDW A;  3IO1 A;  2G0I A;  4ELV A;  1BWE A;  1SCJ B;  1M5O C;  5AE3 A;  1N0V C;  3NAI A;  3E01 A;  2B9X A;  4XO0 A;  3GV8 B;  4DL2 A;  3IFE A;  1DAX A;  3R7S B;  5CQG A;  2QYG A;  3FQL A;  3AFG A;  2VQF J;  1DQ8 A;  3M32 B;  2YH0 A;  1MU2 A;  2XYH B;  2HMI B;  5IOL A;  1AYE A;  3TQ1 A;  2M8D B;  4OHX A;  2IC3 B;  5FLX Y;  4NLY A;  5G4D A;  1UTA A;  3QID A;  2FY8 A;  2P5V A;  4DS4 A;  1WHY A;  3FMB A;  1PAE X;  2AYE A;  1S9F A;  3JTN A;  3PTW A;  1VC0 A;  3HMJ G;  4ENO A;  1QJH A;  1SJ4 P;  4WZQ A;  1URN A;  1NHK L;  2QL9 B;  4RNO A;  1F9E B;  3GP9 A;  5KG7 A;  4GC7 A;  1Q0N A;  2Y3Y A;  4YB1 P;  2PA8 D;  4OJH A;  1TV6 A;  4NLW A;  3P96 A;  3R5G A;  4FYY B;  2BM1 A;  2XS5 A;  1CS4 A;  4YEA A;  4NXN F;  1XWL A;  2WW4 A;  4KGX B;  3HSG A;  4E2F B;  2UXD F;  3D0G E;  1Q81 T;  5KFG A;  2Z57 B;  3AA9 A;  1P8G A;  4USU A;  1X5S A;  3D3B J;  2XI3 A;  4X84 A;  5A0Y A;  2VOO A;  2A18 A;  1KP6 A;  5KFL A;  3D6H B;  2BM0 A;  1L3V A;  3DLH A;  1HNW J;  1FDD A;  4JI5 J;  1FWK A;  2VG6 B;  1X9M A;  2IFX A;  1FVQ A;  1FXR A;  4B3T F;  3SCL E;  4PWW A;  2Y1J A;  2BE9 B;  2DRB A;  1FEH A;  5H9F J;  1TAU A;  3AB4 B;  2W9C A;  2LEP A;  2VG5 A;  5KG0 A;  1WKL A;  3RBX A;  1JQG A;  4HI2 A;  3FZB A;  1HD1 A;  4Q2L A;  4HT5 A;  1X4G A;  4DZD A;  2ZVS A;  5ETS A;  4QBU A;  4M5N A;  2W2M P;  3I5A A;  3SV4 A;  4LRF A;  4ZP9 A;  3G71 S;  4JI2 J;  4DQR A;  4EUV A;  3BGR A;  3IRW P;  1JKH B;  1FRX A;  4DR3 F;  1H73 A;  1JXE A;  4ECU A;  3G8Q A;  3CB4 A;  4E0D A;  3JSR A;  2MQM A;  1WJ9 A;  1NJI T;  2L08 A;  4MFB B;  4HEA 9;  4O3P A;  3BN4 A;  1H2V Z;  4X64 F;  1WHX A;  2XI2 A;  1Y3K A;  2RQC A;  1RJJ A;  4TY8 B;  3MED A;  2HW3 A;  3MAQ A;  1HNX J;  1VQY A;  4OYX A;  4PQU A;  4DV6 J;  3C15 B;  1Q78 A;  1D8Y A;  5DGA A;  2DK2 A;  4L75 A;  5H9F K;  1HMV B;  4GMK A;  5B0F A;  3BJY A;  4Z7C A;  2W9A A;  1PJ7 A;  2F8M A;  2VBW A;  2BKP A;  1H7X A;  4DR1 J;  4DFK A;  2NYI A;  3KK2 B;  5IM0 A;  1Y00 A;  4H4M A;  4OYZ A;  1MWZ A;  2CG4 A;  2CA9 A;  5HK4 A;  1PG5 B;  4Y28 C;  3CCW A;  4OX8 A;  2BJE A;  1UFL A;  1SUQ A;  2GV1 A;  3DRR A;  5ETP A;  1AFJ A;  3DOK A;  2CQI A;  2OMO A;  2WBM A;  2V94 A;  4DX7 A;  1ZM2 A;  3FCH A;  1VRQ C;  2Y1I A;  2ZH5 A;  2CG8 A;  2CAD A;  1JLQ A;  2D7S A;  1PJ5 A;  2VON A;  5HRO A;  4WFX A;  2UXC J;  2KVI A;  2CNO B;  3MEC B;  1QE1 B;  2AQ4 A;  1VFJ A;  2VH7 A;  2LQ9 A;  4DXL A;  5T14 A;  4CNY A;  3MM7 B;  3AQP A;  3FBB A;  2KZZ A;  4I69 A;  3AY0 A;  2XWX A;  4O3R A;  2M52 A;  4HYK A;  3OBI A;  1VBX A;  3H40 A;  3US5 A;  3GSI A;  1Q79 A;  3N79 A;  4P73 A;  3T19 A;  3RRK A;  2BBE A;  4RW4 A;  4IUF A;  4RNH A;  4R25 A;  1YJU A;  3PFE A;  3MR3 A;  4TYB A;  1N34 F;  1RLC L;  3AB2 B;  3D1H A;  2FVR A;  1MG7 A;  5EWG A;  1F1B B;  2IY5 B;  2HNZ B;  4PXD A;  3PX4 A;  1EET B;  4UOH A;  6AT1 B;  3KK1 A;  2BAC A;  3IWN C;  4QIV A;  4DL4 A;  1REG