4DR6J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr6J00
1XMQJ 1N36J 4X65J 4DV1J 4LF9J 3W1YC 1XNRJ 2E5LJ 4GKJJ 3T1HJ 4NEZA 1FJGJ 1HNWJ 1N34J 4RJVA 4B3RJ 5BR8J 2F4VJ 1HNZJ 4GKKJ 2HHHJ 4NXNJ 1XNQJ 4B3SJ 3T1YJ 4JI5J 3JAMU 4KYZA 4JI4J 4DR1J 4DR6J 1XMOJ 4LF7J 2UXCJ 4JI7J 4YY3J 5LM7E 4NEYA 1I94J 4LF5J 4AQYJ 2UUCJ 2ZM6J 1HNXJ 5LMUJ 4JI2J 1N32J 2MQ8A 1IBKJ 1J5EJ 2UUBJ 3D3CJ 4LFBJ 4X66J 2UUAJ 4LF4J 2KL8A 4LF6J 4KHPJ 4JI3J 4K0KJ 4HHUA 4DUYJ 4X62J 4DV5J 4DR3J 2UXBJ 4DV4J 5FLXU 4DR4J 4B3TJ 4LF8J 2UXDJ 4LFAJ 5LMNJ 4JI1J 4OX9J 3IMQJ 4V1Ak 2KVQE 4DV2J 2MEWA 4DV7J 4JI8J 5IWAJ 3J7AN 4JYAJ 4DV0J 3OTOJ 4DR7J 2VQEJ 4JI6J 3J81U 2MTLA 4DR2J 1HR0J 1IBLJ 4DUZJ 3D3BJ 4JV5J 5A2QU 4B3MJ 4DV3J 1N33J 4X64J 2VQFJ 4DR5J 5AJ3J 5IT9U 1IBMJ 4NXMJ 4YHHJ 2UU9J 3R2CJ 4PWWA 4KY3A 4LFCJ 4DV6J 3R2DJ 4JI0J 3J80U
chains in the Genus database with same CATH superfamily
2CNOB 1VMBA 2QSFA 4HACB 4MYTA 4NLPA 2ZWOA 1UAWA 3MM9B 4RW9A 5KG7A 2UP1A 4DSLA 1EP4A 1Q1KA 2AF6A 1XEZA 1G2EA 5D4LA 2N7CA 1RDRA 4B9UA 4TKTA 2W9BB 2R2TA 1NKCA 4GKJJ 2XYHB 4DSFA 5HLFA 4DV0F 1DHMA 2V4QA 3MF5A 2KFNA 2GVZA 1YRTA 1MMDA 1FO1A 2HFUA 1WKLA 2NUUG 4DL0C 1FJEB 3FZBA 5J1EB 1JLGB 2F4VJ 4ZIWA 2HQ3A 3ELHA 3JYTB 1E6YA 3VAJA 1XN9A 2RILA 3T1YF 2HHHJ 1TKXA 2GA7A 2OI2A 3GG1A 1OO0B 2E5HA 2QA4S 3KK1B 4Y2AA 4ZCMA 5J2QB 3M9OB 2VG6B 2IY5B 4LF1A 1EQMA 1XJWB 5GAHU 1C1BB 1LK5A 1T8EA 3OXGA 1XMQF 4F0MA 2UUAF 4O4RA 2CVEA 4FXWA 3TJ8A 4GC6A 3PJWA 3W2WA 1VJWA 4H4KC 1SXLA 1YJWS 1SBRA 4AD6A 4P72A 1VIOA 1HWUA 5L8RC 5GADU 2MLXA 4B3SF 3RB6A 4HH1A 2YX4A 1P8GA 3MEGB 5LSRA 1FRKA 1M5KC 2UXBF 1Q8BA 2CQDA 2CQIA 2DNKA 3I0SA 5HQLA 3T5HA 2VU5A 3M32B 1W26A 2GMHA 4I2QB 3QO9A 4PYAA 1FK9B 5F3TA 4BLGA 5KFEA 1Z2LA 3PYEA 4ZVOB 3OR2B 3AJDA 4LIRA 1SKSA 4PG6A 1VRUA 1N32J 1AFIA 1IBMF 1R0AA 2NUHA 1SKRA 1F9FA 2OEMA 4K5SA 4FP9A 3D2WA 3JQJA 3R1LA 3M8QA 3FSYA 4OZNA 3OTBA 3QQCD 2FVCA 5KFLA 3GU0A 5CXTA 2RS8A 3ZZRA 1QAJA 2AEJA 2GQQA 4OL8A 2ROEA 2WONA 2AHOB 4RKUC 4OHZA 5LXRA 3PX0A 2OAUA 5BYQA 5KFFA 1XMOF 2ERRA 3H8YA 4X4SA 1T3NA 4LR7A 1ZPVA 4DR2F 3TAMA 1YGYA 4EO6A 1VQPS 3F56A 1RTIB 4OQJA 3I4HX 2VFTA 5KG1A 3QRPA 5L38A 1NK0A 4DFPA 3ENVA 2H4WB 5HMWA 3RZAA 1PC4A 1RE1B 3UDCA 1N0UA 5LMNF 1KHVA 2ZZTA 4RPFA 5CYMA 1U24A 4B9LA 1GNKA 4TYBA 2VASA 4A46A 2UUCF 3OR1B 4B9SA 2FHOB 1KBRA 4V1Ak 5A76A 1HBMB 3MHYA 4G65A 3U1NA 2JLGA 2FLLA 1RABB 4USWA 2MGZA 4JYAJ 4A4JA 4DG1B 4IRKA 1RA7A 4URGA 1FJGF 3DGPA 4NA2A 2ZH8A 5H9EJ 3PCOB 2J0QD 2MTLA 4DUTA 4KC5A 1W2BR 4ZJQA 3TP2A 5JUMA 1TKDA 3LOUA 1VQKS 1VJQA 2QLWA 1S0OA 5A8WB 3T5JA 2CZ9A 3MECA 2ASDA 2DXEA 2Q43A 4UOGA 3J80Y 5CD4H 1Q0NA 1WSRA 2IM2A 3CCTA 1RI7A 5DQGA 1PJ6A 5JVHQ 3BR9A 3KK1A 4RBUA 3A3OB 4MH8A 3DLJA 4K2XA 5KG3A 4ZVGA 4B3TF 4M5IA 1KQFB 5IT9U 5C2GA 2LQ8A 2XBPA 5E0OA 4BHQA 3AOCA 3H2LA 2XZWA 3VZIA 4ED8A 3RB0A 1JLAA 1NPPA 4ID8A 2HWHA 2VJVA 3R2DJ 2BE7D 3JB9k 4DI6A 3GYXB 2IBOA 4N56A 2GIQA 3QIDA 1YBTA 3LWMA 3H40A 3SZ2A 3FBFA 2IAJA 4C8LA 5D3GA 4X2BA 4B9VA 2AJ2A 2GX8A 1UWBB 3D1QA 3M2RB 3FZ2A 3N28A 2J9EA 5RUBA 3LWLA 2V9WA 2O3DA 2QV6A 1LWCA 2XMMA 1HNZF 1Q86T 3M32A 3FRYA 2AIRB 2DGOA 3BGLA 2EPIA 3EE3A 4KGZB 5C2CA 2X3GA 1UA0A 2BQ3A 2EFQA 2HBZB 3C66A 4CYUB 2EFNA 3OHAA 1RKJA 1WG5A 5DDPC 1K9MT 3UDVA 1QTNB 3J7Z5 3C6UB 4O44B 2MGZB 3W2WB 4CLKA 2VHGA 3D6TB 4E98A 2XSJB 1H98A 2ZBIA 3HT0A 1KVKA 3KYLA 3G2XA 4G1PA 2ZHOA 3DDIA 2RHSB 1K1SA 1S1WB 4TXSA 2H4YB 4C11A 1WD6A 2WVCA 2ZBCA 5E7OB 3W64A 4IOAQ 1RU1A 1F9EB 2Y8WA 3LP0B 2RUGA 3B54A 6FDRA 2W4CA 4KHPF 4YY3J 1FRLA 3BGOP 1RTJB 2IM3A 3MUVP 2OJ3A 2ASYA 2XMKA 3BYRA 2Z56B 3HVTB 3M4XA 4LRFA 2AGOA 3GYNA 4Z2XA 4Y28C 4ATNA 3HSDA 4YQWA 5A8KA 1RT7A 2ALYB 1MSWD 4LF5F 1DBDA 4PWUA 1U1PA 2XTJP 4XDCA 3BYPA 2RS2A 4C6AA 4FS2A 1XTZA 1F6TA 2VUGA 3VR1A 1SKWA 4DN0A 1Q4RA 4K59A 4NYOA 1EIYB 5T14A 4KT0C 1OY6A 3BO3A 5HO4A 1JQGA 3FEXB 3M2VA 1FK9A 3DGPB 3CCWA 1RXOB 4P7VA 1IKXA 1HWKA 3MR7A 3QFWA 3U27A 3RB3A 4PG8A 5D15A 2P9GA 4J9MA 3OT9A 1RT6B 1TV6B 3OUYB 1UZHA 1WF2A 2YNIA 4ZVEA 4FVCA 2HYIB 2FIUA 2JWNA 3I9ZA 5KFCA 5KFOA 3RRHA 1FERA 4ID5A 4BC9A 2XLKA 3V5RA 2CQCA 4L72B 3W62A 2BW7A 5KT2A 2YH1A 4ZN1A 4X62J 2KYXA 2RIJA 4OJHA 3K58A 4F4ZA 1HBUA 2XB2D 2Y9HA 4OYZA 3HSZA 4J9VA 1KN6A 1RWVB 2AMCB 2BA9A 3CGIA 2WOMA 1F0XA 3VCDA 4X4RA 3CCES 1SC3B 5G4DA 1D1UA 1KONA 1PCAA 2DISA 3DXSX 3BKUA 1Q95G 2A2DA 2QYGA 1YRXA 3DLKB 1MROB 4ANEA 3ZZTA 1TKZB 1FFSB 1SIWB 2HHPA 2JLFA 5AE2A 1UFWA 1DTQA 2VFUA 3DMJB 2J7UA 2POKA 3O1LA 4DSJA 4LQ3A 4HHHA 4MFBA 1HFEL 4C0BA 2LECA 1FT8A 1VK8A 2Z2ZA 4HH0A 4Q45A 2V8HA 3CW2C 5HATA 3GSDA 3Q8RB 2E66A 2AJFE 3PFEA 4KIAA 4QWCA 3I56S 1HLWA 2I5JA 3U1MA 2RKIB 2ZDOA 4ZKAA 5I3QA 1IN0A 1WI8A 1HQEA 3HLUA 5SUHA 4GKKF 2HHQA 4F2RA 3UR0A 1QAYA 4ER8A 2CPYA 4UY8T 2F63A 2JDJA 2KT5A 1NBEB 3MDFA 4HI1A 1X4FA 2XCPA 2IM1A 2HBRB 2RF2B 2XMUA 1K44A 3DLHA 1S77D 2CJYB 3NCPA 5D3GB 2VG5A 4IOBA 1SL2A 1FKPA 4QPTA 2MY8A 2G1DA 2OFHX 2RJZA 2UU9J 1NUEA 2V8PA 3QT6A 3DM2A 3H20A 2HK2A 4ZITA 4MIBA 2I1RA 3KLEA 1TVRA 1CS4A 2W7PA 4LRCA 3C6TB 1S6PB 1Y5NB 3AJ1A 4YFUA 3M8RA 3SV4A 4K2JA 2D41A 3D28A 4CWBA 2CDRB 2LQ5A 3CDAA 2WW4A 3GFYA 2D3OR 3TVKA 3MCNA 2E1RA 1Q7LB 3MAAB 4FKXA 3TVYA 5A6WA 1HQUB 4KO0A 3TUIC 2SXLA 3W66A 3HVTA 1N4LA 1IR2A 5B0FA 1AA1B 1F1BB 1PKUA 1Q53A 2LU2A 5K8OA 1T7PA 2OPSB 3N0VA 5IS2A 1Z1ZA 2M70A 2AX1A 3MEEA 4G1QB 4J9PA 2HHHF 1U0HB 2A6MA 1NDKA 3CB4A 1VI7A 2HRTA 1RAIB 2FGCA 2LVWA 4QWAA 1NB7A 1WHVA 3P49B 1U48A 3CF5Q 2DR9A 2X1AA 1MLAA 4USUA 5HK4A 1GX6A 5J2MB 3IN5A 1EKRA 1N6QB 2M2BA 2VONA 3HHLC 2UV8G 3T1YJ 1IQTA 3UCGA 1CJTB 3SCKE 3KK2A 4CLUA 1NK7A 2EVZA 3GZ7A 3A8KA 4FVMA 4KYZA 5CYQB 4J91A 2B8QA 4I6WA 2QGFB 3ZC4A 4K4SA 4B9NA 8ATCB 1QAXA 2PIIA 1S1TA 4N7TA 2JH3A 1TK0A 5J1EA 2AYGA 3RAQA 3VAGA 3PYDA 2H51B 3MPWA 2YXLA 3NCQA 3CIMA 5LM7E 4FF1A 5I3UA 1EARA 5G0RB 3MMCA 3R6LB 3N79A 3QWUA 1JKHB 4DX6A 3UD3P 2OD6A 3DOKB 2ZE2B 3T1HF 1L3TA 4LFAF 1FHTA 2RRBA 1IKXB 3EGWB 1FFGB 2VOPA 4RW9B 2QLXA 1Q5YA 2FPHX 3OSNA 3O8WA 1HA1A 2XYPB 1NJIT 1HMVA 1QSSA 2DVIA 2HW3A 4OJ3A 3HHNB 2JEJA 3S01A 1ZM2A 1ICEB 2YQ1A 2WB1D 1IWAA 5CH7B 4PABA 2ZHAA 1DZ5A 1RT7B 1UPMB 4KFBA 4F4KA 3GB0A 4ZP7A 1VBXA 3DI6B 1Y00A 3K59A 2DR8A 1RCXB 1OSDA 4HL9A 5HSPA 1HKAA 3T6JA 4PYDA 1JLQA 3FCWA 1O8BA 3KKFA 1G3OA 8RUCA 5DZ6A 2RF2A 5IQQA 3HFVA 3D68A 2IJNA 1TK5A 1IVZA 1FX2A 2XMAA 3G86A 1UJ6A 3PRDA 5AE3A 1AXQA 2LQ9A 5EN1A 3DLGB 3UN2A 2OELA 4P2MA 2IC3A 2IVYA 4RW7A 3RU0A 1WEXA 1XR5A 2DYAA 2MLZA 3P45B 4OX9F 1S1UA 4B02A 3CULA 5I42B 2E29A 3PKYA 3DRXA 1CJKA 1UPPA 1RT1A 2N4DA 3CEDA 3QSIA 4DFMA 2EG1A 3KXDA 3QAUA 4NLOA 4FF4A 1H6KX 3IMQJ 2LXIA 4UOHA 4DV2J 1XR7A 4RW8B 2RSQA 3ZZYA 2WVFA 5JMNA 3IFEA 5D4OA 5H9EK 1HNWF 1WACA 3LF0A 1LFWA 3WIVA 3KNAA 3BGUA 1R8HA 2XGPA 4V19J 1TL4A 3DLKA 2FY8A 4CLTA 1VQLS 1GMVA 3IR5B 4DUZJ 1F2GA 1U25A 2VG7A 3PO4A 3RBZA 1DLOA 2R7UA 4QOTA 1UW9A 3MMBB 3IXQA 1FXRA 4N76A 3TAQA 2YPZA 3GP9A 3OFFA 5F0WA 4F4AA 1R0CB 2W7OA 3GIKA 3P6YC 1B7YB 2CKWA 3FDSA 4NCBA 4L75A 2RQ4A 4R8UB 2UXDF 2WONB 1FF2A 1AFJA 2VBYA 1FD8A 3TAPA 2LFVA 1F3VA 2RVJA 4IKAA 4PWWA 3PX4A 1VQ9S 2NS1B 4WZQA 2YKAA 2G2YA 3A3PB 2O5DA 5L9NA 2C28A 4X66F 1D8ZA 3EXCX 1HW8A 5A8RB 2A2CA 3ENWA 1SJFA 3BSAA 3S7RA 3WQPA 1B64A 1AZSB 3I87A 3IBCB 3LGNA 4UZCA 3VAKA 4DV1J 4DV6F 1OJ4A 3OFEA 2DGWA 4DHVA 1U02A 5A8WA 2C2ZB 2HG4A 1FESA 3VGVA 1HNIA 2E5LJ 1KRPA 1JWWA 4ELVA 1QJHA 1VYAA 3BGRB 3U02A 5HN0A 3EUNA 4KJIA 1X5PA 2XMTA 3DGVA 1VRUB 1RSCA 2E1MC 2GHPA 4GVBA 3F0NA 2CJ9A 2KH9A 1HNZJ 3R5AA 1EAYC 2AW0A 2DH9A 2DITA 4KO0B 4J5OA 5KOWA 1YBUA 2O01C 4NXNJ 3RRGA 3ET6B 3PHEA 2BE9B 2VFRA 2YPYA 3H59A 3HX9A 4JI5J 2VL1A 3QRRA 4NL5A 1PYSB 1IR1A 2Q3PA 2VPXB 5I3UB 4DV2F 3AQPA 2MZJA 4RNMA 3U1LA 4Z7YA 1RU2A 3NP5A 4QWBA 2EFVA 4B3OA 2V63A 2H5JB 3B78A 3HD1A 2KI2A 2UVUA 4DR6J 3H5XA 2KN4A 2YX1A 2XYGB 1U47A 2ZM6F 2L41A 4N41A 3WX4A 3GTYX 2XM3A 4P2SA 2YH0A 2B3TB 3LH2S 2MKIA 1M5VC 5B0BA 3K5OA 1WF1A 2FZCB 3VTIA 3UNGC 1HHQA 4DN9A 4KFBB 2LEBA 4NCGA 4QR1A 4W92B 3QZ7A 1DQ9A 3RBEA 2W4PA 3RG6A 2JEGA 4KR0B 1V6HA 2WSCC 2DNNA 5D4NA 1U09A 1I3OB 1QY7A 4XAKA 5K14A 5C25A 4C8KA 3VV2B 2R7RA 3FEZA 3E8OA 4JI4F 4Y00A 1WG4A 2F4FA 3KNGA 4NI2A 3BQ1A 2C3OA 1UVMA 2FLOA 2NSBA 5FD1A 3FQKA 1N88A 4LF4J 2QA4G 2OHDA 4EYIB 4A8YA 3DLLQ 1MN9A 1UVKA 2MKHA 1LW0B 1M1KT 4LREA 1CC7A 2ZOGA 5ITHA 3B4DA 2D9PA 3SCIE 3I4PA 2H48B 4MKAA 4QR2A 3NNCA 2P6TA 5HANA 5KT4A 3GONA 3R5GA 3GR0A 3DRSB 3FRZA 3PNIA 4DSEA 5KOXA 2CWKA 3TI0A 1N34F 3MUTP 4FYXB 2AYMA 3BPDA 1S1WA 3PRVA 3HDSA 3CJ5A 4DV4J 1GT8A 2BE2B 5DM6Q 2L9DA 1SV5A 2F5GA 2JC1A 1KLMB 4I68A 2VZ9A 1KDNA 1CJVA 1N56A 4UUWA 1T94A 4WK1A 4P7TA 1VQ4S 2Z58B 2JFDA 1RTJA 1U1KA 3CD7A 1LWXA 2CRLA 1FRXA 1VQYA 2UUBF 2EFOA 1R8CA 2MJNA 2V8GA 1ZYQA 2OO4A 1LXJA 3C15B 1JXEA 4A8FA 3MXHP 2VQEJ 4TYAA 2DNHA 1NHVA 1RB0A 1T9TA 1WKJA 3GCWP 5LSOA 3CMAS 1X0FA 2HQIA 2NYHA 4DL2A 3SDEA 1Y0HA 1R8AA 1Z2ZA 3AJ2A 2YWHA 3KLFB 2W9BA 3JSBA 4YS2A 1T03A 3IA0A 3QNWB 1R43A 2C2RA 4OX7A 4WKYA 4URQU 3OQ2A 3ILLA 2C1EB 1CULA 3FMWA 3SXLA 2AQ4A 1UZDA 2R3VA 4ENOA 4JBCA 1SL0A 4DCOB 4RNFA 4KY3A 1RLCL 2HFNA 2ZJPQ 4F50A 2PA3A 3BGRA 3SMZA 2CJXB 4ZN3A 3G9CA 2VC1A 2OSQA 2AEFA 1NKEA 3H98A 3MFHA 3PJXA 2GFFA 2OPPA 4ITSA 2AYEA 4ZVUB 4EZ6A 1SQFA 1YSJA 2J0SD 1REVA 1IJEB 1L3KA 1T3OA 1N36F 2V2VA 2X1FA 1IKWA 1U6BA 1ZZFA 2OEJA 4WFBQ 4Y2MA 1HWIA 2BRKA 2DKOB 4YN3B 2C42A 1Q16B 3GIRA 5JXSA 3MOJB 3P96A 1FKPB 4QIEA 4OHWA 1WC4A 5ETPA 4M5MA 3NGDA 4R5PA 1WOPA 3ETMA 3CJ8A 4Y2IA 4QIGA 1JLBA 4UUXA 3CJKA 2ZUGA 3MM6B 3A12A 1ZTWA 1YJNS 5IXUA 2DHAA 5LOQA 4EO8A 2C22A 4OHVA 3UCUP 2XS7A 3MM5B 4JI8F 4MAKA 4NZ0A 2IHR1 5IM0A 3M8ZA 1X9SA 4AE5A 4CTAA 5HMXA 3K17A 1YJ7A 4OYMA 4ZP6A 1RHKB 2R9LA 4DSIA 3CD0A 1WNEA 3UVJA 5HROA 3EGZA 2RQMA 2IMWP 1PJ5A 1U0HA 4USMA 2ZH5A 4UQTA 3CC4S 1LEOA 3SV3A 2N4CA 1D9DA 5C24A 3HSJA 2DNPA 3NCRA 1LFPA 1P9QC 2Y0BB 4B3RF 3OL8A 4QJVA 3Q86A 1HHSA 2L48A 3CTRA 4CZCA 3PW7A 2F4VF 3DLEB 3T9NA 1KLMA 4DL4A 4BWJA 5J2QA 1YI2S 1L5UA 4NX9A 3KK3B 1JLFA 3CSKA 3MOZA 2X51A 2V50A 3QGPA 3DRYA 1U1OA 5LJ3Y 1TUGB 3DKDA 1QUVA 4QU7A 2U1AA 3IR6B 2FLPA 1X4GA 4I64A 1S9FA 2ZKUA 4OI1A 2QA1A 3PRBA 1RAGB 2J8AA 1NXIA 3ISNC 3RYLA 2ZH4A 2EC2A 2PEHA 2XZTB 5EGYA 1B0PA 3MEGA 4H4OB 2BE2A 2DNRA 2W4DA 5D0EA 2CNLB 2DGXA 1S9EA 1V3RA 2ATCB 5IOLA 5MLCV 2VA2A 2R7SA 2OLWA 2B6AB 1RKIA 2P9CA 1AYEA 2WK4A 3FVYA 1ZAXA 8AT1B 2OTLS 2GJ2A 4I1TA 4AL7A 5HBMA 2CPHA 2QFIA 2QLJB 1WORA 2VPZB 3MGJA 5CZVA 4KTQA 4DR4J 1BQNA 5ETOA 1M5OC 5E3AA 1VQMS 4M5DA 2BYCA 2LU1A 4WIIA 5T7LA 4RL1A 4JI1J 2DD8S 4OX9J 