4DR6L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr6L00
1BKBA 2VQFL 1OXVA 4QL5A 2WB1E 3WWVA 1EUJA 1Y1WG 4A3GG 3I55A 5M5XH 3TREA 1C0AA 1R9TH 4GOPB 3VDYA 2Q2IA 2WFWA 4B3ML 1IBML 3CCJA 1HNXL 3A5ZB 4PZ7A 3K0XA 1I94L 1Q7YC 3RZOH 1K8AC 3J7A5 1HR0W 2GN5A 1O7IA 4GLAC 3KJOA 1WOCA 1VQ8A 3PO2G 4R4QA 4WJ3M 3TEHB 2Y0SG 1B70B 1RL2A 1W3SA 2F3IA 5IT9c 3HOVH 1VQLA 1H95A 4IJHA 2NN6I 4BBRH 1PH9A 2YV5A 1K83H 1XMOL 2B3GA 3KDFA 1LUZA 3SGIA 1PV4A 1VQHA 5LMUQ 4O2DA 3G6EA 1PH6A 4DV2Q 1PHJA 4POFA 1VQAA 3CC2A 2K5HA 1TWAH 5C44G 1ASZA 1IZ6A 3ULLA 1N9WA 3BZKA 2LXJA 4QIWE 1K0RA 4JOIA 1V43A 2BA1A 2KHJA 3HFZB 2ZJPA 4JV5L 1L2FA 4IPGA 1Z47A 3ER0A 2BH8A 2N78A 3BZCA 2VQEQ 3HOWH 2K5NA 5C4XG 3PUZA 3U4ZA 4LF7Q 4DNIA 4PMWA 2F52A 3I4NG 1TWCH 2Z6KA 1X54A 4GN4B 3D31A 4AH6A 3OW2A 1IBMQ 5IYDG 1VQDA 3ICEA 4A3DH 1Z9FA 1KXLA 2VQFQ 1NJIC 4A3FG 2JA5H 1FGUA 2AWNA 4AYBE 3J7ZC 2OTJA 4JI6Q 1PH4A 4IPHA 4A3LG 2CWAA 2D0OA 3J80c 2YYZA 2WB1G 3TS2A 4YHHL 3G4SA 4GKJQ 1D8LA 3TQYA 3AFPA 4R1JA 1LM0A 4MNOA 4HJ9A 3S1MH 1HR0L 1X3FA 4BY7H 1J5EL 1VCIA 2A8VA 1X55A 3JAMc 4GN3B 1S40A 1PYBA 1UE7A 2K75A 2E5LQ 1M90C 5JJLA 3PUWA 4P73A 1A63A 2WP8J 2Z6KC 4LF4L 4OX9Q 5JJIA 1PA6A 2R7ZH 3E9HA 3S1QH 1Q8KA 3PO2H 1E22A 2CQOA 3PCOB 4QGUA 1N33L 2JE6I 3L0OA 2L15A 2IHFA 5FLXc 1NBWA 2FXQA 4JI1L 2CCZA 2RCNA 2H5XA 4L5TA 4DV4L 4DK6C 4LFAQ 1OXSC 1NY4A 3KDFB 4DR5L 1HR0Q 4DKAC 1FJGL 4IFDI 3B6YA 4NXML 1P16A 5HGQA 4B3RQ 1HZCA 1N34Q 4JI8Q 3GTQH 1YZ6A 2A1AA 2QA4A 4PZ6A 3W1BA 1U5KA 3HOZG 1CKMA 1JJ2A 2PI2E 3A74A 1XNRL 5BR8L 1IL2A 3H3VH 4HJ8A 1I5FA 1UE5A 2E2HH 4YY3L 3KF6B 3F8TA 1HZAA 1WCMH 2VQEL 3BJUA 1SR3A 4AQYL 2PQAA 3CCUA 2YU9H 5FJ8G 5IP9H 1VQFA 5JJKA 2UUAL 4K0KQ 4IJLA 3OTOQ 1XJVA 1AH9A 3J81i 2JA9A 2R6GA 1SRUA 2Z0SA 4DPGA 4LFCQ 1UEBA 4BBSG 1EYGA 4LWCA 2KHIA 3EN2A 5BR8Q 1MIUA 1K3RA 3J80i 4DV7L 1N32L 2N49A 4LF5L 1VQ6A 4DR6Q 1N34L 4DV2L 4JI3L 2IT1A 1L0WA 5M5YH 4A75A 4A3FH 2JA5G 3PF4A 4HIMA 2EIFA 4TQUS 3KYHC 4JYAL 1HNWL 3CPFA 4UP8A 1E24A 3KF8B 4DV5Q 1GM5A 4GN5A 3F1ZA 5IWAQ 1PH8A 4BA1I 2DUDA 2JA8H 2HIXA 3G71A 4JBMA 1UE1A 4JI0L 4QQBX 2JA7H 1QVFA 2RHSB 4JI7L 1NMGA 2VY3A 3HOXG 2GVAA 1PFSA 4C3JH 1PH1A 3GTLH 1IBKL 3S1RH 1PH2A 3UDXA 3CCMA 2OQ0A 4H02A 3K7AH 5J3BA 4OWTB 4QY7A 3S2HH 1X9NA 4LF6Q 3FKIG 4OO1I 5DLQE 1HH2P 1EQQA 2R92H 1VQGA 3STBD 2JA6H 2I0QA 3L7ZC 1K73C 1IBKQ 3HKSA 3S15H 1JT8A 2E2JH 1ASYA 2C35B 3GTGH 2HHHQ 4GKJL 4BBRG 4A3IG 1VQEA 2ZTDA 1QVCA 1UWVA 1L1OC 1VQCA 2IX0A 4DUZQ 1K9MC 1VQKA 3IRBA 5C44H 1XPRA 5IP7G 2K14A 4KHZA 1W2BA 4LF5Q 2V1CC 4A3BG 3CF5A 3UDFA 4JI3Q 4JI4L 4R4TA 1KRTA 3I4OA 5C0XG 1X3GA 1S3OA 1CSPA 4LF8L 1X56A 1OXTA 4JI1Q 1VQIA 3GO5A 1UE6A 1YHBA 4DV7Q 3CMEA 4YCUA 2K4KA 4DR4Q 4X6AH 3A0JA 1LTLA 1SLJA 4P75A 2MO1A 3RLOA 4GOPA 3AFQA 2ASBA 5IP9G 4ALPA 1E1OA 2ZJRA 4JI2L 3I7FA 2JA6G 4B3SL 4EX5A 2XTIA 4GNXC 3UE1A 1TXYA 2RHQB 1MJEA 2Q2TA 5IYDH 4LF8Q 1C9OA 4JCVE 4DV6L 4UP9A 5E7NA 4XIGS 5M3FH 1XNQQ 5EAYA 1PVOA 2AHOB 2KCTA 1VQPA 3PIPA 3NELA 1Q1EA 4DAYB 1KQSA 4JI5L 3E9IA 3ZJYC 5K36G 1N36Q 3PGZA 1D7QA 4YCWA 4RMFA 1FVIA 1OXXK 4DV1L 4J15A 4KLKA 4OWXB 3CW2C 1EIYB 2IX1A 3CCQA 4NXNQ 4R4OA 2HQLA 4GLXA 4DR2Q 4IOAA 1VQ9A 1DGSA 4X66Q 2ATWA 1N32Q 4DAMA 1KAWA 2AKWB 2CFMA 2YTXA 1C7YA 1G291 4LW1A 2RF4A 1BBWA 4L5RC 2N3SA 1X3EA 1MJCA 2VL6A 1HNXQ 4LF7L 2WAQE 4HIDA 3GTKH 2YTYA 2LXKA 1T9HA 2ZM6L 4LF4Q 4OX9L 2Q2UA 1TWGH 1YHQA 1QVGA 4AIMA 2XGTA 1Q46A 4KHPQ 3K80C 2WAQG 1KIXA 3U4VA 1MKHA 3RZDH 2UU9Q 3ULJA 1YITA 4UP7A 5C0XI 3CCSA 2AMCB 4HIKA 4HIOA 4L5QA 1XTDA 1YVCA 2DGYA 3CCRA 4JI7Q 3M9BA 4NB3A 4IFDG 2F4VQ 3ULPA 5LMNL 1PH7A 2D62A 2ZTEA 2UU9L 1SROA 2GVBA 4BY7G 1HZ9A 4X65Q 4A3GH 2K52A 1Q81C 2MQHA 2NN6G 1A8VA 4YCVA 2R93H 1EIFA 4JBWA 1G51A 1TWFH 2MNAA 1XNQL 3GTOH 3MEFA 1HJPA 4LFCL 4BY1G 4DV6Q 1V9PA 3RN2A 4YWLA 3DLLA 2ZJQA 3K8AA 2NVYH 4A93H 1YJ9A 3F2DA 4JOIC 3HOUH 3HKZG 3TRZA 2UUCL 3F2BA 4O0AA 3PUVA 5FJ8H 3S1NH 4A3BH 5GAEC 2R92G 5C4JH 4DR3L 4JC0A 1J6QA 2OTLA 3HKZE 1HNZQ 1WFQA 3KOJA 1XPOA 5AJ3Q 1VQMA 1XNRQ 3CC7A 4NXNL 1Q86C 4P72A 2NVXH 1VQNA 3RLFA 4NXMQ 2NVTH 2I5LX 1VQBA 5LMUL 5H1SE 4B3RL 1QUQA 1LYLA 1BVSA 4JI8L 4JI6L 2NVQH 2NZHA 3HOYH 2I5MX 3HOXH 3PIOA 4DV0L 1SMXA 1XMOQ 4LFAL 1I50H 3T1HL 2PI2A 4YWMA 4OXPA 5FLMH 4DR5Q 2UXCL 4RG1A 3L2PA 4GNXA 4C2MH 1Q82C 3K81C 4MZ9A 4LF9Q 1JE5A 4IPCA 3CPWA 1Q1BA 3KF6A 3M4PA 4B3SQ 3OTOL 4GOPC 4A93G 3UE0A 2ES2A 2UUAQ 4X62L 4L5SA 4JBJA 1IYJB 3Q8DA 3CMAA 5ELNA 2ZM6Q 2YTVA 3JC66 4BBSH 3CCLA 3I4NH 4OO1G 2N8NA 3J81c 2Y0SE 4DR1L 2UUBQ 4PZ8A 3NBHB 3EIVA 1V1QA 1WJJA 2EXDA 4C3IH 5IWAL 4UPAA 3W5OA 1YJNA 3H3VI 2B63G 2VNUD 4HJ7A 4WJ4A 3GTJH 4DR7L 1CKNA 1GVPA 1Y1VG 4LUZA 4DR2L 3CD6A 5C3EH 4A3IH 2LSSA 2F4VL 2UXDQ 1TWHH 4Y7NH 1OXUA 5GADC 4YHHQ 3CXCA 4JI0Q 2JA8G 1PH3A 2VS1A 4DV3L 3PO3G 1CUKA 1GKHA 1I3QH 1OTCA 2BA0A 1HNWQ 4GLVB 1QZGA 1YEZA 1B7YB 1YHAA 4JI2Q 4K0KL 3AQQA 4A3MG 4OONA 2HIVA 5AJ3L 2NZOA 5C0XJ 4UY8C 4BY1H 3ERSX 1AE3A 1X6OA 2VZAA 5M5WH 1NMFA 4A4IA 4A3MH 1HNZL 3F2CA 4LF6L 2QGQA 1BBUA 5GQOA 4GS3A 1I94Q 1PH5A 4IO9A 3AYHB 4BA2I 1EWIA 5C4XH 1QZHA 1JJCB 4LF9L 4LUVA 1EFWA 2PMZE 3GTMH 1YBYA 3H15A 2IHEA 3K7UC 3D0FA 4HJ5A 1E7ZA 1L1OA 4FDBA 2D0PA 3CCEA 3PV0A 2MFIA 1NE3A 1N8RC 3RR5A 1EQRA 1U0LA 4DUZL 1FL0A 4X66L 3JAMi 4JBKA 3G48A 3J81j 2JK8A 4JI4Q 3M7NA 5IE8A 1I6HH 3LGJA 2PNHA 1N36L 4DV5L 1VQOA 3PO3H 1B8AA 3U50C 1VQ4A 3GD7A 3H0GG 2R93G 1VS0A 3I2ZA 1KD1C 1M1KC 1JMCA 4KI0A 2B29A 5FLMG 2JEBI 1AE2A 4R4IA 1SN8A 3I56A 3RNUA 3S17H 2UUBL 2UUCQ 4DUYQ 4KHPL 3FP9A 3PSIA 1Y14B 1YIJA 3HOWG 2KBNA 1WCMG 1N33Q 2JJQA 2E5LL 1VQJA 2AWOA 2K5VA 4GKKL 3I4MH 3FKIH 4A3KH 3S14H 3OYYA 4DR4L 5ELOA 4B3MQ 5M3MH 4A3KG 3DM3A 1IBLQ 2ALYB 3HOVG 3EBEA 2MO0A 1HZBA 4MTNA 3M85A 5HY6A 4P71A 2E2IH 4QJFA 4A3EG 5IYBG 1A62A 2Q2HA 4C3HH 2R7FA 4LUOA 4A3DG 5GAGC 1Q12A 4X65L 3AEVA 5C3EG 1KC8C 1IXRA 2JQOA 4XTCS 1VQ7A 4A3CH 1KRSA 1XMQL 1GO3E 3NEMA 3CCVA 4B3TL 1FJGQ 4DR6L 5GAHC 1PYSB 3HOYG 4A3LH 5LMNW 2VUMG 3TS0A 1A0IA 3BU2A 2E8GA 2VW9A 1Y1WH 2EQSA 3RN5A 2VUMH 3CAMA 1KL9A 4X64Q 3KJPA 2UXBL 3CC4A 4DR3Q 1WI5A 4Y52H 4LFBL 1E1TA 5JEAJ 1IBLL 4ME3A 2K50A 3CQZH 3PUYA 2OCEA 4YY3Q 3I4MG 1CKNB 4NPSA 1YI2A 5GROA 1J5EQ 1GD7A 3HOUG 4DUYL 3KFUA 3T1YQ 4JV5Q 4POGA 5JEAG 2R7ZG 3PF5A 3M4QA 1YJWA 3CP0A 4X64L 2UXBQ 5M3FG 1SE8A 5IYCH 4IOCA 1L1OB 1YNXA 1EOVA 3FHWA 1XPUA 3T1HQ 2UXCQ 1CKOA 5IYCG 1X65A 5LMNQ 4OWWB 1SFOH 2B63H 4IFDJ 4DK3C 2CKZB 4JI5Q 2KENA 1K8GA 4BXXH 4JYAQ 3GDEA 3RLNA 5IP7H 2R7DA 3UDGA 2BH2A 2PQAB 2A19A 1JB7A 4BXXG 2HHHL 4DV4Q 4GNXB 2JA7G 5IY0A 2I5HA 3HOZH 3M3YH 2ZTCA 4AYBG 4DR1Q 2ID0A 4A3JH 3T1YL 4EQ5A 4P74A 1QUQB 4AQYQ 4A3JG 2OWOA 3S16H 4R4CA 4GKKQ 3STBC 1WYDA 4X62Q 2IY5B 3M4OH 3S2DH 1RIPA 3U58A 1KHIA 5M3MG 2CWPA 2HT1A 1G6PA 4LFBQ 1NTGA 1E3PA 1P8LA 4PG3A 4APVA 1S72A 3W1GA 1VQ5A 4LNQA 3A5UA 2QEXA 2OQKA 4DV3Q 4A3EH 5IYBH 3S24A 3GTPH 4IPDA 3MXNB 4DV0Q 3E0EA 4TVAB 4DR7Q 4DV1Q 2KCMA 2UXDL 4A76A 1CSQA 3KLWA 1XMQQ 4B3TQ 1Y1VH 3PUXA 2JEAI 4A3CG 1JJGA 4HJAA 3UDIA 3NENA 4JG2A 3H0GH 4YWKA
chains in the Genus database with same CATH superfamily
2WB1E 1ZEQX 3I55A 4IN3A 3HOUB 4A3FB 1SJED 1D5XC 3ITPA 1C0AA 2R7ZB 3RUZA 1QNUA 2HD3A 1SMYC 3A5ZB 1GUNA 2IW3A 1Q7YC 1RDPD 1B1ZA 1ZXTA 4R4QA 3TEHB 1B70B 1DJRD 5ELCA 3QOJA 1VQLA 4PV1C 1STBA 2H4OA 1KDAA 1SYDA 4O2DA 3S16B 1ENAA 3BVZA 4A3JB 1IZ6A 5DM63 2F0VA 1N9WA 2LXJA 4QIWE 2JXMB 2J7ZA 1STNA 4JOIA 1V43A 5EGTA 3QR8A 3PUZA 1BBXC 4PMWA 2F0HA 4GN4B 3OW2A 1BCPC 1J8IA 4A3DH 1Z9FA 2EY5A 1NJIC 2JA5H 3I8ZA 1FGUA 3IFTA 3S9WA 2AWNA 4AYBE 3J7ZC 4LAAA 2AUJD 4IPHA 2YYZA 1WTHA 3TS2A 2A69D 4CHTB 3TP7A 3TQYA 4R1JA 1WVLA 3K7AB 1PZJD 1B9MA 2MGSA 2A8VA 1I4XA 1X55A 3JAMc 2AQ2B 1EIHA 1PYBA 3MEHA 2E5LQ 3PUWA 4EQOA 1A63A 2Z6KC 3E9HA 4TKOB 1XYIA 4HMJA 1LABA 4MIUA 1TY0A 2L15A 1QNKA 1A6XA 1PRTB 5FO9B 1RTNA 4U68A 4DK6C 1HR0Q 3B6YA 1VMPA 3NTIA 4JI8Q 1YZ6A 2I46A 3W1BA 1U5KA 4ZAIA 4K14A 3H3VH 1AW7A 5IODA 2EVBA 3KF6B 3TP8A 3BJUA 2PQAA 5K5PA 3I73A 1VQFA 1STHA 5JJKA 4IJLA 1AH9A 2H1EA 4XXEA 2Z0SA 1MIUA 4DV7L 2DN8A 4MTKA 5DAUA 4DR6Q 5FO7B 1N34L 2IT1A 1L0WA 4A3FH 3PF4A 2K6AA 3L9AX 3KYHC 3TP5A 4DV5Q 1GM5A 3F1ZA 2CH4A 2DUDA 4FNFA 4BA1I 3G71A 3MZ5A 3ND8A 4JBMA 4QQBX 1KNAA 2JA7H 5CC4A 2RHSB 1QVFA 2VY3A 4OIKA 1GHKA 4C3JH 3QOLA 3UDXA 4DAPA 3CCMA 4J8QA 2K5DA 2L4NA 3P75A 4QY7A 2B2TC 2R61A 1RTOA 4FO2A 2K03A 1ENFA 4LF6Q 3Q0AA 1EQQA 2R92H 2B2WA 4NW2A 2Q8IB 3STBD 1PLFA 2I0QA 3L7ZC 3DWAA 2F0GA 4OGQC 1D1KA 1GHJA 2C35B 2B39A 2I07B 1QVCA 1L1OC 2OEOA 3MC0B 1A15A 2RDFA 1UUPA 1EZ6A 1XPRA 3CF5A 4JI3Q 1Y69U 3I4OA 5C0XG 3S1QB 2ICIA 3D3RA 1CSPA 4RHSA 1QILA 1X56A 3IL8A 1O7ZA 4YCUA 1JB3A 1FNVA 4X6AH 4P75A 2ZXOA 3RLOA 1CQVA 1S5CD 1G91A 3P1HA 1MJEA 3W2DA 2CHBD 3Q24A 5E7NA 3P7JA 1GUSA 