X;  2M9K A;  4PWU A;  2UXB J;  4S0M A;  1FKO B;  2OEL A;  2V2Q A;  4PUO A;  2ZE2 A;  4I2P A;  1SQG A;  5B0D A;  4PXE A;  1IXK A;  4Q0B B;  1MML A;  2NQP A;  5KFA A;  3TYT A;  1RWP B;  1HAR A;  3HF5 A;  5L46 A;  3MCM A;  1IM6 A;  2VQF F;  4QWB A;  3QFH A;  2N4C A;  3DM2 B;  4B02 A;  1WG5 A;  4OHW A;  4ZJQ A;  2E9R X;  4EO8 A;  1SH0 A;  1WOR A;  3S8S A;  3VTI A;  3E2E A;  4Y2C A;  3R27 A;  1LWE B;  1RAE B;  4G3I A;  4BC7 A;  2C3M A;  2GHP A;  2F40 A;  4KKO B;  1H98 A;  4OZN A;  4ZIW A;  2HHU A;  3MPY A;  5B0G A;  3O6Q A;  1LEO A;  1HHT P;  2BJD A;  2DNL A;  5T41 A;  3FBC A;  2EC2 A;  3POT B;  3MMA B;  1GXL A;  2R7T A;  1S9E A;  3OHB A;  3HSD A;  2KJV A;  1U8W A;  3MR7 A;  3CCZ A;  3BKU A;  4O0N A;  4RW6 B;  1S6P B;  3LQV A;  1U0H B;  3NNC A;  2CDR B;  2KXF A;  4USH A;  4DBQ A;  3GR0 A;  3NGU A;  2HLU A;  5D0E A;  4I1T A;  5C2G A;  1YG0 A;  2ZEJ A;  3VGT A;  2NUH A;  2PFD A;  2R2U A;  4R8U A;  2HFV A;  4NZ6 A;  4ZMM A;  3D54 A;  1RAH B;  1UJ4 A;  2MYF A;  3PHE A;  5ETN A;  1KQK A;  1GXT A;  3IBC B;  1XMB A;  4DCP B;  4JI5 F;  3QGP A;  3W66 A;  3TP2 A;  5K5M A;  5HP1 B;  1C0T B;  3OTD A;  3HX9 A;  2DEI A;  2MQQ A;  3MAA B;  3KK3 A;  3V6K A;  3CC4 S;  1RAJ A;  4LRA A;  4FPR A;  1T3N A;  1FEE A;  3C6T B;  2W01 A;  3AOD A;  5LXR A;  1OSC A;  2MZQ A;  1RHJ B;  2M7S A;  4V19 X;  2ADB A;  1PBA A;  1LWC B;  1FJC A;  5CD4 H;  4ES1 A;  2GVD B;  2X1A A;  2H54 B;  4WFN Q;  2DY9 A;  5GVQ A;  2CIM A;  4JI2 F;  2RQM A;  3CJ5 A;  1DLO B;  3VQT A;  2MZT A;  2CXE A;  2ILY A;  1NXI A;  1N56 A;  2MLX A;  1CSJ A;  2W7A A;  3H2U B;  2B4O A;  3TVZ A;  4HR2 A;  1VI7 A;  2JJ4 D;  1VDH A;  1L3U A;  4WP9 A;  4OZ5 A;  1S1W A;  4K4Z A;  1B99 A;  2KB2 A;  3GYN A;  4I64 A;  2EW9 A;  5B0E A;  1C2P A;  5K8N A;  3UDV A;  2R8I A;  5A8R B;  4DF8 A;  3QNW B;  2ZKU A;  1HNX F;  3QLH A;  1Q8I A;  3KMS A;  4ZPT R;  4F4X A;  2JEF A;  2UZA A;  2DXD A;  1N4L A;  2BJ9 A;  4LQ3 A;  5ETK A;  1C1B A;  1HNI A;  4JV5 J;  3CPW R;  3M8Q B;  3RYL A;  2G0J A;  1YQH A;  3G87 A;  3THP A;  2JWN A;  1JLA A;  3HSZ A;  4D3G A;  5U47 A;  4OHV A;  4HI1 A;  2IAJ A;  3E01 B;  4RW8 A;  3IRX A;  3ZZZ A;  4O23 A;  2CQ0 A;  5K14 A;  1GTE A;  2CQ3 A;  2DXF A;  2KO1 A;  2HIQ A;  3BDP A;  4UF4 A;  1MU2 B;  3UD4 P;  3EE3 A;  4DU8 A;  1FRI A;  2AEJ A;  2X51 A;  2IVY A;  1CJK A;  3DOL A;  2HYI B;  5DLG A;  2OHD A;  4JI7 J;  4PG8 A;  1A0O B;  4DG1 A;  2D9P A;  2VB6 A;  2FJE B;  2UXC F;  2E29 A;  1IR2 A;  2VBZ A;  4CO0 A;  4B3M F;  2GO8 A;  4TNO A;  2ADC A;  3DHX A;  2OH2 A;  5L9N A;  4DV0 F;  2QE5 A;  5HVF A;  5EWF A;  4NYO A;  3CCJ S;  4TVA B;  2YVS A;  3O44 A;  2B7B B;  1UVJ A;  4MK7 A;  3A8I A;  3NLC A;  2HPU A;  1M5K C;  3S01 A;  1TAQ A;  2AP6 A;  4QWC A;  3T5H A;  1CS4 B;  3MPU B;  5FD1 A;  2P9C A;  3PKY A;  4ECT A;  1TK0 A;  4OHY A;  1CJT A;  2EXU A;  1X31 C;  1TKX B;  1JJH A;  4PR6 A;  3VAK