3FCVA 3I31A 4XK8C 2ASLA 5U47A 4CO2A 3KLFA 4EBDA 5IWAJ 2R8GA 4CT8A 1H7XA 1HPZA 1SI9A 4JI8J 5T41A 2PA8D 3TUJC 2B7CB 2XO7A 4EEYA 3M7VA 2D9OA 3OTOJ 2ZZMA 2PSZA 1H72C 3B4MA 3FC9A 3MR6A 3KK3A 4ZMMA 4G1QA 3BSOA 4IFVA 2OP5A 1RYRA 1K1QA 1WEYA 2Q6BA 2MZ1A 3POTA 1NK4A 3PW2A 1NKBA 4C8ZA 5DJBA 1ZBTA 3KG1A 3OTEA 3BSNA 5IT4A 2DBBA 1S1UB 2OD4A 4OJ1A 4CLYA 3Q2SC 4PQAA 1NJXA 3THPA 4QCLA 1SH3A 3DRRA 1U2FA 4E0DA 4MK8A 2CG4A 5C42A 2LLZA 3KJFB 3DDNA 1IBMJ 1IM6A 1VLYA 4YHHJ 4QW9A 3Q2TC 3R2CJ 5IM0B 3R9LA 1U7LA 1VK3A 3ILJA 1NSQA 4DV6J 1R0BG 3V6HA 4K5RA 4AT1B 2RH3A 3V2UC 4QPXA 4IQMA 4CDIA 2Z8QA 4USKA 3HPOA 1F2HA 4Y2KA 5GMEA 2V4JA 4DPUA 4ZOSA 1S7HA 3SQGB 1JLCA 4R5PB 1PC5A 3CWJA 4PQUB 4LSZB 3MECB 5DGAA 3LAKA 2B9EA 2BMBA 3QGHA 5C7PA 1RHUB 4I7FA 4Y34A 2M52A 4EGLA 2QFJA 3T5LA 4FBUA 2CNKB 4RJVA 5H1SV 4PRFA 1FKOB 4R8UA 1GMWD 4OMFG 1TMJA 1PBAA 1SPBP 2A3JA 2PT0A 3FCHA 4USIA 4ES3A 2YNHA 3CVKA 4WFNQ 1S10A 3I96A 3MMJA 3MPUB 3E3XA 2BJ3A 2C2DA 1KQSR 4OLOA 4DL6A 4YB1P 4XDDA 4DF4A 1GXUA 1R8BA 5A8RA 5A0YB 1WI6A 3FGVA 3BDEA 2FQQB 2VDHA 2D1CA 4RO0A 2C3YA 2XZDB 3H90A 4QIWD 4O3OA 1YQHA 2CJAA 4F4YA 3MM7B 3AHPA 4A8SA 4JI5F 2HNZA 3M8PB 1FEEA 3CPWR 3L7UA 4NPOA 2PI4A 2HHSA 1CEZA 1RUSA 3M6XA 2JZ5A 4BCAA 2UXCJ 3DOLB 1LXNA 4L3NA 4ZLLA 5EX0A 4HTIA 4JI7J 3HHEA 1UMJA 3KDNA 4K8RA 3I82A 2YNIB 1KQKA 5K8NA 2OEKA 1LNQA 1UCNA 4TN2A 2PO4A 3IRXB 4F04B 2J6UA 3UR3C 4M94A 3K8VA 3NWGA 3UVJB 3BPSP 2ZM6J 1FVSA 2VDIA 2G4BA 2GAGC 1RADB 1S1XB 5ETQA 3HVRA 1YTYA 5GAGI 2FDNA 1KR4A 4M8LA 1E6YB 5F8LA 4U67Q 5L1KA 1QLNA 1HPZB 1HNIB 2E5IA 2M9KA 4RZRA 3QT5A 1KWMA 4C8NA 1X4EA 2GO8A 2VBZA 4CO5A 2MHEA 4FYDA 1X5OA 5F3ZA 4GVBB 3PZPA 4NMLA 1XNRF 1KP6A 1YZ7A 1VC6A 3D7SB 1K0VA 4KB7A 3LP1A 2KZZA 1X4HA 1TL7B 1XMBA 3Q8QB 5J2PB 1A0OB 4EFAC 4DV4F 5A0YA 4M5KA 2F7VA 1T9UA 4QU6A 5B0EA 4DV3F 4PWDA 4IFYA 3WC2A 1QSLA 3F73A 2UXBJ 4HEA9 3OPKA 4A8OA 5EDWA 3D0GE 4NASA 2XGQA 4OZLA 5GAEU 1OQ6A 2PDAA 1U1QA 3W8GA 4NI2B 3ZFVA 4Z7CA 3IGNA 3KJQB 1HYSA 2DHXA 5IT0A 5HL7Q 2BRLA 5IQ6A 3W8PA 3PYGA 3UQSA 1AW0A 4DDFA 2LXUA 1HBNB 2NPIA 4LBHA 4CT9A 1Q7YT 4DR7J 1DFDA 3L7OA 4HDHA 3AOAA 4NCGB 1J27A 2WHOA 2R2RA 3PX6A 5J2NB 1HR0J 1RHMB 3ENAA 3I9V9 1C1BA 5KFKA 1VQOS 1REGX 1FEHA 1X60A 4HHJA 3AD8C 1TP7A 2HRYA 1N5TA 1N33J 4TQRA 1OY8A 2YKOA 2CUYA 2ZC4A 2BQUA 4K0KF 4JV5F 4F25A 4WZMA 1XR6A 2V5HG 1SJRA 2CAJA 2M8HA 3LANA 4F3QA 2N3LA 4OI3A 2KDOA 3IG1A 3KG4A 3A13A 1V9OA 4FN5A 2VOOA 2FY1A 1FJ7A 2GCFA 3WDOA 4QIVA 2KFYA 3D1HA 3PACA 4OZ3A 1N36J 1N52B 1RYSA 4IFYB 2UVVA 2ADBA 4LF9J 3P3DA 5KFTA 3M6VA 1RHJB 1XNRJ 2K1RA 1KTVA 4GO7X 3HJVA 2ALZA 4H4KA 1IM4A 4NEZA 1FJGJ 1MU2A 3GMGA 2VKRA 3L7PA 2HFZA 4I56A 3T9ZA 4KGMA 1BQMB 4AQYF 1EKSA 4X62F 4DV5F 3T5KA 1HYSB 1NH8A 4M5HA 1U0SA 2V67A 3OBIA 1X4AA 3C46A 3NXZA 5G0RA 4OZ5A 2FVQA 2BX6A 4RNNA 3VHQA 1J5EF 3FBCA 3GJRB 3M8WA 2KXFA 3SI8A 5LSLA 3TZXA 1F60B 3JAMU 3VAHA 4CQ1A 4P71A 2Z0GA 3A1YG 3R7SB 4PG7A 2VF3A 4BDPA 3BR8A 2WRMA 5KG5A 1OSCA 4EBCA 1UKUA 2D69A 3LA0A 1GTHA 1OWXA 2EKYA 2HKEA 3AB2B 5HVHA 4DS5A 3I0RB 1UFLA 2ZITA 2GAHC 1ZAWA 1WOSA 1X4BA 2L08A 2R8JA 2GJIA 4ZVSB 3PKMA 4MYUA 2CQ1A 1KQGB 3EDRB 2CQ4A 4N8NA 6FD1A 2DNYA 2E9RX 3GILA 3BV8A 3Q8UA 3DLGA 1H74A 2DK2A 3MM5A 3NAHA 3TR5A 5D4PA 1IBKJ 4PUOA 3Q83A 3R97A 4CM2A 5CZXA 2AEMA 3KLIA 2CG8A 3W65A 1S6QA 4UT4A 5K8MA 1RTZA 3N01A 2BJ9A 1X5TA 1T05B 2M8DB 1S57A 3G87A 2RU3A 4N47A 4J9RA 4YB7A 4AUKA 4PCQA 1BMQB 5DRKA 5B0DA 4DWIA 1IBLF 4JI6J 1V3SA 1EETB 1WC5A 2E1AA 3MWBA 2KVIA 2R7QA 1TL1B 3LP0A 4FZVA 4DMZA 4WFAQ 1M90T 1KFSA 3CC7S 1UVNA 1CULB 4DR4F 4WKRA 4P73A 3K2YA 4J9LA 1E6VA 2W7AA 4U96A 3BH6B 2GGPA 5KFRA 1FDDA 4RWXA 1UEUA 2NLWA 2XSFA 3D6MB 5DG8A 3M8SA 3KHRA 2VQFF 2OUGA 2OSRA 2MHNA 5J2PA 1FRMA 3BKTA 1I6JA 3GQCA 4MKVA 2KVQE 1FI4A 1NLKL 3J7AN 3VAMA 3PG9A 1UVLA 1RHQB 2IRUA 1BD6A 2WSEC 3G96A 1C0TB 4RU2A 2K06A 4NYPA 3BN7A 3GCXP 2Z2MA 4LSLA 3TUZC 4O3SA 3UD5A 1T02A 4C3LA 4DPOA 1D9FA 3MZIA 1NHUA 3QZ8A 4ZPDA 1I1GA 3CC2S 1SL1A 1YZ6A 3FSXA 1FA0A 1GK8A 4C3MA 1RT5A 3MTJA 3OLBA 2QYCA 4DBQA 1RT3B 3QATA 5DGBA 3KJVA 3VAFA 2JOQA 2NR0A 3G82B 4DR5J 2OGUA 1R31A 1RT4B 2XHCA 3IP0A 2BR0A 3RUBL 1FTRA 2LA6A 1X5SA 5KFZA 1KHWA 4RW8A 4X4PA 1U26A 4IG3B 2A10A 2DH7A 5I42A 2XQCA 5HLFB 1WTBA 3QWPA 4WPAA 2OPRB 1FDBA 2GIRA 2R8KA 2JLEA 3QJJA 4HDGA 3GV7B 4X4UA 2QTWA 2O66A 2XULA 4X4NA 1VS3A 2G1HA 5JJBA 1RWUA 2JC0A 3UI3A 2AGPA 3PXGa 3HHKA 1S0VA 4X4VA 3SCLE 2VB6A 4NLDA 2CQ0A 5F8IA 4IDKA 5HP1A 2B9WA 2QIFA 3WBZA 5D77A 2PGCA 1YLXA 4RWWA 3RTVA 1D09B 2F8MA 2CPJA 4P9SA 1GH8A 1V5IB 1LKZA 4GKKJ 4NRUA 2IDEA 2YKNB 3RRKA 3GIMA 3C8YA 1OS5A 2ZVSA 3EGNA 2OTJS 1Y7PA 4DEZA 2R7VA 2ILZA 4Q5VA 3ZTQA 2KFZA 2W2MP 5A8KB 5IC6B 3H0PA 4CI0B 1JJ2R 1NJWA 4IH6A 5EWEA 3QJLA 3D5MA 4P75A 1RBAA 1NK9A 2Q79A 4F7VA 4ILMA 1JLCB 3DFEA 3PTWA 5CCLA 3DM2B 1WC0A 2UZAA 2YWWA 4KAIA 3BQ2A 4WXOA 2FJBB 4ECZA 4JI7F 2Y1LB 1S9EB 4FYYB 5CD4A 3O2IA 2B43A 1ZM4A 3ILOA 4DLGA 2IJRA 1M1GA 3C14B 1KTQA 2DGVA 1IR0A 3W5XA 4CLFA 4D3GA 3PV8A 3R5CA 2DGTA 4UOFA 4IG3A 1GFWB 1I94J 3EGVA 1KS2A 3Q24A 1HIYA 1M5SA 2W2NP 4PEOA 2OPQB 4F0HA 1NEEA 3FFIB 4RW6A 3T1AA 2OKQA 1HNXJ 3HVAA 2APOA 2MZTA 3NGRA 4R25A 5KT6A 2HFOA 1FKAF 1ULRA 2CPDA 2GVDA 4PXBA 3V4MA 4CH7A 4K4WA 4ECYA 1KOOA 2QMUB 1CBKA 2BKOA 2WOMB 2PN6A 3TAMB 4DPTA 3ZTRA 5KFNA 4IR9A 2LQBA 2IJFA 5F9NA 1N6QA 2D74B 2V94A 3AA9A 3HFZB 4LSLB 2NXJA 3K8WA 3TZWA 4X66J 5LXYA 2ZJRQ 3CCJS 1L3UA 1X7VA 3DOLA 5CHCB 1TFYA 1U8WA 1HNVB 3VQSA 1JX4A 1GMWA 4FYVB 3LTOA 4ED4A 3CCZA 2NREA 3MEKA 3PY8A 4WU2A 2JEIA 2HNYA 4ED0A 3JTOA 1VISA 3V6KA 1N54B 2B5JA 2J9DA 2F9DA 1H2TZ 2PD1A 2PFDA 5B7WA 4OHYA 5K20B 4F4WA 1CJUB 3PIPQ 3L3CA 1SJ3P 4FXDA 3UCZP 1G1XA 2LDYA 1C4CA 4OYIA 2G2OA 2AGQA 4QYZK 2XS5A 1NRKA 2M0GB 2CPEA 3WC0A 1HWJA 4LF8J 1YITS 1EZZB 2OPRA 4NXNF 3EYZA 3KWMA 3LW5C 4LFAJ 3FUYA 4DU7A 5ETMA 4F4XA 2PFFB 1SKUB 3BN4A 4ECTA 1RBOB 2Y1RI 1EHWA 4C2MA 3K5NA 1R0AB 2KTQA 4PXDA 4DQPA 4QW8A 3JYTA 1WC3A 2QE5A 4IDKB 5I3PA 3ICLA 2CJQA 1VBZA 1S12A 2LYVA 1C1CA 1XIQA 2HHXA 1Q79A 4QWDA 4IRCA 2BM0A 1F5CA 1JNZB 3OR1A 2OPPB 2XC9A 4GKJF 4ZCIA 3OL9A 4PWDB 3IWNC 4WCEQ 1VQSA 1WG1A 5B08A 4JV5J 2NSCA 1AROP 1F9HA 5IC4B 4B3MJ 4DV3J 1QSYA 1WJ9A 3ITHB 4LVOP 3ZNUA 1R7IA 2MZQA 5CYJA 4A8QA 2CZVC 2ZDPA 5HVGA 4DPWA 2ILYA 3TJ9A 1YIJS 2MQOA 2DR5A 2BACA 4NXMJ 2EBGA 2JNJA 4ICLA 2K8GA 3ILIA 3NEKA 1FDNA 3JQKA 2CYYA 4U8VA 4RUHA 4HT5A 2AU0A 4F02A 2HNZB 1NPKA 1RT1B 2CQGA 3M8PA 4KGXB 1URNA 2VFVA 3CNQP 1ZM3A 3BF4A 3MFIA 5HMYA 4LFCF 2WVDA 4NA1A 2ZZNA 2KM8B 3CMQA 2WBRA 4Q2LA 4LF7F 3ZTSA 4DG1A 2G0CA 4WP9A 1B70B 3N4WA 2OPQA 4C98A 2BBEA 1HNWJ 3U7JA 2MYFA 3R3TA 2F65A 3ENQA 3KLGA 2W9AA 2ZD1A 3MAQA 4HT7A 1Y3JA 4QYZJ 1VC0A 1DRZA 2AD9A 1WC1A 4EBEA 2JJ4D 4IQXA 2JVOA 4O3PA 2XMWA 4R0EA 2CJKA 1JXLA 4FPRA 1S9GB 2ZH1A 2N82B 1WDDA 1NSKL 2V69A 4H4MA 2R4FA 2FUG9 3QIPA 5KFYA 2PMZD 3JSMB 2JEFA 4ECVA 2B4VA 2UVRA 3EJMA 4B9TA 1HMVB 4ZCKA 1XBWA 2KXNB 1HW9A 2P2CB 3OW2R 4LBPA 4YB5A 3HKWA 1SH0A 1NK5A 1KKHA 3IBWA 2KHCA 1GEHA 4UTGA 3R8YA 1XMOJ 5DDOC 1YRUA 2LDIA 7AT1B 4LF6F 2GVDB 1QE1A 3PHTA 5J1PA 2N3OA 4ICLB 3P8BB 4YDDB 1UEVA 4F3MA 4F8RA 1PBUA 3IM8A 3GLJA 4WTYA 2MQPA 1RACB 3FQLA 3UWTA 3RR7A 1N5SA 2F8EX 4ANDA 4G1IA 1S6OA 2K3IA 3FBBA 4RR5A 1T0TV 1QTMA 2RQCA 3KUHA 3BH7B 3JTNA 2EK6A 5K8PA 3MCOA 4ZPBA 4JI2F 4EZ9A 2GQ2A 1ITPA 2XSJA 3UN5A 1FRHA 2UUAJ 4IH7A 4KKOA 5IZHA 1ZPWX 4O4GA 4RU9A 4TU8A 2MQLA 5L1IA 2NQPA 4M95A 4OYAA 1HI0P 2W9CB 1O0PA 2HAIA 3MPYA 2LCWA 2P8IA 1SJ4P 1LQ9A 3CO9A 4C11B 2NCKL 9RUBA 1U1RA 4B3OB 1S9GA 4MIWA 3ITHA 1FE4A 1XQIA 4RLEA 4ZJOA 1SQEA 1VBYA 2MKYA 2G0IA 2G2ZA 1S7IA 1AZSA 4NLRA 1IXKA 1S99A 2J5AA 3M2UB 4ED3A 1RTHA 3MEDB 1TV6A 3MMBA 1FWPA 3OUYA 4PKDB 1C1CB 3CCSS 1XNQF 2H1YA 2RE1A 4KHRA 2B5JB 3Q8PB 3HFKA 3FSIA 4BS2A 4NA3A 3I55S 2B4OA 2J6TA 2HNDB 1FRIA 5E33A 4NLGA 1K8AT 3H4BA 1R8PA 5EWGA 4TY9A 4DZDA 1NCLA 1X0PA 1GXLA 5FIIA 4H4OA 3W3SA 2FTRA 2K1RB 2ACMA 2Q1LA 4MIAA 5KT3A 1N5YB 2HHUA 2BQRA 1KOHA 1D8YA 4LMZA 1S72S 3OTDA 2GMLA 4YOEA 4H54A 3W2VA 3R7NB 4DR2J 3KDOA 1YJ9S 2IA6A 2MKCA 4LF4F 4PUOB 2BM1A 2YNFB 4JB8B 2X1BA 3HP6A 1N5VA 3A8EA 3QT7A 5KFPA 1P9YA 3ISND 2X1GA 4X64J 3KHLA 3QSYB 2HQCA 1KFDA 4WJBA 2YWKA 3TZYA 3GV8B 4EYHB 1Q81T 4JV2A 4NLWA 3VGUA 5D6GA 2DT9A 1BXNA 4YUDA 4ZVTB 3M1VB 4DQQA 2EW9A 3IGVA 2IIHA 1RCOB 4WK3A 5KFGA 3GIJA 5KFDA 4OI4A 4J9SA 3V6DA 3IWXA 2ZWPA 3V81A 4OI2A 5LT5A 2QJ3A 4HYKA 1JLGA 2K7KA 4P2XA 4W98A 4X65J 1E6VB 4MKYA 3JSYA 1NSAA 3Q8VA 3QGIA 3W1YC 3ZNJ1 1CSJA 2C2NA 3GPAA 1YJVA 3NBPA 4ELUA 4KH0B 3HZGA 4L73A 1APSA 4OYBA 3RBDA 3NKYA 2QX0A 5L9XA 1NK6A 4GMKA 2YBVA 1TVRB 4LRBA 4X4OA 3GYGA 5L39A 2LP4A 3FNNA 3R7BB 3JSMA 1URRA 2HNDA 4Q8EA 2DCLA 1NSPA 3CJ3A 4HACA 4DR3F 5F8MA 1VHFA 2WCXA 4WP8A 2RU9A 5KT5A 3HHLA 1SIZA 4YHHF 2DNOA 3SSQA 4DPXA 1XNQJ 3OJUA 3NNHA 2GHWA 1NZ8A 4ALZA 2OPSA 3CDEA 3DRSA 5KFSA 2VBXA 2HFVA 3BKFA 2RDDA 4M5GA 4NLSA 3KLHA 4PZVA 5IWAF 2R2UA 4DQSA 4PQUA 1RT5B 3B8HA 2YKMB 5KFQA 2JRSA 3TWZA 4CO4A 1VOMA 3TUPA 2HQDA 2YTCA 3ISZA 4DS4A 1VQ8S 3OR2A 1CC8A 4OV6A 4ZPVR 2V4RA 1X9WA 3B82A 4FNIA 3UPFA 2VG6A 5AXNA 2KHDA 4IH5A 4IG0A 2GV1A 2RHQB 1FKOA 3H2UB 3N9UC 3G6XA 2AJ4A 2KM8C 3UO0A 3THVA 4C8YA 3BREA 1OPIA 3N6NA 5EUHA 4F67A 3UD4P 1U1MA 4EWTA 3J7ZT 1IKYB 5KAKA 4O4GB 1I94F 2FJXA 4WXWA 3TEHB 3I5BA 2RMLA 1FNOA 4I6YA 1H73A 1DQ8A 2DO0A 2HAFA 2OMOA 2P9EA 4TU9A 4DFKA 2MDAA 4ED5A 2QL9B 3HK2A 1H3DA 2BOPA 1HI8A 3I0SB 1WKKA 4WYLA 1JKHA 5J2MA 1S0NA 4UZBA 3BSCA 3MM6A 1SC1B 3QPIA 4LRAA 5KFIA 4UF4A 2V6AA 1YWXA 2J0XA 5KFVA 3BQ0A 3C6UA 4ZDNA 2C3PA 1RTDA 5CYMB 3R5DA 3RBXA 4K4ZA 4CTAB 2BDPA 4JI6F 1UTAA 4KHPJ 3TJAA 3TNVA 3PR5B 3G6YA 2FVSA 1ZS6A 2BJ7A 2DNGA 4NMXA 1BUXA 3MAHA 2F3JA 4DJBA 2JHEA 1T9VA 1TR0A 2DXDA 2R2SA 1TL3A 1SJQA 4DR3J 4YEAA 5A2QY 1NDPA 4M63A 1N5QA 3OFGA 1JLQB 2CQ2A 3HULA 1FWLA 2DR7A 4ZPTR 2QRRA 3E01A 4AL5A 3N6MA 1SC6A 2UUWA 3GJTB 3SFGA 2Z4PA 5GVQA 1Q82T 4NCAA 3UW1A 1NJZA 2MMYA 2QMXA 1RGVA 1NB2A 3CE8A 1UJ5A 3D0HE 4M5NA 4ZVFA 5E3PA 1K0TA 3PO5A 1FE0A 3HHDA 4L6V3 2VA3A 1LW2B 4A8WA 4C9DA 1S1VB 1NNDA 3ETOA 3N5BA 3ZZUA 1NHKL 4CH0S 4OV1A 3DC2A 1VRQC 3D3BJ 3SFUA 2HWIA 1JLAB 1WEZA 2V2KA 2YVSA 3HMJG 3ADAC 2GW8A 3EVOA 4ZCLA 5LJ5Y 2FYXA 1P1TA 2V0NA 3VF0B 7FDRA 5DLFA 1HNVA 1VBKA 1VRTA 3AXKA 3V4IA 1X4CA 4I2PB 1IJFB 2RRAA 1FNXH 4ERDA 2RB7A 1HQ2A 3K0JA 3TARA 4LFCJ 5AJ3F 1RK8A 1U8SA 3Q0AA 3C16B 1B4SA 4W90B 4NRTA 2IFXA 2I38A 3HJFA 3P5BP 2JVRA 5D78A 3K57A 4M5JA 3EVWA 3NY0A 3OV7A 3VQTA 1HR0F 1NK8A 1WWHA 2HZCA 3GE9A 5GAHI 3V6DB 2ZHBA 1HD1A 1ACMB 