4BY1B 1WTOA 1XNQQ 3HOXB 1Y8PB 2A6ED 1Q1EA 4DAYB 4JI5L 5K36G 1N36Q 3PGZA 1FVIA 1F2LA 2PO4A 4DV1L 5F2DA 4ZQ3A 3NE5B 4NXNQ 1RJTA 4DR2Q 1Q8IA 2F0EA 4X66Q 1N32Q 1KAWA 3NTHA 2YTXA 2RF4A 1WTWA 1PDQA 4IUVA 2VL6A 1HNXQ 2B2UC 3GTKH 2BOSA 3D8GA 2Q2UA 3I4MB 4AIMA 1C8CA 3X3NA 1DM0B 3RZDH 1EU4A 1H9SA 2QILA 3A55A 2EY1A 2F4VQ 4IUTA 3MWYW 3GTQB 4OEMB 5I2XA 1HJPA 4H44C 3K8AA 2NVYH 4AYBB 3HKZG 2HCIA 4O0AA 4A3BH 1A3TA 2R92G 3BZDB 3HKZE 1PTOH 4ODGA 1HNZQ 1VQMA 1KDCA 1STEA 3OIQA 4FVMA 4J1MA 3PIO3 3UI2A 1G8ZD 1EZ8A 4DV0L 3PIOA 1H9RA 1XMOQ 1I50H 2PI2A 2EY6A 1I50B 4C2MH 3K81C 4MZ9A 4WFN3 1Y1WB 3M4PA 4GOPC 2D5DA 3UE0A 4C3JB 2L11A 1DXMA 1IYJB 2Z4HA 1K0SA 2ICEC 1KDBA 2Y0SE 2UUBQ 3G7LA 5E4WC 1YNND 5M9OA 2DNEA 3QG1A 1WCMB 3W5OA 5IT9E 4HJ7A 4DR7L 1CKNA 4O1NA 4HSPA 3D4RA 4ZKCB 4YHHQ 5J22A 4U673 5IGFA 1AZQA 4DGZA 1YEZA 2B2WC 4FF2A 1A3VA 4JI2Q 4K0KL 4UY8C 5C0XJ 3C1FA 4BY1H 5M5WH 1HNZL 3BVGA 1SBBB 3F2CA 4LF6L 1WD1A 2QGQA 1BBUA 1G6ZA 4RA8A 4IO9A 3AYHB 4RGOS 4BA2I 2VUMB 1GJXA 1JJCB 4LF9L 1EFWA 1DZ1A 2KVMA 3H15A 3I4NB 1STGA 1ONLA 4ULLA 4ZRZA 1NE3A 1PRTF 1SXTA 4DUZL 4X66L 1XTCD 3D4DA 3LGJA 1HA6A 1HCZA 4ZYSA 4DV5L 3PO3H 1B8AA 4QMGA 3U50C 3GD7A 1VQ4A 3I2ZA 5IOCA 1JMCA 5JJZA 2XWBB 4H13C 5FLMG 2WB1B 4JVZA 2JEBI 3GTOB 3GTGB 1II3A 2UUBL 2UUCQ 4DUYQ 1K3BC 2KBNA 5C3XA 1VQJA 2AWOA 5COYA 2K5VA 3S1MB 3FKIH 4PQXA 4K6LA 3DM3A 1IBLQ 1QJOA 3EBEA 4MTNA 4RCOA 2E2IH 2LKVA 3M7GA 4A3DG 2PNRC 4CDCC 1IXRA 2JQOA 1I4GA 1VQ7A 5LMNW 1S5BD 4BS9A 1XWEA 1SE2A 3RN5A 2VUMH 4X64Q 3KJPA 1PZID 4Y52H 4L63B 1E1TA 4ILWA 5G3LF 4WRDA 3AU7A 3I4MG 3KF8A 3KFUA 4DUYL 3E6ZX 4POGA 2E2HB 2NVXB 4IOCA 1AZPA 5IYCG 2NUCA 4WJWA 3MXGA 1LLRD 1KTKA 5I9PA 5IP7H 2Y0SB 2BH2A 2F0UA 1HTPA 3MFGA 2MUYA 4KKSA 4K2KA 1LT6D 2KEEA 4DFAA 4AYBG 4DR1Q 2XRSD 2BE5C 3T1YL 1EWCA 1LTSD 3I90A 2CVRA 2OWOA 2F0LA 3HS0C 2R92B 5G3LD 3H94A 1RIPA 2A74C 4IUPA 5M3MG 2CWPA 3IAYA 1NTGA 1I4HA 3W1GA 2EE1A 3S24A 5IYBH 4IPDA 2YU9B 1EYAA 2KCMA 4HAEA 4DV1Q 4RAUC 1E2WA 1XMQQ 3SDZA 1FR3A 1TWCB 4HJAA 3GO5A 3G4SA 3NPPA 2VQFL 4A3GG 3WWVA 1DD2A 1EUJA 1Y1WG 1RF2D 5M5XH 3MHBA 2L0CA 3GTLB 4MHEA 3A8IE 1D5ZC 4C3JG 3DUZA 3RD4A 4GOPB 4B3ML 1IBML 3CCJA 3RZOH 3T53B 1PFMA 2ZT9C 2GN5A 3EA6A 1D1IA 4GLAC 1VQ8A 2IPKD 2L9HA 5IT9c 1W3SA 2F3IA 1LTRD 2QKIC 1H95A 1EY6A 4BBRH 1PH9A 4PNYA 1K83H 2RA4A 1XMOL 3SGIA 3KDFA 1J9OA 5LMUQ 3G6EA 1NAPA 1VQAA 5CV4A 5FK9C 4CDFC 1ASZA 4XQNA 1EQTA 2FHTA 3BZKA 1K0RA 1ENCA 2IJ0A 2RDGA 2ZJPA 1EEID 2B8GA 1L2FA 1R4PB 1TS2A 3HOWH 5HURA 3DM1A 3U4ZA 2KECA 2F52A 3IKJA 3I4NG 1X54A 5CBAE 3EROA 1JC7A 2WAQB 1WD0A 4RGMA 4A3FG 4C56C 5C3WA 2CH4W 2KHSA 2CWAA 4I65A 2WB1G 4YHHL 4GKJQ 3FPUB 3AFPA 4HJ9A 1LM0A 3KLRA 4DXFA 1PZKD 2DNCA 1CFMA 3OSOA 1VCIA 2XSCA 2K75A 1M90C 4X3UA 1TR5A 1B50A 4G4KA 3CQZB 3CU7A 1XX8A 4P73A 5EBDA 2RSOA 4LF4L 4OX9Q 5JEAH 1PA6A 3S1QH 4A3BB 3PCOB 1N33L 3L0OA 3G6JB 2IHFA 3VA5A 1NBWA 2FXQA 4A3DB 1TS5A 1QWYA 1IYUA 4L5TA 5IIFA 1F9RA 1DOKA 1HFNA 1FYCA 4LFAQ 3KDFB 5EPLA 2B8FA 3DMUA 1P16A 1RCVD 1V1PB 3C1EA 4QIWB 3SHLA 5IT9L 4PZ6A 3HOZG 2F3VA 1CKMA 1JJ2A 1XNRL 4BBRB 1IL2A 4HJ8A 1I5FA 2SNSA 3F8TA 1STYA 2YU9H 1CI3M 5FJ8G 1PMRA 2UUAL 4QB4A 1XJVA 2QW7A 2R6GA 1SRUA 3NBHA 4DPGA 1CHQD 5BN3A 4LFCQ 2JYOA 1EYGA 4LWCA 2KHIA 1E2ZA 3J80i 3J7AV 1VQ6A 2CQAA 5KNDA 4HSVA 4C3HG 1VDZA 4JI3L 1LT3D 2EIFA 4TQUS 1HNWL 3CPFA 4DNRB 4XYOA 4GN5A 1PH8A 4YIJA 1Y1VB 4JI0L 5EKLA 1M8AA 1EWHA 2GVAA 1PFSA 3GTMB 2FINB 3E3XA 1I3QB 2VB3X 4CGYB 4OWTB 1BXTA 1K83B 5M3MB 1X9NA 1PTOB 5E1FA 4OO1I 3K0YA 1HH2P 5FO8B 2JA6H 2XIWA 2RBMA 1K73C 2B2TA 3HKSA 1JWMD 1ASYA 4N8FA 4OHJA 4DU9A 2EY2A 4A3IG 1VQEA 1K9MC 2B2YC 1JR0D 1VQKA 5C44H 4A3GB 4OL7A 4LF5Q 2QCPX 3UDFA 4PMBA 4JI4L 3DEPA 1S3OA 3H0GB 2R93B 4XT1B 1VQIA 2EYLA 3CMEA 1V8QA 2MO1A 5FOBB 2PW5A 3ZYYX 3AFQA 3DWPA 1ICWA 3BDOA 2ASBA 5IP9G 4ALPA 1E1OA 1U4MA 4GNXC 2Q2TA 5IYDH 2RHQB 1C9OA 1BR9A 1KLGD 2O4XA 4UP9A 4DV6L 4XIGS 1JQYD 3OOCA 5CV6A 1F2MA 1VQPA 1VMCA 2XVSA 1VF5C 3ZJYC 1D7QA 2NVTB 5DNFA 4B9WA 4KLKA 3RZOB 3CW2C 1EIYB 4RFBA 2HQLA 3OWFA 4KHVA 5KIXA 4IOAA 1DGSA 2ATWA 5CV7A 4DAMA 2AKWB 4K2LA 1G291 5EJWA 1C7YA 1BBWA 1G2SA 1Z7TA 2N3SA 1JCKB 1X3EA 1SFOB 2A6HC 2WAQE 1IW7D 1JICA 3JAME 2ZM6L 2LMCB 4ABNA 1Q46A 3K80C 2WAQG 3T16A 1MKHA 5C4HA 2UU9Q 4DN4M 4KV6A 3ULJA 1YITA 1PYWD 5IGBA 1W6JA 5C0XI 1NCVA 4HIOA 4L5QA 3CCRA 3M9BA 4NB3A 3NQIA 3ULPA 5D3IB 5LMNL 2D62A 1I6HB 3GQBA 4WORA 2K01A 2K52A 2NN6G 1A8VA 1STAA 2Z9HA 4JBWA 1TWFH 2MNAA 2MPMA 4BY1G 1X32A 1V9PA 4DV6Q 3RN2A 4YWLA 1KLUD 3L3OC 3T13A 3HEJA 4DXGA 5ISRA 2F0KA 1YJ9A 4A3BG 4JOIC 3HOUH 1UNSA 3TRZA 2UUCL 3F2BA 3S1NH 3PUVA 3VYRA 3A8KE 4K8JA 5GAEC 4DR3L 2QEJC 3QB3A 2OTLA 4A3MB 3J80L 1WFQA 3KOJA 3RLFA 1Q90A 1EY5A 2NVTH 1HQRD 5H1SE 1QUQA 2NVQH 4JI8L 3HOYH 3BDLA 1SMXA 3T1HL 2UXCL 5FLMH 4RG1A 3L2PA 3S2DB 4LF9Q 1JE5A 1CQFA 3OTOL 4A93G 2BCOA 3SK6A 4CBVA 3CMAA 1ESRA 1RKNA 3FRPB 3J81c 4DR1L 4UDUC 4KKTA 3K57A 3EIVA 1WJJA 2F0FA 2EXDA 1RD9D 2K5QA 4NDXA 4UPAA 3H3VI 2B2YA 3KLSX 1TVXA 4LUZA 1Y1VG 3NXWA 3CD6A 2F4VL 2HQEA 4A3KB 4Y7NH 1TWFB 3CXCA 4JI0Q 1PH3A 5KYLA 3SVMA 2BA0A 3LNNA 1HNWQ 3AQQA 2OF1A 4KJOA 2NZOA 5C3EB 3CRLC 5C6AA 2HDLA 4HCEA 4A4IA 4F8MA 4A3MH 5E4XA 1TT2A 5EBCA 4UAIA 1EY7A 2LY7A 5C4XH 2GA4B 1QZHA 3RZDB 2SNMA 1YBYA 2EYFA 2IHEA 5CORA 3K58A 4M8AA 1E7ZA 1L1OA 5A2QE 2D0PA 5JPNC 4A3IB 3PV0A 2MFIA 2F0DA 3A56A 3JAMi 4JBKA 2JK8A 5M5XB 2EJMA 5IE8A 1N36L 2PNHA 3S1NB 3D6CA 4R9WA 4N9PA 4K5VA 3H0GG 2R93G 2B29A 1UAPA 2KCNA 1SN8A 3I56A 3RNUA 4KHPL 4Q5VA 3PSIA 2QF7A 1WCMG 1N33Q 3EQLC 4GKKL 3RMHA 3S14H 5ELOA 1IW7C 1ESFA 5M3MH 2WKDA 2B2UA 3QWNA 2D9UA 1SYGA 5I6YA 3M85A 5HY6A 1LTGD 4P71A 4QJFA 4C3IG 3J80E 5IYBG 5A2QL 3VR4A 1A62A 3VYSA 1GOZA 4DAYA 1B2TA 2PQEA 3A7AB 3AEVA 2DJFC 1I4PA 3R93A 1KC8C 4B3TL 1SNCA 2F0NA 5GAHC 3HOYG 5C0XH 2VUMG 2E76C 1B9NA 5D3DA 2E8GA 1Y1WH 1ET9A 3CAMA 1KL9A 4F88A 1U4PA 1WI5A 4LFBL 3K5NA 3EJIA 1PRTD 4Q0FA 2Q8TA 2OCEA 4YY3Q 1BCPB 4NPSA 3TSSA 1J5EQ 3NSWA 4G7ZC 3V05A 5JEAG 2QDBA 4QF4A 4B9XA 5IYCH 1L1OB 4CKBA 1FGBD 1YNXA 4H0LC 2LFNA 2M00A 3SEBA 1SFOH 1B44D 3KBXA 3MVVA 4JI5Q 4JYAQ 4G7OC 1G2TA 2RCFA 1Y8NB 3PO2B 3UDGA 2R7DA 2A19A 1FD7D 1TQOA 3DXJC 2HHHL 4ZKBB 4GNXB 1F9SA 5IY0A 2I5HA 3HOZH 3M3YH 5FKAC 1C4QA 3OPOA 1F9QA 4LJZC 4AQYQ 2KCCA 3S16H 4GKKQ 1WYDA 2IY5B 3M4OH 2JP1A 3S2DH 1DYQA 2K05A 3MXUA 2HT1A 1P8LA 4PG3A 3MTSA 3I3CA 4F7XA 4LNQA 2OQKA 4DV3Q 5BN5A 4A3EH 1WTPA 4ZUJA 4DV0Q 3E0EA 3KLWA 2JEAI 1JJGA 1LACA 3UDIA 4WJ3M 5AFWA 3H0GH 2R93H 3WDNA 1BKBA 1OXVA 3KUPA 2F0PA 5M5YB 3A8JE 3TREA 4K5WA 3VDYA 2FJ2A 3QO2A 1EEFD 4RKBA 1K8AC 5EQ0A 1HR0W 1WOCA 2E2IB 2Y0SG 4KD3A 2IWHA 4IJHA 2NN6I 2B3GA 1PV4A 1LUZA 2NB0A 1SJHD 1PH6A 4K8IA 1PHJA 3NWSA 2K5HA 1TY2A 1TWAH 5C44G 3NK9A 5BN4A 4XQQA 2BDNA 1JWSD 4JV5L 4KK7A 1NUCA 4IPGA 4CDDC 2BH8A 3E0JA 2K5NA 2KQ3A 5C4XG 3KLSA 4LF7Q 1MD2D 2Z6KA 5D14A 1EY8A 3D31A 4AH6A 5DM73 5IYDG 4LK1C 1VQDA 4TRDA 1MBYA 1KXLA 2VQFQ 2DJGC 1HUNA 4NP5A 1SNMA 3M4YA 1PH4A 2D0OA 5I6WA 4C1NI 2LS01 1B4OA 3S1MH 4ZLTF 1CA5A 1HR0L 1X3FA 2JA5B 4BY7H 1J5EL 3O13A 4BY7B 1SNDA 4GN3B 4N8X1 1UE7A 1TU2B 2N55A 3OIPA 1TWHB 2F0QA 4ME5A 1H9JA 1SYEA 3D6WA 2WP8J 2R7ZH 4BWGB 1E22A 3PO2H 4C3IB 2JE6I 3BS1A 3K59A 5FLXc 2CCZA 2MJ8A 4F87A 1KAAA 1SDFA 1BNZA 3FKIB 4HR7B 4DR5L 4DKAC 1FJGL 3J81E 3TMEA 5KRUA 4B3RQ 1HZCA 3GTQH 1D6EC 3PQIA 3S17B 2EYJA 2QA4A 1E2VA 3PIP3 5BR8L 3ERQA 1UE5A 2DY8A 2NN6H 4CJ0B 3HG9A 4YY3L 3VR6A 2E2HH 1HZAA 1LO5D 1SR3A 4KTAA 1EYCA 2EZVA 1HFGA 3MAQA 5IP9H 4L8JA 4K0KQ 1QOHA 3OTOQ 3J81i 2JA9A 1UEBA 1NSNS 3EN2A 5BR8Q 1K3RA 3K5OA 1MHWC 5HGTA 2N49A 5JAVA 4KY5A 4A75A 5M5YH 4G57A 2KJXA 4HIMA 4V190 4UP8A 1E0BA 1E24A 1O78A 5JPMC 1DCZA 1SEBD 2HIXA 1CHPD 3CRKC 1AFPA 1JWUD 1LTBD 2F1MA 3S1RH 1PH2A 3BG3A 4H02A 1A2UA 3K7AH 5J3BA 4IQZA 5JVH3 2G9DA 4DK0A 4XQJA 1VF7A 3HP3A 3AMUA 3TN2A 1IBKQ 4HEDA 3VA7A 3HOZB 2F0TA 1H9SB 2HHHQ 3VYTA 4BBRG 1CTMA 2ZTDA 2NZ1D 1HA5A 3GTKB 5IGGA 2IX0A 2XRQD 3IRBA 5K36H 3M4OB 5IP7G 2K14A 1W2BA 1EY9A 1X3GA 1EY4A 2NVYB 1X3PA 1SAPA 3A54A 1UE6A 1YHBA 2K4KA 4DR4Q 1ICFB 1LTLA 1SLJA 1U4LA 1R9TB 1I6VC 4GOPA 2NVQB 4C3HB 3TDQA 1K28A 3I7FA 4B3SL 4EX5A 2XTIA 3UE1A 4K5XA 1SYBA 4EQNA 4LF8Q 5M3FH 3HOVB 2AHOB 4FF1A 2KCTA 3NELA 2RKSA 3E9IA 3S1RB 1D5MC 4RMFA 1OXXK 4J15A 4OWXB 5CBEE 2IX1A 3CCQA 4GLXA 3SK8A 1ILPA 1S5FD 1VQ9A 2K1BA 4XYQA 1K8OA 2CFMA 3FDTA 1L0XB 4LW1A 3JAML 4L5RC 1CM9A 4HIDA 2YTYA 2LXKA 1DONA 2A73B 5KEEA 2E75C 5EPJA 1YHQA 2XGTA 4KHPQ 1IL8A 1KIXA 5J39A 1O7LA 2E74C 4UP7A 3EFXD 3CCSA 3URYA 1U9RA 4HIKA 2WIIB 1XTDA 1YVCA 2DGYA 4JI7Q 4IFDG 3LWUA 5T1GA 3X3MA 2KEDA 1O80A 2IL8A 4L6TB 2UU9L 1SROA 4BY7G 2F0IA 1OO9B 4G7HC 2MQHA 4YCVA 3N52A 2PZWA 1G51A 3TBIB 1HHVA 1XNQL 5A35A 2JA8B 2F0SA 5CGKA 