A;  3HT3 A;  3DNC A;  5A0Y B;  3MMC A;  1UPM B;  4CH0 S;  2W7P A;  4UT4 A;  1VQL S;  3H42 A;  3IAM 9;  3CJ8 A;  4I68 A;  4HH0 A;  3JSM A;  2PI4 A;  1I94 J;  1VQ9 S;  5IQ6 A;  1X4H A;  2D3Z A;  2W9C B;  5HLF A;  4F4Z A;  2VG5 B;  1MWY A;  1KQS R;  3MM5 A;  4KIA A;  2YX1 A;  2HSE B;  3QO9 B;  4OLO A;  5IC4 B;  4QIW D;  4I67 A;  4IRD A;  5HQ8 A;  2ZIT A;  5I3U A;  2OEK A;  2JHE A;  4AQY J;  5BXI A;  1KEK A;  3BGR B;  4RJV A;  2UUA F;  1QAJ A;  3C2P A;  3ILI A;  4YY3 J;  1GX5 A;  3KWM A;  1U25 A;  4FXW A;  1TU0 B;  2VZ9 A;  3OTC A;  1NK9 A;  3JXO A;  3Q2S C;  4O44 A;  2DGQ A;  1TMM A;  2FLO A;  4O4R A;  3MED B;  4J9O A;  4PQU B;  2JEI A;  5C7P A;  1Q82 T;  1S76 D;  3LUY A;  2LP4 A;  4N76 A;  4K0K J;  1FER A;  2XB2 D;  2W2P P;  3PHT A;  1LXJ A;  4ZVR B;  2YWG A;  4WFB Q;  2ZBQ A;  1QTN B;  1I3O B;  4C8Z A;  1NJW A;  2EKY A;  3CO0 P;  4XDD A;  3HUL A;  4W4M A;  4J9L A;  1R6Y A;  4ED3 A;  2ZOF A;  4YDX A;  2KT5 A;  1HWK A;  2ASD A;  3OTE A;  1F5C A;  1S10 A;  2HRU A;  1HYS A;  4H4M B;  4A8O A;  3C6U B;  3I31 A;  4X4R A;  1Q7L B;  2ZDO A;  3MFI A;  2VHG A;  1N6Q A;  3MMJ A;  3DRR B;  1GFW B;  4KQZ A;  3DOK B;  2ATL A;  4MIW A;  2FHJ D;  3GMG A;  2MQ8 A;  3N6L A;  2ZD1 A;  4DEZ A;  2M5Y A;  4F0K A;  3NGR A;  2KN4 A;  4OJ3 A;  1HBN A;  4PEO A;  3OT9 A;  1IKX A;  1JLQ B;  2NLW A;  3TAR A;  1JK9 B;  1N88 A;  4JI6 J;  3W3S A;  1JB0 C;  5HRO B;  2VU5 A;  3C8Y A;  2GQC A;  2DNZ A;  4RBV A;  3I4H X;  1R31 A;  2CQP A;  4B9L A;  3GJR B;  4ED6 A;  4XPE A;  3Q89 A;  5F8L A;  3JQJ A;  3FMW A;  2Q6C A;  2WSF C;  4K8R A;  4RW4 B;  1Z2Z A;  4WP8 A;  2RUG A;  2R7O A;  2PMW A;  3T3F A;  1ZTW A;  2DH8 A;  2DYA A;  1V3R A;  5C42 A;  4P6Q A;  3KHG A;  4M5I A;  1XBW A;  2MGZ A;  1NO8 A;  3QGG A;  2MZS A;  1IKY A;  2DIU A;  4RPF A;  2XO6 A;  3Q8R B;  3HVW A;  3TQE A;  3ZZY A;  2AJQ A;  4ZVO B;  5EUH A;  5LXY A;  2M0G B;  3QT5 A;  2Q6B A;  3KK1 B;  5D15 A;  1YJV A;  5K8M A;  2VBY A;  4JV5 F;  1NK7 A;  3CDE A;  3EVO A;  4DQI A;  3Q86 A;  4BC9 A;  3FCV A;  3OSP A;  1B64 A;  4C2M A;  2VFT A;  5LL6 d;  5LJ3 Y;  4PUO B;  2ZE2 B;  4I2P B;  3NS7 B;  2K8G A;  2LYV A;  2CPJ A;  3UO0 A;  2MEW A;  4EWT A;  5G0R A;  5K20 B;  3MGJ A;  1FRH A;  2RDJ A;  3KJV B;  1ZAV A;  3V81 A;  1QDU B;  1XMQ J;  1KLM A;  2G2Z A;  5HAO A;  4X2B A;  5ITH A;  4OZ2 A;  4QW8 A;  3PW5 A;  3HKZ D;  5DG9 A;  2RRB A;  4GRS A;  2XMW A;  3Q8S B;  5HQM A;  1FDB A;  3HHK A;  4WYW A;  2OSR A;  4DPW A;  2V8H A;  4A8W A;  4ED0 A;  1OS5 A;  4JI7 F;  1NME B;  3GFX A;  4U95 A;  4X4P A;  1YJN S;  2HND A;  2M88 A;  4ECY A;  1DTQ A;  4OV6 A;  2MLY A;  3J81 U;  1FFG B;  3W64 A;  3GV7 B;  2V8D A;  1AW0 A;  4L76 A;  3KNA A;  2F5G A;  4UY8 5;  1HQU A;  2XNR A;  1RT3 A;  2MHN A;  2WTF A;  2PA3 A;  2HHH J;  2DR5 A;  1S9E B;  3SSR A;  3OR1 B;  2XC9 A;  2GZO A;  4DLG A;  4ZCI A;  3V4I A;  1WF1 A;  4K4T A;  1QVG R;  