4WE1B 3DYAB 4LF2A 4FF3A 1QD1A 2DY1A 2D3O1 4O3RA 3BBCA 2IAJB 4KPYA 1S5ZA 3DI6A 4WP3A 1YKWA 1M0SA 3O3LA 1VLOA 2AZ3A 2BXJA 4XO0A 3J7YI 2ZOMA 2EC0A 3M6WA 2XMVA 2GZOA 5DDRC 1H38A 4B3SJ 2YWFA 4USVA 1RAHB 2B0GA 1CG2A 1YG0A 1VDHA 3R1HA 2W8LA 2XY7A 3TA0A 4TNOA 2Y8YA 3TZZA 2AX0A 3MR2A 2HNYB 1F3FA 1I51B 3HHLB 1XC9A 2QSWA 2ZBRA 4DR1J 4O0IA 2FHJD 2PEBA 3LPYA 3NS5A 4ILRA 4DL7A 3OL7A 3QYYA 4DCPB 2A0FB 1BE4A 2AP6A 1CJUA 2DJWA 4Q0BB 2F1FA 1LWFA 4JI1F 4NLQA 4ECSA 3M30A 2RUSA 5K14B 3AXMA 3AT1B 2HQGA 5H9FJ 5C25B 3FEYB 4Q2MA 4KV8B 4O3NA 4YR2A 1IKVA 1U2RA 3B6BA 2HFSA 3P4UB 3W63A 2CNNB 4EU0A 1X4DA 3M9NB 1O5JA 4RUBA 4TY8A 2EXUA 5L1JA 2NZCA 3BBBA 4OZ2A 3SSSA 1JJCB 4UOCA 3M05A 5F0UA 1TKZA 4JI2J 4ETXA 5DO2A 5HQMA 1U6ZA 1V3ZA 1BGXT 1VHIA 1DLOB 4QYRA 5F9LA 2CIMA 4RUCA 4Q43A 3O6QA 3ZZPA 2HK3A 4DV7F 1RLDA 2DPJA 2YNGB 3A8IA 2B51A 4J9NA 2MZRA 1S48A 4HLBA 3CJ2A 4AXJA 3H5SA 5IV4A 2WVBA 2F9JA 1HI1A 2CPIA 4L74A 3BS9A 2IVFB 2B56A 3K5PA 3I5AA 2KB2A 4WFYA 1U4BA 4I69A 3CD6S 4N77A 4DX5A 3NL0A 4HHUA 5KTQA 1CJVB 4DPYA 4DL3A 5F8HA 5F41A 2MQQA 4G3IA 4IFVB 1PILA 1O51A 4Y0FA 1NJYA 1DURA 1OYEA 2J0WA 2ACYA 2WW8A 2XMJA 5BYRA 1T9XA 3LGHA 4ZPCA 3IR7B 4ZJLA 5DDQC 5GADI 4ZIVA 4NE9C 2UXDJ 1S6PA 2YY3A 1XWLA 2EBEA 4TVAB 4DU8A 5GMDA 2ZJQQ 4B9MA 5M2RA 2ZUAA 2ZC3A 4DXLA 2CQ3A 2QN6B 2YWEA 3MI7X 4NLYA 4ZVPB 1OQ3A 3MURP 3MMAA 2YNHB 9ATCB 3GSIA 4RNOA 2YQ0A 2EEYA 2VBWA 2FJAB 3Q89A 4I2QA 3H4DA 1NZAA 2MY7A 4DV0J 3E51A 5FJ4A 2C3UA 1HWLA 2HIYA 4WE1A 1ZA2B 3G8SA 3KLGB 4WF9Q 3CJRA 1IBLJ 2E5LF 2C2MB 2V4JB 1YK9A 3QRQA 3TRGA 1DARA 1U6FA 5KG0A 2HGNA 1YDLA 2IDLA 1SC4B 1WOOA 2AKWB 2BVZA 1C2PA 2ZNZA 1CS4B 3D6FB 3KJNB 2I9SA 3C6TA 2FC9A 2HIQA 1TKXB 3A3NB 3I6PA 5KFXA 2P5VA 3EXYA 4C3KA 3AD9C 4HR2A 2DEIA 4JUZA 4U7UD 2EWHA 2CJBA 1VQ7S 1FNMA 2EG2A 3AOBA 4Y2CA 5AXMA 5HQ8A 1YJRA 1HBMA 1SQGA 2H5EA 1ELOA 2HVEA 2RT3A 5ETRA 3THTA 2C2EA 2AT1B 2A6OA 2AWZA 4L76A 2FVPA 2BUNA 4TQSA 2XNQA 1WDTA 4BWMA 2FJVA 1S0MA 2L9NA 4CP5A 1N48A 3CJ0A 1PO6A 1B99A 1JMTA 4JP8A 3BB5A 2DO4A 3AY0A 2IC3B 2DNZA 4LR9A 1K47A 2W2OP 2DTJA 4RW7B 2YNFA 5E2QA 3SSRA 3W9JA 2GQCA 2Q6CA 2B4UA 4KV8A 3MM8A 5HVFA 5EX3A 3C16A 2HWTA 2YKQA 3S6EA 4A8KA 3ZZZA 2K7JA 1W2IA 2G13A 2PI5A 2FJWA 4WTOB 1IUJA 2BEFA 4RW4B 1N5YA 4PG4A 1JLEB 3HKZD 4MK9A 3PJ9A 2P6SA 2GC8A 1TAQA 2ZVIA 1TZ0A 2XWXA 4Y65A 5THWA 4U95A 5HROB 2OFGX 2QL7B 2I8EA 4DSKA 1IKWB 2E5GA 1TUWA 2M4MA 3NGKA 2W1BA 3MEEB 5ETNA 5KG2A 3E2EA 4Q0BA 3S8SA 4X4TA 2DY9A 1P6TA 1UWBA 3J7YU 1RAJA 1SVDA 3NOGA 4K4TA 1BHNA 3CMES 1PSDA 2DHHA 2VD3A 4TY8B 2CPZA 3T6BA 3OVAA 1KVJA 2XY6A 5IT9Y 2CQHA 1ZOTA 3KUGA 4LIWA 4LF9F 1CPZA 1NH7A 1TL5A 3UDEA 4IR1A 4O44A 4FF2A 2NXEA 2O1PA 3DCAA 4YDXA 1KEKA 3RW6A 2CWXA 2UUCJ 2DGQA 4OHXA 3T41A 3EMTA 1WTFA 1GMUA 2LEAA 1Y9OA 1UP1A 2VFSA 5DQHA 3OVSA 2FVRA 2IMOA 1DAXA 3SQOP 3BO2A 4FS1A 3M2RA 1CVJA 5F8GA 4DX8H 2RD5C 4OZ1A 1PJ7A 3D3CJ 3T19A 1AT1B 3LUYA 3NLCA 4LFBJ 5DS7A 2CZ4A 2ZBQA 4RNHA 3VVTA 4C97A 4QBUA 3PR4A 1T9WA 4MJKA 1UVJA 1T95A 3ZZ0A 4QWEA 2VH7A 4C8MA 2CPXA 4RW4A 2GIFA 3IO1A 4O3QA 4ZLNA 4DUYF 2BKPA 1WF0A 4ZPAA 4KHMA 3JAMY 1ZM9A 3PEHA 2VV5A 2DGSA 3HHLD 3CCQS 2HVIA 2RDIA 4IRDA 3MTKA 3D66A 3EM1A 3SYZA 2DH8A 4YB6A 3K89A 3QT8A 3HO1A 1LK7A 1B0TA 2QO3A 1JB0C 4HTJA 3H7HB 5LL6d 2BKNA 3KLHB 2DR6A 3MUMP 2QEXS 4CO1A 4CNZA 1VC5A 5D0HA 5IFMA 4KGKA 4ECWA 1RBLA 2W25A 2G0JA 1PIEA 1Q78A 2M88A 1S76D 4ED1A 3P5TL 1PG5B 1S4FA 3DOMA 2FHKA 4K7QA 3W9HA 5HMZA 3LP2B 2BW2A 3VWSA 1VQ6S 4ZHRA 1O6XA 1UETA 4L3KA 3T3FA 2ADCA 3CJSA 5CQGA 1YVFA 3FBEA 4KBIA 4FXVA 3MM9A 1FXDA 1FD2A 4LVNP 1QVGR 5A2QU 1ZTTA 2HQFA 3GWCA 5DZ7A 5E5NA 2DRDA 3TX8A 2JL9A 1MMNA 3W5ZA 4MTPA 4F36A 2E7VA 2B9YA 2V8VA 3EPGA 3EPIA 1SH2A 2XNRA 1B7FA 3CT9A 2ATLA 1SUQA 4A48A 3RR8A 1Y3KA 5AJ3J 1JK9B 4GVLA 1S4EA 1TUVA 1A7GE 2VC0A 3PW0A 2HZVA 4K4VA 5IV3A 4ECQA 2MKJA 2MSSA 2WAQD 1RAOA 4KQZA 3MM8B 3NS7B 3H5UA 3AB4B 2CXEA 3R5BA 1Y5IB 1BWVA 3DRRB 5DM7Q 1XMQJ 1FX4A 4OYPA 3AQOA 1G4CA 3N5FA 1YX2A 3PW5A 3KG0A 5F8JA 1VGYA 2EFPA 3DU6A 3AD7C 4J7CA 2FD2A 1RWOB 2ZKTA 2Z57B 2PE8A 1IKYA 1W25A 2J9CA 4ES2A 3KOAA 2RNEA 3UE2A 3D0IE 4TU7A 1MROA 2V34A 3RB4A 4ECUA 4B3RJ 1GX5A 1VIXA 5KG4A 5CAAA 1QE1B 3HF5A 1VRTB 1TAUA 1BWEA 1WC6A 2BOAA 2HS0A 2QC3A 4I2PA 2XEXA 3VZHA 3MR3A 5J1NA 3SEOA 2KRRA 1RZMA 1L3VA 1WUUA 3H42A 4CH1A 2CADA 1PAEX 1J5OB 4LBIA 4DCJB 4JV1A 2M7SA 3DHXA 3I32A 2AJQA 3QLHA 3EWGA 1C0UA 1QM9A 1AB8A 2BJ8A 1QAIA 1MWYA 1HQUA 2GJFA 3OLAA 2J76E 2HEKA 5EWFA 3D54A 3TYTA 1KVIA 1MWZA 3ZZOA 3Q22A 2J9DE 1JJHA 4YP3A 2JX2A 3NAIA 3MPDA 5KFMA 4LF7J 1P27B 4PG5A 2ZD1B 2R7WA 1S49A 4DV1F 2R7TA 5D8HB 3WX8A 2AJ0A 3KLEB 1H2VZ 1VFJA 3DHWC 2V2QA 1L3SA 2KT3A 1M5PC 4B3MF 3JSRA 2MSTA 1MMLA 1MN7A 2QLFB 3DDKA 3IM9A 5FDLB 4EMDA 3G8QA 3IBFB 2R7XA 2IA0A 2VPWB 1JIHA 3M2UA 1R89A 4NXMF 1OY9A 4IOCQ 4ZHRB 2GMJA 2XO6A 1HBOB 4ZVQB 1LOUA 3CDBA 5C5JA 2BV3A 1UFKA 4BC7A 1MW7A 4P6QA 1R6YA 3L09A 3GFZA 2PMWA 5B09A 1P1LA 4ECXA 1U1NA 4OIXA 4WWSA 2ZFHA 1NPRA 3MMCB 4CO0A 3D9BA 3CCUS 4LF6J 1JLBB 3MCSA 3HXMA 2CDQA 5JVGQ 3A8JA 3D67A 4K0KJ 1W7WA 4S0MA 1LV5A 4FYWB 1WSVA 1SUQB 1YJTA 4J9UE 1C0UB 1X8DA 4ED7A 1WELA 5E3RA 2J6SA 2ZH2A 4NYZA 2XCAA 2Z30B 5E3CA 1HBNA 3M8QB 4B3TJ 3C15A 4WU3A 1KSPA 1RISA 4ZLPA 2FHJA 4C48A 3DRPB 4KKOB 4U7UK 1HNXF 1LWFB 3EDQB 3KFWX 2XLIA 2BANA 2QT7A 1OMSA 2NXNA 2QA2A 2DIVA 4MKBA 4CM0A 5C24B 2XI3A 3M1VA 7FD1A 4FKYA 3UN3A 3OHBA 1FXLA 2K2PA 1REVB 3DOKA 2B9XA 2H3EB 2AZ1A 1RWWB 1SV5B 1R6VA 3F44A 3LALA 3N6LA 2H9ZA 4PAAA 1RAFB 4ZS6A 5ETKA 4U7CA 5FDLA 3DYAA 4M5LA 3LGMA 3HT3A 3G6VA 4YY3F 1RT2A 3CJTA 5FLXY 2QG9B 3TA1A 2XI2A 3NBPB 3EZUA 2KYZA 5HP1B 3NMRA 1RTHB 2V68A 3MEDA 3J81j 2HVDA 3LP1B 4NLVA 3TQ1A 1M5HA 1LWEA 3NGSA 3CJKB 2GO9A 1A6LA 3R27A 4QQBA 2ROPA 4NZ6A 1CJTA 2HHTA 1DQAA 2EKNA 2YX7A 2XY5A 3CIZA 2H54B 2C3MA 4WFZA 2RAQA 4X4QA 1YHQS 4LF8F 4OZJA 1MWQA 1TKTB 4OX8A 2RDJA 1DTTA 2W2QP 1S1TB 3J80U 3GFXA 2X7IA 4E8UA 1NMEB 1S1XA 4CLLA 4E2FB 4EUVA 5BJRA 1U45A 4K4UA 2MJUA 1D3WA 4MT1A 5AXLA 5K5MA 2RRNA 3X1LB 3R6GB 4JI3F 2KT2A 1CJKB 3MD3A 2HBYB 1HD0A 3T1HJ 2X3DA 2ZE2A 3Q8YA 3G6ES 3EZOA 2MKSA 1F5AA 2J8SA 3PEJA 4IG0B 5BR8J 3M9MB 2VODA 2HMIB 2DNQA 3OXFA 1TTHB 3PFOA 4ECRA 1IBKF 1EX8A 4MK7A 1IBCB 2V8DA 1NU4A 1PAUB 1T9YA 5D0RA 4ETZA 4FPIA 2PC6A 3GJSB 5AT1B 2KXHA 3CXCR 1TFWA 3FFIA 4RW6B 3TX0A 4J9KA 1BC6A 3I0RA 4KPCA 3QAEA 2E9ZA 4J9QA 5HAOA 1RQ0A 3POTB 1FRJA 1RAAB 3WZ0A 4USTA 2F8HA 3JXOA 2L3MA 3H2VE 3MCMA 2ZH6A 3D1OA 5KFHA 6AT1B 2CPFA 4U6PA 2DHGA 2FJDB 2IYIA 2U2FA 5CA5A 5BYSA 4MMOA 4NOHA 1RWKB 1QVFR 1VQNS 3JTPA 5DG7A 2JSXA 1Q5VA 2C2OB 3KMQA 4TLRA 5MAOA 3MR5A 2W01A 3M8YA 1F5BA 1JLEA 2XG8A 3A4TA 4EI2A 4DX7A 4J9OA 2CQPA 2I6WA 3R5JB 4GC7A 3NG8A 1TK8A 2CFXA 2ZH9A 4RUAA 1BQMA 2B4PA 2N7YA 5LMUJ 3VALA 3MPVA 2MQ8A 4ED2A 3C3LA 2UU9F 4ANCA 3PVXA 3ONQA 3AA8A 3MMAB 1JJ4A 4I67A 2FGOA 3ZXWA 2MXYA 4ILLA 1OPZA 2ZOFA 1X31C 3CO0P 3DLEA 4YMEA 2V2ZA 2IYGA 4UQGA 2G9OA 2B7BB 2Y1JA 5M2UA 4LFBF 2LA4A 2E1PA 5KFWA 4DF8A 5D0GA 2UXCF 2W2PP 2ZEJA 3ET6A 3KLIB 4JI3J 4CO3A 2YKPA 2BABA 4ZP9A 1WHWA 1RWXB 5T7LB 3DRPA 4DUYJ 1RAEB 2M5YA 4ZVRB 1RWMB 3IAM9 5BR8F 2IM0A 2MLYA 3IS9B 1HQEB 1Q8KA 2DXFA 2IPOB 3GR1A 2KJWA 4ZVHA 1EP4B 3MM7A 3KMSA 3CJQA 3J81Y 1FTCA 3BZQA 3PDNA 4DFJA 2A18A 1KC8T 1TKTA 1SJ1A 1OIAA 1DY3A 2BJDA 3CJ4A 1ZAVA 4I0WA 3CCRS 1RT2B 4HVZA 2GHVC 4ZP8A 5AE1A 2JFKA 5B0AA 4GO5X 4A8XA 2A1BA 1RT6A 2HGLA 2O67A 3J7A1 3OD2A 2NZ4A 3QMQA 1TU0B 1NDCA 3AAWB 4OZ0A 3TW0A 5KFBA 1LWEB 5EHHA 1Y10A 2QZ8A 4DLEA 3W9IA 2E7XA 2HLUA 2KU7A 4XTTA 3J81U 2HS3A 2E7WA 2DB1A 3PIOQ 4PXCA 2R8HA 1HBUB 1G7CB 2UVWA 2QLBB 5ETSA 3OVBA 1BY9A 2LKZA 5L1LA 4DQIA 3DLBA 1YJUA 3OSPA 2WSFC 1UVIA 1M1HA 3NNAA 2HGMA 2UV8A 4KRWA 4Y6IA 4B17A 2CVIA 4V19X 2OMLA 3DOMB 2GGPB 3L95X 4NLXA 4OJGA 2FHMA 2Z2YB 3BO4A 4XIUA 1ZA1B 4KE5A 2E1CA 4MFBB 2DNMA 2HVZA 5KG6A 3W7BA 3G71S 1FDAA 3D6HB 1EB0A 3HCXA 5KFAA 4ZLJA 4DV5J 2ASJA 1D9AA 2XHWA 5C42B 3AODA 2I5JB 3NOCA 3GJQB 2HSEB 3HI9A 4LSNB 5CYQA 2HZAA 1B0VA 4YR3A 4CCHA 3CDWA 4KGVB 5BXIA 4K4YA 1PGZA 4F26A 3BEGB 3FJ2A 5HJYA 3IRXA 1T11A 2W24A 2NPFA 3OTOF 4DOZA 5CCMA 1N33F 4AYBD 3ULHA 3V4IB 1S59A 3Q23A 1XERA 4ZK7M 1FJCA 3K5LA 2DRAA 2W9CA 3O44A 2C2KB 1A9NB 1C4AA 1GTEA 3UFCX 1HHTP 2HVHA 1FFWB 4A47A 1AUSL 4FBTA 1RT3A 4NLTA 1UWAA 2DNLA 4I7FB 2WTFA 5H9FK 1RTIA 4LQ9A 2W8KA 2L9WA 4OFZA 4IO9Q 2IRYA 3MAAA 2XLJA 2DGUA 2I2YA 3K5MA 1YBAA 3NRBA 3V6JA 4NWBA 3TEGA 2MB0B 1J2VA 4AFFA 3C2PA 4OYOA 3DNCA 4G6VB 2DPIA 1OYDA 3OTCA 3BBFA 1UA1A 2ZBPA 4BBYA 4IUFA 3CCVS 3EVMA 4DUZF 4UY85 1NDLA 4HI2A 1R3NA 2GS8A 3LO3A 4JOUA 2FZGB 3GFHA 4NEYA 1CLFA 2LMIA 1N32F 3KHHA 4AQYJ 1LWCB 3HZEA 3L4BC 2H65B 4D3HA 1Y4ZB 1EQ0A 2OH2A 1GXTA 1NO8A 2ABYA 1BLUA 3TVZA 1X9MA 2COLA 4Q7AA 2UUTA 3PM9A 4LSNA 4R0JA 2ZH7A 3QJPA 2VICA 2YKNA 4RX6A 2QL5B 4UW2A 1J5EJ 2UUBJ 3M6UA 3ZO7A 3VVUA 2KG0A 2J7KA 3EZ5A 2LEPA 4JI0F 3O5TB 5HJXA 1TELA 4F0KA 3QBCA 3UNYA 3G8TA 4PXEA 3W5YA 1ZH5A 1RT4A 1FWKA 3CD5A 3GV5B 2MZSA 3M30B 4GRSA 2HBQB 2M3DA 2KL8A 3UDLA 3VGSA 1ZZNA 1H2UX 2WB4A 1K73T 3US5A 5GMKa 5AXKA 5B0CA 4PPZA 4ELTA 2DCUB 3QLHB 3W60A 3NMAA 4HKQA 4NLUA 3SBMA 1GQEA 1H7WA 1RP5A 2BJEA 1JNRB 3JS9A 2B8PA 3IG1B 3X3UA 3BGFA 1B3TA 2KO1A 2Y3YA 4C4WA 5FLXU 1IQZA 4DR5F 4AL6A 4C7QA 3OXLA 1TL7A 2YWGA 3OJSA 1ROFA 3FKBA 5LMNJ 3LAMA 1VR6A 5J2NA 1U49A 2FLNA 2MPUA 4C0OC 4CYUA 2MQNA 1S6UA 4Y3CA 1RHRB 2MEWA 3IAS9 3JQMA 4XPEA 4DV7J 2HS4A 3TANA 4ZPWR 4KSEB 4P2FA 4DR6F 4LRDA 3M2VB 3D4JA 1MU2B 3HSGA 2DEJA 2KRBA 2OIHA 3HM9A 2E9TA 3TOQA 4XPCA 3VAIA 1NAQA 4JYAF 3OFHA 4C0HA 5HBMB 2WBMA 1H0HB 2BZ2A 5F8NA 4FDFA 4K50A 2HURA 3BM7A 3TA2A 4EK2A 1BQNB 1UJ4A 2EK1A 4F3OA 4ID5B 1RJJA 2YKMA 5GAEI 4DQRA 3DU5A 1Z4UA 2WVEA 4PPDA 3C14A 3IC1A 2KKHA 2RQKA 3NGTA 5ETLA 4ZA1A 3W61A 2VQFJ 1FVQA 1D0EA 4WBFA 2ZNYA 4X84A 1U2CA 3LPEA 2MQMA 4CNYA 3NGUA 2Y0SD 4OX6A 1RA6A 1WHYA 4CLZA 3DXBA 1TL1A 3E01B 5ADZA 3AH6A 4JI0J 2XS2A 2KZMA 3H5YA 5CABA 1UL3A 4I4BA 1JXVA 3EX7B 3PW4A 3RAXA 1N0VC 2VG7B 3RW7A 5DETA 4URSA 4OYWA 3H25A 3BDPA 1PYOB 4DZ6A 4P10A 1ZETA 2HPUA 3NWRA 4DL5A 4DR7F 2Z2LA 3KTQA 4IYQA 4O23A 1N34J 4WIQA 2DRBA 4J37A 1HL6A 1BQXA 1JLFB 2BANB 3HVWA 2ZH3A 5E3QA 1PYTA 1Q8IA 2IRXA 1CQMA 1I5OB 2D7SA 2E5JA 1HARA 4I6AA 4WYWA 1VQ5S 1HBOA 4LT6A 2KG1A 4OI0A 3QGGA 4KH1B 2GVZB 1Q8LA 4IO1A 4USHA 4N5SA 4W4MA 1AUDA 1TL3B 2EI5A 1U1LA 3EICA 2AV5A 2Y1IA 4JI4J 1Y5LB 1IWGA 3IWLA 3NS6A 4O0NA 1SCJB 3QO9B 4QR0A 2K3KA 2QMWA 2VQEF 2CQBA 3G82A 2R42A 1DJ0A 2B6AA 4FNHA 4RBTA 3TO8A 2V9KA 4H4MB 3VGTA 3QIPB 1QUPA 2BJ1A 2IVMA 5K9FA 1V5VA 5SZTA 2CA9A 3FMBA 3L9ZA 4JV0A 1RTDB 2HMIA 1LW0A 1NM2A 4LF5J 2NYIA 3MD1A 2VKZG 5KFUA 5LMUF 2F40A 2MKKA 5DG9A 3CCMS 2EFGA 1WHXA 4M5DB 3Q8SB 1T05A 2GNKA 1LW2A 2FJEB 2YQ3A 1S1VA 3QFHA 3OL6A 2NXUA 4CLPA 3SQGA 5A6PA 5DLGA 3KHGA 3WIUA 2HHWA 3K7RA 5I4MA 2WZ1A 3FK4A 2ROGA 1MNEA 1MG7A 3CCLS 4F2SA 1SB6A 4U8YA 1N8RT 1EETA 3IRWP 1CQNA 4Z37A 5ETVA 1QDUB 2XWYA 4Q44A 3TQEA 2Q66A 2AJ1A 4K4XA 1VCTA 2VG5B 4M1KA 4Q8FA 3DN9A 4U9RA 2HHVA 3ZTOA 3LP2A 1DTQB 1XK8A 3DMJA 1UEKA 4P74A 4QIFA 1RWPB 4B08A 4CIOA 4ES1A 3SIPB 2VJUA 4A8MP 4X64F 1S6QB 2I0XA 4DR1F 1G6BA 4OYXA 3WHIA 3CDUA 2R8IA 3LQVA 2RKIA 3F41A 2D3ZA 3SDEB 2DHSA 2FB0A 1TMMA 4USJC 4PR6A 3RGIA 3ZTPA 3I5CA 5E41A 2AYBA 3BJYA 4RBVA 1C0TA 4NZ7A 1T03B 1S79A 4OI6A 2D3UA 4TLQA 1IKVB 2KJVA 3RAMA 1S97A 1Y11A 1UW4A 1DTTB 2R7OA 4LJMA 3W2VB 1RWNB 4N8OA 4X65F 4AXIA 4LUBA 3SCJE 3G4SS 2FZKB 5M2PA 4C8OA 1KD1T 1EJ7L 3S1TA 3GG0A 4J90A 1TQLA 3CUNA 3KJVB 2LXFA 2YNGA 5L46A 3PYFA 1FCAA 2HRUA 3HD2A 3IS9A 2E44A 3KK2B 3C19A 2IBKA 5KFJA 4P52A 3RJMB 2H5IB 3AFGA 4QZVB 4CRJA 3V81B 3GIIA 4LR8A 2J7WA 2LQJA 5HI7A 4OLPA 2FC8A 4WFXA 5ETTA 2NXCA 2HLTA 4CLWA 2PMHA 5DQIA 4YR0A 4ED6A 1KNZA 1GAOA 2VIHA 2VPYB 5KT7A 1KLNA 4CLSA 1R27B 3KUEA 5GAGU 1J5OA 2DIUA 3KLVA 5B0GA