3DLLA 2OT2A 2A68C 5FJ8H 1V1PA 2XWJB 4JC0A 1J6QA 4HTHA 1RODA 5AJ3Q 3W3AA 3CC7A 2NVXH 4NXMQ 5CV9A 1MSHA 4B3RL 1LYLA 1I4RA 5ELBA 3HOXH 4YWMA 2KA7A 1WTXA 3K5MA 4ZK9B 3CKIB 2PCFB 3C46A 3CPWA 1Q1BA 4B3SQ 2D2CC 2UUAQ 4P2CB 1K8MA 5DEHA 4X62L 4L5SA 3Q8DA 3TZDA 2ZM6Q 3VYUA 3NQTA 2L1BA 2L55A 3BVMA 3CCLA 4OO1G 4PZ8A 1ZKOA 3NBHB 4PMCA 1V1QA 3HOWB 4XT3B 4C3IH 2BDOA 4RH6A 1F9PA 4WJ4A 2B63G 2VNUD 1BCPD 1GVPA 1PRTC 5C5MA 1T5EA 5IGCA 4A3IH 2UXDQ 2WINB 5GADC 3AB9A 1JORA 5C4ZA 4DV3L 3PO3G 1I3QH 4GLVB 1QZGA 3IFDA 1B7YB 2E2DC 4KKUA 4A3MG 2HIVA 5AJ3L 2ENBA 1EU3A 4DA2A 2EJGC 3C2PA 1CZWA 1HPCA 1PH5A 4LUVA 1JOOA 3GTMH 1Y8OB 3K7UC 1QCBD 3D0FA 4HJ5A 1MI2A 1WTVA 3OHXC 5NUCA 1HQMC 1X3QA 1SNOA 3RR5A 4GZYC 1U0LA 1SYCA 3M7NA 2SOBA 4JI4Q 3R2IA 1I6HH 2F0OA 4HCSA 1VQOA 4A93B 4HMIA 5M3FB 4KI0A 1SMYD 4X3KA 1SE3A 2HDMA 4ZUIA 4X3SA 2X6GA 5TSSA 1Y14B 4EQPA 3BDCA 2E5LL 4FYDA 3I4MH 4IUNA 4C2MB 1I4QA 4DR4L 2B2VA 3Q22A 4A3KG 2ALYB 3HOVG 5ELDA 4CJ1B 3NHHA 2MO0A 3ND9A 1SNQA 1SNPA 4A3EG 2F3WA 2R7FA 4LUOA 2PYKA 3H3VC 4X65L 1IKLA 4JK1C 5C3EG 1F2ZA 2NTTA 3NEMA 1FJGQ 1ML0D 4CDEC 1PYSB 3FPPA 4IUQA 3TS0A 3BU2A 2VW9A 2EQSA 4QCLA 4FXKC 3CC4A 3KBGA 4EGVA 1S4ZA 1IBLL 2K50A 3CQZH 3PUYA 4MN3A 1EQVA 1YI2A 4I7ZC 5T1IA 2B2VC 3S15B 1GD7A 3HOUG 3CHBD 3J81L 3A7LA 1YNNC 5CYUA 2R7ZG 3CP0A 4X64L 1S5ED 1EL0A 3FHWA 1XPUA 3T1HQ 2UXCQ 1CKOA 1SYFA 4OWWB 2CW0D 2B63H 3BYYB 4OIJA 4BXXG 2O5IC 3GV6A 1ILQA 2RQXA 4JW0A 3ONAB 2VXWA 4EQ5A 3T56B 4P74A 2Q8RE 1QUQB 1B3AA 3H09A 4A3JG 4R4CA 3STBC 1AEXA 5I9OA 3WOFA 3U58A 1KHIA 1G6PA 4LFBQ 4FF4A 1HTLD 1S72A 1HRJA 3HOYB 2RDHA 3A5UA 2QEXA 2K33A 1GUGA 2TSSA 1BDOA 2A68D 5C5LA 2EJFC 4V0BA 4A76A 4B3TQ 4A3CG 2UXDL 4C1NK 1Y1VH 1LTID 2J4XA 2PMZB 4JG2A 5KYIA 4QL5A 3GP7A 3DEOA 3FVQA 1R9TH 2Q2IA 2WFWA 1KABA 1HNXL 2EYHA 2AQ3B 4PZ7A 3K0XA 1I94L 3J7A5 1O7IA 3KJOA 3GTPB 5IGEA 3PO2G 3FMCA 1RL2A 2EYOA 3HOVH 2B63B 5KNBA 2YV5A 4FF3A 2A6HD 1PTOD 3V2TA 1VQHA 1AP0A 5IGDA 1F77A 4KY6A 1EFID 4POFA 4DV2Q 3CC2A 1A2TA 2Z4IA 3H6MA 3ULLA 1YNJC 1W6KA 5JOBA 2BA1A 2KHJA 3R3OA 3HFZB 1LV9A 5ELFA 1Z47A 3ER0A 2N78A 4KN4C 3BZCA 2VQEQ 2BE5D 4CKCA 4DNIA 1TWCH 2KUMA 1IBMQ 4ZCKA 2FMCA 3ICEA 4NKLA 4ID6A 3I91A 5D65A 4QUFA 3MFYA 1BCPF 3SK4A 4JI6Q 3T4AC 3J80c 4A3LG 2A69C 3VR2A 5M5WB 1D8LA 1EY0A 4MNOA 2F4IA 1TWAB 5I4DA 1WTQA 5CR3A 3Q6SA 2G5DA 1S40A 5JJLA 1A3UA 5LHY1 3OW7A 1EOTA 2X69A 2Z6BA 3QJYA 1TS4A 5KNCA 2PPBC 5JJIA 1Q8KA 4KN7C 2HUGA 2CQOA 3MA2B 4QGUA 3WOEA 1DOLA 4H7BA 5C44B 4JI1L 2RCNA 2H5XA 4DV4L 1O7YA 1YNJD 4RGTA 1OXSC 1NY4A 4IFDI 3VR3A 2M9VA 3R2TA 3SE0A 4NXML 5HGQA 1N34Q 2A1AA 2NTSA 1F2YA 5C4XB 1PTOC 2PI2E 3A74A 1XXGA 3GV3A 2O5JC 1WTRA 1T5XD 1QB5D 1WCMH 2N88A 2VQEL 4AQYL 3CCUA 4IALA 4KY7A 1ZYRD 3U9OA 4S3SA 2F0MA 1FNUA 2WACA 3OMGA 4BBSG 2R3ZA 2Z8LA 4N9TA 3K5LA 1N32L 1LTAD 3K6OA 4LF5L 4DV2L 2JA5G 1R4QB 4JYAL 3KF8B 2SDFA 1HUMA 5IWAQ 1SE4A 2JA8H 1B3QA 1UE1A 4RHRA 1NR4A 4JI7L 1NMGA 3HOXG 1PH1A 3GTLH 1GUOA 1IBKL 1CA6A 1LT5D 2OQ0A 4OELB 5FLXE 1EIGA 2MP1A 3S2HH 3FKIG 5DLQE 1VQGA 3PMFA 2EYPA 3S15H 1JT8A 5EKIA 1H9MA 1SSOA 3BYTB 4RGNA 2E2JH 4DF7A 3GTGH 1TWGB 4GKJL 1JOKA 4RCNA 2EPBA 1UWVA 4DUZQ 1VQCA 1M4VA 4Z9CB 4KHZA 1QE6A 2RSNA 2V1CC 1U4RA 2ZXRA 4R4TA 1KRTA 4DK1A 3I70A 4B08A 4LF8L 1OXTA 4KMUC 4JI1Q 3FEWX 1CK1A 4DV7Q 4UHVA 3A0JA 4DAVA 5CV5A 2ZJRA 4JI2L 2JA6G 2F0WA 1TXYA 2X6LA 4JCVE 5C4JB 5EAYA 4XDXA 4KD4A 5J1ZA 3PIPA 3HKZB 1KQSA 4YCWA 1BQQT 4R4OA 4NMZA 3D4WA 2JN4A 4O42A 2KOLA 2ZXPA 3Q23A 3T51B 1PFBA 1CZGA 1MJCA 3I72A 4LF7L 3M3YB 1JOQA 1T9HA 2FFKB 4LF4Q 4OX9L 1TWGH 1QVGA 1S5DD 3C3LA 2E2JB 3U4VA 3TP6A 2K28A 2AMCB 2K5WA 4Y7NB 2XNAC 3SK5A 4RWSC 5CMDA 4IFDH 3P20A 3S2HB 1FNWA 1GUWA 1ZYRC 2OXPA 3TZUA 1PH7A 2ZTEA 5EPKA 1PFNA 1BF4A 4A3GH 2GVBA 1TKWB 1HZ9A 2WV6D 4X65Q 2HCCA 1Q81C 1QG7A 2A5HA 1EIFA 1C48A 2JA7B 3GTOH 3MEFA 1BO0A 4LFCL 3OMCA 2PW7A 2ZJQA 4A93H 3NWTA 3F2DA 5KGUA 3HRZC 4K6DA 2PZTA 3I4LA 1IYVA 5C4JH 5L37A 3F2UA 2NWGA 2IX3A 1IHZA 1XPOA 2EOTA 1XNRQ 1Q86C 4NXNL 1VQNA 4P72A 2EYMA 2I5LX 1VQBA 3H91A 5LMUL 5I2YA 2A6EC 1BVSA 2L5TA 4JI6L 3HGBA 2NZHA 2I5MX 4R8NA 2P5ZX 4LFAL 4OXPA 4DR5Q 4GNXA 1Q82C 2K32A 2NYZD 4IPCA 4TSSA 2F03A 3KF6A 3OWEB 1TS3A 2ES2A 4JBJA 3LWEA 4BBSB 1TIID 5ELNA 4OO1H 2YTVA 3JC66 4BBSH 3I4NH 2N8NA 4FXGC 4FXDA 4CJ2C 2F0JA 1MSGA 1PTOF 3NTKA 3SR1A 5IWAL 1YJNA 3J7YW 3GTJH 2EDGA 4DR2L 5C3EH 2LSSA 3S14B 1TWHH 2JA8G 1OXUA 2VS1A 1LT4D 1CUKA 1GKHA 1OTCA 4DNTB 2PZUA 1YHAA 5JVG3 1MGSA 2OTJA 4OONA 2FMMA 1AE3A 3ERSX 1X6OA 2VZAA 1NMFA 3VR5A 4X3TA 5GQOA 4GS3A 1I94Q 2EXZA 1EWIA 1NNXA 3N6RA 2PMZE 2VB2X 5ELEA 3E5SA 4IZ8A 4FDBA 3CCEA 3SXHA 1N8RC 1EQRA 2K04A 1FL0A 3G48A 2TMPA 3J81j 1PXUA 1EYDA 5E3FA 1AN8A 2QDLA 3LX0A 3NBIA 1VS0A 1KD1C 1M1KC 4JPBW 2AQ1B 1AE2A 2G9HD 4R4IA 2J0TD 3S17H 3FP9A 1YIJA 3HOWG 2MHVA 2JJQA 2JA6B 4A3KH 4QUCA 3OYYA 1CT1D 4B3MQ 3GTJB 2V4DA 1L0YB 1IKMA 3U9SA 4R8IA 3DWQA 3MXNA 2SEBD 3QIAA 3PO3B 1HZBA 3V96A 2C9OA 2Q2HA 3NP8A 4C3HH 2RVLA 5GAGC 1Q12A 1BUVT 4XTCS 4A3CH 1KRSA 1XMQL 1GO3E 3CCVA 4IURA 4DR6L 1D2BA 4A3LH 1KNEA 4FP5D 1A0IA 4E6IA 5EKKA 2UXBL 4J6HA 1V1OA 1B53A 4KJNA 2NBFA 4DR3Q 5JEAJ 4ME3A 4RKLA 1CKNB 2WKCA 3MXPA 1Q3LA 5GROA 4JV5Q 3T1YQ 4IUUA 2M2LA 5FLXL 1RHPA 2AUKA 2CW0C 3M4QA 3PF5A 1YJWA 2UXBQ 5M3FG 4HN7A 1SE8A 5LL6X 1EOVA 1JE4A 1X65A 5LMNQ 4IFDJ 4DK3C 2CKZB 3J7AF 5CV8A 2DY7A 2KENA 1K8GA 4BXXH 3GDEA 3KK7A 3RLNA 2K7VA 2PQAB 1JB7A 1HXYD 2L12A 4DV4Q 2C5CA 2JA7G 3HZXA 2O2LD 2ZTCA 1UEAB 2ID0A 4A3JH 1LTTD 1DOMA 4A3EB 1H9KA 1BOSA 3EVQA 3DHQA 4X62Q 3R8BA 1E3PA 4APVA 4LMQD 1VQ5A 2Z1CA 1ET6A 2XN9C 1Z6HA 2JSOA 3GTPH 3MXNB 1NR2A 4CKEA 4TVAB 4DR7Q 4I7AA 4EVOA 1PVOA 1CSQA 5LL6S 3PUXA 1GXDC 3NENA 3NUCA 1GUTA 4YWKA 4M1UB
chains in the Genus database with same CATH topology
1BKBA 2VQFL 1OXVA 4QL5A 2WB1E 3WWVA 1EUJA 1Y1WG 4A3GG 3I55A 5M5XH 3TREA 1C0AA 1R9TH 4GOPB 3VDYA 2Q2IA 2WFWA 4B3ML 1IBML 3CCJA 1HNXL 3A5ZB 4PZ7A 3K0XA 1I94L 1Q7YC 3RZOH 1K8AC 3J7A5 1HR0W 2GN5A 1O7IA 4GLAC 3KJOA 1WOCA 1VQ8A 3PO2G 4R4QA 4WJ3M 3TEHB 2Y0SG 1B70B 1RL2A 1W3SA 2F3IA 5IT9c 3HOVH 1VQLA 1H95A 4IJHA 2NN6I 4BBRH 1PH9A 2YV5A 1K83H 1XMOL 2B3GA 3KDFA 1LUZA 3SGIA 1PV4A 1VQHA 5LMUQ 4O2DA 3G6EA 1PH6A 4DV2Q 1PHJA 4POFA 1VQAA 3CC2A 2K5HA 1TWAH 5C44G 1ASZA 1IZ6A 3ULLA 1N9WA 3BZKA 2LXJA 4QIWE 1K0RA 4JOIA 1V43A 2BA1A 2KHJA 3HFZB 2ZJPA 4JV5L 1L2FA 4IPGA 1Z47A 3ER0A 2BH8A 2N78A 3BZCA 2VQEQ 3HOWH 2K5NA 5C4XG 3PUZA 3U4ZA 4LF7Q 4DNIA 4PMWA 2F52A 3I4NG 1TWCH 2Z6KA 1X54A 4GN4B 3D31A 4AH6A 3OW2A 1IBMQ 5IYDG 1VQDA 3ICEA 4A3DH 1Z9FA 1KXLA 2VQFQ 1NJIC 4A3FG 2JA5H 1FGUA 2AWNA 4AYBE 3J7ZC 2OTJA 4JI6Q 1PH4A 4IPHA 4A3LG 2CWAA 2D0OA 3J80c 2YYZA 2WB1G 3TS2A 4YHHL 3G4SA 4GKJQ 1D8LA 3TQYA 3AFPA 4R1JA 1LM0A 4MNOA 4HJ9A 3S1MH 1HR0L 1X3FA 4BY7H 1J5EL 1VCIA 2A8VA 1X55A 3JAMc 4GN3B 1S40A 1PYBA 1UE7A 2K75A 2E5LQ 1M90C 5JJLA 3PUWA 4P73A 1A63A 2WP8J 2Z6KC 4LF4L 4OX9Q 5JJIA 1PA6A 2R7ZH 3E9HA 3S1QH 1Q8KA 3PO2H 1E22A 2CQOA 3PCOB 4QGUA 1N33L 2JE6I 3L0OA 2L15A 2IHFA 5FLXc 1NBWA 2FXQA 4JI1L 2CCZA 2RCNA 2H5XA 4L5TA 4DV4L 4DK6C 4LFAQ 1OXSC 1NY4A 3KDFB 4DR5L 1HR0Q 4DKAC 1FJGL 4IFDI 3B6YA 4NXML 1P16A 5HGQA 4B3RQ 1HZCA 1N34Q 4JI8Q 3GTQH 1YZ6A 2A1AA 2QA4A 4PZ6A 3W1BA 1U5KA 3HOZG 1CKMA 1JJ2A 2PI2E 3A74A 1XNRL 5BR8L 1IL2A 3H3VH 4HJ8A 1I5FA 1UE5A 2E2HH 4YY3L 3KF6B 3F8TA 1HZAA 1WCMH 2VQEL 3BJUA 1SR3A 4AQYL 2PQAA 3CCUA 2YU9H 5FJ8G 5IP9H 1VQFA 5JJKA 2UUAL 4K0KQ 4IJLA 3OTOQ 1XJVA 1AH9A 3J81i 2JA9A 2R6GA 1SRUA 2Z0SA 4DPGA 4LFCQ 1UEBA 4BBSG 1EYGA 4LWCA 2KHIA 3EN2A 5BR8Q 1MIUA 1K3RA 3J80i 4DV7L 1N32L 2N49A 4LF5L 1VQ6A 4DR6Q 1N34L 4DV2L 4JI3L 2IT1A 1L0WA 5M5YH 4A75A 4A3FH 2JA5G 3PF4A 4HIMA 2EIFA 4TQUS 3KYHC 4JYAL 1HNWL 3CPFA 4UP8A 1E24A 3KF8B 4DV5Q 1GM5A 4GN5A 3F1ZA 5IWAQ 1PH8A 4BA1I 2DUDA 2JA8H 2HIXA 3G71A 4JBMA 1UE1A 4JI0L 4QQBX 2JA7H 1QVFA 2RHSB 4JI7L 1NMGA 2VY3A 3HOXG 2GVAA 1PFSA 4C3JH 1PH1A 3GTLH 1IBKL 3S1RH 1PH2A 3UDXA 3CCMA 2OQ0A 4H02A 3K7AH 5J3BA 4OWTB 4QY7A 3S2HH 1X9NA 4LF6Q 3FKIG 4OO1I 5DLQE 1HH2P 1EQQA 2R92H 1VQGA 3STBD 2JA6H 2I0QA 3L7ZC 1K73C 1IBKQ 3HKSA 3S15H 1JT8A 2E2JH 1ASYA 2C35B 3GTGH 2HHHQ 4GKJL 4BBRG 4A3IG 1VQEA 2ZTDA 1QVCA 1UWVA 1L1OC 1VQCA 2IX0A 4DUZQ 1K9MC 1VQKA 3IRBA 5C44H 1XPRA 5IP7G 2K14A 4KHZA 1W2BA 4LF5Q 2V1CC 4A3BG 3CF5A 3UDFA 4JI3Q 4JI4L 4R4TA 1KRTA 3I4OA 5C0XG 1X3GA 1S3OA 1CSPA 4LF8L 1X56A 1OXTA 4JI1Q 1VQIA 3GO5A 1UE6A 1YHBA 4DV7Q 3CMEA 4YCUA 2K4KA 4DR4Q 4X6AH 3A0JA 1LTLA 1SLJA 4P75A 2MO1A 3RLOA 4GOPA 3AFQA 2ASBA 5IP9G 4ALPA 1E1OA 2ZJRA 4JI2L 3I7FA 2JA6G 4B3SL 4EX5A 2XTIA 4GNXC 3UE1A 1TXYA 2RHQB 1MJEA 2Q2TA 5IYDH 4LF8Q 1C9OA 4JCVE 4DV6L 4UP9A 5E7NA 4XIGS 5M3FH 1XNQQ 5EAYA 1PVOA 2AHOB 2KCTA 1VQPA 3PIPA 3NELA 1Q1EA 4DAYB 1KQSA 