4ZLP A;  4DV5 J;  4TLQ A;  1SC6 A;  4F25 A;  4FYD A;  3AD9 C;  1A6L A;  3AD8 C;  2GS8 A;  1RAD B;  2CQG A;  2ERR A;  1FK9 A;  3VVT A;  2BOP A;  4ZJL A;  1X9W A;  1IWA A;  4IRC A;  2AZ3 A;  4CLW A;  4R8U B;  3MF5 A;  3SYZ A;  3TAN A;  3IM8 A;  1K47 A;  1ZAW A;  3P6Y C;  2ZVI A;  4EEY A;  1TFY A;  4C7Q A;  3NCQ A;  4BLG A;  3ONQ A;  4NLV A;  4N56 A;  1X9S A;  1NK0 A;  1KR4 A;  1O6X A;  3EVM A;  1I94 F;  1BQM A;  3RBD A;  1OY9 A;  1VHI A;  5E3R A;  4K50 A;  4CLY A;  1Q95 G;  2JFK A;  4QWE A;  2FJW A;  2EFG A;  4ELT A;  1TEL A;  2PC6 A;  3TRG A;  2YWF A;  2VL1 A;  4DJB A;  2JC0 A;  4M1K A;  2FB0 A;  1UA1 A;  4LRC A;  1SJ1 A;  4G1P A;  2NXC A;  4C3K A;  2HRT A;  1RWU A;  4N7T A;  2XMT A;  1N32 F;  1T05 A;  3AJD A;  4XDC A;  3IR7 B;  1LFP A;  1ZM4 A;  3BKT A;  1HFE L;  6FD1 A;  1SL2 A;  3B4D A;  3D4J A;  2C2Z B;  4ZJO A;  3I0R A;  2D3U A;  1I6J A;  1X4A A;  4F7V A;  2KH9 A;  5L1I A;  1S1W B;  1R3N A;  4PG5 A;  3H4B A;  1U1R A;  5IT9 Y;  4FS2 A;  2KZM A;  4OJ1 A;  1GQE A;  2HKE A;  4NYP A;  3Q22 A;  3UDE A;  3IAS 9;  4NCG A;  4KHR A;  3QLH B;  4NYZ A;  1U1M A;  1LKZ A;  3V2U C;  2H51 B;  3GTY X;  4NAS A;  5AT1 B;  1C1B B;  1HNI B;  5HBM A;  2I9S A;  1S57 A;  1IM4 A;  4CI0 B;  2QT7 A;  4PPZ A;  1JLA B;  3LGH A;  4Y65 A;  4LFC F;  3R3T A;  1YVF A;  1QSY A;  3BGF A;  1Q1K A;  2IAJ B;  4RW8 B;  3DMJ B;  3IRX B;  4QR2 A;  2I0X A;  5RUB A;  4ZCL A;  5K14 B;  4ZVF A;  4EBC A;  4OQJ A;  4IR9 A;  1U0S A;  3I32 A;  4B9S A;  3LGN A;  1T9T A;  3H8Y A;  2Y8Y A;  3OVS A;  1SL0 A;  1MMD A;  4EYH B;  2XMA A;  3F44 A;  1CJK B;  3DOL B;  2C3O A;  3PW7 A;  4DG1 B;  4JV1 A;  3BO2 A;  4JI6 F;  1VQO S;  4ZK7 M;  2IYI A;  2ZOM A;  1X0F A;  5T7L A;  3H25 A;  2D3O R;  2GAH C;  3GON A;  3GR1 A;  4NLO A;  3TEH B;  4YR0 A;  2VQE J;  2F9D A;  2QLB B;  4RR5 A;  2J76 E;  3KG0 A;  1MW7 A;  3BF4 A;  5KG5 A;  2A6M A;  4OZL A;  2XQC A;  4OI3 A;  2NPF A;  3CCM S;  2MQN A;  3G4S S;  4OX7 A;  2ZC4 A;  5DDO C;  3ILJ A;  2KM8 C;  1SJR A;  1F9H A;  5IV3 A;  3J81 Y;  5HI7 A;  3GSD A;  4WPA A;  1IBL J;  2QLW A;  1S0N A;  1I51 B;  3SIP B;  4EGL A;  1X5T A;  3OR2 A;  3KFW X;  3VQS A;  1A7G E;  2VV5 A;  1NSK L;  4GO7 X;  5GAD I;  1CJT B;  3EGV A;  4NOH A;  2CJA A;  1LW0 B;  3DLE A;  1JLF A;  1CJV A;  2BVZ A;  4ZPD A;  4AL6 A;  1SC3 B;  2Z56 B;  4ZP6 A;  3MMC B;  5FDL A;  3MDF A;  4Q8E A;  2U1A A;  1SJQ A;  2ZWO A;  4FF4 A;  4OMF G;  2RF2 A;  4DFM A;  2RHS B;  4C11 A;  4A8Y A;  3CGI A;  3ZNU A;  4IR1 A;  2OFH X;  4DV3 J;  2RUS A;  1F60 B;  2FVQ A;  4KPY A;  3JSM B;  1T7P A;  3JYT A;  2FC9 A;  1NPK A;  3G8S A;  1U6Z A;  5HLF B;  4RX6 A;  1FXD A;  2EKN A;  5HAT A;  3MM5 B;  4AXJ A;  1WKK A;  5GAE I;  3G96 A;  4DOZ A;  3CD7 A;  2KYX A;  1WTB A;  5A8K A;  1RT4 A;  1VQK S;  5I3U B;  5F9N A;  2E9T A;  2QA1 A;  2FJX A;  1KVJ A;  3CJR A;  1WC6 A;  2DRA A;  3I82 A;  1NZA A;  2DD8 S;  