chains in the Genus database with same CATH topology
1XMQJ 1N36J 4X65J 4DV1J 4LF9J 3W1YC 1XNRJ 2E5LJ 4GKJJ 3T1HJ 4NEZA 1FJGJ 1HNWJ 1N34J 4RJVA 4B3RJ 5BR8J 2F4VJ 1HNZJ 4GKKJ 2HHHJ 4NXNJ 1XNQJ 4B3SJ 3T1YJ 4JI5J 3JAMU 4KYZA 4JI4J 4DR1J 4DR6J 1XMOJ 4LF7J 2UXCJ 4JI7J 4YY3J 5LM7E 4NEYA 1I94J 4LF5J 4AQYJ 2UUCJ 2ZM6J 1HNXJ 5LMUJ 4JI2J 1N32J 2MQ8A 1IBKJ 1J5EJ 2UUBJ 3D3CJ 4LFBJ 4X66J 2UUAJ 4LF4J 2KL8A 4LF6J 4KHPJ 4JI3J 4K0KJ 4HHUA 4DUYJ 4X62J 4DV5J 4DR3J 2UXBJ 4DV4J 5FLXU 4DR4J 4B3TJ 4LF8J 2UXDJ 4LFAJ 5LMNJ 4JI1J 4OX9J 3IMQJ 4V1Ak 2KVQE 4DV2J 2MEWA 4DV7J 4JI8J 5IWAJ 3J7AN 4JYAJ 4DV0J 3OTOJ 4DR7J 2VQEJ 4JI6J 3J81U 2MTLA 4DR2J 1HR0J 1IBLJ 4DUZJ 3D3BJ 4JV5J 5A2QU 4B3MJ 4DV3J 1N33J 4X64J 2VQFJ 4DR5J 5AJ3J 5IT9U 1IBMJ 4NXMJ 4YHHJ 2UU9J 3R2CJ 4PWWA 4KY3A 4LFCJ 4DV6J 3R2DJ 4JI0J 3J80U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ J;  1N36 J;  4X65 J;  4DV1 J;  4LF9 J;  3W1Y C;  1XNR J;  2E5L J;  4GKJ J;  3T1H J;  4NEZ A;  1FJG J;  1HNW J;  1N34 J;  4RJV A;  4B3R J;  5BR8 J;  2F4V J;  1HNZ J;  4GKK J;  2HHH J;  4NXN J;  1XNQ J;  4B3S J;  3T1Y J;  4JI5 J;  3JAM U;  4KYZ A;  4JI4 J;  4DR1 J;  4DR6 J;  1XMO J;  4LF7 J;  2UXC J;  4JI7 J;  4YY3 J;  5LM7 E;  4NEY A;  1I94 J;  4LF5 J;  4AQY J;  2UUC J;  2ZM6 J;  1HNX J;  5LMU J;  4JI2 J;  1N32 J;  2MQ8 A;  1IBK J;  1J5E J;  2UUB J;  3D3C J;  4LFB J;  4X66 J;  2UUA J;  4LF4 J;  2KL8 A;  4LF6 J;  4KHP J;  4JI3 J;  4K0K J;  4HHU A;  4DUY J;  4X62 J;  4DV5 J;  4DR3 J;  2UXB J;  4DV4 J;  5FLX U;  4DR4 J;  4B3T J;  4LF8 J;  2UXD J;  4LFA J;  5LMN J;  4JI1 J;  4OX9 J;  3IMQ J;  4V1A k;  2KVQ E;  4DV2 J;  2MEW A;  4DV7 J;  4JI8 J;  5IWA J;  3J7A N;  4JYA J;  4DV0 J;  3OTO J;  4DR7 J;  2VQE J;  4JI6 J;  3J81 U;  2MTL A;  4DR2 J;  1HR0 J;  1IBL J;  4DUZ J;  3D3B J;  4JV5 J;  5A2Q U;  4B3M J;  4DV3 J;  1N33 J;  4X64 J;  2VQF J;  4DR5 J;  5AJ3 J;  5IT9 U;  1IBM J;  4NXM J;  4YHH J;  2UU9 J;  3R2C J;  4PWW A;  4KY3 A;  4LFC J;  4DV6 J;  3R2D J;  4JI0 J;  3J80 U; 
#chains in the Genus database with same CATH topology
 2CNO B;  1VMB A;  2QSF A;  4HAC B;  4MYT A;  4NLP A;  2ZWO A;  1UAW A;  3MM9 B;  4RW9 A;  5KG7 A;  2UP1 A;  4DSL A;  1EP4 A;  1Q1K A;  2AF6 A;  1XEZ A;  1G2E A;  5D4L A;  2N7C A;  1RDR A;  4B9U A;  4TKT A;  2W9B B;  2R2T A;  1NKC A;  4GKJ J;  2XYH B;  4DSF A;  5HLF A;  4DV0 F;  1DHM A;  2V4Q A;  3MF5 A;  2KFN A;  2GVZ A;  1YRT A;  1MMD A;  1FO1 A;  2HFU A;  1WKL A;  2NUU G;  4DL0 C;  1FJE B;  3FZB A;  5J1E B;  1JLG B;  2F4V J;  4ZIW A;  2HQ3 A;  3ELH A;  3JYT B;  1E6Y A;  3VAJ A;  1XN9 A;  2RIL A;  3T1Y F;  2HHH J;  1TKX A;  2GA7 A;  2OI2 A;  3GG1 A;  1OO0 B;  2E5H A;  2QA4 S;  3KK1 B;  4Y2A A;  4ZCM A;  5J2Q B;  3M9O B;  2VG6 B;  2IY5 B;  4LF1 A;  1EQM A;  1XJW B;  5GAH U;  1C1B B;  1LK5 A;  1T8E A;  3OXG A;  1XMQ F;  4F0M A;  2UUA F;  4O4R A;  2CVE A;  4FXW A;  3TJ8 A;  4GC6 A;  3PJW A;  3W2W A;  1VJW A;  4H4K C;  1SXL A;  1YJW S;  1SBR A;  4AD6 A;  4P72 A;  1VIO A;  1HWU A;  5L8R C;  5GAD U;  2MLX A;  4B3S F;  3RB6 A;  4HH1 A;  2YX4 A;  1P8G A;  3MEG B;  5LSR A;  1FRK A;  1M5K C;  2UXB F;  1Q8B A;  2CQD A;  2CQI A;  2DNK A;  3I0S A;  5HQL A;  3T5H A;  2VU5 A;  3M32 B;  1W26 A;  2GMH A;  4I2Q B;  3QO9 A;  4PYA A;  1FK9 B;  5F3T A;  4BLG A;  5KFE A;  1Z2L A;  3PYE A;  4ZVO B;  3OR2 B;  3AJD A;  4LIR A;  1SKS A;  4PG6 A;  1VRU A;  1N32 J;  1AFI A;  1IBM F;  1R0A A;  2NUH A;  1SKR A;  1F9F A;  2OEM A;  4K5S A;  4FP9 A;  3D2W A;  3JQJ A;  3R1L A;  3M8Q A;  3FSY A;  4OZN A;  3OTB A;  3QQC D;  2FVC A;  5KFL A;  3GU0 A;  5CXT A;  2RS8 A;  3ZZR A;  1QAJ A;  2AEJ A;  2GQQ A;  4OL8 A;  2ROE A;  2WON A;  2AHO B;  4RKU C;  4OHZ A;  5LXR A;  3PX0 A;  2OAU A;  5BYQ A;  5KFF A;  1XMO F;  2ERR A;  3H8Y A;  4X4S A;  1T3N A;  4LR7 A;  1ZPV A;  4DR2 F;  3TAM A;  1YGY A;  4EO6 A;  1VQP S;  3F56 A;  1RTI B;  4OQJ A;  3I4H X;  2VFT A;  5KG1 A;  3QRP A;  5L38 A;  1NK0 A;  4DFP A;  3ENV A;  2H4W B;  5HMW A;  3RZA A;  1PC4 A;  1RE1 B;  3UDC A;  1N0U A;  5LMN F;  1KHV A;  2ZZT A;  4RPF A;  5CYM A;  1U24 A;  4B9L A;  1GNK A;  4TYB A;  2VAS A;  4A46 A;  2UUC F;  3OR1 B;  4B9S A;  2FHO B;  1KBR A;  4V1A k;  5A76 A;  1HBM B;  3MHY A;  4G65 A;  3U1N A;  2JLG A;  2FLL A;  1RAB B;  4USW A;  2MGZ A;  4JYA J;  4A4J A;  4DG1 B;  4IRK A;  1RA7 A;  4URG A;  1FJG F;  3DGP A;  4NA2 A;  2ZH8 A;  5H9E J;  3PCO B;  2J0Q D;  2MTL A;  4DUT A;  4KC5 A;  1W2B R;  4ZJQ A;  3TP2 A;  5JUM A;  1TKD A;  3LOU A;  1VQK S;  1VJQ A;  2QLW A;  1S0O A;  5A8W B;  3T5J A;  2CZ9 A;  3MEC A;  2ASD A;  2DXE A;  2Q43 A;  4UOG A;  3J80 Y;  5CD4 H;  1Q0N A;  1WSR A;  2IM2 A;  3CCT A;  1RI7 A;  5DQG A;  1PJ6 A;  5JVH Q;  3BR9 A;  3KK1 A;  4RBU A;  3A3O B;  4MH8 A;  3DLJ A;  4K2X A;  5KG3 A;  4ZVG A;  4B3T F;  4M5I A;  1KQF B;  5IT9 U;  5C2G A;  2LQ8 A;  2XBP A;  5E0O A;  4BHQ A;  3AOC A;  3H2L A;  2XZW A;  3VZI A;  4ED8 A;  3RB0 A;  1JLA A;  1NPP A;  4ID8 A;  2HWH A;  2VJV A;  3R2D J;  2BE7 D;  3JB9 k;  4DI6 A;  3GYX B;  2IBO A;  4N56 A;  2GIQ A;  3QID A;  1YBT A;  3LWM A;  3H40 A;  3SZ2 A;  3FBF A;  2IAJ A;  4C8L A;  5D3G A;  4X2B A;  4B9V A;  2AJ2 A;  2GX8 A;  1UWB B;  3D1Q A;  3M2R B;  3FZ2 A;  3N28 A;  2J9E A;  5RUB A;  3LWL A;  2V9W A;  2O3D A;  2QV6 A;  1LWC A;  2XMM A;  1HNZ F;  1Q86 T;  3M32 A;  3FRY A;  2AIR B;  2DGO A;  3BGL A;  2EPI A;  3EE3 A;  4KGZ B;  5C2C A;  2X3G A;  1UA0 A;  2BQ3 A;  2EFQ A;  2HBZ B;  3C66 A;  4CYU B;  2EFN A;  3OHA A;  1RKJ A;  1WG5 A;  5DDP C;  1K9M T;  3UDV A;  1QTN B;  3J7Z 5;  3C6U B;  4O44 B;  2MGZ B;  3W2W B;  4CLK A;  2VHG A;  3D6T B;  4E98 A;  2XSJ B;  1H98 A;  2ZBI A;  3HT0 A;  1KVK A;  3KYL A;  3G2X A;  4G1P A;  2ZHO A;  3DDI A;  2RHS B;  1K1S A;  1S1W B;  4TXS A;  2H4Y B;  4C11 A;  1WD6 A;  2WVC A;  2ZBC A;  5E7O B;  3W64 A;  4IOA Q;  1RU1 A;  1F9E B;  2Y8W A;  3LP0 B;  2RUG A;  3B54 A;  6FDR A;  2W4C A;  4KHP F;  4YY3 J;  1FRL A;  3BGO P;  1RTJ B;  2IM3 A;  3MUV P;  2OJ3 A;  2ASY A;  2XMK A;  3BYR A;  2Z56 B;  3HVT B;  3M4X A;  4LRF A;  2AGO A;  3GYN A;  4Z2X A;  4Y28 C;  4ATN A;  3HSD A;  4YQW A;  5A8K A;  1RT7 A;  2ALY B;  1MSW D;  4LF5 F;  1DBD A;  4PWU A;  1U1P A;  2XTJ P;  4XDC A;  3BYP A;  2RS2 A;  4C6A A;  4FS2 A;  1XTZ A;  1F6T A;  2VUG A;  3VR1 A;  1SKW A;  4DN0 A;  1Q4R A;  4K59 A;  4NYO A;  1EIY B;  5T14 A;  4KT0 C;  1OY6 A;  3BO3 A;  5HO4 A;  1JQG A;  3FEX B;  3M2V A;  1FK9 A;  3DGP B;  3CCW A;  1RXO B;  4P7V A;  1IKX A;  1HWK A;  3MR7 A;  3QFW A;  3U27 A;  3RB3 A;  4PG8 A;  5D15 A;  2P9G A;  4J9M A;  3OT9 A;  1RT6 B;  1TV6 B;  3OUY B;  1UZH A;  1WF2 A;  2YNI A;  4ZVE A;  4FVC A;  2HYI B;  2FIU A;  2JWN A;  3I9Z A;  5KFC A;  5KFO A;  3RRH A;  1FER A;  4ID5 A;  4BC9 A;  2XLK A;  3V5R A;  2CQC A;  4L72 B;  3W62 A;  2BW7 A;  5KT2 A;  2YH1 A;  4ZN1 A;  4X62 J;  2KYX A;  2RIJ A;  4OJH A;  3K58 A;  4F4Z A;  1HBU A;  2XB2 D;  2Y9H A;  4OYZ A;  3HSZ A;  4J9V A;  1KN6 A;  1RWV B;  2AMC B;  2BA9 A;  3CGI A;  2WOM A;  1F0X A;  3VCD A;  4X4R A;  3CCE S;  1SC3 B;  5G4D A;  1D1U A;  1KON A;  1PCA A;  2DIS A;  3DXS X;  3BKU A;  1Q95 G;  2A2D A;  2QYG A;  1YRX A;  3DLK B;  1MRO B;  4ANE A;  3ZZT A;  1TKZ B;  1FFS B;  1SIW B;  2HHP A;  2JLF A;  5AE2 A;  1UFW A;  1DTQ A;  2VFU A;  3DMJ B;  2J7U A;  2POK A;  3O1L A;  4DSJ A;  4LQ3 A;  4HHH A;  4MFB A;  1HFE L;  4C0B A;  2LEC A;  1FT8 A;  1VK8 A;  2Z2Z A;  4HH0 A;  4Q45 A;  2V8H A;  3CW2 C;  5HAT A;  3GSD A;  3Q8R B;  2E66 A;  2AJF E;  3PFE A;  4KIA A;  4QWC A;  3I56 S;  1HLW A;  2I5J A;  3U1M A;  2RKI B;  2ZDO A;  4ZKA A;  5I3Q A;  1IN0 A;  1WI8 A;  1HQE A;  3HLU A;  5SUH A;  4GKK F;  2HHQ A;  4F2R A;  3UR0 A;  1QAY A;  4ER8 A;  2CPY A;  4UY8 T;  2F63 A;  2JDJ A;  2KT5 A;  1NBE B;  3MDF A;  4HI1 A;  1X4F A;  2XCP A;  2IM1 A;  2HBR B;  2RF2 B;  2XMU A;  1K44 A;  3DLH A;  1S77 D;  2CJY B;  3NCP A;  5D3G B;  2VG5 A;  4IOB A;  1SL2 A;  1FKP A;  4QPT A;  2MY8 A;  2G1D A;  2OFH X;  2RJZ A;  2UU9 J;  1NUE A;  2V8P A;  3QT6 A;  3DM2 A;  3H20 A;  2HK2 A;  4ZIT A;  4MIB A;  2I1R A;  3KLE A;  1TVR A;  1CS4 A;  2W7P A;  4LRC A;  3C6T B;  1S6P B;  1Y5N B;  3AJ1 A;  4YFU A;  3M8R A;  3SV4 A;  4K2J A;  2D41 A;  3D28 A;  4CWB A;  2CDR B;  2LQ5 A;  3CDA A;  2WW4 A;  3GFY A;  2D3O R;  3TVK A;  3MCN A;  2E1R A;  1Q7L B;  3MAA B;  4FKX A;  3TVY A;  5A6W A;  1HQU B;  4KO0 A;  3TUI C;  2SXL A;  3W66 A;  3HVT A;  1N4L A;  1IR2 A;  5B0F A;  1AA1 B;  1F1B B;  1PKU A;  1Q53 A;  2LU2 A;  5K8O A;  1T7P A;  2OPS B;  3N0V A;  5IS2 A;  1Z1Z A;  2M70 A;  2AX1 A;  3MEE A;  4G1Q B;  4J9P A;  2HHH F;  1U0H B;  2A6M A;  1NDK A;  3CB4 A;  1VI7 A;  2HRT A;  1RAI B;  2FGC A;  2LVW A;  4QWA A;  1NB7 A;  1WHV A;  3P49 B;  1U48 A;  3CF5 Q;  2DR9 A;  2X1A A;  1MLA A;  4USU A;  5HK4 A;  1GX6 A;  5J2M B;  3IN5 A;  1EKR A;  1N6Q B;  2M2B A;  2VON A;  3HHL C;  2UV8 G;  3T1Y J;  1IQT A;  3UCG A;  1CJT B;  3SCK E;  3KK2 A;  4CLU A;  1NK7 A;  2EVZ A;  3GZ7 A;  3A8K A;  4FVM A;  4KYZ A;  5CYQ B;  4J91 A;  2B8Q A;  