4JI5L 3E9IA 3ZJYC 5K36G 1N36Q 3PGZA 1D7QA 4YCWA 4RMFA 1FVIA 1OXXK 4DV1L 4J15A 4KLKA 4OWXB 3CW2C 1EIYB 2IX1A 3CCQA 4NXNQ 4R4OA 2HQLA 4GLXA 4DR2Q 4IOAA 1VQ9A 1DGSA 4X66Q 2ATWA 1N32Q 4DAMA 1KAWA 2AKWB 2CFMA 2YTXA 1C7YA 1G291 4LW1A 2RF4A 1BBWA 4L5RC 2N3SA 1X3EA 1MJCA 2VL6A 1HNXQ 4LF7L 2WAQE 4HIDA 3GTKH 2YTYA 2LXKA 1T9HA 2ZM6L 4LF4Q 4OX9L 2Q2UA 1TWGH 1YHQA 1QVGA 4AIMA 2XGTA 1Q46A 4KHPQ 3K80C 2WAQG 1KIXA 3U4VA 1MKHA 3RZDH 2UU9Q 3ULJA 1YITA 4UP7A 5C0XI 3CCSA 2AMCB 4HIKA 4HIOA 4L5QA 1XTDA 1YVCA 2DGYA 3CCRA 4JI7Q 3M9BA 4NB3A 4IFDG 2F4VQ 3ULPA 5LMNL 1PH7A 2D62A 2ZTEA 2UU9L 1SROA 2GVBA 4BY7G 1HZ9A 4X65Q 4A3GH 2K52A 1Q81C 2MQHA 2NN6G 1A8VA 4YCVA 2R93H 1EIFA 4JBWA 1G51A 1TWFH 2MNAA 1XNQL 3GTOH 3MEFA 1HJPA 4LFCL 4BY1G 4DV6Q 1V9PA 3RN2A 4YWLA 3DLLA 2ZJQA 3K8AA 2NVYH 4A93H 1YJ9A 3F2DA 4JOIC 3HOUH 3HKZG 3TRZA 2UUCL 3F2BA 4O0AA 3PUVA 5FJ8H 3S1NH 4A3BH 5GAEC 2R92G 5C4JH 4DR3L 4JC0A 1J6QA 2OTLA 3HKZE 1HNZQ 1WFQA 3KOJA 1XPOA 5AJ3Q 1VQMA 1XNRQ 3CC7A 4NXNL 1Q86C 4P72A 2NVXH 1VQNA 3RLFA 4NXMQ 2NVTH 2I5LX 1VQBA 5LMUL 5H1SE 4B3RL 1QUQA 1LYLA 1BVSA 4JI8L 4JI6L 2NVQH 2NZHA 3HOYH 2I5MX 3HOXH 3PIOA 4DV0L 1SMXA 1XMOQ 4LFAL 1I50H 3T1HL 2PI2A 4YWMA 4OXPA 5FLMH 4DR5Q 2UXCL 4RG1A 3L2PA 4GNXA 4C2MH 1Q82C 3K81C 4MZ9A 4LF9Q 1JE5A 4IPCA 3CPWA 1Q1BA 3KF6A 3M4PA 4B3SQ 3OTOL 4GOPC 4A93G 3UE0A 2ES2A 2UUAQ 4X62L 4L5SA 4JBJA 1IYJB 3Q8DA 3CMAA 5ELNA 2ZM6Q 2YTVA 3JC66 4BBSH 3CCLA 3I4NH 4OO1G 2N8NA 3J81c 2Y0SE 4DR1L 2UUBQ 4PZ8A 3NBHB 3EIVA 1V1QA 1WJJA 2EXDA 4C3IH 5IWAL 4UPAA 3W5OA 1YJNA 3H3VI 2B63G 2VNUD 4HJ7A 4WJ4A 3GTJH 4DR7L 1CKNA 1GVPA 1Y1VG 4LUZA 4DR2L 3CD6A 5C3EH 4A3IH 2LSSA 2F4VL 2UXDQ 1TWHH 4Y7NH 1OXUA 5GADC 4YHHQ 3CXCA 4JI0Q 2JA8G 1PH3A 2VS1A 4DV3L 3PO3G 1CUKA 1GKHA 1I3QH 1OTCA 2BA0A 1HNWQ 4GLVB 1QZGA 1YEZA 1B7YB 1YHAA 4JI2Q 4K0KL 3AQQA 4A3MG 4OONA 2HIVA 5AJ3L 2NZOA 5C0XJ 4UY8C 4BY1H 3ERSX 1AE3A 1X6OA 2VZAA 5M5WH 1NMFA 4A4IA 4A3MH 1HNZL 3F2CA 4LF6L 2QGQA 1BBUA 5GQOA 4GS3A 1I94Q 1PH5A 4IO9A 3AYHB 4BA2I 1EWIA 5C4XH 1QZHA 1JJCB 4LF9L 4LUVA 1EFWA 2PMZE 3GTMH 1YBYA 3H15A 2IHEA 3K7UC 3D0FA 4HJ5A 1E7ZA 1L1OA 4FDBA 2D0PA 3CCEA 3PV0A 2MFIA 1NE3A 1N8RC 3RR5A 1EQRA 1U0LA 4DUZL 1FL0A 4X66L 3JAMi 4JBKA 3G48A 3J81j 2JK8A 4JI4Q 3M7NA 5IE8A 1I6HH 3LGJA 2PNHA 1N36L 4DV5L 1VQOA 3PO3H 1B8AA 3U50C 1VQ4A 3GD7A 3H0GG 2R93G 1VS0A 3I2ZA 1KD1C 1M1KC 1JMCA 4KI0A 2B29A 5FLMG 2JEBI 1AE2A 4R4IA 1SN8A 3I56A 3RNUA 3S17H 2UUBL 2UUCQ 4DUYQ 4KHPL 3FP9A 3PSIA 1Y14B 1YIJA 3HOWG 2KBNA 1WCMG 1N33Q 2JJQA 2E5LL 1VQJA 2AWOA 2K5VA 4GKKL 3I4MH 3FKIH 4A3KH 3S14H 3OYYA 4DR4L 5ELOA 4B3MQ 5M3MH 4A3KG 3DM3A 1IBLQ 2ALYB 3HOVG 3EBEA 2MO0A 1HZBA 4MTNA 3M85A 5HY6A 4P71A 2E2IH 4QJFA 4A3EG 5IYBG 1A62A 2Q2HA 4C3HH 2R7FA 4LUOA 4A3DG 5GAGC 1Q12A 4X65L 3AEVA 5C3EG 1KC8C 1IXRA 2JQOA 4XTCS 1VQ7A 4A3CH 1KRSA 1XMQL 1GO3E 3NEMA 3CCVA 4B3TL 1FJGQ 4DR6L 5GAHC 1PYSB 3HOYG 4A3LH 5LMNW 2VUMG 3TS0A 1A0IA 3BU2A 2E8GA 2VW9A 1Y1WH 2EQSA 3RN5A 2VUMH 3CAMA 1KL9A 4X64Q 3KJPA 2UXBL 3CC4A 4DR3Q 1WI5A 4Y52H 4LFBL 1E1TA 5JEAJ 1IBLL 4ME3A 2K50A 3CQZH 3PUYA 2OCEA 4YY3Q 3I4MG 1CKNB 4NPSA 1YI2A 5GROA 1J5EQ 1GD7A 3HOUG 4DUYL 3KFUA 3T1YQ 4JV5Q 4POGA 5JEAG 2R7ZG 3PF5A 3M4QA 1YJWA 3CP0A 4X64L 2UXBQ 5M3FG 1SE8A 5IYCH 4IOCA 1L1OB 1YNXA 1EOVA 3FHWA 1XPUA 3T1HQ 2UXCQ 1CKOA 5IYCG 1X65A 5LMNQ 4OWWB 1SFOH 2B63H 4IFDJ 4DK3C 2CKZB 4JI5Q 2KENA 1K8GA 4BXXH 4JYAQ 3GDEA 3RLNA 5IP7H 2R7DA 3UDGA 2BH2A 2PQAB 2A19A 1JB7A 4BXXG 2HHHL 4DV4Q 4GNXB 2JA7G 5IY0A 2I5HA 3HOZH 3M3YH 2ZTCA 4AYBG 4DR1Q 2ID0A 4A3JH 3T1YL 4EQ5A 4P74A 1QUQB 4AQYQ 4A3JG 2OWOA 3S16H 4R4CA 4GKKQ 3STBC 1WYDA 4X62Q 2IY5B 3M4OH 3S2DH 1RIPA 3U58A 1KHIA 5M3MG 2CWPA 2HT1A 1G6PA 4LFBQ 1NTGA 1E3PA 1P8LA 4PG3A 4APVA 1S72A 3W1GA 1VQ5A 4LNQA 3A5UA 2QEXA 2OQKA 4DV3Q 4A3EH 5IYBH 3S24A 3GTPH 4IPDA 3MXNB 4DV0Q 3E0EA 4TVAB 4DR7Q 4DV1Q 2KCMA 2UXDL 4A76A 1CSQA 3KLWA 1XMQQ 4B3TQ 1Y1VH 3PUXA 2JEAI 4A3CG 1JJGA 4HJAA 3UDIA 3NENA 4JG2A 3H0GH 4YWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKB A;  2VQF L;  1OXV A;  4QL5 A;  2WB1 E;  3WWV A;  1EUJ A;  1Y1W G;  4A3G G;  3I55 A;  5M5X H;  3TRE A;  1C0A A;  1R9T H;  4GOP B;  3VDY A;  2Q2I A;  2WFW A;  4B3M L;  1IBM L;  3CCJ A;  1HNX L;  3A5Z B;  4PZ7 A;  3K0X A;  1I94 L;  1Q7Y C;  3RZO H;  1K8A C;  3J7A 5;  1HR0 W;  2GN5 A;  1O7I A;  4GLA C;  3KJO A;  1WOC A;  1VQ8 A;  3PO2 G;  4R4Q A;  4WJ3 M;  3TEH B;  2Y0S G;  1B70 B;  1RL2 A;  1W3S A;  2F3I A;  5IT9 c;  3HOV H;  1VQL A;  1H95 A;  4IJH A;  2NN6 I;  4BBR H;  1PH9 A;  2YV5 A;  1K83 H;  1XMO L;  2B3G A;  3KDF A;  1LUZ A;  3SGI A;  1PV4 A;  1VQH A;  5LMU Q;  4O2D A;  3G6E A;  1PH6 A;  4DV2 Q;  1PHJ A;  4POF A;  1VQA A;  3CC2 A;  2K5H A;  1TWA H;  5C44 G;  1ASZ A;  1IZ6 A;  3ULL A;  1N9W A;  3BZK A;  2LXJ A;  4QIW E;  1K0R A;  4JOI A;  1V43 A;  2BA1 A;  2KHJ A;  3HFZ B;  2ZJP A;  4JV5 L;  1L2F A;  4IPG A;  1Z47 A;  3ER0 A;  2BH8 A;  2N78 A;  3BZC A;  2VQE Q;  3HOW H;  2K5N A;  5C4X G;  3PUZ A;  3U4Z A;  4LF7 Q;  4DNI A;  4PMW A;  2F52 A;  3I4N G;  1TWC H;  2Z6K A;  1X54 A;  4GN4 B;  3D31 A;  4AH6 A;  3OW2 A;  1IBM Q;  5IYD G;  1VQD A;  3ICE A;  4A3D H;  1Z9F A;  1KXL A;  2VQF Q;  1NJI C;  4A3F G;  2JA5 H;  1FGU A;  2AWN A;  4AYB E;  3J7Z C;  2OTJ A;  4JI6 Q;  1PH4 A;  4IPH A;  4A3L G;  2CWA A;  2D0O A;  3J80 c;  2YYZ A;  2WB1 G;  3TS2 A;  4YHH L;  3G4S A;  4GKJ Q;  1D8L A;  3TQY A;  3AFP A;  4R1J A;  1LM0 A;  4MNO A;  4HJ9 A;  3S1M H;  1HR0 L;  1X3F A;  4BY7 H;  1J5E L;  1VCI A;  2A8V A;  1X55 A;  3JAM c;  4GN3 B;  1S40 A;  1PYB A;  1UE7 A;  2K75 A;  2E5L Q;  1M90 C;  5JJL A;  3PUW A;  4P73 A;  1A63 A;  2WP8 J;  2Z6K C;  4LF4 L;  4OX9 Q;  5JJI A;  1PA6 A;  2R7Z H;  3E9H A;  3S1Q H;  1Q8K A;  3PO2 H;  1E22 A;  2CQO A;  3PCO B;  4QGU A;  1N33 L;  2JE6 I;  3L0O A;  2L15 A;  2IHF A;  5FLX c;  1NBW A;  2FXQ A;  4JI1 L;  2CCZ A;  2RCN A;  2H5X A;  4L5T A;  4DV4 L;  4DK6 C;  4LFA Q;  1OXS C;  1NY4 A;  3KDF B;  4DR5 L;  1HR0 Q;  4DKA C;  1FJG L;  4IFD I;  3B6Y A;  4NXM L;  1P16 A;  5HGQ A;  4B3R Q;  1HZC A;  1N34 Q;  4JI8 Q;  3GTQ H;  1YZ6 A;  2A1A A;  2QA4 A;  4PZ6 A;  3W1B A;  1U5K A;  3HOZ G;  1CKM A;  1JJ2 A;  2PI2 E;  3A74 A;  1XNR L;  5BR8 L;  1IL2 A;  3H3V H;  4HJ8 A;  1I5F A;  1UE5 A;  2E2H H;  4YY3 L;  3KF6 B;  3F8T A;  1HZA A;  1WCM H;  2VQE L;  3BJU A;  1SR3 A;  4AQY L;  2PQA A;  3CCU A;  2YU9 H;  5FJ8 G;  5IP9 H;  1VQF A;  5JJK A;  2UUA L;  4K0K Q;  4IJL A;  3OTO Q;  1XJV A;  1AH9 A;  3J81 i;  2JA9 A;  2R6G A;  1SRU A;  2Z0S A;  4DPG A;  4LFC Q;  1UEB A;  4BBS G;  1EYG A;  4LWC A;  2KHI A;  3EN2 A;  5BR8 Q;  1MIU A;  1K3R A;  3J80 i;  4DV7 L;  1N32 L;  2N49 A;  4LF5 L;  1VQ6 A;  4DR6 Q;  1N34 L;  4DV2 L;  4JI3 L;  2IT1 A;  1L0W A;  5M5Y H;  4A75 A;  4A3F H;  2JA5 G;  3PF4 A;  4HIM A;  2EIF A;  4TQU S;  3KYH C;  4JYA L;  1HNW L;  3CPF A;  4UP8 A;  1E24 A;  3KF8 B;  4DV5 Q;  1GM5 A;  4GN5 A;  3F1Z A;  5IWA Q;  1PH8 A;  4BA1 I;  2DUD A;  2JA8 H;  2HIX A;  3G71 A;  4JBM A;  1UE1 A;  4JI0 L;  4QQB X;  2JA7 H;  1QVF A;  2RHS B;  4JI7 L;  1NMG A;  2VY3 A;  3HOX G;  2GVA A;  1PFS A;  4C3J H;  1PH1 A;  3GTL H;  1IBK L;  3S1R H;  1PH2 A;  3UDX A;  3CCM A;  2OQ0 A;  4H02 A;  3K7A H;  5J3B A;  4OWT B;  4QY7 A;  3S2H H;  1X9N A;  4LF6 Q;  3FKI G;  4OO1 I;  5DLQ E;  1HH2 P;  1EQQ A;  2R92 H;  1VQG A;  3STB D;  2JA6 H;  2I0Q A;  3L7Z C;  1K73 C;  1IBK Q;  3HKS A;  3S15 H;  1JT8 A;  2E2J H;  1ASY A;  2C35 B;  3GTG H;  2HHH Q;  4GKJ L;  4BBR G;  4A3I G;  1VQE A;  2ZTD A;  1QVC A;  1UWV A;  1L1O C;  1VQC A;  2IX0 A;  4DUZ Q;  1K9M C;  1VQK A;  3IRB A;  5C44 H;  1XPR A;  5IP7 G;  2K14 A;  4KHZ A;  1W2B A;  4LF5 Q;  2V1C C;  4A3B G;  3CF5 A;  3UDF A;  4JI3 Q;  4JI4 L;  4R4T A;  1KRT A;  3I4O A;  5C0X G;  1X3G A;  1S3O A;  1CSP A;  4LF8 L;  1X56 A;  1OXT A;  4JI1 Q;  1VQI A;  3GO5 A;  1UE6 A;  1YHB A;  4DV7 Q;  3CME A;  4YCU A;  2K4K A;  4DR4 Q;  4X6A H;  3A0J A;  1LTL A;  1SLJ A;  4P75 A;  2MO1 A;  3RLO A;  4GOP A;  3AFQ A;  2ASB A;  5IP9 G;  4ALP A;  1E1O A;  2ZJR A;  4JI2 L;  3I7F A;  2JA6 G;  4B3S L;  4EX5 A;  2XTI A;  4GNX C;  3UE1 A;  1TXY A;  2RHQ B;  1MJE A;  2Q2T A;  5IYD H;  4LF8 Q;  1C9O A;  4JCV E;  4DV6 L;  4UP9 A;  5E7N A;  4XIG S;  5M3F H;  1XNQ Q;  5EAY A;  1PVO A;  2AHO B;  2KCT A;  1VQP A;  3PIP A;  3NEL A;  1Q1E A;  4DAY B;  1KQS A;  4JI5 L;  3E9I A;  3ZJY C;  5K36 G;  1N36 Q;  3PGZ A;  1D7Q A;  4YCW A;  4RMF A;  1FVI A;  1OXX K;  4DV1 L;  4J15 A;  4KLK A;  4OWX B;  3CW2 C;  1EIY B;  2IX1 A;  3CCQ A;  4NXN Q;  4R4O A;  2HQL A;  4GLX A;  4DR2 Q;  4IOA A;  1VQ9 A;  1DGS A;  