2CQ1 A;  4AD6 A;  4TY9 A;  1YJW S;  4J9U E;  4IG3 A;  2JFD A;  4X66 J;  1KQG B;  3U1L A;  1KFD A;  4CLK A;  3Q8P B;  3EXY A;  3CED A;  1FRK A;  2ZH2 A;  1YRX A;  4Y3C A;  5AE2 A;  1E6V A;  3AH6 A;  1S4E A;  1JWW A;  3BSA A;  4GO5 X;  4LSL A;  3V6D A;  2ZHA A;  3R5D A;  4BS2 A;  3LTO A;  1GTH A;  2PN6 A;  3DGP A;  4O44 B;  4UY8 T;  2HHH F;  1FXL A;  2ZNZ A;  3EGN A;  1T94 A;  3OXG A;  4OI6 A;  2RIJ A;  1L3K A;  4BHQ A;  2Y1R I;  1S0M A;  4M5G A;  4TLR A;  4Y2M A;  5L9X A;  4NXM J;  5BYQ A;  4NPO A;  2F4V F;  2QJ3 A;  4DUT A;  3W7B A;  2YBV A;  5KFO A;  3ZZO A;  2XZT B;  3FEY B;  3UFC X;  5DQH A;  1IWG A;  1HYS B;  4EMD A;  2BYC A;  1UP1 A;  3TUP A;  4MK8 A;  4CWB A;  1RT5 A;  3CUL A;  3FZ2 A;  1OY8 A;  4CLL A;  1N6Q B;  2CJQ A;  3EZO A;  5DM7 Q;  3J7Y U;  1SJF A;  3THT A;  4R5P A;  3HP6 A;  2I5J A;  2ZD1 B;  1M1K T;  1HBN B;  2IA0 A;  4I0W A;  1IKX B;  3BEG B;  2ACM A;  1TL4 A;  1G6B A;  2IPO B;  2CPY A;  3W9H A;  2E7V A;  2E5H A;  3VWS A;  1F2G A;  4CH1 A;  3MUT P;  3LA0 A;  2AD9 A;  1R6V A;  2QIF A;  3QWU A;  4WZM A;  2A10 A;  2Z2M A;  2GIQ A;  2V9K A;  4KTQ A;  4QIF A;  1X4C A;  3BGO P;  2MB0 B;  1NSA A;  1FDA A;  3H5Y A;  1VQ7 S;  3CCL S;  2YQ1 A;  5ETV A;  2HQI A;  5C42 B;  2BRK A;  4K4X A;  4KC5 A;  4DX8 H;  1IBK J;  1IKY B;  3AXM A;  1SKU B;  1HPZ A;  4IFV A;  4DMZ A;  3UN3 A;  5IFM A;  1NPP A;  1K9M T;  4DR7 F;  2KG0 A;  2OI2 A;  2BQR A;  2DCL A;  1RZM A;  4R0E A;  2KFY A;  2HRY A;  4OI0 A;  5MLC V;  4LF5 J;  1PCA A;  3G6X A;  2WRM A;  3NEK A;  3CT9 A;  4DUZ F;  2V4Q A;  4DFJ A;  2UUW A;  5G0R B;  4H4O A;  3M2R A;  2YKO A;  1VK3 A;  2CJB A;  1BC6 A;  2HHV A;  3V81 B;  1KLM B;  2DBB A;  2R7V A;  3GJT B;  5AXM A;  3F0N A;  2M70 A;  4NLQ A;  4PYD A;  4QU7 A;  5F8J A;  3IN5 A;  4PG4 A;  1Q8L A;  1OMS A;  4I2Q B;  1Y0H A;  1RYS A;  2HK2 A;  2ROE A;  3HFK A;  2NZ4 A;  4NZ0 A;  4ZOS A;  1WKJ A;  2RDD A;  2HND B;  4EI2 A;  4P7T A;  1BE4 A;  1DTQ B;  1R0B G;  1DUR A;  5DGB A;  4L3N A;  5A76 A;  3T5L A;  2NSB A;  1IBC B;  3W63 A;  2BV3 A;  1HQU B;  3SMZ A;  1EX8 A;  1RT3 B;  2EBG A;  4WFA Q;  5ETM A;  1WEX A;  3OTO F;  1OO0 B;  3CXC R;  2HG4 A;  3A3O B;  2GC8 A;  2XMJ A;  4KV8 B;  3FEX B;  3ILL A;  3K8V A;  2WVC A;  4OZ1 A;  5L8R C;  1PO6 A;  5GAH I;  3V4I B;  5ETQ A;  2ZH8 A;  3TAP A;  3DYA A;  4Y2I A;  1UVL A;  1YTY A;  1UKU A;  1EQ0 A;  3TO8 A;  1SJ3 P;  3MR5 A;  4E98 A;  1QSL A;  3KYL A;  1FK9 B;  4Y2A A;  5BJR A;  2B7C B;  2CJ9 A;  1S4F A;  3KLV A;  1VQS A;  5J1N A;  2IVM A;  2BX6 A;  4P9S A;  4FVC A;  3DRS A;  3O1L A;  2LXI A;  3UDC A;  1RYR A;  4U9R A;  2FHK A;  2MKI A;  4OYB A;  2IJN A;  4DV3 F;  4MKV A;  1QUP A;  1ZYQ A;  3QFW A;  4J37 A;  1QAX A;  1D1U A;  1J27 A;  3HHL C;  3ETO A;  3JSY A;  2R8K A;  3H5S A;  4A8X A;  2FHO B;  2VG7 A;  3W9J A;  3OUY A;  4KSE B;  3W2W A;  4B08 A;  3QZ8 A;  3DHW C;  2HS4 A;  1YK9 A;  