4I6W A;  2QGF B;  3ZC4 A;  4K4S A;  4B9N A;  8ATC B;  1QAX A;  2PII A;  1S1T A;  4N7T A;  2JH3 A;  1TK0 A;  5J1E A;  2AYG A;  3RAQ A;  3VAG A;  3PYD A;  2H51 B;  3MPW A;  2YXL A;  3NCQ A;  3CIM A;  5LM7 E;  4FF1 A;  5I3U A;  1EAR A;  5G0R B;  3MMC A;  3R6L B;  3N79 A;  3QWU A;  1JKH B;  4DX6 A;  3UD3 P;  2OD6 A;  3DOK B;  2ZE2 B;  3T1H F;  1L3T A;  4LFA F;  1FHT A;  2RRB A;  1IKX B;  3EGW B;  1FFG B;  2VOP A;  4RW9 B;  2QLX A;  1Q5Y A;  2FPH X;  3OSN A;  3O8W A;  1HA1 A;  2XYP B;  1NJI T;  1HMV A;  1QSS A;  2DVI A;  2HW3 A;  4OJ3 A;  3HHN B;  2JEJ A;  3S01 A;  1ZM2 A;  1ICE B;  2YQ1 A;  2WB1 D;  1IWA A;  5CH7 B;  4PAB A;  2ZHA A;  1DZ5 A;  1RT7 B;  1UPM B;  4KFB A;  4F4K A;  3GB0 A;  4ZP7 A;  1VBX A;  3DI6 B;  1Y00 A;  3K59 A;  2DR8 A;  1RCX B;  1OSD A;  4HL9 A;  5HSP A;  1HKA A;  3T6J A;  4PYD A;  1JLQ A;  3FCW A;  1O8B A;  3KKF A;  1G3O A;  8RUC A;  5DZ6 A;  2RF2 A;  5IQQ A;  3HFV A;  3D68 A;  2IJN A;  1TK5 A;  1IVZ A;  1FX2 A;  2XMA A;  3G86 A;  1UJ6 A;  3PRD A;  5AE3 A;  1AXQ A;  2LQ9 A;  5EN1 A;  3DLG B;  3UN2 A;  2OEL A;  4P2M A;  2IC3 A;  2IVY A;  4RW7 A;  3RU0 A;  1WEX A;  1XR5 A;  2DYA A;  2MLZ A;  3P45 B;  4OX9 F;  1S1U A;  4B02 A;  3CUL A;  5I42 B;  2E29 A;  3PKY A;  3DRX A;  1CJK A;  1UPP A;  1RT1 A;  2N4D A;  3CED A;  3QSI A;  4DFM A;  2EG1 A;  3KXD A;  3QAU A;  4NLO A;  4FF4 A;  1H6K X;  3IMQ J;  2LXI A;  4UOH A;  4DV2 J;  1XR7 A;  4RW8 B;  2RSQ A;  3ZZY A;  2WVF A;  5JMN A;  3IFE A;  5D4O A;  5H9E K;  1HNW F;  1WAC A;  3LF0 A;  1LFW A;  3WIV A;  3KNA A;  3BGU A;  1R8H A;  2XGP A;  4V19 J;  1TL4 A;  3DLK A;  2FY8 A;  4CLT A;  1VQL S;  1GMV A;  3IR5 B;  4DUZ J;  1F2G A;  1U25 A;  2VG7 A;  3PO4 A;  3RBZ A;  1DLO A;  2R7U A;  4QOT A;  1UW9 A;  3MMB B;  3IXQ A;  1FXR A;  4N76 A;  3TAQ A;  2YPZ A;  3GP9 A;  3OFF A;  5F0W A;  4F4A A;  1R0C B;  2W7O A;  3GIK A;  3P6Y C;  1B7Y B;  2CKW A;  3FDS A;  4NCB A;  4L75 A;  2RQ4 A;  4R8U B;  2UXD F;  2WON B;  1FF2 A;  1AFJ A;  2VBY A;  1FD8 A;  3TAP A;  2LFV A;  1F3V A;  2RVJ A;  4IKA A;  4PWW A;  3PX4 A;  1VQ9 S;  2NS1 B;  4WZQ A;  2YKA A;  2G2Y A;  3A3P B;  2O5D A;  5L9N A;  2C28 A;  4X66 F;  1D8Z A;  3EXC X;  1HW8 A;  5A8R B;  2A2C A;  3ENW A;  1SJF A;  3BSA A;  3S7R A;  3WQP A;  1B64 A;  1AZS B;  3I87 A;  3IBC B;  3LGN A;  4UZC A;  3VAK A;  4DV1 J;  4DV6 F;  1OJ4 A;  3OFE A;  2DGW A;  4DHV A;  1U02 A;  5A8W A;  2C2Z B;  2HG4 A;  1FES A;  3VGV A;  1HNI A;  2E5L J;  1KRP A;  1JWW A;  4ELV A;  1QJH A;  1VYA A;  3BGR B;  3U02 A;  5HN0 A;  3EUN A;  4KJI A;  1X5P A;  2XMT A;  3DGV A;  1VRU B;  1RSC A;  2E1M C;  2GHP A;  4GVB A;  3F0N A;  2CJ9 A;  2KH9 A;  1HNZ J;  3R5A A;  1EAY C;  2AW0 A;  2DH9 A;  2DIT A;  4KO0 B;  4J5O A;  5KOW A;  1YBU A;  2O01 C;  4NXN J;  3RRG A;  3ET6 B;  3PHE A;  2BE9 B;  2VFR A;  2YPY A;  3H59 A;  3HX9 A;  4JI5 J;  2VL1 A;  3QRR A;  4NL5 A;  1PYS B;  1IR1 A;  2Q3P A;  2VPX B;  5I3U B;  4DV2 F;  3AQP A;  2MZJ A;  4RNM A;  3U1L A;  4Z7Y A;  1RU2 A;  3NP5 A;  4QWB A;  2EFV A;  4B3O A;  2V63 A;  2H5J B;  3B78 A;  3HD1 A;  2KI2 A;  2UVU A;  4DR6 J;  3H5X A;  2KN4 A;  2YX1 A;  2XYG B;  1U47 A;  2ZM6 F;  2L41 A;  4N41 A;  3WX4 A;  3GTY X;  2XM3 A;  4P2S A;  2YH0 A;  2B3T B;  3LH2 S;  2MKI A;  1M5V C;  5B0B A;  3K5O A;  1WF1 A;  2FZC B;  3VTI A;  3UNG C;  1HHQ A;  4DN9 A;  4KFB B;  2LEB A;  4NCG A;  4QR1 A;  4W92 B;  3QZ7 A;  1DQ9 A;  3RBE A;  2W4P A;  3RG6 A;  2JEG A;  4KR0 B;  1V6H A;  2WSC C;  2DNN A;  5D4N A;  1U09 A;  1I3O B;  1QY7 A;  4XAK A;  5K14 A;  5C25 A;  4C8K A;  3VV2 B;  2R7R A;  3FEZ A;  3E8O A;  4JI4 F;  4Y00 A;  1WG4 A;  2F4F A;  3KNG A;  4NI2 A;  3BQ1 A;  2C3O A;  1UVM A;  2FLO A;  2NSB A;  5FD1 A;  3FQK A;  1N88 A;  4LF4 J;  2QA4 G;  2OHD A;  4EYI B;  4A8Y A;  3DLL Q;  1MN9 A;  1UVK A;  2MKH A;  1LW0 B;  1M1K T;  4LRE A;  1CC7 A;  2ZOG A;  5ITH A;  3B4D A;  2D9P A;  3SCI E;  3I4P A;  2H48 B;  4MKA A;  4QR2 A;  3NNC A;  2P6T A;  5HAN A;  5KT4 A;  3GON A;  3R5G A;  3GR0 A;  3DRS B;  3FRZ A;  3PNI A;  4DSE A;  5KOX A;  2CWK A;  3TI0 A;  1N34 F;  3MUT P;  4FYX B;  2AYM A;  3BPD A;  1S1W A;  3PRV A;  3HDS A;  3CJ5 A;  4DV4 J;  1GT8 A;  2BE2 B;  5DM6 Q;  2L9D A;  1SV5 A;  2F5G A;  2JC1 A;  1KLM B;  4I68 A;  2VZ9 A;  1KDN A;  1CJV A;  1N56 A;  4UUW A;  1T94 A;  4WK1 A;  4P7T A;  1VQ4 S;  2Z58 B;  2JFD A;  1RTJ A;  1U1K A;  3CD7 A;  1LWX A;  2CRL A;  1FRX A;  1VQY A;  2UUB F;  2EFO A;  1R8C A;  2MJN A;  2V8G A;  1ZYQ A;  2OO4 A;  1LXJ A;  3C15 B;  1JXE A;  4A8F A;  3MXH P;  2VQE J;  4TYA A;  2DNH A;  1NHV A;  1RB0 A;  1T9T A;  1WKJ A;  3GCW P;  5LSO A;  3CMA S;  1X0F A;  2HQI A;  2NYH A;  4DL2 A;  3SDE A;  1Y0H A;  1R8A A;  1Z2Z A;  3AJ2 A;  2YWH A;  3KLF B;  2W9B A;  3JSB A;  4YS2 A;  1T03 A;  3IA0 A;  3QNW B;  1R43 A;  2C2R A;  4OX7 A;  4WKY A;  4URQ U;  3OQ2 A;  3ILL A;  2C1E B;  1CUL A;  3FMW A;  3SXL A;  2AQ4 A;  1UZD A;  2R3V A;  4ENO A;  4JBC A;  1SL0 A;  4DCO B;  4RNF A;  4KY3 A;  1RLC L;  2HFN A;  2ZJP Q;  4F50 A;  2PA3 A;  3BGR A;  3SMZ A;  2CJX B;  4ZN3 A;  3G9C A;  2VC1 A;  2OSQ A;  2AEF A;  1NKE A;  3H98 A;  3MFH A;  3PJX A;  2GFF A;  2OPP A;  4ITS A;  2AYE A;  4ZVU B;  4EZ6 A;  1SQF A;  1YSJ A;  2J0S D;  1REV A;  1IJE B;  1L3K A;  1T3O A;  1N36 F;  2V2V A;  2X1F A;  1IKW A;  1U6B A;  1ZZF A;  2OEJ A;  4WFB Q;  4Y2M A;  1HWI A;  2BRK A;  2DKO B;  4YN3 B;  2C42 A;  1Q16 B;  3GIR A;  5JXS A;  3MOJ B;  3P96 A;  1FKP B;  4QIE A;  4OHW A;  1WC4 A;  5ETP A;  4M5M A;  3NGD A;  4R5P A;  1WOP A;  3ETM A;  3CJ8 A;  4Y2I A;  4QIG A;  1JLB A;  4UUX A;  3CJK A;  2ZUG A;  3MM6 B;  3A12 A;  1ZTW A;  1YJN S;  5IXU A;  2DHA A;  5LOQ A;  4EO8 A;  2C22 A;  4OHV A;  3UCU P;  2XS7 A;  3MM5 B;  4JI8 F;  4MAK A;  4NZ0 A;  2IHR 1;  5IM0 A;  3M8Z A;  1X9S A;  4AE5 A;  4CTA A;  5HMX A;  3K17 A;  1YJ7 A;  4OYM A;  4ZP6 A;  1RHK B;  2R9L A;  4DSI A;  3CD0 A;  1WNE A;  3UVJ A;  5HRO A;  3EGZ A;  2RQM A;  2IMW P;  1PJ5 A;  1U0H A;  4USM A;  2ZH5 A;  4UQT A;  3CC4 S;  1LEO A;  3SV3 A;  2N4C A;  1D9D A;  5C24 A;  3HSJ A;  2DNP A;  3NCR A;  1LFP A;  1P9Q C;  2Y0B B;  4B3R F;  3OL8 A;  4QJV A;  3Q86 A;  1HHS A;  2L48 A;  3CTR A;  4CZC A;  3PW7 A;  2F4V F;  3DLE B;  3T9N A;  1KLM A;  4DL4 A;  4BWJ A;  5J2Q A;  1YI2 S;  1L5U A;  4NX9 A;  3KK3 B;  1JLF A;  3CSK A;  3MOZ A;  2X51 A;  2V50 A;  3QGP A;  3DRY A;  1U1O A;  5LJ3 Y;  1TUG B;  3DKD A;  1QUV A;  4QU7 A;  2U1A A;  3IR6 B;  2FLP A;  1X4G A;  4I64 A;  1S9F A;  2ZKU A;  4OI1 A;  2QA1 A;  3PRB A;  1RAG B;  2J8A A;  1NXI A;  3ISN C;  3RYL A;  2ZH4 A;  2EC2 A;  2PEH A;  2XZT B;  5EGY A;  1B0P A;  3MEG A;  4H4O B;  2BE2 A;  2DNR A;  2W4D A;  5D0E A;  2CNL B;  2DGX A;  1S9E A;  1V3R A;  2ATC B;  5IOL A;  5MLC V;  2VA2 A;  2R7S A;  2OLW A;  2B6A B;  1RKI A;  2P9C A;  1AYE A;  2WK4 A;  3FVY A;  1ZAX A;  8AT1 B;  2OTL S;  2GJ2 A;  4I1T A;  4AL7 A;  5HBM A;  2CPH A;  2QFI A;  2QLJ B;  1WOR A;  2VPZ B;  3MGJ A;  5CZV A;  4KTQ A;  4DR4 J;  1BQN A;  5ETO A;  1M5O C;  5E3A A;  1VQM S;  4M5D A;  2BYC A;  2LU1 A;  4WII A;  5T7L A;  4RL1 A;  4JI1 J;  2DD8 S;  4OX9 J;  3FCV A;  3I31 A;  4XK8 C;  2ASL A;  5U47 A;  4CO2 A;  3KLF A;  4EBD A;  5IWA J;  2R8G A;  4CT8 A;  1H7X A;  1HPZ A;  1SI9 A;  4JI8 J;  5T41 A;  2PA8 D;  3TUJ C;  2B7C B;  2XO7 A;  4EEY A;  3M7V A;  2D9O A;  3OTO J;  2ZZM A;  2PSZ A;  1H72 C;  3B4M A;  3FC9 A;  3MR6 A;  3KK3 A;  4ZMM A;  4G1Q A;  3BSO A;  4IFV A;  2OP5 A;  1RYR A;  1K1Q A;  1WEY A;  2Q6B A;  2MZ1 A;  3POT A;  1NK4 A;  3PW2 A;  1NKB A;  4C8Z A;  5DJB A;  1ZBT A;  3KG1 A;  3OTE A;  3BSN A;  5IT4 A;  2DBB A;  1S1U B;  2OD4 A;  4OJ1 A;  4CLY A;  3Q2S C;  4PQA A;  1NJX A;  3THP A;  4QCL A;  1SH3 A;  3DRR A;  1U2F A;  4E0D A;  4MK8 A;  2CG4 A;  5C42 A;  2LLZ A;  3KJF B;  3DDN A;  1IBM J;  1IM6 A;  1VLY A;  4YHH J;  4QW9 A;  3Q2T C;  3R2C J;  5IM0 B;  3R9L A;  1U7L A;  1VK3 A;  3ILJ A;  1NSQ A;  4DV6 J;  1R0B G;  3V6H A;  4K5R A;  4AT1 B;  2RH3 A;  3V2U C;  4QPX A;  4IQM A;  4CDI A;  2Z8Q A;  4USK A;  3HPO A;  1F2H A;  4Y2K A;  5GME A;  2V4J A;  4DPU A;  4ZOS A;  1S7H A;  3SQG B;  1JLC A;  4R5P B;  1PC5 A;  3CWJ A;  4PQU B;  4LSZ B;  3MEC B;  5DGA A;  3LAK A;  2B9E A;  2BMB A;  3QGH A;  5C7P A;  1RHU B;  4I7F A;  4Y34 A;  2M52 A;  4EGL A;  2QFJ A;  3T5L A;  4FBU A;  2CNK B;  4RJV A;  5H1S V;  4PRF A;  1FKO B;  4R8U A;  1GMW D;  4OMF G;  1TMJ A;  1PBA A;  1SPB P;  2A3J A;  2PT0 A;  3FCH A;  4USI A;  4ES3 A;  2YNH A;  3CVK A;  4WFN Q;  1S10 A;  3I96 A;  3MMJ A;  3MPU B;  3E3X A;  2BJ3 A;  2C2D A;  1KQS R;  4OLO A;  4DL6 A;  4YB1 P;  4XDD A;  4DF4 A;  1GXU A;  1R8B A;  5A8R A;  5A0Y B;  1WI6 A;  3FGV A;  3BDE A;  2FQQ B;  2VDH A;  2D1C A;  4RO0 A;  2C3Y A;  2XZD B;  3H90 A;  4QIW D;  4O3O A;  1YQH A;  2CJA A;  4F4Y A;  3MM7 B;  3AHP A;  4A8S A;  4JI5 F;  2HNZ A;  3M8P B;  1FEE A;  3CPW R;  3L7U A;  4NPO A;  2PI4 A;  2HHS A;  1CEZ A;  1RUS A;  3M6X A;  2JZ5 A;  4BCA A;  2UXC J;  3DOL B;  1LXN A;  4L3N A;  4ZLL A;  5EX0 A;  4HTI A;  4JI7 J;  3HHE A;  1UMJ A;  3KDN A;  4K8R A;  3I82 A;  2YNI B;  1KQK A;  5K8N A;  2OEK A;  1LNQ A;  1UCN A;  4TN2 A;  2PO4 A;  3IRX B;  4F04 B;  2J6U A;  3UR3 C;  4M94 A;  3K8V A;  3NWG A;  3UVJ B;  3BPS P;  2ZM6 J;  1FVS A;  2VDI A;  2G4B A;  2GAG C;  1RAD B;  1S1X B;  5ETQ A;  3HVR A;  1YTY A;  5GAG I;  2FDN A;  1KR4 A;  4M8L A;  1E6Y B;  5F8L A;  4U67 Q;  5L1K A;  1QLN A;  1HPZ B;  1HNI B;  2E5I A;  2M9K A;  4RZR A;  3QT5 A;  1KWM A;  4C8N A;  1X4E A;  2GO8 A;  2VBZ A;  4CO5 A;  2MHE A;  4FYD A;  1X5O A;  5F3Z A;  4GVB B;  3PZP A;  4NML A;  1XNR F;  1KP6 A;  1YZ7 A;  1VC6 A;  3D7S B;  1K0V A;  4KB7 A;  3LP1 A;  2KZZ A;  1X4H A;  1TL7 B;  1XMB A;  3Q8Q B;  5J2P B;  1A0O B;  4EFA C;  4DV4 F;  5A0Y A;  4M5K A;  2F7V A;  1T9U A;  4QU6 A;  5B0E A;  4DV3 F;  4PWD A;  4IFY A;  3WC2 A;  1QSL A;  3F73 A;  2UXB J;  4HEA 9;  3OPK A;  4A8O A;  5EDW A;  3D0G E;  4NAS A;  2XGQ A;  4OZL A;  5GAE U;  1OQ6 A;  2PDA A;  1U1Q A;  3W8G A;  4NI2 B;  3ZFV A;  4Z7C A;  3IGN A;  3KJQ B;  1HYS A;  2DHX A;  5IT0 A;  5HL7 Q;  2BRL A;  5IQ6 A;  3W8P A;  3PYG A;  3UQS A;  1AW0 A;  4DDF A;  2LXU A;  1HBN B;  2NPI A;  4LBH A;  4CT9 A;  1Q7Y T;  4DR7 J;  1DFD A;  3L7O A;  4HDH A;  3AOA A;  