4X66 Q;  2ATW A;  1N32 Q;  4DAM A;  1KAW A;  2AKW B;  2CFM A;  2YTX A;  1C7Y A;  1G29 1;  4LW1 A;  2RF4 A;  1BBW A;  4L5R C;  2N3S A;  1X3E A;  1MJC A;  2VL6 A;  1HNX Q;  4LF7 L;  2WAQ E;  4HID A;  3GTK H;  2YTY A;  2LXK A;  1T9H A;  2ZM6 L;  4LF4 Q;  4OX9 L;  2Q2U A;  1TWG H;  1YHQ A;  1QVG A;  4AIM A;  2XGT A;  1Q46 A;  4KHP Q;  3K80 C;  2WAQ G;  1KIX A;  3U4V A;  1MKH A;  3RZD H;  2UU9 Q;  3ULJ A;  1YIT A;  4UP7 A;  5C0X I;  3CCS A;  2AMC B;  4HIK A;  4HIO A;  4L5Q A;  1XTD A;  1YVC A;  2DGY A;  3CCR A;  4JI7 Q;  3M9B A;  4NB3 A;  4IFD G;  2F4V Q;  3ULP A;  5LMN L;  1PH7 A;  2D62 A;  2ZTE A;  2UU9 L;  1SRO A;  2GVB A;  4BY7 G;  1HZ9 A;  4X65 Q;  4A3G H;  2K52 A;  1Q81 C;  2MQH A;  2NN6 G;  1A8V A;  4YCV A;  2R93 H;  1EIF A;  4JBW A;  1G51 A;  1TWF H;  2MNA A;  1XNQ L;  3GTO H;  3MEF A;  1HJP A;  4LFC L;  4BY1 G;  4DV6 Q;  1V9P A;  3RN2 A;  4YWL A;  3DLL A;  2ZJQ A;  3K8A A;  2NVY H;  4A93 H;  1YJ9 A;  3F2D A;  4JOI C;  3HOU H;  3HKZ G;  3TRZ A;  2UUC L;  3F2B A;  4O0A A;  3PUV A;  5FJ8 H;  3S1N H;  4A3B H;  5GAE C;  2R92 G;  5C4J H;  4DR3 L;  4JC0 A;  1J6Q A;  2OTL A;  3HKZ E;  1HNZ Q;  1WFQ A;  3KOJ A;  1XPO A;  5AJ3 Q;  1VQM A;  1XNR Q;  3CC7 A;  4NXN L;  1Q86 C;  4P72 A;  2NVX H;  1VQN A;  3RLF A;  4NXM Q;  2NVT H;  2I5L X;  1VQB A;  5LMU L;  5H1S E;  4B3R L;  1QUQ A;  1LYL A;  1BVS A;  4JI8 L;  4JI6 L;  2NVQ H;  2NZH A;  3HOY H;  2I5M X;  3HOX H;  3PIO A;  4DV0 L;  1SMX A;  1XMO Q;  4LFA L;  1I50 H;  3T1H L;  2PI2 A;  4YWM A;  4OXP A;  5FLM H;  4DR5 Q;  2UXC L;  4RG1 A;  3L2P A;  4GNX A;  4C2M H;  1Q82 C;  3K81 C;  4MZ9 A;  4LF9 Q;  1JE5 A;  4IPC A;  3CPW A;  1Q1B A;  3KF6 A;  3M4P A;  4B3S Q;  3OTO L;  4GOP C;  4A93 G;  3UE0 A;  2ES2 A;  2UUA Q;  4X62 L;  4L5S A;  4JBJ A;  1IYJ B;  3Q8D A;  3CMA A;  5ELN A;  2ZM6 Q;  2YTV A;  3JC6 6;  4BBS H;  3CCL A;  3I4N H;  4OO1 G;  2N8N A;  3J81 c;  2Y0S E;  4DR1 L;  2UUB Q;  4PZ8 A;  3NBH B;  3EIV A;  1V1Q A;  1WJJ A;  2EXD A;  4C3I H;  5IWA L;  4UPA A;  3W5O A;  1YJN A;  3H3V I;  2B63 G;  2VNU D;  4HJ7 A;  4WJ4 A;  3GTJ H;  4DR7 L;  1CKN A;  1GVP A;  1Y1V G;  4LUZ A;  4DR2 L;  3CD6 A;  5C3E H;  4A3I H;  2LSS A;  2F4V L;  2UXD Q;  1TWH H;  4Y7N H;  1OXU A;  5GAD C;  4YHH Q;  3CXC A;  4JI0 Q;  2JA8 G;  1PH3 A;  2VS1 A;  4DV3 L;  3PO3 G;  1CUK A;  1GKH A;  1I3Q H;  1OTC A;  2BA0 A;  1HNW Q;  4GLV B;  1QZG A;  1YEZ A;  1B7Y B;  1YHA A;  4JI2 Q;  4K0K L;  3AQQ A;  4A3M G;  4OON A;  2HIV A;  5AJ3 L;  2NZO A;  5C0X J;  4UY8 C;  4BY1 H;  3ERS X;  1AE3 A;  1X6O A;  2VZA A;  5M5W H;  1NMF A;  4A4I A;  4A3M H;  1HNZ L;  3F2C A;  4LF6 L;  2QGQ A;  1BBU A;  5GQO A;  4GS3 A;  1I94 Q;  1PH5 A;  4IO9 A;  3AYH B;  4BA2 I;  1EWI A;  5C4X H;  1QZH A;  1JJC B;  4LF9 L;  4LUV A;  1EFW A;  2PMZ E;  3GTM H;  1YBY A;  3H15 A;  2IHE A;  3K7U C;  3D0F A;  4HJ5 A;  1E7Z A;  1L1O A;  4FDB A;  2D0P A;  3CCE A;  3PV0 A;  2MFI A;  1NE3 A;  1N8R C;  3RR5 A;  1EQR A;  1U0L A;  4DUZ L;  1FL0 A;  4X66 L;  3JAM i;  4JBK A;  3G48 A;  3J81 j;  2JK8 A;  4JI4 Q;  3M7N A;  5IE8 A;  1I6H H;  3LGJ A;  2PNH A;  1N36 L;  4DV5 L;  1VQO A;  3PO3 H;  1B8A A;  3U50 C;  1VQ4 A;  3GD7 A;  3H0G G;  2R93 G;  1VS0 A;  3I2Z A;  1KD1 C;  1M1K C;  1JMC A;  4KI0 A;  2B29 A;  5FLM G;  2JEB I;  1AE2 A;  4R4I A;  1SN8 A;  3I56 A;  3RNU A;  3S17 H;  2UUB L;  2UUC Q;  4DUY Q;  4KHP L;  3FP9 A;  3PSI A;  1Y14 B;  1YIJ A;  3HOW G;  2KBN A;  1WCM G;  1N33 Q;  2JJQ A;  2E5L L;  1VQJ A;  2AWO A;  2K5V A;  4GKK L;  3I4M H;  3FKI H;  4A3K H;  3S14 H;  3OYY A;  4DR4 L;  5ELO A;  4B3M Q;  5M3M H;  4A3K G;  3DM3 A;  1IBL Q;  2ALY B;  3HOV G;  3EBE A;  2MO0 A;  1HZB A;  4MTN A;  3M85 A;  5HY6 A;  4P71 A;  2E2I H;  4QJF A;  4A3E G;  5IYB G;  1A62 A;  2Q2H A;  4C3H H;  2R7F A;  4LUO A;  4A3D G;  5GAG C;  1Q12 A;  4X65 L;  3AEV A;  5C3E G;  1KC8 C;  1IXR A;  2JQO A;  4XTC S;  1VQ7 A;  4A3C H;  1KRS A;  1XMQ L;  1GO3 E;  3NEM A;  3CCV A;  4B3T L;  1FJG Q;  4DR6 L;  5GAH C;  1PYS B;  3HOY G;  4A3L H;  5LMN W;  2VUM G;  3TS0 A;  1A0I A;  3BU2 A;  2E8G A;  2VW9 A;  1Y1W H;  2EQS A;  3RN5 A;  2VUM H;  3CAM A;  1KL9 A;  4X64 Q;  3KJP A;  2UXB L;  3CC4 A;  4DR3 Q;  1WI5 A;  4Y52 H;  4LFB L;  1E1T A;  5JEA J;  1IBL L;  4ME3 A;  2K50 A;  3CQZ H;  3PUY A;  2OCE A;  4YY3 Q;  3I4M G;  1CKN B;  4NPS A;  1YI2 A;  5GRO A;  1J5E Q;  1GD7 A;  3HOU G;  4DUY L;  3KFU A;  3T1Y Q;  4JV5 Q;  4POG A;  5JEA G;  2R7Z G;  3PF5 A;  3M4Q A;  1YJW A;  3CP0 A;  4X64 L;  2UXB Q;  5M3F G;  1SE8 A;  5IYC H;  4IOC A;  1L1O B;  1YNX A;  1EOV A;  3FHW A;  1XPU A;  3T1H Q;  2UXC Q;  1CKO A;  5IYC G;  1X65 A;  5LMN Q;  4OWW B;  1SFO H;  2B63 H;  4IFD J;  4DK3 C;  2CKZ B;  4JI5 Q;  2KEN A;  1K8G A;  4BXX H;  4JYA Q;  3GDE A;  3RLN A;  5IP7 H;  2R7D A;  3UDG A;  2BH2 A;  2PQA B;  2A19 A;  1JB7 A;  4BXX G;  2HHH L;  4DV4 Q;  4GNX B;  2JA7 G;  5IY0 A;  2I5H A;  3HOZ H;  3M3Y H;  2ZTC A;  4AYB G;  4DR1 Q;  2ID0 A;  4A3J H;  3T1Y L;  4EQ5 A;  4P74 A;  1QUQ B;  4AQY Q;  4A3J G;  2OWO A;  3S16 H;  4R4C A;  4GKK Q;  3STB C;  1WYD A;  4X62 Q;  2IY5 B;  3M4O H;  3S2D H;  1RIP A;  3U58 A;  1KHI A;  5M3M G;  2CWP A;  2HT1 A;  1G6P A;  4LFB Q;  1NTG A;  1E3P A;  1P8L A;  4PG3 A;  4APV A;  1S72 A;  3W1G A;  1VQ5 A;  4LNQ A;  3A5U A;  2QEX A;  2OQK A;  4DV3 Q;  4A3E H;  5IYB H;  3S24 A;  3GTP H;  4IPD A;  3MXN B;  4DV0 Q;  3E0E A;  4TVA B;  4DR7 Q;  4DV1 Q;  2KCM A;  2UXD L;  4A76 A;  1CSQ A;  3KLW A;  1XMQ Q;  4B3T Q;  1Y1V H;  3PUX A;  2JEA I;  4A3C G;  1JJG A;  4HJA A;  3UDI A;  3NEN A;  4JG2 A;  3H0G H;  4YWK A; 
#chains in the Genus database with same CATH topology
 2WB1 E;  1ZEQ X;  3I55 A;  4IN3 A;  3HOU B;  4A3F B;  1SJE D;  1D5X C;  3ITP A;  1C0A A;  2R7Z B;  3RUZ A;  1QNU A;  2HD3 A;  1SMY C;  3A5Z B;  1GUN A;  2IW3 A;  1Q7Y C;  1RDP D;  1B1Z A;  1ZXT A;  4R4Q A;  3TEH B;  1B70 B;  1DJR D;  5ELC A;  3QOJ A;  1VQL A;  4PV1 C;  1STB A;  2H4O A;  1KDA A;  1SYD A;  4O2D A;  3S16 B;  1ENA A;  3BVZ A;  4A3J B;  1IZ6 A;  5DM6 3;  2F0V A;  1N9W A;  2LXJ A;  4QIW E;  2JXM B;  2J7Z A;  1STN A;  4JOI A;  1V43 A;  5EGT A;  3QR8 A;  3PUZ A;  1BBX C;  4PMW A;  2F0H A;  4GN4 B;  3OW2 A;  1BCP C;  1J8I A;  4A3D H;  1Z9F A;  2EY5 A;  1NJI C;  2JA5 H;  3I8Z A;  1FGU A;  3IFT A;  3S9W A;  2AWN A;  4AYB E;  3J7Z C;  4LAA A;  2AUJ D;  4IPH A;  2YYZ A;  1WTH A;  3TS2 A;  2A69 D;  4CHT B;  3TP7 A;  3TQY A;  4R1J A;  1WVL A;  3K7A B;  1PZJ D;  1B9M A;  2MGS A;  2A8V A;  1I4X A;  1X55 A;  3JAM c;  2AQ2 B;  1EIH A;  1PYB A;  3MEH A;  2E5L Q;  3PUW A;  4EQO A;  1A63 A;  2Z6K C;  3E9H A;  4TKO B;  1XYI A;  4HMJ A;  1LAB A;  4MIU A;  1TY0 A;  2L15 A;  1QNK A;  1A6X A;  1PRT B;  5FO9 B;  1RTN A;  4U68 A;  4DK6 C;  1HR0 Q;  3B6Y A;  1VMP A;  3NTI A;  4JI8 Q;  1YZ6 A;  2I46 A;  3W1B A;  1U5K A;  4ZAI A;  4K14 A;  3H3V H;  1AW7 A;  5IOD A;  2EVB A;  3KF6 B;  3TP8 A;  3BJU A;  2PQA A;  5K5P A;  3I73 A;  1VQF A;  1STH A;  5JJK A;  4IJL A;  1AH9 A;  2H1E A;  4XXE A;  2Z0S A;  1MIU A;  4DV7 L;  2DN8 A;  4MTK A;  5DAU A;  4DR6 Q;  5FO7 B;  1N34 L;  2IT1 A;  1L0W A;  4A3F H;  3PF4 A;  2K6A A;  3L9A X;  3KYH C;  3TP5 A;  4DV5 Q;  1GM5 A;  3F1Z A;  2CH4 A;  2DUD A;  4FNF A;  4BA1 I;  3G71 A;  3MZ5 A;  3ND8 A;  4JBM A;  4QQB X;  1KNA A;  2JA7 H;  5CC4 A;  2RHS B;  1QVF A;  2VY3 A;  4OIK A;  1GHK A;  4C3J H;  3QOL A;  3UDX A;  4DAP A;  3CCM A;  4J8Q A;  2K5D A;  2L4N A;  3P75 A;  4QY7 A;  2B2T C;  2R61 A;  1RTO A;  4FO2 A;  2K03 A;  1ENF A;  4LF6 Q;  3Q0A A;  1EQQ A;  2R92 H;  2B2W A;  4NW2 A;  2Q8I B;  3STB D;  1PLF A;  2I0Q A;  3L7Z C;  3DWA A;  2F0G A;  4OGQ C;  1D1K A;  1GHJ A;  2C35 B;  2B39 A;  2I07 B;  1QVC A;  1L1O C;  2OEO A;  3MC0 B;  1A15 A;  2RDF A;  1UUP A;  1EZ6 A;  1XPR A;  3CF5 A;  4JI3 Q;  1Y69 U;  3I4O A;  5C0X G;  3S1Q B;  2ICI A;  3D3R A;  1CSP A;  4RHS A;  1QIL A;  1X56 A;  3IL8 A;  1O7Z A;  4YCU A;  1JB3 A;  1FNV A;  4X6A H;  4P75 A;  2ZXO A;  3RLO A;  1CQV A;  1S5C D;  1G91 A;  3P1H A;  1MJE A;  3W2D A;  2CHB D;  3Q24 A;  5E7N A;  3P7J A;  1GUS A;  4BY1 B;  1WTO A;  1XNQ Q;  3HOX B;  1Y8P B;  2A6E D;  1Q1E A;  4DAY B;  4JI5 L;  5K36 G;  1N36 Q;  3PGZ A;  1FVI A;  1F2L A;  2PO4 A;  4DV1 L;  5F2D A;  4ZQ3 A;  3NE5 B;  4NXN Q;  1RJT A;  4DR2 Q;  1Q8I A;  2F0E A;  4X66 Q;  1N32 Q;  1KAW A;  3NTH A;  2YTX A;  2RF4 A;  1WTW A;  1PDQ A;  4IUV A;  2VL6 A;  1HNX Q;  2B2U C;  3GTK H;  2BOS A;  3D8G A;  2Q2U A;  3I4M B;  4AIM A;  1C8C A;  3X3N A;  1DM0 B;  3RZD H;  1EU4 A;  1H9S