3I5C A;  1EHW A;  3MFH A;  1D8Z A;  4YB5 A;  1QVF R;  1V5I B;  1N33 J;  2DGW A;  1L3S A;  2UVU A;  1L3T A;  2F3J A;  2FD2 A;  1VBY A;  4PAB A;  3IBW A;  3RUB L;  2QA4 S;  2QEX S;  2BE2 A;  1ZM3 A;  2DPI A;  2NXE A;  3FBE A;  2DO0 A;  1GNK A;  3PZP A;  2XGP A;  3IGN A;  3EZU A;  1KVI A;  4DUY J;  2AJ4 A;  5KT7 A;  1SIW B;  1R7I A;  4C6A A;  1SH2 A;  5D3G A;  3I0R B;  1SL1 A;  5SUH A;  2B9E A;  5EX3 A;  1KHW A;  3R5B A;  3BSO A;  2L41 A;  3K5N A;  4K4W A;  4H4K A;  1T9X A;  3VGU A;  3L9Z A;  3GV5 B;  4LF9 J;  1FE4 A;  4ECR A;  3MAH A;  3A1Y G;  1U1Q A;  2F8H A;  1HLW A;  1YHQ S;  1D09 B;  3CF5 Q;  3FQK A;  4K7Q A;  5KFX A;  4NCG B;  1BMQ B;  4DSE A;  4CLS A;  4Q2M A;  2MJU A;  1S5Z A;  2CPZ A;  4IH5 A;  1YDL A;  3RW7 A;  4ITS A;  4AUK A;  2DHA A;  3GZ7 A;  1OJ4 A;  4CCH A;  1WDT A;  4A8K A;  5HBM B;  1FFS B;  1RKI A;  5MAO A;  2H4Y B;  2H48 B;  2K1R A;  3W61 A;  1Y11 A;  1JIH A;  1TVR A;  1VHF A;  2BJ1 A;  1RAA B;  1G2E A;  3CJT A;  5HMX A;  3DOM A;  3EPG A;  2BQU A;  2DR9 A;  1XEZ A;  4FP9 A;  2OPQ B;  2QV6 A;  4LFB J;  3BKF A;  3WX4 A;  1NM2 A;  5GMK a;  2HFU A;  2R7Q A;  1RQ0 A;  3EJM A;  1RWK B;  1HWI A;  4OYA A;  3D28 A;  2PEH A;  1CEZ A;  1U47 A;  3FDS A;  4LSZ B;  5BR8 F;  1AFI A;  1FJG J;  2AIR B;  1WC4 A;  3OVB A;  4ETZ A;  4KHP F;  2VDI A;  2EG1 A;  1VS3 A;  5L39 A;  5DRK A;  1N5T A;  4HL9 A;  1HIY A;  4ZVH A;  1J5E J;  5SZT A;  4DWI A;  3R5C A;  1OYE A;  1IJE B;  4GVL A;  4NA1 A;  2JZ5 A;  2RQK A;  3H20 A;  1FA0 A;  2VFS A;  4IRK A;  2DTJ A;  2HZA A;  3OVA A;  1U1O A;  3IMQ J;  3PRD A;  3OR2 B;  4KHM A;  3OHA A;  2B6A A;  2UVV A;  2QL5 B;  4PPD A;  2VKZ G;  2CJK A;  3IP0 A;  3DLE B;  1CJV B;  1JLF B;  4YB6 A;  4ZVP B;  1WDD A;  3EXC X;  3T1A A;  5FDL B;  4WTY A;  5C25 A;  2RF2 B;  4C11 B;  3I9V 9;  4RWW A;  3LO3 A;  2A2D A;  4UST A;  3EDR B;  1F0X A;  3NS6 A;  4HTI A;  4LF5 F;  2YKN A;  3O5T B;  3JYT B;  4QYZ J;  4GVB B;  3LH2 S;  1X4B A;  5AXL A;  5IXU A;  4FF1 A;  3K2Y A;  2X1G A;  4UOG A;  3TW0 A;  4YS2 A;  4QIG A;  6FDR A;  4B9U A;  2F8E X;  1CUL A;  3PW0 A;  3J7Z 5;  5A8K B;  1RB0 A;  1TFW A;  1QUV A;  1H38 A;  1RT4 B;  3R2C J;  5CYQ A;  3P8B B;  3LWM A;  1XR6 A;  4KPC A;  1M5P C;  1IJF B;  5KTQ A;  4YHH F;  3JAM U;  1N54 B;  3RAQ A;  5F3Z A;  3AOA A;  2AV5 A;  1C4C A;  3PR5 B;  3U1N A;  3HD2 A;  4IG3 B;  4OV1 A;  3KJF B;  5B09 A;  3W9I A;  1ZZN A;  3W5Y A;  3BGL A;  8ATC B;  4NXN J;  1YWX A;  4KT0 C;  3ZXW A;  1E6V B;  3P5T L;  3SDE A;  3AJ1 A;  4LSL B;  3HO1 A;  3V6D B;  4CH7 A;  1DHM A;  3DGP B;  2GJI A;  2XCA A;  2RKI A;  2VF3 A;  2RHQ B;  5A6P A;  1KN6 A;  5KG4 A;  3TAM A;  2YX4 A;  1GK8 A;  2W25 A;  1HR0 J;  1RAG B;  2HFO A;  1FKA F;  2G1D A;  4NE9 C;  3W65 A;  3HJF A;  1H2U X;  3CJK A;  5LOQ A;  2E5G A;  1BXN A;  5AJ3 J;  3EGZ A;  5FLX U;  4K4Y A;  2ZJQ Q;  5M2R A;  7FD1 A;  3M9N B;  4F4K A;  5I42 A;  2KJW