4NCG B;  1J27 A;  2WHO A;  2R2R A;  3PX6 A;  5J2N B;  1HR0 J;  1RHM B;  3ENA A;  3I9V 9;  1C1B A;  5KFK A;  1VQO S;  1REG X;  1FEH A;  1X60 A;  4HHJ A;  3AD8 C;  1TP7 A;  2HRY A;  1N5T A;  1N33 J;  4TQR A;  1OY8 A;  2YKO A;  2CUY A;  2ZC4 A;  2BQU A;  4K0K F;  4JV5 F;  4F25 A;  4WZM A;  1XR6 A;  2V5H G;  1SJR A;  2CAJ A;  2M8H A;  3LAN A;  4F3Q A;  2N3L A;  4OI3 A;  2KDO A;  3IG1 A;  3KG4 A;  3A13 A;  1V9O A;  4FN5 A;  2VOO A;  2FY1 A;  1FJ7 A;  2GCF A;  3WDO A;  4QIV A;  2KFY A;  3D1H A;  3PAC A;  4OZ3 A;  1N36 J;  1N52 B;  1RYS A;  4IFY B;  2UVV A;  2ADB A;  4LF9 J;  3P3D A;  5KFT A;  3M6V A;  1RHJ B;  1XNR J;  2K1R A;  1KTV A;  4GO7 X;  3HJV A;  2ALZ A;  4H4K A;  1IM4 A;  4NEZ A;  1FJG J;  1MU2 A;  3GMG A;  2VKR A;  3L7P A;  2HFZ A;  4I56 A;  3T9Z A;  4KGM A;  1BQM B;  4AQY F;  1EKS A;  4X62 F;  4DV5 F;  3T5K A;  1HYS B;  1NH8 A;  4M5H A;  1U0S A;  2V67 A;  3OBI A;  1X4A A;  3C46 A;  3NXZ A;  5G0R A;  4OZ5 A;  2FVQ A;  2BX6 A;  4RNN A;  3VHQ A;  1J5E F;  3FBC A;  3GJR B;  3M8W A;  2KXF A;  3SI8 A;  5LSL A;  3TZX A;  1F60 B;  3JAM U;  3VAH A;  4CQ1 A;  4P71 A;  2Z0G A;  3A1Y G;  3R7S B;  4PG7 A;  2VF3 A;  4BDP A;  3BR8 A;  2WRM A;  5KG5 A;  1OSC A;  4EBC A;  1UKU A;  2D69 A;  3LA0 A;  1GTH A;  1OWX A;  2EKY A;  2HKE A;  3AB2 B;  5HVH A;  4DS5 A;  3I0R B;  1UFL A;  2ZIT A;  2GAH C;  1ZAW A;  1WOS A;  1X4B A;  2L08 A;  2R8J A;  2GJI A;  4ZVS B;  3PKM A;  4MYU A;  2CQ1 A;  1KQG B;  3EDR B;  2CQ4 A;  4N8N A;  6FD1 A;  2DNY A;  2E9R X;  3GIL A;  3BV8 A;  3Q8U A;  3DLG A;  1H74 A;  2DK2 A;  3MM5 A;  3NAH A;  3TR5 A;  5D4P A;  1IBK J;  4PUO A;  3Q83 A;  3R97 A;  4CM2 A;  5CZX A;  2AEM A;  3KLI A;  2CG8 A;  3W65 A;  1S6Q A;  4UT4 A;  5K8M A;  1RTZ A;  3N01 A;  2BJ9 A;  1X5T A;  1T05 B;  2M8D B;  1S57 A;  3G87 A;  2RU3 A;  4N47 A;  4J9R A;  4YB7 A;  4AUK A;  4PCQ A;  1BMQ B;  5DRK A;  5B0D A;  4DWI A;  1IBL F;  4JI6 J;  1V3S A;  1EET B;  1WC5 A;  2E1A A;  3MWB A;  2KVI A;  2R7Q A;  1TL1 B;  3LP0 A;  4FZV A;  4DMZ A;  4WFA Q;  1M90 T;  1KFS A;  3CC7 S;  1UVN A;  1CUL B;  4DR4 F;  4WKR A;  4P73 A;  3K2Y A;  4J9L A;  1E6V A;  2W7A A;  4U96 A;  3BH6 B;  2GGP A;  5KFR A;  1FDD A;  4RWX A;  1UEU A;  2NLW A;  2XSF A;  3D6M B;  5DG8 A;  3M8S A;  3KHR A;  2VQF F;  2OUG A;  2OSR A;  2MHN A;  5J2P A;  1FRM A;  3BKT A;  1I6J A;  3GQC A;  4MKV A;  2KVQ E;  1FI4 A;  1NLK L;  3J7A N;  3VAM A;  3PG9 A;  1UVL A;  1RHQ B;  2IRU A;  1BD6 A;  2WSE C;  3G96 A;  1C0T B;  4RU2 A;  2K06 A;  4NYP A;  3BN7 A;  3GCX P;  2Z2M A;  4LSL A;  3TUZ C;  4O3S A;  3UD5 A;  1T02 A;  4C3L A;  4DPO A;  1D9F A;  3MZI A;  1NHU A;  3QZ8 A;  4ZPD A;  1I1G A;  3CC2 S;  1SL1 A;  1YZ6 A;  3FSX A;  1FA0 A;  1GK8 A;  4C3M A;  1RT5 A;  3MTJ A;  3OLB A;  2QYC A;  4DBQ A;  1RT3 B;  3QAT A;  5DGB A;  3KJV A;  3VAF A;  2JOQ A;  2NR0 A;  3G82 B;  4DR5 J;  2OGU A;  1R31 A;  1RT4 B;  2XHC A;  3IP0 A;  2BR0 A;  3RUB L;  1FTR A;  2LA6 A;  1X5S A;  5KFZ A;  1KHW A;  4RW8 A;  4X4P A;  1U26 A;  4IG3 B;  2A10 A;  2DH7 A;  5I42 A;  2XQC A;  5HLF B;  1WTB A;  3QWP A;  4WPA A;  2OPR B;  1FDB A;  2GIR A;  2R8K A;  2JLE A;  3QJJ A;  4HDG A;  3GV7 B;  4X4U A;  2QTW A;  2O66 A;  2XUL A;  4X4N A;  1VS3 A;  2G1H A;  5JJB A;  1RWU A;  2JC0 A;  3UI3 A;  2AGP A;  3PXG a;  3HHK A;  1S0V A;  4X4V A;  3SCL E;  2VB6 A;  4NLD A;  2CQ0 A;  5F8I A;  4IDK A;  5HP1 A;  2B9W A;  2QIF A;  3WBZ A;  5D77 A;  2PGC A;  1YLX A;  4RWW A;  3RTV A;  1D09 B;  2F8M A;  2CPJ A;  4P9S A;  1GH8 A;  1V5I B;  1LKZ A;  4GKK J;  4NRU A;  2IDE A;  2YKN B;  3RRK A;  3GIM A;  3C8Y A;  1OS5 A;  2ZVS A;  3EGN A;  2OTJ S;  1Y7P A;  4DEZ A;  2R7V A;  2ILZ A;  4Q5V A;  3ZTQ A;  2KFZ A;  2W2M P;  5A8K B;  5IC6 B;  3H0P A;  4CI0 B;  1JJ2 R;  1NJW A;  4IH6 A;  5EWE A;  3QJL A;  3D5M A;  4P75 A;  1RBA A;  1NK9 A;  2Q79 A;  4F7V A;  4ILM A;  1JLC B;  3DFE A;  3PTW A;  5CCL A;  3DM2 B;  1WC0 A;  2UZA A;  2YWW A;  4KAI A;  3BQ2 A;  4WXO A;  2FJB B;  4ECZ A;  4JI7 F;  2Y1L B;  1S9E B;  4FYY B;  5CD4 A;  3O2I A;  2B43 A;  1ZM4 A;  3ILO A;  4DLG A;  2IJR A;  1M1G A;  3C14 B;  1KTQ A;  2DGV A;  1IR0 A;  3W5X A;  4CLF A;  4D3G A;  3PV8 A;  3R5C A;  2DGT A;  4UOF A;  4IG3 A;  1GFW B;  1I94 J;  3EGV A;  1KS2 A;  3Q24 A;  1HIY A;  1M5S A;  2W2N P;  4PEO A;  2OPQ B;  4F0H A;  1NEE A;  3FFI B;  4RW6 A;  3T1A A;  2OKQ A;  1HNX J;  3HVA A;  2APO A;  2MZT A;  3NGR A;  4R25 A;  5KT6 A;  2HFO A;  1FKA F;  1ULR A;  2CPD A;  2GVD A;  4PXB A;  3V4M A;  4CH7 A;  4K4W A;  4ECY A;  1KOO A;  2QMU B;  1CBK A;  2BKO A;  2WOM B;  2PN6 A;  3TAM B;  4DPT A;  3ZTR A;  5KFN A;  4IR9 A;  2LQB A;  2IJF A;  5F9N A;  1N6Q A;  2D74 B;  2V94 A;  3AA9 A;  3HFZ B;  4LSL B;  2NXJ A;  3K8W A;  3TZW A;  4X66 J;  5LXY A;  2ZJR Q;  3CCJ S;  1L3U A;  1X7V A;  3DOL A;  5CHC B;  1TFY A;  1U8W A;  1HNV B;  3VQS A;  1JX4 A;  1GMW A;  4FYV B;  3LTO A;  4ED4 A;  3CCZ A;  2NRE A;  3MEK A;  3PY8 A;  4WU2 A;  2JEI A;  2HNY A;  4ED0 A;  3JTO A;  1VIS A;  3V6K A;  1N54 B;  2B5J A;  2J9D A;  2F9D A;  1H2T Z;  2PD1 A;  2PFD A;  5B7W A;  4OHY A;  5K20 B;  4F4W A;  1CJU B;  3PIP Q;  3L3C A;  1SJ3 P;  4FXD A;  3UCZ P;  1G1X A;  2LDY A;  1C4C A;  4OYI A;  2G2O A;  2AGQ A;  4QYZ K;  2XS5 A;  1NRK A;  2M0G B;  2CPE A;  3WC0 A;  1HWJ A;  4LF8 J;  1YIT S;  1EZZ B;  2OPR A;  4NXN F;  3EYZ A;  3KWM A;  3LW5 C;  4LFA J;  3FUY A;  4DU7 A;  5ETM A;  4F4X A;  2PFF B;  1SKU B;  3BN4 A;  4ECT A;  1RBO B;  2Y1R I;  1EHW A;  4C2M A;  3K5N A;  1R0A B;  2KTQ A;  4PXD A;  4DQP A;  4QW8 A;  3JYT A;  1WC3 A;  2QE5 A;  4IDK B;  5I3P A;  3ICL A;  2CJQ A;  1VBZ A;  1S12 A;  2LYV A;  1C1C A;  1XIQ A;  2HHX A;  1Q79 A;  4QWD A;  4IRC A;  2BM0 A;  1F5C A;  1JNZ B;  3OR1 A;  2OPP B;  2XC9 A;  4GKJ F;  4ZCI A;  3OL9 A;  4PWD B;  3IWN C;  4WCE Q;  1VQS A;  1WG1 A;  5B08 A;  4JV5 J;  2NSC A;  1ARO P;  1F9H A;  5IC4 B;  4B3M J;  4DV3 J;  1QSY A;  1WJ9 A;  3ITH B;  4LVO P;  3ZNU A;  1R7I A;  2MZQ A;  5CYJ A;  4A8Q A;  2CZV C;  2ZDP A;  5HVG A;  4DPW A;  2ILY A;  3TJ9 A;  1YIJ S;  2MQO A;  2DR5 A;  2BAC A;  4NXM J;  2EBG A;  2JNJ A;  4ICL A;  2K8G A;  3ILI A;  3NEK A;  1FDN A;  3JQK A;  2CYY A;  4U8V A;  4RUH A;  4HT5 A;  2AU0 A;  4F02 A;  2HNZ B;  1NPK A;  1RT1 B;  2CQG A;  3M8P A;  4KGX B;  1URN A;  2VFV A;  3CNQ P;  1ZM3 A;  3BF4 A;  3MFI A;  5HMY A;  4LFC F;  2WVD A;  4NA1 A;  2ZZN A;  2KM8 B;  3CMQ A;  2WBR A;  4Q2L A;  4LF7 F;  3ZTS A;  4DG1 A;  2G0C A;  4WP9 A;  1B70 B;  3N4W A;  2OPQ A;  4C98 A;  2BBE A;  1HNW J;  3U7J A;  2MYF A;  3R3T A;  2F65 A;  3ENQ A;  3KLG A;  2W9A A;  2ZD1 A;  3MAQ A;  4HT7 A;  1Y3J A;  4QYZ J;  1VC0 A;  1DRZ A;  2AD9 A;  1WC1 A;  4EBE A;  2JJ4 D;  4IQX A;  2JVO A;  4O3P A;  2XMW A;  4R0E A;  2CJK A;  1JXL A;  4FPR A;  1S9G B;  2ZH1 A;  2N82 B;  1WDD A;  1NSK L;  2V69 A;  4H4M A;  2R4F A;  2FUG 9;  3QIP A;  5KFY A;  2PMZ D;  3JSM B;  2JEF A;  4ECV A;  2B4V A;  2UVR A;  3EJM A;  4B9T A;  1HMV B;  4ZCK A;  1XBW A;  2KXN B;  1HW9 A;  2P2C B;  3OW2 R;  4LBP A;  4YB5 A;  3HKW A;  1SH0 A;  1NK5 A;  1KKH A;  3IBW A;  2KHC A;  1GEH A;  4UTG A;  3R8Y A;  1XMO J;  5DDO C;  1YRU A;  2LDI A;  7AT1 B;  4LF6 F;  2GVD B;  1QE1 A;  3PHT A;  5J1P A;  2N3O A;  4ICL B;  3P8B B;  4YDD B;  1UEV A;  4F3M A;  4F8R A;  1PBU A;  3IM8 A;  3GLJ A;  4WTY A;  2MQP A;  1RAC B;  3FQL A;  3UWT A;  3RR7 A;  1N5S A;  2F8E X;  4AND A;  4G1I A;  1S6O A;  2K3I A;  3FBB A;  4RR5 A;  1T0T V;  1QTM A;  2RQC A;  3KUH A;  3BH7 B;  3JTN A;  2EK6 A;  5K8P A;  3MCO A;  4ZPB A;  4JI2 F;  4EZ9 A;  2GQ2 A;  1ITP A;  2XSJ A;  3UN5 A;  1FRH A;  2UUA J;  4IH7 A;  4KKO A;  5IZH A;  1ZPW X;  4O4G A;  4RU9 A;  4TU8 A;  2MQL A;  5L1I A;  2NQP A;  4M95 A;  4OYA A;  1HI0 P;  2W9C B;  1O0P A;  2HAI A;  3MPY A;  2LCW A;  2P8I A;  1SJ4 P;  1LQ9 A;  3CO9 A;  4C11 B;  2NCK L;  9RUB A;  1U1R A;  4B3O B;  1S9G A;  4MIW A;  3ITH A;  1FE4 A;  1XQI A;  4RLE A;  4ZJO A;  1SQE A;  1VBY A;  2MKY A;  2G0I A;  2G2Z A;  1S7I A;  1AZS A;  4NLR A;  1IXK A;  1S99 A;  2J5A A;  3M2U B;  4ED3 A;  1RTH A;  3MED B;  1TV6 A;  3MMB A;  1FWP A;  3OUY A;  4PKD B;  1C1C B;  3CCS S;  1XNQ F;  2H1Y A;  2RE1 A;  4KHR A;  2B5J B;  3Q8P B;  3HFK A;  3FSI A;  4BS2 A;  4NA3 A;  3I55 S;  2B4O A;  2J6T A;  2HND B;  1FRI A;  5E33 A;  4NLG A;  1K8A T;  3H4B A;  1R8P A;  5EWG A;  4TY9 A;  4DZD A;  1NCL A;  1X0P A;  1GXL A;  5FII A;  4H4O A;  3W3S A;  2FTR A;  2K1R B;  2ACM A;  2Q1L A;  4MIA A;  5KT3 A;  1N5Y B;  2HHU A;  2BQR A;  1KOH A;  1D8Y A;  4LMZ A;  1S72 S;  3OTD A;  2GML A;  4YOE A;  4H54 A;  3W2V A;  3R7N B;  4DR2 J;  3KDO A;  1YJ9 S;  2IA6 A;  2MKC A;  4LF4 F;  4PUO B;  2BM1 A;  2YNF B;  4JB8 B;  2X1B A;  3HP6 A;  1N5V A;  3A8E A;  3QT7 A;  5KFP A;  1P9Y A;  3ISN D;  2X1G A;  4X64 J;  3KHL A;  3QSY B;  2HQC A;  1KFD A;  4WJB A;  2YWK A;  3TZY A;  3GV8 B;  4EYH B;  1Q81 T;  4JV2 A;  4NLW A;  3VGU A;  5D6G A;  2DT9 A;  1BXN A;  4YUD A;  4ZVT B;  3M1V B;  4DQQ A;  2EW9 A;  3IGV A;  2IIH A;  1RCO B;  4WK3 A;  5KFG A;  3GIJ A;  5KFD A;  4OI4 A;  4J9S A;  3V6D A;  3IWX A;  2ZWP A;  3V81 A;  4OI2 A;  5LT5 A;  2QJ3 A;  4HYK A;  1JLG A;  2K7K A;  4P2X A;  4W98 A;  4X65 J;  1E6V B;  4MKY A;  3JSY A;  1NSA A;  3Q8V A;  3QGI A;  3W1Y C;  3ZNJ 1;  1CSJ A;  2C2N A;  3GPA A;  1YJV A;  3NBP A;  4ELU A;  4KH0 B;  3HZG A;  4L73 A;  1APS A;  4OYB A;  3RBD A;  3NKY A;  2QX0 A;  5L9X A;  1NK6 A;  4GMK A;  2YBV A;  1TVR B;  4LRB A;  4X4O A;  3GYG A;  5L39 A;  2LP4 A;  3FNN A;  3R7B B;  3JSM A;  1URR A;  2HND A;  4Q8E A;  2DCL A;  1NSP A;  3CJ3 A;  4HAC A;  4DR3 F;  5F8M A;  1VHF A;  2WCX A;  4WP8 A;  2RU9 A;  5KT5 A;  3HHL A;  1SIZ A;  4YHH F;  2DNO A;  3SSQ A;  4DPX A;  1XNQ J;  3OJU A;  3NNH A;  2GHW A;  1NZ8 A;  4ALZ A;  2OPS A;  3CDE A;  3DRS A;  5KFS A;  2VBX A;  2HFV A;  3BKF A;  2RDD A;  4M5G A;  4NLS A;  3KLH A;  4PZV A;  5IWA F;  2R2U A;  4DQS A;  4PQU A;  1RT5 B;  3B8H A;  2YKM B;  5KFQ A;  2JRS A;  3TWZ A;  4CO4 A;  1VOM A;  3TUP A;  2HQD A;  2YTC A;  3ISZ A;  4DS4 A;  1VQ8 S;  3OR2 A;  1CC8 A;  4OV6 A;  4ZPV R;  2V4R A;  1X9W A;  3B82 A;  4FNI A;  3UPF A;  2VG6 A;  5AXN A;  2KHD A;  4IH5 A;  4IG0 A;  2GV1 A;  2RHQ B;  1FKO A;  3H2U B;  3N9U C;  3G6X A;  2AJ4 A;  2KM8 C;  