A;  2QIL A;  3A55 A;  2EY1 A;  2F4V Q;  4IUT A;  3MWY W;  3GTQ B;  4OEM B;  5I2X A;  1HJP A;  4H44 C;  3K8A A;  2NVY H;  4AYB B;  3HKZ G;  2HCI A;  4O0A A;  4A3B H;  1A3T A;  2R92 G;  3BZD B;  3HKZ E;  1PTO H;  4ODG A;  1HNZ Q;  1VQM A;  1KDC A;  1STE A;  3OIQ A;  4FVM A;  4J1M A;  3PIO 3;  3UI2 A;  1G8Z D;  1EZ8 A;  4DV0 L;  3PIO A;  1H9R A;  1XMO Q;  1I50 H;  2PI2 A;  2EY6 A;  1I50 B;  4C2M H;  3K81 C;  4MZ9 A;  4WFN 3;  1Y1W B;  3M4P A;  4GOP C;  2D5D A;  3UE0 A;  4C3J B;  2L11 A;  1DXM A;  1IYJ B;  2Z4H A;  1K0S A;  2ICE C;  1KDB A;  2Y0S E;  2UUB Q;  3G7L A;  5E4W C;  1YNN D;  5M9O A;  2DNE A;  3QG1 A;  1WCM B;  3W5O A;  5IT9 E;  4HJ7 A;  4DR7 L;  1CKN A;  4O1N A;  4HSP A;  3D4R A;  4ZKC B;  4YHH Q;  5J22 A;  4U67 3;  5IGF A;  1AZQ A;  4DGZ A;  1YEZ A;  2B2W C;  4FF2 A;  1A3V A;  4JI2 Q;  4K0K L;  4UY8 C;  5C0X J;  3C1F A;  4BY1 H;  5M5W H;  1HNZ L;  3BVG A;  1SBB B;  3F2C A;  4LF6 L;  1WD1 A;  2QGQ A;  1BBU A;  1G6Z A;  4RA8 A;  4IO9 A;  3AYH B;  4RGO S;  4BA2 I;  2VUM B;  1GJX A;  1JJC B;  4LF9 L;  1EFW A;  1DZ1 A;  2KVM A;  3H15 A;  3I4N B;  1STG A;  1ONL A;  4ULL A;  4ZRZ A;  1NE3 A;  1PRT F;  1SXT A;  4DUZ L;  4X66 L;  1XTC D;  3D4D A;  3LGJ A;  1HA6 A;  1HCZ A;  4ZYS A;  4DV5 L;  3PO3 H;  1B8A A;  4QMG A;  3U50 C;  3GD7 A;  1VQ4 A;  3I2Z A;  5IOC A;  1JMC A;  5JJZ A;  2XWB B;  4H13 C;  5FLM G;  2WB1 B;  4JVZ A;  2JEB I;  3GTO B;  3GTG B;  1II3 A;  2UUB L;  2UUC Q;  4DUY Q;  1K3B C;  2KBN A;  5C3X A;  1VQJ A;  2AWO A;  5COY A;  2K5V A;  3S1M B;  3FKI H;  4PQX A;  4K6L A;  3DM3 A;  1IBL Q;  1QJO A;  3EBE A;  4MTN A;  4RCO A;  2E2I H;  2LKV A;  3M7G A;  4A3D G;  2PNR C;  4CDC C;  1IXR A;  2JQO A;  1I4G A;  1VQ7 A;  5LMN W;  1S5B D;  4BS9 A;  1XWE A;  1SE2 A;  3RN5 A;  2VUM H;  4X64 Q;  3KJP A;  1PZI D;  4Y52 H;  4L63 B;  1E1T A;  4ILW A;  5G3L F;  4WRD A;  3AU7 A;  3I4M G;  3KF8 A;  3KFU A;  4DUY L;  3E6Z X;  4POG A;  2E2H B;  2NVX B;  4IOC A;  1AZP A;  5IYC G;  2NUC A;  4WJW A;  3MXG A;  1LLR D;  1KTK A;  5I9P A;  5IP7 H;  2Y0S B;  2BH2 A;  2F0U A;  1HTP A;  3MFG A;  2MUY A;  4KKS A;  4K2K A;  1LT6 D;  2KEE A;  4DFA A;  4AYB G;  4DR1 Q;  2XRS D;  2BE5 C;  3T1Y L;  1EWC A;  1LTS D;  3I90 A;  2CVR A;  2OWO A;  2F0L A;  3HS0 C;  2R92 B;  5G3L D;  3H94 A;  1RIP A;  2A74 C;  4IUP A;  5M3M G;  2CWP A;  3IAY A;  1NTG A;  1I4H A;  3W1G A;  2EE1 A;  3S24 A;  5IYB H;  4IPD A;  2YU9 B;  1EYA A;  2KCM A;  4HAE A;  4DV1 Q;  4RAU C;  1E2W A;  1XMQ Q;  3SDZ A;  1FR3 A;  1TWC B;  4HJA A;  3GO5 A;  3G4S A;  3NPP A;  2VQF L;  4A3G G;  3WWV A;  1DD2 A;  1EUJ A;  1Y1W G;  1RF2 D;  5M5X H;  3MHB A;  2L0C A;  3GTL B;  4MHE A;  3A8I E;  1D5Z C;  4C3J G;  3DUZ A;  3RD4 A;  4GOP B;  4B3M L;  1IBM L;  3CCJ A;  3RZO H;  3T53 B;  1PFM A;  2ZT9 C;  2GN5 A;  3EA6 A;  1D1I A;  4GLA C;  1VQ8 A;  2IPK D;  2L9H A;  5IT9 c;  1W3S A;  2F3I A;  1LTR D;  2QKI C;  1H95 A;  1EY6 A;  4BBR H;  1PH9 A;  4PNY A;  1K83 H;  2RA4 A;  1XMO L;  3SGI A;  3KDF A;  1J9O A;  5LMU Q;  3G6E A;  1NAP A;  1VQA A;  5CV4 A;  5FK9 C;  4CDF C;  1ASZ A;  4XQN A;  1EQT A;  2FHT A;  3BZK A;  1K0R A;  1ENC A;  2IJ0 A;  2RDG A;  2ZJP A;  1EEI D;  2B8G A;  1L2F A;  1R4P B;  1TS2 A;  3HOW H;  5HUR A;  3DM1 A;  3U4Z A;  2KEC A;  2F52 A;  3IKJ A;  3I4N G;  1X54 A;  5CBA E;  3ERO A;  1JC7 A;  2WAQ B;  1WD0 A;  4RGM A;  4A3F G;  4C56 C;  5C3W A;  2CH4 W;  2KHS A;  2CWA A;  4I65 A;  2WB1 G;  4YHH L;  4GKJ Q;  3FPU B;  3AFP A;  4HJ9 A;  1LM0 A;  3KLR A;  4DXF A;  1PZK D;  2DNC A;  1CFM A;  3OSO A;  1VCI A;  2XSC A;  2K75 A;  1M90 C;  4X3U A;  1TR5 A;  1B50 A;  4G4K A;  3CQZ B;  3CU7 A;  1XX8 A;  4P73 A;  5EBD A;  2RSO A;  4LF4 L;  4OX9 Q;  5JEA H;  1PA6 A;  3S1Q H;  4A3B B;  3PCO B;  1N33 L;  3L0O A;  3G6J B;  2IHF A;  3VA5 A;  1NBW A;  2FXQ A;  4A3D B;  1TS5 A;  1QWY A;  1IYU A;  4L5T A;  5IIF A;  1F9R A;  1DOK A;  1HFN A;  1FYC A;  4LFA Q;  3KDF B;  5EPL A;  2B8F A;  3DMU A;  1P16 A;  1RCV D;  1V1P B;  3C1E A;  4QIW B;  3SHL A;  5IT9 L;  4PZ6 A;  3HOZ G;  2F3V A;  1CKM A;  1JJ2 A;  1XNR L;  4BBR B;  1IL2 A;  4HJ8 A;  1I5F A;  2SNS A;  3F8T A;  1STY A;  2YU9 H;  1CI3 M;  5FJ8 G;  1PMR A;  2UUA L;  4QB4 A;  1XJV A;  2QW7 A;  2R6G A;  1SRU A;  3NBH A;  4DPG A;  1CHQ D;  5BN3 A;  4LFC Q;  2JYO A;  1EYG A;  4LWC A;  2KHI A;  1E2Z A;  3J80 i;  3J7A V;  1VQ6 A;  2CQA A;  5KND A;  4HSV A;  4C3H G;  1VDZ A;  4JI3 L;  1LT3 D;  2EIF A;  4TQU S;  1HNW L;  3CPF A;  4DNR B;  4XYO A;  4GN5 A;  1PH8 A;  4YIJ A;  1Y1V B;  4JI0 L;  5EKL A;  1M8A A;  1EWH A;  2GVA A;  1PFS A;  3GTM B;  2FIN B;  3E3X A;  1I3Q B;  2VB3 X;  4CGY B;  4OWT B;  1BXT A;  1K83 B;  5M3M B;  1X9N A;  1PTO B;  5E1F A;  4OO1 I;  3K0Y A;  1HH2 P;  5FO8 B;  2JA6 H;  2XIW A;  2RBM A;  1K73 C;  2B2T A;  3HKS A;  1JWM D;  1ASY A;  4N8F A;  4OHJ A;  4DU9 A;  2EY2 A;  4A3I G;  1VQE A;  1K9M C;  2B2Y C;  1JR0 D;  1VQK A;  5C44 H;  4A3G B;  4OL7 A;  4LF5 Q;  2QCP X;  3UDF A;  4PMB A;  4JI4 L;  3DEP A;  1S3O A;  3H0G B;  2R93 B;  4XT1 B;  1VQI A;  2EYL A;  3CME A;  1V8Q A;  2MO1 A;  5FOB B;  2PW5 A;  3ZYY X;  3AFQ A;  3DWP A;  1ICW A;  3BDO A;  2ASB A;  5IP9 G;  4ALP A;  1E1O A;  1U4M A;  4GNX C;  2Q2T A;  5IYD H;  2RHQ B;  1C9O A;  1BR9 A;  1KLG D;  2O4X A;  4UP9 A;  4DV6 L;  4XIG S;  1JQY D;  3OOC A;  5CV6 A;  1F2M A;  1VQP A;  1VMC A;  2XVS A;  1VF5 C;  3ZJY C;  1D7Q A;  2NVT B;  5DNF A;  4B9W A;  4KLK A;  3RZO B;  3CW2 C;  1EIY B;  4RFB A;  2HQL A;  3OWF A;  4KHV A;  5KIX A;  4IOA A;  1DGS A;  2ATW A;  5CV7 A;  4DAM A;  2AKW B;  4K2L A;  1G29 1;  5EJW A;  1C7Y A;  1BBW A;  1G2S A;  1Z7T A;  2N3S A;  1JCK B;  1X3E A;  1SFO B;  2A6H C;  2WAQ E;  1IW7 D;  1JIC A;  3JAM E;  2ZM6 L;  2LMC B;  4ABN A;  1Q46 A;  3K80 C;  2WAQ G;  3T16 A;  1MKH A;  5C4H A;  2UU9 Q;  4DN4 M;  4KV6 A;  3ULJ A;  1YIT A;  1PYW D;  5IGB A;  1W6J A;  5C0X I;  1NCV A;  4HIO A;  4L5Q A;  3CCR A;  3M9B A;  4NB3 A;  3NQI A;  3ULP A;  5D3I B;  5LMN L;  2D62 A;  1I6H B;  3GQB A;  4WOR A;  2K01 A;  2K52 A;  2NN6 G;  1A8V A;  1STA A;  2Z9H A;  4JBW A;  1TWF H;  2MNA A;  2MPM A;  4BY1 G;  1X32 A;  1V9P A;  4DV6 Q;  3RN2 A;  4YWL A;  1KLU D;  3L3O C;  3T13 A;  3HEJ A;  4DXG A;  5ISR A;  2F0K A;  1YJ9 A;  4A3B G;  4JOI C;  3HOU H;  1UNS A;  3TRZ A;  2UUC L;  3F2B A;  3S1N H;  3PUV A;  3VYR A;  3A8K E;  4K8J A;  5GAE C;  4DR3 L;  2QEJ C;  3QB3 A;  2OTL A;  4A3M B;  3J80 L;  1WFQ A;  3KOJ A;  3RLF A;  1Q90 A;  1EY5 A;  2NVT H;  1HQR D;  5H1S E;  1QUQ A;  2NVQ H;  4JI8 L;  3HOY H;  3BDL A;  1SMX A;  3T1H L;  2UXC L;  5FLM H;  4RG1 A;  3L2P A;  3S2D B;  4LF9 Q;  1JE5 A;  1CQF A;  3OTO L;  4A93 G;  2BCO A;  3SK6 A;  4CBV A;  3CMA A;  1ESR A;  1RKN A;  3FRP B;  3J81 c;  4DR1 L;  4UDU C;  4KKT A;  3K57 A;  3EIV A;  1WJJ A;  2F0F A;  2EXD A;  1RD9 D;  2K5Q A;  4NDX A;  4UPA A;  3H3V I;  2B2Y A;  3KLS X;  1TVX A;  4LUZ A;  1Y1V G;  3NXW A;  3CD6 A;  2F4V L;  2HQE A;  4A3K B;  4Y7N H;  1TWF B;  3CXC A;  4JI0 Q;  1PH3 A;  5KYL A;  3SVM A;  2BA0 A;  3LNN A;  1HNW Q;  3AQQ A;  2OF1 A;  4KJO A;  2NZO A;  5C3E B;  3CRL C;  5C6A A;  2HDL A;  4HCE A;  4A4I A;  4F8M A;  4A3M H;  5E4X A;  1TT2 A;  5EBC A;  4UAI A;  1EY7 A;  2LY7 A;  5C4X H;  2GA4 B;  1QZH A;  3RZD B;  2SNM A;  1YBY A;  2EYF A;  2IHE A;  5COR A;  3K58 A;  4M8A A;  1E7Z A;  1L1O A;  5A2Q E;  2D0P A;  5JPN C;  4A3I B;  3PV0 A;  2MFI A;  2F0D A;  3A56 A;  3JAM i;  4JBK A;  2JK8 A;  5M5X B;  2EJM A;  5IE8 A;  1N36 L;  2PNH A;  3S1N B;  3D6C A;  4R9W A;  4N9P A;  4K5V A;  3H0G G;  2R93 G;  2B29 A;  1UAP A;  2KCN A;  1SN8 A;  3I56 A;  3RNU A;  4KHP L;  4Q5V A;  3PSI A;  2QF7 A;  1WCM G;  1N33 Q;  3EQL C;  4GKK L;  3RMH A;  3S14 H;  5ELO A;  1IW7 C;  1ESF A;  5M3M H;  2WKD A;  2B2U A;  3QWN A;  2D9U A;  1SYG A;  5I6Y A;  3M85 A;  5HY6 A;  1LTG D;  4P71 A;  4QJF A;  4C3I G;  3J80 E;  5IYB G;  5A2Q L;  3VR4 A;  1A62 A;  3VYS A;  1GOZ A;  4DAY A;  1B2T A;  2PQE A;  3A7A B;  3AEV A;  2DJF C;  1I4P A;  3R93 A;  1KC8 C;  4B3T L;  1SNC A;  2F0N A;  5GAH C;  3HOY G;  5C0X H;  2VUM G;  2E76 C;  1B9N A;  5D3D A;  2E8G A;  1Y1W H;  1ET9 A;  3CAM A;  1KL9 A;  4F88 A;  1U4P A;  1WI5 A;  4LFB L;  3K5N A;  3EJI A;  1PRT D;  4Q0F A;  2Q8T A;  2OCE A;  4YY3 Q;  1BCP B;  4NPS A;  3TSS A;  1J5E Q;  3NSW A;  4G7Z C;  3V05 A;  5JEA G;  2QDB A;  4QF4 A;  4B9X A;  5IYC H;  1L1O B;  4CKB A;  1FGB D;  1YNX A;  4H0L C;  2LFN A;  2M00 A;  3SEB A;  1SFO H;  1B44 D;  3KBX A;  3MVV A;  4JI5 Q;  4JYA Q;  4G7O C;  1G2T A;  