A;  3NNH A;  1IBM J;  4DPX A;  2VPX B;  1U24 A;  2VUG A;  1U1L A;  1YGY A;  3D68 A;  2B51 A;  1LNQ A;  1RT5 B;  2QYC A;  1LWX A;  1BGX T;  4PZV A;  5KFF A;  3VVU A;  2IDL A;  5DLF A;  1HNV A;  2C2N A;  5JXS A;  2P9E A;  4R5P B;  1RTJ B;  4IG0 A;  2I5J B;  3VV2 B;  1B0V A;  4IYQ A;  4AT1 B;  4A8Q A;  1LXN A;  2OPP A;  3KJN B;  4ZVT B;  2O5D A;  4CNZ A;  2FJD B;  4TU8 A;  2P2C B;  2IA6 A;  4IOA Q;  1SH3 A;  3QT6 A;  2FZK B;  5KFW A;  3HT0 A;  5L1K A;  2AZ1 A;  1HD0 A;  2V8G A;  3P5B P;  3HSJ A;  2LFV A;  2NCK L;  2HQD A;  4ANC A;  2UU9 F;  5DQI A;  2KVQ E;  5F8M A;  2J6S A;  2DY1 A;  4M8L A;  3ZC4 A;  2FYX A;  1BD6 A;  2HQ3 A;  1WAC A;  4KYZ A;  2J9C A;  5LSL A;  3HVA A;  2DJW A;  4LF9 F;  2UUC F;  2Z4P A;  2PT0 A;  1TKZ A;  3HHN B;  4YP3 A;  3CJ0 A;  3EM1 A;  4D3H A;  3DRY A;  3FEZ A;  4N47 A;  2KL8 A;  1HPZ B;  2DH7 A;  4WXO A;  2VBX A;  2BUN A;  4NLX A;  3W2V A;  4TKT A;  3Q23 A;  2V63 A;  1U1N A;  3TA1 A;  2V69 A;  3WZ0 A;  2X3G A;  2MST A;  5CCM A;  1XMO F;  3GB0 A;  5KG1 A;  1HA1 A;  2KFZ A;  1C0T A;  1PBU A;  3W5Z A;  2RVJ A;  1RTI A;  4WKR A;  2ZZM A;  2XG8 A;  3U1M A;  3FRY A;  2VOP A;  1XIQ A;  3UW1 A;  4H4O B;  3QT8 A;  3K5L A;  5JUM A;  3M2R B;  3IBF B;  4F8R A;  5AXN A;  4YR2 A;  3J80 U;  2DVI A;  2GVD A;  2BR0 A;  1CPZ A;  1HW8 A;  1NK4 A;  3VAJ A;  1Y5N B;  2Q79 A;  2C2M B;  3X3U A;  4MIB A;  4WP3 A;  4LMZ A;  3IA0 A;  3LF0 A;  2E5J A;  4ZLN A;  3B6B A;  3A3P B;  4EK2 A;  4RBT A;  2KTQ A;  1LK5 A;  5FJ4 A;  1JMT A;  4CO5 A;  4C3L A;  4DR5 F;  1N34 J;  1YRT A;  4LRD A;  2ZH6 A;  3I6P A;  2WW8 A;  3QJJ A;  3T41 A;  5LJ5 Y;  4C9D A;  1J5E F;  3PV8 A;  3DLK A;  1TL5 A;  5DDR C;  3JAM Y;  1RWN B;  1NHU A;  5DQG A;  2PFF B;  1SKR A;  3E3X A;  2VC0 A;  3M4X A;  4CO2 A;  3DYA B;  2Z2L A;  4LVO P;  3HD1 A;  2HAF A;  3PM9 A;  1EAR A;  2LQ8 A;  1ZM9 A;  4O0I A;  3ZTP A;  2P8I A;  2QFI A;  5EWE A;  2WCX A;  2B4U A;  1GH8 A;  3NCP A;  1SV5 A;  3DRS B;  1RT6 A;  1LQ9 A;  4KFB A;  2HUR A;  2XMK A;  4JV2 A;  4X4Q A;  1SBR A;  2B9Y A;  2NXN A;  5KT3 A;  1S6O A;  1R8A A;  4N77 A;  3KLI A;  4LF4 J;  3FGV A;  2DT9 A;  3M6W A;  4ZP7 A;  2VG7 B;  3OUY B;  4Y34 A;  3TA0 A;  3JTP A;  3W2W B;  4RW9 A;  4UTG A;  1KON A;  2PMZ D;  4ZKA A;  4GKK J;  1T3O A;  1H74 A;  1T95 A;  3TZY A;  1GMW D;  3OPK A;  4DSK A;  5IV4 A;  3J7Z T;  1LOU A;  2VFR A;  3WIV A;  2BE2 B;  1T02 A;  1DZ5 A;  4O3N A;  2DNQ A;  2DR8 A;  3L7O A;  4G1Q A;  3V6J A;  4RKU C;  2AEF A;  1B0T A;  2AMC B;  4JV0 A;  5D3G B;  1NZ8 A;  4DL7 A;  1X8D A;  2D69 A;  2Z58 B;  4WII A;  1N5Q A;  2Z2Z A;  3QPI A;  2QSF A;  1TKX A;  2HHX A;  1DJ0 A;  1DRZ A;  1QAY A;  4C8Y A;  1Q8K A;  1U45 A;  4MH8 A;  1HR0 F;  1FRJ A;  3MM6 A;  4ED5 A;  1O5J A;  1MN9 A;  4K4V A;  3GFZ A;  3GG0 A;  2ZH3 A;  1SI9 A;  3OL9 A;  1G7C B;  2NR0 A;  2YNF A;  5AJ3 F;  2W1B A;  4RO0 A;  2HFN A;  1UCN A;  1WF0 