3UO0 A;  3THV A;  4C8Y A;  3BRE A;  1OPI A;  3N6N A;  5EUH A;  4F67 A;  3UD4 P;  1U1M A;  4EWT A;  3J7Z T;  1IKY B;  5KAK A;  4O4G B;  1I94 F;  2FJX A;  4WXW A;  3TEH B;  3I5B A;  2RML A;  1FNO A;  4I6Y A;  1H73 A;  1DQ8 A;  2DO0 A;  2HAF A;  2OMO A;  2P9E A;  4TU9 A;  4DFK A;  2MDA A;  4ED5 A;  2QL9 B;  3HK2 A;  1H3D A;  2BOP A;  1HI8 A;  3I0S B;  1WKK A;  4WYL A;  1JKH A;  5J2M A;  1S0N A;  4UZB A;  3BSC A;  3MM6 A;  1SC1 B;  3QPI A;  4LRA A;  5KFI A;  4UF4 A;  2V6A A;  1YWX A;  2J0X A;  5KFV A;  3BQ0 A;  3C6U A;  4ZDN A;  2C3P A;  1RTD A;  5CYM B;  3R5D A;  3RBX A;  4K4Z A;  4CTA B;  2BDP A;  4JI6 F;  1UTA A;  4KHP J;  3TJA A;  3TNV A;  3PR5 B;  3G6Y A;  2FVS A;  1ZS6 A;  2BJ7 A;  2DNG A;  4NMX A;  1BUX A;  3MAH A;  2F3J A;  4DJB A;  2JHE A;  1T9V A;  1TR0 A;  2DXD A;  2R2S A;  1TL3 A;  1SJQ A;  4DR3 J;  4YEA A;  5A2Q Y;  1NDP A;  4M63 A;  1N5Q A;  3OFG A;  1JLQ B;  2CQ2 A;  3HUL A;  1FWL A;  2DR7 A;  4ZPT R;  2QRR A;  3E01 A;  4AL5 A;  3N6M A;  1SC6 A;  2UUW A;  3GJT B;  3SFG A;  2Z4P A;  5GVQ A;  1Q82 T;  4NCA A;  3UW1 A;  1NJZ A;  2MMY A;  2QMX A;  1RGV A;  1NB2 A;  3CE8 A;  1UJ5 A;  3D0H E;  4M5N A;  4ZVF A;  5E3P A;  1K0T A;  3PO5 A;  1FE0 A;  3HHD A;  4L6V 3;  2VA3 A;  1LW2 B;  4A8W A;  4C9D A;  1S1V B;  1NND A;  3ETO A;  3N5B A;  3ZZU A;  1NHK L;  4CH0 S;  4OV1 A;  3DC2 A;  1VRQ C;  3D3B J;  3SFU A;  2HWI A;  1JLA B;  1WEZ A;  2V2K A;  2YVS A;  3HMJ G;  3ADA C;  2GW8 A;  3EVO A;  4ZCL A;  5LJ5 Y;  2FYX A;  1P1T A;  2V0N A;  3VF0 B;  7FDR A;  5DLF A;  1HNV A;  1VBK A;  1VRT A;  3AXK A;  3V4I A;  1X4C A;  4I2P B;  1IJF B;  2RRA A;  1FNX H;  4ERD A;  2RB7 A;  1HQ2 A;  3K0J A;  3TAR A;  4LFC J;  5AJ3 F;  1RK8 A;  1U8S A;  3Q0A A;  3C16 B;  1B4S A;  4W90 B;  4NRT A;  2IFX A;  2I38 A;  3HJF A;  3P5B P;  2JVR A;  5D78 A;  3K57 A;  4M5J A;  3EVW A;  3NY0 A;  3OV7 A;  3VQT A;  1HR0 F;  1NK8 A;  1WWH A;  2HZC A;  3GE9 A;  5GAH I;  3V6D B;  2ZHB A;  1HD1 A;  1ACM B;  4WE1 B;  3DYA B;  4LF2 A;  4FF3 A;  1QD1 A;  2DY1 A;  2D3O 1;  4O3R A;  3BBC A;  2IAJ B;  4KPY A;  1S5Z A;  3DI6 A;  4WP3 A;  1YKW A;  1M0S A;  3O3L A;  1VLO A;  2AZ3 A;  2BXJ A;  4XO0 A;  3J7Y I;  2ZOM A;  2EC0 A;  3M6W A;  2XMV A;  2GZO A;  5DDR C;  1H38 A;  4B3S J;  2YWF A;  4USV A;  1RAH B;  2B0G A;  1CG2 A;  1YG0 A;  1VDH A;  3R1H A;  2W8L A;  2XY7 A;  3TA0 A;  4TNO A;  2Y8Y A;  3TZZ A;  2AX0 A;  3MR2 A;  2HNY B;  1F3F A;  1I51 B;  3HHL B;  1XC9 A;  2QSW A;  2ZBR A;  4DR1 J;  4O0I A;  2FHJ D;  2PEB A;  3LPY A;  3NS5 A;  4ILR A;  4DL7 A;  3OL7 A;  3QYY A;  4DCP B;  2A0F B;  1BE4 A;  2AP6 A;  1CJU A;  2DJW A;  4Q0B B;  2F1F A;  1LWF A;  4JI1 F;  4NLQ A;  4ECS A;  3M30 A;  2RUS A;  5K14 B;  3AXM A;  3AT1 B;  2HQG A;  5H9F J;  5C25 B;  3FEY B;  4Q2M A;  4KV8 B;  4O3N A;  4YR2 A;  1IKV A;  1U2R A;  3B6B A;  2HFS A;  3P4U B;  3W63 A;  2CNN B;  4EU0 A;  1X4D A;  3M9N B;  1O5J A;  4RUB A;  4TY8 A;  2EXU A;  5L1J A;  2NZC A;  3BBB A;  4OZ2 A;  3SSS A;  1JJC B;  4UOC A;  3M05 A;  5F0U A;  1TKZ A;  4JI2 J;  4ETX A;  5DO2 A;  5HQM A;  1U6Z A;  1V3Z A;  1BGX T;  1VHI A;  1DLO B;  4QYR A;  5F9L A;  2CIM A;  4RUC A;  4Q43 A;  3O6Q A;  3ZZP A;  2HK3 A;  4DV7 F;  1RLD A;  2DPJ A;  2YNG B;  3A8I A;  2B51 A;  4J9N A;  2MZR A;  1S48 A;  4HLB A;  3CJ2 A;  4AXJ A;  3H5S A;  5IV4 A;  2WVB A;  2F9J A;  1HI1 A;  2CPI A;  4L74 A;  3BS9 A;  2IVF B;  2B56 A;  3K5P A;  3I5A A;  2KB2 A;  4WFY A;  1U4B A;  4I69 A;  3CD6 S;  4N77 A;  4DX5 A;  3NL0 A;  4HHU A;  5KTQ A;  1CJV B;  4DPY A;  4DL3 A;  5F8H A;  5F41 A;  2MQQ A;  4G3I A;  4IFV B;  1PIL A;  1O51 A;  4Y0F A;  1NJY A;  1DUR A;  1OYE A;  2J0W A;  2ACY A;  2WW8 A;  2XMJ A;  5BYR A;  1T9X A;  3LGH A;  4ZPC A;  3IR7 B;  4ZJL A;  5DDQ C;  5GAD I;  4ZIV A;  4NE9 C;  2UXD J;  1S6P A;  2YY3 A;  1XWL A;  2EBE A;  4TVA B;  4DU8 A;  5GMD A;  2ZJQ Q;  4B9M A;  5M2R A;  2ZUA A;  2ZC3 A;  4DXL A;  2CQ3 A;  2QN6 B;  2YWE A;  3MI7 X;  4NLY A;  4ZVP B;  1OQ3 A;  3MUR P;  3MMA A;  2YNH B;  9ATC B;  3GSI A;  4RNO A;  2YQ0 A;  2EEY A;  2VBW A;  2FJA B;  3Q89 A;  4I2Q A;  3H4D A;  1NZA A;  2MY7 A;  4DV0 J;  3E51 A;  5FJ4 A;  2C3U A;  1HWL A;  2HIY A;  4WE1 A;  1ZA2 B;  3G8S A;  3KLG B;  4WF9 Q;  3CJR A;  1IBL J;  2E5L F;  2C2M B;  2V4J B;  1YK9 A;  3QRQ A;  3TRG A;  1DAR A;  1U6F A;  5KG0 A;  2HGN A;  1YDL A;  2IDL A;  1SC4 B;  1WOO A;  2AKW B;  2BVZ A;  1C2P A;  2ZNZ A;  1CS4 B;  3D6F B;  3KJN B;  2I9S A;  3C6T A;  2FC9 A;  2HIQ A;  1TKX B;  3A3N B;  3I6P A;  5KFX A;  2P5V A;  3EXY A;  4C3K A;  3AD9 C;  4HR2 A;  2DEI A;  4JUZ A;  4U7U D;  2EWH A;  2CJB A;  1VQ7 S;  1FNM A;  2EG2 A;  3AOB A;  4Y2C A;  5AXM A;  5HQ8 A;  1YJR A;  1HBM A;  1SQG A;  2H5E A;  1ELO A;  2HVE A;  2RT3 A;  5ETR A;  3THT A;  2C2E A;  2AT1 B;  2A6O A;  2AWZ A;  4L76 A;  2FVP A;  2BUN A;  4TQS A;  2XNQ A;  1WDT A;  4BWM A;  2FJV A;  1S0M A;  2L9N A;  4CP5 A;  1N48 A;  3CJ0 A;  1PO6 A;  1B99 A;  1JMT A;  4JP8 A;  3BB5 A;  2DO4 A;  3AY0 A;  2IC3 B;  2DNZ A;  4LR9 A;  1K47 A;  2W2O P;  2DTJ A;  4RW7 B;  2YNF A;  5E2Q A;  3SSR A;  3W9J A;  2GQC A;  2Q6C A;  2B4U A;  4KV8 A;  3MM8 A;  5HVF A;  5EX3 A;  3C16 A;  2HWT A;  2YKQ A;  3S6E A;  4A8K A;  3ZZZ A;  2K7J A;  1W2I A;  2G13 A;  2PI5 A;  2FJW A;  4WTO B;  1IUJ A;  2BEF A;  4RW4 B;  1N5Y A;  4PG4 A;  1JLE B;  3HKZ D;  4MK9 A;  3PJ9 A;  2P6S A;  2GC8 A;  1TAQ A;  2ZVI A;  1TZ0 A;  2XWX A;  4Y65 A;  5THW A;  4U95 A;  5HRO B;  2OFG X;  2QL7 B;  2I8E A;  4DSK A;  1IKW B;  2E5G A;  1TUW A;  2M4M A;  3NGK A;  2W1B A;  3MEE B;  5ETN A;  5KG2 A;  3E2E A;  4Q0B A;  3S8S A;  4X4T A;  2DY9 A;  1P6T A;  1UWB A;  3J7Y U;  1RAJ A;  1SVD A;  3NOG A;  4K4T A;  1BHN A;  3CME S;  1PSD A;  2DHH A;  2VD3 A;  4TY8 B;  2CPZ A;  3T6B A;  3OVA A;  1KVJ A;  2XY6 A;  5IT9 Y;  2CQH A;  1ZOT A;  3KUG A;  4LIW A;  4LF9 F;  1CPZ A;  1NH7 A;  1TL5 A;  3UDE A;  4IR1 A;  4O44 A;  4FF2 A;  2NXE A;  2O1P A;  3DCA A;  4YDX A;  1KEK A;  3RW6 A;  2CWX A;  2UUC J;  2DGQ A;  4OHX A;  3T41 A;  3EMT A;  1WTF A;  1GMU A;  2LEA A;  1Y9O A;  1UP1 A;  2VFS A;  5DQH A;  3OVS A;  2FVR A;  2IMO A;  1DAX A;  3SQO P;  3BO2 A;  4FS1 A;  3M2R A;  1CVJ A;  5F8G A;  4DX8 H;  2RD5 C;  4OZ1 A;  1PJ7 A;  3D3C J;  3T19 A;  1AT1 B;  3LUY A;  3NLC A;  4LFB J;  5DS7 A;  2CZ4 A;  2ZBQ A;  4RNH A;  3VVT A;  4C97 A;  4QBU A;  3PR4 A;  1T9W A;  4MJK A;  1UVJ A;  1T95 A;  3ZZ0 A;  4QWE A;  2VH7 A;  4C8M A;  2CPX A;  4RW4 A;  2GIF A;  3IO1 A;  4O3Q A;  4ZLN A;  4DUY F;  2BKP A;  1WF0 A;  4ZPA A;  4KHM A;  3JAM Y;  1ZM9 A;  3PEH A;  2VV5 A;  2DGS A;  3HHL D;  3CCQ S;  2HVI A;  2RDI A;  4IRD A;  3MTK A;  3D66 A;  3EM1 A;  3SYZ A;  2DH8 A;  4YB6 A;  3K89 A;  3QT8 A;  3HO1 A;  1LK7 A;  1B0T A;  2QO3 A;  1JB0 C;  4HTJ A;  3H7H B;  5LL6 d;  2BKN A;  3KLH B;  2DR6 A;  3MUM P;  2QEX S;  4CO1 A;  4CNZ A;  1VC5 A;  5D0H A;  5IFM A;  4KGK A;  4ECW A;  1RBL A;  2W25 A;  2G0J A;  1PIE A;  1Q78 A;  2M88 A;  1S76 D;  4ED1 A;  3P5T L;  1PG5 B;  1S4F A;  3DOM A;  2FHK A;  4K7Q A;  3W9H A;  5HMZ A;  3LP2 B;  2BW2 A;  3VWS A;  1VQ6 S;  4ZHR A;  1O6X A;  1UET A;  4L3K A;  3T3F A;  2ADC A;  3CJS A;  5CQG A;  1YVF A;  3FBE A;  4KBI A;  4FXV A;  3MM9 A;  1FXD A;  1FD2 A;  4LVN P;  1QVG R;  5A2Q U;  1ZTT A;  2HQF A;  3GWC A;  5DZ7 A;  5E5N A;  2DRD A;  3TX8 A;  2JL9 A;  1MMN A;  3W5Z A;  4MTP A;  4F36 A;  2E7V A;  2B9Y A;  2V8V A;  3EPG A;  3EPI A;  1SH2 A;  2XNR A;  1B7F A;  3CT9 A;  2ATL A;  1SUQ A;  4A48 A;  3RR8 A;  1Y3K A;  5AJ3 J;  1JK9 B;  4GVL A;  1S4E A;  1TUV A;  1A7G E;  2VC0 A;  3PW0 A;  2HZV A;  4K4V A;  5IV3 A;  4ECQ A;  2MKJ A;  2MSS A;  2WAQ D;  1RAO A;  4KQZ A;  3MM8 B;  3NS7 B;  3H5U A;  3AB4 B;  2CXE A;  3R5B A;  1Y5I B;  1BWV A;  3DRR B;  5DM7 Q;  1XMQ J;  1FX4 A;  4OYP A;  3AQO A;  1G4C A;  3N5F A;  1YX2 A;  3PW5 A;  3KG0 A;  5F8J A;  1VGY A;  2EFP A;  3DU6 A;  3AD7 C;  4J7C A;  2FD2 A;  1RWO B;  2ZKT A;  2Z57 B;  2PE8 A;  1IKY A;  1W25 A;  2J9C A;  4ES2 A;  3KOA A;  2RNE A;  3UE2 A;  3D0I E;  4TU7 A;  1MRO A;  2V34 A;  3RB4 A;  4ECU A;  4B3R J;  1GX5 A;  1VIX A;  5KG4 A;  5CAA A;  1QE1 B;  3HF5 A;  1VRT B;  1TAU A;  1BWE A;  1WC6 A;  2BOA A;  2HS0 A;  2QC3 A;  4I2P A;  2XEX A;  3VZH A;  3MR3 A;  5J1N A;  3SEO A;  2KRR A;  1RZM A;  1L3V A;  1WUU A;  3H42 A;  4CH1 A;  2CAD A;  1PAE X;  1J5O B;  4LBI A;  4DCJ B;  4JV1 A;  2M7S A;  3DHX A;  3I32 A;  2AJQ A;  3QLH A;  3EWG A;  1C0U A;  1QM9 A;  1AB8 A;  2BJ8 A;  1QAI A;  1MWY A;  1HQU A;  2GJF A;  3OLA A;  2J76 E;  2HEK A;  5EWF A;  3D54 A;  3TYT A;  1KVI A;  1MWZ A;  3ZZO A;  3Q22 A;  2J9D E;  1JJH A;  4YP3 A;  2JX2 A;  3NAI A;  3MPD A;  5KFM A;  4LF7 J;  1P27 B;  4PG5 A;  2ZD1 B;  2R7W A;  1S49 A;  4DV1 F;  2R7T A;  5D8H B;  3WX8 A;  2AJ0 A;  3KLE B;  1H2V Z;  1VFJ A;  3DHW C;  2V2Q A;  1L3S A;  2KT3 A;  1M5P C;  4B3M F;  3JSR A;  2MST A;  1MML A;  1MN7 A;  2QLF B;  3DDK A;  3IM9 A;  5FDL B;  4EMD A;  3G8Q A;  3IBF B;  2R7X A;  2IA0 A;  2VPW B;  1JIH A;  3M2U A;  1R89 A;  4NXM F;  1OY9 A;  4IOC Q;  4ZHR B;  2GMJ A;  2XO6 A;  1HBO B;  4ZVQ B;  1LOU A;  3CDB A;  5C5J A;  2BV3 A;  1UFK A;  4BC7 A;  1MW7 A;  4P6Q A;  1R6Y A;  3L09 A;  3GFZ A;  2PMW A;  5B09 A;  1P1L A;  4ECX A;  1U1N A;  4OIX A;  4WWS A;  2ZFH A;  1NPR A;  3MMC B;  4CO0 A;  3D9B A;  3CCU S;  4LF6 J;  1JLB B;  3MCS A;  3HXM A;  2CDQ A;  5JVG Q;  3A8J A;  3D67 A;  4K0K J;  1W7W A;  4S0M A;  1LV5 A;  4FYW B;  1WSV A;  1SUQ B;  1YJT A;  4J9U E;  1C0U B;  1X8D A;  4ED7 A;  1WEL A;  5E3R A;  2J6S A;  2ZH2 A;  4NYZ A;  2XCA A;  2Z30 B;  5E3C A;  1HBN A;  3M8Q B;  4B3T J;  3C15 A;  4WU3 A;  1KSP A;  1RIS A;  4ZLP A;  2FHJ A;  4C48 A;  3DRP B;  4KKO B;  4U7U K;  1HNX F;  1LWF B;  3EDQ B;  3KFW X;  2XLI A;  2BAN A;  2QT7 A;  1OMS A;  2NXN A;  2QA2 A;  2DIV A;  4MKB A;  4CM0 A;  5C24 B;  2XI3 A;  3M1V A;  7FD1 A;  4FKY A;  3UN3 A;  3OHB A;  1FXL A;  2K2P A;  1REV B;  3DOK A;  2B9X A;  2H3E B;  2AZ1 A;  1RWW B;  1SV5 B;  1R6V A;  3F44 A;  3LAL A;  3N6L A;  2H9Z A;  4PAA A;  1RAF B;  4ZS6 A;  5ETK A;  4U7C A;  5FDL A;  3DYA A;  4M5L A;  3LGM A;  3HT3 A;  3G6V A;  4YY3 F;  1RT2 A;  3CJT A;  5FLX Y;  2QG9 B;  3TA1 A;  2XI2 A;  3NBP B;  3EZU A;  2KYZ A;  5HP1 B;  3NMR A;  1RTH B;  