2RCF A;  1Y8N B;  3PO2 B;  3UDG A;  2R7D A;  2A19 A;  1FD7 D;  1TQO A;  3DXJ C;  2HHH L;  4ZKB B;  4GNX B;  1F9S A;  5IY0 A;  2I5H A;  3HOZ H;  3M3Y H;  5FKA C;  1C4Q A;  3OPO A;  1F9Q A;  4LJZ C;  4AQY Q;  2KCC A;  3S16 H;  4GKK Q;  1WYD A;  2IY5 B;  3M4O H;  2JP1 A;  3S2D H;  1DYQ A;  2K05 A;  3MXU A;  2HT1 A;  1P8L A;  4PG3 A;  3MTS A;  3I3C A;  4F7X A;  4LNQ A;  2OQK A;  4DV3 Q;  5BN5 A;  4A3E H;  1WTP A;  4ZUJ A;  4DV0 Q;  3E0E A;  3KLW A;  2JEA I;  1JJG A;  1LAC A;  3UDI A;  4WJ3 M;  5AFW A;  3H0G H;  2R93 H;  3WDN A;  1BKB A;  1OXV A;  3KUP A;  2F0P A;  5M5Y B;  3A8J E;  3TRE A;  4K5W A;  3VDY A;  2FJ2 A;  3QO2 A;  1EEF D;  4RKB A;  1K8A C;  5EQ0 A;  1HR0 W;  1WOC A;  2E2I B;  2Y0S G;  4KD3 A;  2IWH A;  4IJH A;  2NN6 I;  2B3G A;  1PV4 A;  1LUZ A;  2NB0 A;  1SJH D;  1PH6 A;  4K8I A;  1PHJ A;  3NWS A;  2K5H A;  1TY2 A;  1TWA H;  5C44 G;  3NK9 A;  5BN4 A;  4XQQ A;  2BDN A;  1JWS D;  4JV5 L;  4KK7 A;  1NUC A;  4IPG A;  4CDD C;  2BH8 A;  3E0J A;  2K5N A;  2KQ3 A;  5C4X G;  3KLS A;  4LF7 Q;  1MD2 D;  2Z6K A;  5D14 A;  1EY8 A;  3D31 A;  4AH6 A;  5DM7 3;  5IYD G;  4LK1 C;  1VQD A;  4TRD A;  1MBY A;  1KXL A;  2VQF Q;  2DJG C;  1HUN A;  4NP5 A;  1SNM A;  3M4Y A;  1PH4 A;  2D0O A;  5I6W A;  4C1N I;  2LS0 1;  1B4O A;  3S1M H;  4ZLT F;  1CA5 A;  1HR0 L;  1X3F A;  2JA5 B;  4BY7 H;  1J5E L;  3O13 A;  4BY7 B;  1SND A;  4GN3 B;  4N8X 1;  1UE7 A;  1TU2 B;  2N55 A;  3OIP A;  1TWH B;  2F0Q A;  4ME5 A;  1H9J A;  1SYE A;  3D6W A;  2WP8 J;  2R7Z H;  4BWG B;  1E22 A;  3PO2 H;  4C3I B;  2JE6 I;  3BS1 A;  3K59 A;  5FLX c;  2CCZ A;  2MJ8 A;  4F87 A;  1KAA A;  1SDF A;  1BNZ A;  3FKI B;  4HR7 B;  4DR5 L;  4DKA C;  1FJG L;  3J81 E;  3TME A;  5KRU A;  4B3R Q;  1HZC A;  3GTQ H;  1D6E C;  3PQI A;  3S17 B;  2EYJ A;  2QA4 A;  1E2V A;  3PIP 3;  5BR8 L;  3ERQ A;  1UE5 A;  2DY8 A;  2NN6 H;  4CJ0 B;  3HG9 A;  4YY3 L;  3VR6 A;  2E2H H;  1HZA A;  1LO5 D;  1SR3 A;  4KTA A;  1EYC A;  2EZV A;  1HFG A;  3MAQ A;  5IP9 H;  4L8J A;  4K0K Q;  1QOH A;  3OTO Q;  3J81 i;  2JA9 A;  1UEB A;  1NSN S;  3EN2 A;  5BR8 Q;  1K3R A;  3K5O A;  1MHW C;  5HGT A;  2N49 A;  5JAV A;  4KY5 A;  4A75 A;  5M5Y H;  4G57 A;  2KJX A;  4HIM A;  4V19 0;  4UP8 A;  1E0B A;  1E24 A;  1O78 A;  5JPM C;  1DCZ A;  1SEB D;  2HIX A;  1CHP D;  3CRK C;  1AFP A;  1JWU D;  1LTB D;  2F1M A;  3S1R H;  1PH2 A;  3BG3 A;  4H02 A;  1A2U A;  3K7A H;  5J3B A;  4IQZ A;  5JVH 3;  2G9D A;  4DK0 A;  4XQJ A;  1VF7 A;  3HP3 A;  3AMU A;  3TN2 A;  1IBK Q;  4HED A;  3VA7 A;  3HOZ B;  2F0T A;  1H9S B;  2HHH Q;  3VYT A;  4BBR G;  1CTM A;  2ZTD A;  2NZ1 D;  1HA5 A;  3GTK B;  5IGG A;  2IX0 A;  2XRQ D;  3IRB A;  5K36 H;  3M4O B;  5IP7 G;  2K14 A;  1W2B A;  1EY9 A;  1X3G A;  1EY4 A;  2NVY B;  1X3P A;  1SAP A;  3A54 A;  1UE6 A;  1YHB A;  2K4K A;  4DR4 Q;  1ICF B;  1LTL A;  1SLJ A;  1U4L A;  1R9T B;  1I6V C;  4GOP A;  2NVQ B;  4C3H B;  3TDQ A;  1K28 A;  3I7F A;  4B3S L;  4EX5 A;  2XTI A;  3UE1 A;  4K5X A;  1SYB A;  4EQN A;  4LF8 Q;  5M3F H;  3HOV B;  2AHO B;  4FF1 A;  2KCT A;  3NEL A;  2RKS A;  3E9I A;  3S1R B;  1D5M C;  4RMF A;  1OXX K;  4J15 A;  4OWX B;  5CBE E;  2IX1 A;  3CCQ A;  4GLX A;  3SK8 A;  1ILP A;  1S5F D;  1VQ9 A;  2K1B A;  4XYQ A;  1K8O A;  2CFM A;  3FDT A;  1L0X B;  4LW1 A;  3JAM L;  4L5R C;  1CM9 A;  4HID A;  2YTY A;  2LXK A;  1DON A;  2A73 B;  5KEE A;  2E75 C;  5EPJ A;  1YHQ A;  2XGT A;  4KHP Q;  1IL8 A;  1KIX A;  5J39 A;  1O7L A;  2E74 C;  4UP7 A;  3EFX D;  3CCS A;  3URY A;  1U9R A;  4HIK A;  2WII B;  1XTD A;  1YVC A;  2DGY A;  4JI7 Q;  4IFD G;  3LWU A;  5T1G A;  3X3M A;  2KED A;  1O80 A;  2IL8 A;  4L6T B;  2UU9 L;  1SRO A;  4BY7 G;  2F0I A;  1OO9 B;  4G7H C;  2MQH A;  4YCV A;  3N52 A;  2PZW A;  1G51 A;  3TBI B;  1HHV A;  1XNQ L;  5A35 A;  2JA8 B;  2F0S A;  5CGK A;  3DLL A;  2OT2 A;  2A68 C;  5FJ8 H;  1V1P A;  2XWJ B;  4JC0 A;  1J6Q A;  4HTH A;  1ROD A;  5AJ3 Q;  3W3A A;  3CC7 A;  2NVX H;  4NXM Q;  5CV9 A;  1MSH A;  4B3R L;  1LYL A;  1I4R A;  5ELB A;  3HOX H;  4YWM A;  2KA7 A;  1WTX A;  3K5M A;  4ZK9 B;  3CKI B;  2PCF B;  3C46 A;  3CPW A;  1Q1B A;  4B3S Q;  2D2C C;  2UUA Q;  4P2C B;  1K8M A;  5DEH A;  4X62 L;  4L5S A;  3Q8D A;  3TZD A;  2ZM6 Q;  3VYU A;  3NQT A;  2L1B A;  2L55 A;  3BVM A;  3CCL A;  4OO1 G;  4PZ8 A;  1ZKO A;  3NBH B;  4PMC A;  1V1Q A;  3HOW B;  4XT3 B;  4C3I H;  2BDO A;  4RH6 A;  1F9P A;  4WJ4 A;  2B63 G;  2VNU D;  1BCP D;  1GVP A;  1PRT C;  5C5M A;  1T5E A;  5IGC A;  4A3I H;  2UXD Q;  2WIN B;  5GAD C;  3AB9 A;  1JOR A;  5C4Z A;  4DV3 L;  3PO3 G;  1I3Q H;  4GLV B;  1QZG A;  3IFD A;  1B7Y B;  2E2D C;  4KKU A;  4A3M G;  2HIV A;  5AJ3 L;  2ENB A;  1EU3 A;  4DA2 A;  2EJG C;  3C2P A;  1CZW A;  1HPC A;  1PH5 A;  4LUV A;  1JOO A;  3GTM H;  1Y8O B;  3K7U C;  1QCB D;  3D0F A;  4HJ5 A;  1MI2 A;  1WTV A;  3OHX C;  5NUC A;  1HQM C;  1X3Q A;  1SNO A;  3RR5 A;  4GZY C;  1U0L A;  1SYC A;  3M7N A;  2SOB A;  4JI4 Q;  3R2I A;  1I6H H;  2F0O A;  4HCS A;  1VQO A;  4A93 B;  4HMI A;  5M3F B;  4KI0 A;  1SMY D;  4X3K A;  1SE3 A;  2HDM A;  4ZUI A;  4X3S A;  2X6G A;  5TSS A;  1Y14 B;  4EQP A;  3BDC A;  2E5L L;  4FYD A;  3I4M H;  4IUN A;  4C2M B;  1I4Q A;  4DR4 L;  2B2V A;  3Q22 A;  4A3K G;  2ALY B;  3HOV G;  5ELD A;  4CJ1 B;  3NHH A;  2MO0 A;  3ND9 A;  1SNQ A;  1SNP A;  4A3E G;  2F3W A;  2R7F A;  4LUO A;  2PYK A;  3H3V C;  4X65 L;  1IKL A;  4JK1 C;  5C3E G;  1F2Z A;  2NTT A;  3NEM A;  1FJG Q;  1ML0 D;  4CDE C;  1PYS B;  3FPP A;  4IUQ A;  3TS0 A;  3BU2 A;  2VW9 A;  2EQS A;  4QCL A;  4FXK C;  3CC4 A;  3KBG A;  4EGV A;  1S4Z A;  1IBL L;  2K50 A;  3CQZ H;  3PUY A;  4MN3 A;  1EQV A;  1YI2 A;  4I7Z C;  5T1I A;  2B2V C;  3S15 B;  1GD7 A;  3HOU G;  3CHB D;  3J81 L;  3A7L A;  1YNN C;  5CYU A;  2R7Z G;  3CP0 A;  4X64 L;  1S5E D;  1EL0 A;  3FHW A;  1XPU A;  3T1H Q;  2UXC Q;  1CKO A;  1SYF A;  4OWW B;  2CW0 D;  2B63 H;  3BYY B;  4OIJ A;  4BXX G;  2O5I C;  3GV6 A;  1ILQ A;  2RQX A;  4JW0 A;  3ONA B;  2VXW A;  4EQ5 A;  3T56 B;  4P74 A;  2Q8R E;  1QUQ B;  1B3A A;  3H09 A;  4A3J G;  4R4C A;  3STB C;  1AEX A;  5I9O A;  3WOF A;  3U58 A;  1KHI A;  1G6P A;  4LFB Q;  4FF4 A;  1HTL D;  1S72 A;  1HRJ A;  3HOY B;  2RDH A;  3A5U A;  2QEX A;  2K33 A;  1GUG A;  2TSS A;  1BDO A;  2A68 D;  5C5L A;  2EJF C;  4V0B A;  4A76 A;  4B3T Q;  4A3C G;  2UXD L;  4C1N K;  1Y1V H;  1LTI D;  2J4X A;  2PMZ B;  4JG2 A;  5KYI A;  4QL5 A;  3GP7 A;  3DEO A;  3FVQ A;  1R9T H;  2Q2I A;  2WFW A;  1KAB A;  1HNX L;  2EYH A;  2AQ3 B;  4PZ7 A;  3K0X A;  1I94 L;  3J7A 5;  1O7I A;  3KJO A;  3GTP B;  5IGE A;  3PO2 G;  3FMC A;  1RL2 A;  2EYO A;  3HOV H;  2B63 B;  5KNB A;  2YV5 A;  4FF3 A;  2A6H D;  1PTO D;  3V2T A;  1VQH A;  1AP0 A;  5IGD A;  1F77 A;  4KY6 A;  1EFI D;  4POF A;  4DV2 Q;  3CC2 A;  1A2T A;  2Z4I A;  3H6M A;  3ULL A;  1YNJ C;  1W6K A;  5JOB A;  2BA1 A;  2KHJ A;  3R3O A;  3HFZ B;  1LV9 A;  5ELF A;  1Z47 A;  3ER0 A;  2N78 A;  4KN4 C;  3BZC A;  2VQE Q;  2BE5 D;  4CKC A;  4DNI A;  1TWC H;  2KUM A;  1IBM Q;  4ZCK A;  2FMC A;  3ICE A;  4NKL A;  4ID6 A;  3I91 A;  5D65 A;  4QUF A;  3MFY A;  1BCP F;  3SK4 A;  4JI6 Q;  3T4A C;  3J80 c;  4A3L G;  2A69 C;  3VR2 A;  5M5W B;  1D8L A;  1EY0 A;  4MNO A;  2F4I A;  1TWA B;  5I4D A;  1WTQ A;  5CR3 A;  3Q6S A;  2G5D A;  1S40 A;  5JJL A;  1A3U A;  5LHY 1;  3OW7 A;  1EOT A;  2X69 A;  2Z6B A;  3QJY A;  1TS4 A;  5KNC A;  2PPB C;  5JJI A;  1Q8K A;  4KN7 C;  2HUG A;  2CQO A;  3MA2 B;  4QGU A;  3WOE A;  1DOL A;  4H7B A;  5C44 B;  4JI1 L;  2RCN A;  2H5X A;  4DV4 L;  1O7Y A;  1YNJ D;  4RGT A;  1OXS C;  1NY4 A;  4IFD I;  3VR3 A;  2M9V A;  3R2T A;  3SE0 A;  4NXM L;  5HGQ A;  1N34 Q;  2A1A A;  2NTS A;  1F2Y A;  5C4X B;  1PTO C;  2PI2 E;  3A74 A;  1XXG A;  3GV3 A;  2O5J C;  1WTR A;  1T5X D;  1QB5 D;  1WCM H;  2N88 A;  2VQE L;  4AQY L;  3CCU A;  4IAL A;  4KY7 A;  1ZYR D;  3U9O A;  4S3S A;  2F0M A;  1FNU A;  2WAC A;  3OMG A;  4BBS G;  2R3Z A;  2Z8L A;  4N9T A;  3K5L A;  1N32 L;  1LTA D;  3K6O A;  4LF5 L;  4DV2 L;  2JA5 G;  1R4Q B;  4JYA L;  3KF8 B;  2SDF A;  1HUM A;  5IWA Q;  1SE4 A;  2JA8 H;  1B3Q A;  1UE1 A;  4RHR A;  1NR4 A;  4JI7 L;  1NMG A;  3HOX G;  1PH1 A;  3GTL H;  1GUO A;  1IBK L;  1CA6 A;  1LT5 D;  2OQ0 A;  4OEL B;  5FLX E;  1EIG A;  2MP1 A;  3S2H H;  3FKI G;  5DLQ E;  1VQG A;  3PMF A;  2EYP A;  3S15 H;  1JT8 A;  5EKI A;  1H9M A;  1SSO A;  3BYT B;  4RGN A;  2E2J H;  4DF7 A;  3GTG H;  1TWG B;  4GKJ L;  1JOK A;  4RCN A;  2EPB A;  1UWV A;  4DUZ Q;  1VQC A;  1M4V A;  4Z9C B;  4KHZ A;  1QE6 A;  2RSN A;  