A;  2K1R B;  1DTT A;  3OFH A;  1ULR A;  3IR5 B;  1EB0 A;  3N6N A;  2AJ2 A;  3VF0 B;  3DU6 A;  1TVR B;  3MTK A;  3UR0 A;  3ULH A;  1IBM F;  3QO9 A;  3LP2 A;  5LMU F;  3M8S A;  3DOM B;  2HVD A;  3M2U A;  1YBU A;  4C0B A;  2J9D E;  3HFZ B;  2HFS A;  3D67 A;  2JRS A;  4QZV B;  5B0A A;  2BAN A;  1UFK A;  3M8W A;  3CC2 S;  4ZIT A;  1RHR B;  2R7R A;  4ZVQ B;  2VKR A;  1HHS A;  2DNH A;  1GEH A;  3MR6 A;  2MQP A;  1A9N B;  1NB2 A;  3N4W A;  4AXI A;  5JVG Q;  1SC1 B;  3J80 Y;  4FNH A;  3RTV A;  4OYO A;  3I55 S;  4IOB A;  2GX8 A;  4DPT A;  3B82 A;  2FLL A;  3GPA A;  3D7S B;  5KAK A;  2WVD A;  1GMU A;  4ECV A;  5DS7 A;  2JDJ A;  1HHQ A;  4URS A;  4C0H A;  3SBM A;  1VQ8 S;  2XSF A;  4C3M A;  4WK1 A;  1EZZ B;  1H7W A;  3FKB A;  2XMU A;  3A8E A;  3QSI A;  2ZM6 F;  2QTW A;  5K8O A;  3VAF A;  2HBZ B;  3GYG A;  4P2S A;  2B6A B;  4M95 A;  5E33 A;  1NH8 A;  2YWH A;  3C6U A;  3UE2 A;  2V5H G;  3FK4 A;  3K17 A;  4N5S A;  3QGH A;  2QZ8 A;  2E5L F;  3HHL D;  3C16 A;  1TUV A;  1G4C A;  5CYM A;  5C25 B;  4DR4 J;  5ADZ A;  4QIE A;  5D4P A;  3ITH A;  2YY3 A;  4DFP A;  2YKN B;  4ZCK A;  4JYA F;  4K5S A;  2GVZ B;  2G1H A;  1YSJ A;  4ALZ A;  2IM3 A;  3NXZ A;  2N3O A;  1CUL B;  1FKP B;  1Q4R A;  3TVK A;  4B3M J;  3O3L A;  3OL7 A;  2AX0 A;  4DV0 J;  3BPS P;  4ID8 A;  4ED1 A;  5CYQ B;  1DY3 A;  4PG6 A;  4DR6 J;  1HBM A;  2XMM A;  1PIE A;  2A2C A;  3DI6 A;  3OL8 A;  2HVH A;  1OQ6 A;  4RNN A;  2N7C A;  3M6X A;  4FKY A;  4CP5 A;  1DQ9 A;  4FPI A;  1N8R T;  7AT1 B;  2IM1 A;  2IMO A;  1YBA A;  4YUD A;  4AL7 A;  2D41 A;  4P72 A;  2OJ3 A;  3SDE B;  1NLK L;  2XHC A;  2ATC B;  2F9J A;  2HWI A; 
#chains in the Genus database with same CATH homology
 3T1H J;  4DR1 J;  4DR7 J;  4B3S J;  3OTO J;  1HR0 J;  1FJG J;  2ZM6 J;  4LF6 J;  4LF9 J;  4DR4 J;  2UXD J;  4NEZ A;  2KVQ E;  4X62 J;  4NXM J;  1N32 J;  3J80 U;  1XMO J;  4KY3 A;  4LF7 J;  4DR2 J;  2VQE J;  3R2D J;  5LMU J;  5LMN J;  3W1Y C;  4LF8 J;  4V1A k;  4JI2 J;  4JI3 J;  4JV5 J;  5A2Q U;  5AJ3 J;  5FLX U;  4DUZ J;  4X64 J;  4GKJ J;  4OX9 J;  4NEY A;  1J5E J;  4AQY J;  4KYZ A;  2E5L J;  3J81 U;  1XNQ J;  4JI0 J;  4RJV A;  1IBK J;  1XNR J;  4B3M J;  1IBM J;  3T1Y J;  3R2C J;  5BR8 J;  2UU9 J;  4LF4 J;  4B3T J;  4YY3 J;  4KHP J;  5LM7 E;  2VQF J;  1IBL J;  2MQ8 A;  2HHH J;  2UXB J;  2KL8 A;  4DV0 J;  3D3B J;  4X66 J;  2F4V J;  1N34 J;  3JAM U;  4DV4 J;  1N33 J;  3J7A N;  5IT9 U;  1HNZ J;  4GKK J;  2MTL A;  3IMQ J;  4DR6 J;  2UXC J;  4DV7 J;  4JYA J;  4DV5 J;  4JI6 J;  1HNX J;  1HNW J;  2UUB J;  4JI4 J;  4JI5 J;  3D3C J;  4X65 J;  4DV1 J;  4NXN J;  4LFB J;  4LF5 J;  4DV6 J;  2MEW A;  2UUC J;  4PWW A;  1N36 J;  2UUA J;  5IWA J;  4DV2 J;  4B3R J;  4JI7 J;  4K0K J;  4HHU A;  1XMQ J;  4DUY J;  1I94 J;  4DV3 J;  4JI1 J;  4JI8 J;  4LFC J;  4DR5 J;  4LFA J;  4YHH J;  4DR3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...