2V68 A;  3MED A;  3J81 j;  2HVD A;  3LP1 B;  4NLV A;  3TQ1 A;  1M5H A;  1LWE A;  3NGS A;  3CJK B;  2GO9 A;  1A6L A;  3R27 A;  4QQB A;  2ROP A;  4NZ6 A;  1CJT A;  2HHT A;  1DQA A;  2EKN A;  2YX7 A;  2XY5 A;  3CIZ A;  2H54 B;  2C3M A;  4WFZ A;  2RAQ A;  4X4Q A;  1YHQ S;  4LF8 F;  4OZJ A;  1MWQ A;  1TKT B;  4OX8 A;  2RDJ A;  1DTT A;  2W2Q P;  1S1T B;  3J80 U;  3GFX A;  2X7I A;  4E8U A;  1NME B;  1S1X A;  4CLL A;  4E2F B;  4EUV A;  5BJR A;  1U45 A;  4K4U A;  2MJU A;  1D3W A;  4MT1 A;  5AXL A;  5K5M A;  2RRN A;  3X1L B;  3R6G B;  4JI3 F;  2KT2 A;  1CJK B;  3MD3 A;  2HBY B;  1HD0 A;  3T1H J;  2X3D A;  2ZE2 A;  3Q8Y A;  3G6E S;  3EZO A;  2MKS A;  1F5A A;  2J8S A;  3PEJ A;  4IG0 B;  5BR8 J;  3M9M B;  2VOD A;  2HMI B;  2DNQ A;  3OXF A;  1TTH B;  3PFO A;  4ECR A;  1IBK F;  1EX8 A;  4MK7 A;  1IBC B;  2V8D A;  1NU4 A;  1PAU B;  1T9Y A;  5D0R A;  4ETZ A;  4FPI A;  2PC6 A;  3GJS B;  5AT1 B;  2KXH A;  3CXC R;  1TFW A;  3FFI A;  4RW6 B;  3TX0 A;  4J9K A;  1BC6 A;  3I0R A;  4KPC A;  3QAE A;  2E9Z A;  4J9Q A;  5HAO A;  1RQ0 A;  3POT B;  1FRJ A;  1RAA B;  3WZ0 A;  4UST A;  2F8H A;  3JXO A;  2L3M A;  3H2V E;  3MCM A;  2ZH6 A;  3D1O A;  5KFH A;  6AT1 B;  2CPF A;  4U6P A;  2DHG A;  2FJD B;  2IYI A;  2U2F A;  5CA5 A;  5BYS A;  4MMO A;  4NOH A;  1RWK B;  1QVF R;  1VQN S;  3JTP A;  5DG7 A;  2JSX A;  1Q5V A;  2C2O B;  3KMQ A;  4TLR A;  5MAO A;  3MR5 A;  2W01 A;  3M8Y A;  1F5B A;  1JLE A;  2XG8 A;  3A4T A;  4EI2 A;  4DX7 A;  4J9O A;  2CQP A;  2I6W A;  3R5J B;  4GC7 A;  3NG8 A;  1TK8 A;  2CFX A;  2ZH9 A;  4RUA A;  1BQM A;  2B4P A;  2N7Y A;  5LMU J;  3VAL A;  3MPV A;  2MQ8 A;  4ED2 A;  3C3L A;  2UU9 F;  4ANC A;  3PVX A;  3ONQ A;  3AA8 A;  3MMA B;  1JJ4 A;  4I67 A;  2FGO A;  3ZXW A;  2MXY A;  4ILL A;  1OPZ A;  2ZOF A;  1X31 C;  3CO0 P;  3DLE A;  4YME A;  2V2Z A;  2IYG A;  4UQG A;  2G9O A;  2B7B B;  2Y1J A;  5M2U A;  4LFB F;  2LA4 A;  2E1P A;  5KFW A;  4DF8 A;  5D0G A;  2UXC F;  2W2P P;  2ZEJ A;  3ET6 A;  3KLI B;  4JI3 J;  4CO3 A;  2YKP A;  2BAB A;  4ZP9 A;  1WHW A;  1RWX B;  5T7L B;  3DRP A;  4DUY J;  1RAE B;  2M5Y A;  4ZVR B;  1RWM B;  3IAM 9;  5BR8 F;  2IM0 A;  2MLY A;  3IS9 B;  1HQE B;  1Q8K A;  2DXF A;  2IPO B;  3GR1 A;  2KJW A;  4ZVH A;  1EP4 B;  3MM7 A;  3KMS A;  3CJQ A;  3J81 Y;  1FTC A;  3BZQ A;  3PDN A;  4DFJ A;  2A18 A;  1KC8 T;  1TKT A;  1SJ1 A;  1OIA A;  1DY3 A;  2BJD A;  3CJ4 A;  1ZAV A;  4I0W A;  3CCR S;  1RT2 B;  4HVZ A;  2GHV C;  4ZP8 A;  5AE1 A;  2JFK A;  5B0A A;  4GO5 X;  4A8X A;  2A1B A;  1RT6 A;  2HGL A;  2O67 A;  3J7A 1;  3OD2 A;  2NZ4 A;  3QMQ A;  1TU0 B;  1NDC A;  3AAW B;  4OZ0 A;  3TW0 A;  5KFB A;  1LWE B;  5EHH A;  1Y10 A;  2QZ8 A;  4DLE A;  3W9I A;  2E7X A;  2HLU A;  2KU7 A;  4XTT A;  3J81 U;  2HS3 A;  2E7W A;  2DB1 A;  3PIO Q;  4PXC A;  2R8H A;  1HBU B;  1G7C B;  2UVW A;  2QLB B;  5ETS A;  3OVB A;  1BY9 A;  2LKZ A;  5L1L A;  4DQI A;  3DLB A;  1YJU A;  3OSP A;  2WSF C;  1UVI A;  1M1H A;  3NNA A;  2HGM A;  2UV8 A;  4KRW A;  4Y6I A;  4B17 A;  2CVI A;  4V19 X;  2OML A;  3DOM B;  2GGP B;  3L95 X;  4NLX A;  4OJG A;  2FHM A;  2Z2Y B;  3BO4 A;  4XIU A;  1ZA1 B;  4KE5 A;  2E1C A;  4MFB B;  2DNM A;  2HVZ A;  5KG6 A;  3W7B A;  3G71 S;  1FDA A;  3D6H B;  1EB0 A;  3HCX A;  5KFA A;  4ZLJ A;  4DV5 J;  2ASJ A;  1D9A A;  2XHW A;  5C42 B;  3AOD A;  2I5J B;  3NOC A;  3GJQ B;  2HSE B;  3HI9 A;  4LSN B;  5CYQ A;  2HZA A;  1B0V A;  4YR3 A;  4CCH A;  3CDW A;  4KGV B;  5BXI A;  4K4Y A;  1PGZ A;  4F26 A;  3BEG B;  3FJ2 A;  5HJY A;  3IRX A;  1T11 A;  2W24 A;  2NPF A;  3OTO F;  4DOZ A;  5CCM A;  1N33 F;  4AYB D;  3ULH A;  3V4I B;  1S59 A;  3Q23 A;  1XER A;  4ZK7 M;  1FJC A;  3K5L A;  2DRA A;  2W9C A;  3O44 A;  2C2K B;  1A9N B;  1C4A A;  1GTE A;  3UFC X;  1HHT P;  2HVH A;  1FFW B;  4A47 A;  1AUS L;  4FBT A;  1RT3 A;  4NLT A;  1UWA A;  2DNL A;  4I7F B;  2WTF A;  5H9F K;  1RTI A;  4LQ9 A;  2W8K A;  2L9W A;  4OFZ A;  4IO9 Q;  2IRY A;  3MAA A;  2XLJ A;  2DGU A;  2I2Y A;  3K5M A;  1YBA A;  3NRB A;  3V6J A;  4NWB A;  3TEG A;  2MB0 B;  1J2V A;  4AFF A;  3C2P A;  4OYO A;  3DNC A;  4G6V B;  2DPI A;  1OYD A;  3OTC A;  3BBF A;  1UA1 A;  2ZBP A;  4BBY A;  4IUF A;  3CCV S;  3EVM A;  4DUZ F;  4UY8 5;  1NDL A;  4HI2 A;  1R3N A;  2GS8 A;  3LO3 A;  4JOU A;  2FZG B;  3GFH A;  4NEY A;  1CLF A;  2LMI A;  1N32 F;  3KHH A;  4AQY J;  1LWC B;  3HZE A;  3L4B C;  2H65 B;  4D3H A;  1Y4Z B;  1EQ0 A;  2OH2 A;  1GXT A;  1NO8 A;  2ABY A;  1BLU A;  3TVZ A;  1X9M A;  2COL A;  4Q7A A;  2UUT A;  3PM9 A;  4LSN A;  4R0J A;  2ZH7 A;  3QJP A;  2VIC A;  2YKN A;  4RX6 A;  2QL5 B;  4UW2 A;  1J5E J;  2UUB J;  3M6U A;  3ZO7 A;  3VVU A;  2KG0 A;  2J7K A;  3EZ5 A;  2LEP A;  4JI0 F;  3O5T B;  5HJX A;  1TEL A;  4F0K A;  3QBC A;  3UNY A;  3G8T A;  4PXE A;  3W5Y A;  1ZH5 A;  1RT4 A;  1FWK A;  3CD5 A;  3GV5 B;  2MZS A;  3M30 B;  4GRS A;  2HBQ B;  2M3D A;  2KL8 A;  3UDL A;  3VGS A;  1ZZN A;  1H2U X;  2WB4 A;  1K73 T;  3US5 A;  5GMK a;  5AXK A;  5B0C A;  4PPZ A;  4ELT A;  2DCU B;  3QLH B;  3W60 A;  3NMA A;  4HKQ A;  4NLU A;  3SBM A;  1GQE A;  1H7W A;  1RP5 A;  2BJE A;  1JNR B;  3JS9 A;  2B8P A;  3IG1 B;  3X3U A;  3BGF A;  1B3T A;  2KO1 A;  2Y3Y A;  4C4W A;  5FLX U;  1IQZ A;  4DR5 F;  4AL6 A;  4C7Q A;  3OXL A;  1TL7 A;  2YWG A;  3OJS A;  1ROF A;  3FKB A;  5LMN J;  3LAM A;  1VR6 A;  5J2N A;  1U49 A;  2FLN A;  2MPU A;  4C0O C;  4CYU A;  2MQN A;  1S6U A;  4Y3C A;  1RHR B;  2MEW A;  3IAS 9;  3JQM A;  4XPE A;  4DV7 J;  2HS4 A;  3TAN A;  4ZPW R;  4KSE B;  4P2F A;  4DR6 F;  4LRD A;  3M2V B;  3D4J A;  1MU2 B;  3HSG A;  2DEJ A;  2KRB A;  2OIH A;  3HM9 A;  2E9T A;  3TOQ A;  4XPC A;  3VAI A;  1NAQ A;  4JYA F;  3OFH A;  4C0H A;  5HBM B;  2WBM A;  1H0H B;  2BZ2 A;  5F8N A;  4FDF A;  4K50 A;  2HUR A;  3BM7 A;  3TA2 A;  4EK2 A;  1BQN B;  1UJ4 A;  2EK1 A;  4F3O A;  4ID5 B;  1RJJ A;  2YKM A;  5GAE I;  4DQR A;  3DU5 A;  1Z4U A;  2WVE A;  4PPD A;  3C14 A;  3IC1 A;  2KKH A;  2RQK A;  3NGT A;  5ETL A;  4ZA1 A;  3W61 A;  2VQF J;  1FVQ A;  1D0E A;  4WBF A;  2ZNY A;  4X84 A;  1U2C A;  3LPE A;  2MQM A;  4CNY A;  3NGU A;  2Y0S D;  4OX6 A;  1RA6 A;  1WHY A;  4CLZ A;  3DXB A;  1TL1 A;  3E01 B;  5ADZ A;  3AH6 A;  4JI0 J;  2XS2 A;  2KZM A;  3H5Y A;  5CAB A;  1UL3 A;  4I4B A;  1JXV A;  3EX7 B;  3PW4 A;  3RAX A;  1N0V C;  2VG7 B;  3RW7 A;  5DET A;  4URS A;  4OYW A;  3H25 A;  3BDP A;  1PYO B;  4DZ6 A;  4P10 A;  1ZET A;  2HPU A;  3NWR A;  4DL5 A;  4DR7 F;  2Z2L A;  3KTQ A;  4IYQ A;  4O23 A;  1N34 J;  4WIQ A;  2DRB A;  4J37 A;  1HL6 A;  1BQX A;  1JLF B;  2BAN B;  3HVW A;  2ZH3 A;  5E3Q A;  1PYT A;  1Q8I A;  2IRX A;  1CQM A;  1I5O B;  2D7S A;  2E5J A;  1HAR A;  4I6A A;  4WYW A;  1VQ5 S;  1HBO A;  4LT6 A;  2KG1 A;  4OI0 A;  3QGG A;  4KH1 B;  2GVZ B;  1Q8L A;  4IO1 A;  4USH A;  4N5S A;  4W4M A;  1AUD A;  1TL3 B;  2EI5 A;  1U1L A;  3EIC A;  2AV5 A;  2Y1I A;  4JI4 J;  1Y5L B;  1IWG A;  3IWL A;  3NS6 A;  4O0N A;  1SCJ B;  3QO9 B;  4QR0 A;  2K3K A;  2QMW A;  2VQE F;  2CQB A;  3G82 A;  2R42 A;  1DJ0 A;  2B6A A;  4FNH A;  4RBT A;  3TO8 A;  2V9K A;  4H4M B;  3VGT A;  3QIP B;  1QUP A;  2BJ1 A;  2IVM A;  5K9F A;  1V5V A;  5SZT A;  2CA9 A;  3FMB A;  3L9Z A;  4JV0 A;  1RTD B;  2HMI A;  1LW0 A;  1NM2 A;  4LF5 J;  2NYI A;  3MD1 A;  2VKZ G;  5KFU A;  5LMU F;  2F40 A;  2MKK A;  5DG9 A;  3CCM S;  2EFG A;  1WHX A;  4M5D B;  3Q8S B;  1T05 A;  2GNK A;  1LW2 A;  2FJE B;  2YQ3 A;  1S1V A;  3QFH A;  3OL6 A;  2NXU A;  4CLP A;  3SQG A;  5A6P A;  5DLG A;  3KHG A;  3WIU A;  2HHW A;  3K7R A;  5I4M A;  2WZ1 A;  3FK4 A;  2ROG A;  1MNE A;  1MG7 A;  3CCL S;  4F2S A;  1SB6 A;  4U8Y A;  1N8R T;  1EET A;  3IRW P;  1CQN A;  4Z37 A;  5ETV A;  1QDU B;  2XWY A;  4Q44 A;  3TQE A;  2Q66 A;  2AJ1 A;  4K4X A;  1VCT A;  2VG5 B;  4M1K A;  4Q8F A;  3DN9 A;  4U9R A;  2HHV A;  3ZTO A;  3LP2 A;  1DTQ B;  1XK8 A;  3DMJ A;  1UEK A;  4P74 A;  4QIF A;  1RWP B;  4B08 A;  4CIO A;  4ES1 A;  3SIP B;  2VJU A;  4A8M P;  4X64 F;  1S6Q B;  2I0X A;  4DR1 F;  1G6B A;  4OYX A;  3WHI A;  3CDU A;  2R8I A;  3LQV A;  2RKI A;  3F41 A;  2D3Z A;  3SDE B;  2DHS A;  2FB0 A;  1TMM A;  4USJ C;  4PR6 A;  3RGI A;  3ZTP A;  3I5C A;  5E41 A;  2AYB A;  3BJY A;  4RBV A;  1C0T A;  4NZ7 A;  1T03 B;  1S79 A;  4OI6 A;  2D3U A;  4TLQ A;  1IKV B;  2KJV A;  3RAM A;  1S97 A;  1Y11 A;  1UW4 A;  1DTT B;  2R7O A;  4LJM A;  3W2V B;  1RWN B;  4N8O A;  4X65 F;  4AXI A;  4LUB A;  3SCJ E;  3G4S S;  2FZK B;  5M2P A;  4C8O A;  1KD1 T;  1EJ7 L;  3S1T A;  3GG0 A;  4J90 A;  1TQL A;  3CUN A;  3KJV B;  2LXF A;  2YNG A;  5L46 A;  3PYF A;  1FCA A;  2HRU A;  3HD2 A;  3IS9 A;  2E44 A;  3KK2 B;  3C19 A;  2IBK A;  5KFJ A;  4P52 A;  3RJM B;  2H5I B;  3AFG A;  4QZV B;  4CRJ A;  3V81 B;  3GII A;  4LR8 A;  2J7W A;  2LQJ A;  5HI7 A;  4OLP A;  2FC8 A;  4WFX A;  5ETT A;  2NXC A;  2HLT A;  4CLW A;  2PMH A;  5DQI A;  4YR0 A;  4ED6 A;  1KNZ A;  1GAO A;  2VIH A;  2VPY B;  5KT7 A;  1KLN A;  4CLS A;  1R27 B;  3KUE A;  5GAG U;  1J5O A;  2DIU A;  3KLV A;  5B0G A; 
#chains in the Genus database with same CATH homology
 1XMQ J;  1N36 J;  4X65 J;  4DV1 J;  4LF9 J;  3W1Y C;  1XNR J;  2E5L J;  4GKJ J;  3T1H J;  4NEZ A;  1FJG J;  1HNW J;  1N34 J;  4RJV A;  4B3R J;  5BR8 J;  2F4V J;  1HNZ J;  4GKK J;  2HHH J;  4NXN J;  1XNQ J;  4B3S J;  3T1Y J;  4JI5 J;  3JAM U;  4KYZ A;  4JI4 J;  4DR1 J;  4DR6 J;  1XMO J;  4LF7 J;  2UXC J;  4JI7 J;  4YY3 J;  5LM7 E;  4NEY A;  1I94 J;  4LF5 J;  4AQY J;  2UUC J;  2ZM6 J;  1HNX J;  5LMU J;  4JI2 J;  1N32 J;  2MQ8 A;  1IBK J;  1J5E J;  2UUB J;  3D3C J;  4LFB J;  4X66 J;  2UUA J;  4LF4 J;  2KL8 A;  4LF6 J;  4KHP J;  4JI3 J;  4K0K J;  4HHU A;  4DUY J;  4X62 J;  4DV5 J;  4DR3 J;  2UXB J;  4DV4 J;  5FLX U;  4DR4 J;  4B3T J;  4LF8 J;  2UXD J;  4LFA J;  5LMN J;  4JI1 J;  4OX9 J;  3IMQ J;  4V1A k;  2KVQ E;  4DV2 J;  2MEW A;  4DV7 J;  4JI8 J;  5IWA J;  3J7A N;  4JYA J;  4DV0 J;  3OTO J;  4DR7 J;  2VQE J;  4JI6 J;  3J81 U;  2MTL A;  4DR2 J;  1HR0 J;  1IBL J;  4DUZ J;  3D3B J;  4JV5 J;  5A2Q U;  4B3M J;  4DV3 J;  1N33 J;  4X64 J;  2VQF J;  4DR5 J;  5AJ3 J;  5IT9 U;  1IBM J;  4NXM J;  4YHH J;  2UU9 J;  3R2C J;  4PWW A;  4KY3 A;  4LFC J;  4DV6 J;  3R2D J;  4JI0 J;  3J80 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...