2V1C C;  1U4R A;  2ZXR A;  4R4T A;  1KRT A;  4DK1 A;  3I70 A;  4B08 A;  4LF8 L;  1OXT A;  4KMU C;  4JI1 Q;  3FEW X;  1CK1 A;  4DV7 Q;  4UHV A;  3A0J A;  4DAV A;  5CV5 A;  2ZJR A;  4JI2 L;  2JA6 G;  2F0W A;  1TXY A;  2X6L A;  4JCV E;  5C4J B;  5EAY A;  4XDX A;  4KD4 A;  5J1Z A;  3PIP A;  3HKZ B;  1KQS A;  4YCW A;  1BQQ T;  4R4O A;  4NMZ A;  3D4W A;  2JN4 A;  4O42 A;  2KOL A;  2ZXP A;  3Q23 A;  3T51 B;  1PFB A;  1CZG A;  1MJC A;  3I72 A;  4LF7 L;  3M3Y B;  1JOQ A;  1T9H A;  2FFK B;  4LF4 Q;  4OX9 L;  1TWG H;  1QVG A;  1S5D D;  3C3L A;  2E2J B;  3U4V A;  3TP6 A;  2K28 A;  2AMC B;  2K5W A;  4Y7N B;  2XNA C;  3SK5 A;  4RWS C;  5CMD A;  4IFD H;  3P20 A;  3S2H B;  1FNW A;  1GUW A;  1ZYR C;  2OXP A;  3TZU A;  1PH7 A;  2ZTE A;  5EPK A;  1PFN A;  1BF4 A;  4A3G H;  2GVB A;  1TKW B;  1HZ9 A;  2WV6 D;  4X65 Q;  2HCC A;  1Q81 C;  1QG7 A;  2A5H A;  1EIF A;  1C48 A;  2JA7 B;  3GTO H;  3MEF A;  1BO0 A;  4LFC L;  3OMC A;  2PW7 A;  2ZJQ A;  4A93 H;  3NWT A;  3F2D A;  5KGU A;  3HRZ C;  4K6D A;  2PZT A;  3I4L A;  1IYV A;  5C4J H;  5L37 A;  3F2U A;  2NWG A;  2IX3 A;  1IHZ A;  1XPO A;  2EOT A;  1XNR Q;  1Q86 C;  4NXN L;  1VQN A;  4P72 A;  2EYM A;  2I5L X;  1VQB A;  3H91 A;  5LMU L;  5I2Y A;  2A6E C;  1BVS A;  2L5T A;  4JI6 L;  3HGB A;  2NZH A;  2I5M X;  4R8N A;  2P5Z X;  4LFA L;  4OXP A;  4DR5 Q;  4GNX A;  1Q82 C;  2K32 A;  2NYZ D;  4IPC A;  4TSS A;  2F03 A;  3KF6 A;  3OWE B;  1TS3 A;  2ES2 A;  4JBJ A;  3LWE A;  4BBS B;  1TII D;  5ELN A;  4OO1 H;  2YTV A;  3JC6 6;  4BBS H;  3I4N H;  2N8N A;  4FXG C;  4FXD A;  4CJ2 C;  2F0J A;  1MSG A;  1PTO F;  3NTK A;  3SR1 A;  5IWA L;  1YJN A;  3J7Y W;  3GTJ H;  2EDG A;  4DR2 L;  5C3E H;  2LSS A;  3S14 B;  1TWH H;  2JA8 G;  1OXU A;  2VS1 A;  1LT4 D;  1CUK A;  1GKH A;  1OTC A;  4DNT B;  2PZU A;  1YHA A;  5JVG 3;  1MGS A;  2OTJ A;  4OON A;  2FMM A;  1AE3 A;  3ERS X;  1X6O A;  2VZA A;  1NMF A;  3VR5 A;  4X3T A;  5GQO A;  4GS3 A;  1I94 Q;  2EXZ A;  1EWI A;  1NNX A;  3N6R A;  2PMZ E;  2VB2 X;  5ELE A;  3E5S A;  4IZ8 A;  4FDB A;  3CCE A;  3SXH A;  1N8R C;  1EQR A;  2K04 A;  1FL0 A;  3G48 A;  2TMP A;  3J81 j;  1PXU A;  1EYD A;  5E3F A;  1AN8 A;  2QDL A;  3LX0 A;  3NBI A;  1VS0 A;  1KD1 C;  1M1K C;  4JPB W;  2AQ1 B;  1AE2 A;  2G9H D;  4R4I A;  2J0T D;  3S17 H;  3FP9 A;  1YIJ A;  3HOW G;  2MHV A;  2JJQ A;  2JA6 B;  4A3K H;  4QUC A;  3OYY A;  1CT1 D;  4B3M Q;  3GTJ B;  2V4D A;  1L0Y B;  1IKM A;  3U9S A;  4R8I A;  3DWQ A;  3MXN A;  2SEB D;  3QIA A;  3PO3 B;  1HZB A;  3V96 A;  2C9O A;  2Q2H A;  3NP8 A;  4C3H H;  2RVL A;  5GAG C;  1Q12 A;  1BUV T;  4XTC S;  4A3C H;  1KRS A;  1XMQ L;  1GO3 E;  3CCV A;  4IUR A;  4DR6 L;  1D2B A;  4A3L H;  1KNE A;  4FP5 D;  1A0I A;  4E6I A;  5EKK A;  2UXB L;  4J6H A;  1V1O A;  1B53 A;  4KJN A;  2NBF A;  4DR3 Q;  5JEA J;  4ME3 A;  4RKL A;  1CKN B;  2WKC A;  3MXP A;  1Q3L A;  5GRO A;  4JV5 Q;  3T1Y Q;  4IUU A;  2M2L A;  5FLX L;  1RHP A;  2AUK A;  2CW0 C;  3M4Q A;  3PF5 A;  1YJW A;  2UXB Q;  5M3F G;  4HN7 A;  1SE8 A;  5LL6 X;  1EOV A;  1JE4 A;  1X65 A;  5LMN Q;  4IFD J;  4DK3 C;  2CKZ B;  3J7A F;  5CV8 A;  2DY7 A;  2KEN A;  1K8G A;  4BXX H;  3GDE A;  3KK7 A;  3RLN A;  2K7V A;  2PQA B;  1JB7 A;  1HXY D;  2L12 A;  4DV4 Q;  2C5C A;  2JA7 G;  3HZX A;  2O2L D;  2ZTC A;  1UEA B;  2ID0 A;  4A3J H;  1LTT D;  1DOM A;  4A3E B;  1H9K A;  1BOS A;  3EVQ A;  3DHQ A;  4X62 Q;  3R8B A;  1E3P A;  4APV A;  4LMQ D;  1VQ5 A;  2Z1C A;  1ET6 A;  2XN9 C;  1Z6H A;  2JSO A;  3GTP H;  3MXN B;  1NR2 A;  4CKE A;  4TVA B;  4DR7 Q;  4I7A A;  4EVO A;  1PVO A;  1CSQ A;  5LL6 S;  3PUX A;  1GXD C;  3NEN A;  3NUC A;  1GUT A;  4YWK A;  4M1U B; 
#chains in the Genus database with same CATH homology
 1BKB A;  2VQF L;  1OXV A;  4QL5 A;  2WB1 E;  3WWV A;  1EUJ A;  1Y1W G;  4A3G G;  3I55 A;  5M5X H;  3TRE A;  1C0A A;  1R9T H;  4GOP B;  3VDY A;  2Q2I A;  2WFW A;  4B3M L;  1IBM L;  3CCJ A;  1HNX L;  3A5Z B;  4PZ7 A;  3K0X A;  1I94 L;  1Q7Y C;  3RZO H;  1K8A C;  3J7A 5;  1HR0 W;  2GN5 A;  1O7I A;  4GLA C;  3KJO A;  1WOC A;  1VQ8 A;  3PO2 G;  4R4Q A;  4WJ3 M;  3TEH B;  2Y0S G;  1B70 B;  1RL2 A;  1W3S A;  2F3I A;  5IT9 c;  3HOV H;  1VQL A;  1H95 A;  4IJH A;  2NN6 I;  4BBR H;  1PH9 A;  2YV5 A;  1K83 H;  1XMO L;  2B3G A;  3KDF A;  1LUZ A;  3SGI A;  1PV4 A;  1VQH A;  5LMU Q;  4O2D A;  3G6E A;  1PH6 A;  4DV2 Q;  1PHJ A;  4POF A;  1VQA A;  3CC2 A;  2K5H A;  1TWA H;  5C44 G;  1ASZ A;  1IZ6 A;  3ULL A;  1N9W A;  3BZK A;  2LXJ A;  4QIW E;  1K0R A;  4JOI A;  1V43 A;  2BA1 A;  2KHJ A;  3HFZ B;  2ZJP A;  4JV5 L;  1L2F A;  4IPG A;  1Z47 A;  3ER0 A;  2BH8 A;  2N78 A;  3BZC A;  2VQE Q;  3HOW H;  2K5N A;  5C4X G;  3PUZ A;  3U4Z A;  4LF7 Q;  4DNI A;  4PMW A;  2F52 A;  3I4N G;  1TWC H;  2Z6K A;  1X54 A;  4GN4 B;  3D31 A;  4AH6 A;  3OW2 A;  1IBM Q;  5IYD G;  1VQD A;  3ICE A;  4A3D H;  1Z9F A;  1KXL A;  2VQF Q;  1NJI C;  4A3F G;  2JA5 H;  1FGU A;  2AWN A;  4AYB E;  3J7Z C;  2OTJ A;  4JI6 Q;  1PH4 A;  4IPH A;  4A3L G;  2CWA A;  2D0O A;  3J80 c;  2YYZ A;  2WB1 G;  3TS2 A;  4YHH L;  3G4S A;  4GKJ Q;  1D8L A;  3TQY A;  3AFP A;  4R1J A;  1LM0 A;  4MNO A;  4HJ9 A;  3S1M H;  1HR0 L;  1X3F A;  4BY7 H;  1J5E L;  1VCI A;  2A8V A;  1X55 A;  3JAM c;  4GN3 B;  1S40 A;  1PYB A;  1UE7 A;  2K75 A;  2E5L Q;  1M90 C;  5JJL A;  3PUW A;  4P73 A;  1A63 A;  2WP8 J;  2Z6K C;  4LF4 L;  4OX9 Q;  5JJI A;  1PA6 A;  2R7Z H;  3E9H A;  3S1Q H;  1Q8K A;  3PO2 H;  1E22 A;  2CQO A;  3PCO B;  4QGU A;  1N33 L;  2JE6 I;  3L0O A;  2L15 A;  2IHF A;  5FLX c;  1NBW A;  2FXQ A;  4JI1 L;  2CCZ A;  2RCN A;  2H5X A;  4L5T A;  4DV4 L;  4DK6 C;  4LFA Q;  1OXS C;  1NY4 A;  3KDF B;  4DR5 L;  1HR0 Q;  4DKA C;  1FJG L;  4IFD I;  3B6Y A;  4NXM L;  1P16 A;  5HGQ A;  4B3R Q;  1HZC A;  1N34 Q;  4JI8 Q;  3GTQ H;  1YZ6 A;  2A1A A;  2QA4 A;  4PZ6 A;  3W1B A;  1U5K A;  3HOZ G;  1CKM A;  1JJ2 A;  2PI2 E;  3A74 A;  1XNR L;  5BR8 L;  1IL2 A;  3H3V H;  4HJ8 A;  1I5F A;  1UE5 A;  2E2H H;  4YY3 L;  3KF6 B;  3F8T A;  1HZA A;  1WCM H;  2VQE L;  3BJU A;  1SR3 A;  4AQY L;  2PQA A;  3CCU A;  2YU9 H;  5FJ8 G;  5IP9 H;  1VQF A;  5JJK A;  2UUA L;  4K0K Q;  4IJL A;  3OTO Q;  1XJV A;  1AH9 A;  3J81 i;  2JA9 A;  2R6G A;  1SRU A;  2Z0S A;  4DPG A;  4LFC Q;  1UEB A;  4BBS G;  1EYG A;  4LWC A;  2KHI A;  3EN2 A;  5BR8 Q;  1MIU A;  1K3R A;  3J80 i;  4DV7 L;  1N32 L;  2N49 A;  4LF5 L;  1VQ6 A;  4DR6 Q;  1N34 L;  4DV2 L;  4JI3 L;  2IT1 A;  1L0W A;  5M5Y H;  4A75 A;  4A3F H;  2JA5 G;  3PF4 A;  4HIM A;  2EIF A;  4TQU S;  3KYH C;  4JYA L;  1HNW L;  3CPF A;  4UP8 A;  1E24 A;  3KF8 B;  4DV5 Q;  1GM5 A;  4GN5 A;  3F1Z A;  5IWA Q;  1PH8 A;  4BA1 I;  2DUD A;  2JA8 H;  2HIX A;  3G71 A;  4JBM A;  1UE1 A;  4JI0 L;  4QQB X;  2JA7 H;  1QVF A;  2RHS B;  4JI7 L;  1NMG A;  2VY3 A;  3HOX G;  2GVA A;  1PFS A;  4C3J H;  1PH1 A;  3GTL H;  1IBK L;  3S1R H;  1PH2 A;  3UDX A;  3CCM A;  2OQ0 A;  4H02 A;  3K7A H;  5J3B A;  4OWT B;  4QY7 A;  3S2H H;  1X9N A;  4LF6 Q;  3FKI G;  4OO1 I;  5DLQ E;  1HH2 P;  1EQQ A;  2R92 H;  1VQG A;  3STB D;  2JA6 H;  2I0Q A;  3L7Z C;  1K73 C;  1IBK Q;  3HKS A;  3S15 H;  1JT8 A;  2E2J H;  1ASY A;  2C35 B;  3GTG H;  2HHH Q;  4GKJ L;  4BBR G;  4A3I G;  1VQE A;  2ZTD A;  1QVC A;  1UWV A;  1L1O C;  1VQC A;  2IX0 A;  4DUZ Q;  1K9M C;  1VQK A;  3IRB A;  5C44 H;  1XPR A;  5IP7 G;  2K14 A;  4KHZ A;  1W2B A;  4LF5 Q;  2V1C C;  4A3B G;  3CF5 A;  3UDF A;  4JI3 Q;  4JI4 L;  4R4T A;  1KRT A;  3I4O A;  5C0X G;  1X3G A;  1S3O A;  1CSP A;  4LF8 L;  1X56 A;  1OXT A;  4JI1 Q;  1VQI A;  3GO5 A;  1UE6 A;  1YHB A;  4DV7 Q;  3CME A;  4YCU A;  2K4K A;  4DR4 Q;  4X6A H;  3A0J A;  1LTL A;  1SLJ A;  4P75 A;  2MO1 A;  3RLO A;  4GOP A;  3AFQ A;  2ASB A;  5IP9 G;  4ALP A;  1E1O A;  2ZJR A;  4JI2 L;  3I7F A;  2JA6 G;  4B3S L;  4EX5 A;  2XTI A;  4GNX C;  3UE1 A;  1TXY A;  2RHQ B;  1MJE A;  2Q2T A;  5IYD H;  4LF8 Q;  1C9O A;  4JCV E;  4DV6 L;  4UP9 A;  5E7N A;  4XIG S;  5M3F H;  1XNQ Q;  5EAY A;  1PVO A;  2AHO B;  2KCT A;  1VQP A;  3PIP A;  3NEL A;  1Q1E A;  4DAY B;  1KQS A;  4JI5 L;  3E9I A;  3ZJY C;  5K36 G;  1N36 Q;  3PGZ A;  1D7Q A;  4YCW A;  4RMF A;  1FVI A;  1OXX K;  4DV1 L;  4J15 A;  4KLK A;  4OWX B;  3CW2 C;  1EIY B;  2IX1 A;  3CCQ A;  4NXN Q;  4R4O A;  2HQL A;  4GLX A;  4DR2 Q;  4IOA A;  1VQ9 A;  1DGS A;  4X66 Q;  2ATW A;  1N32 Q;  4DAM A;  1KAW A;  2AKW B;  2CFM A;  2YTX A;  1C7Y A;  1G29 1;  4LW1 A;  2RF4 A;  1BBW A;  4L5R C;  2N3S A;  1X3E A;  1MJC A;  2VL6 A;  1HNX Q;  4LF7 L;  2WAQ E;  4HID A;  3GTK H;  2YTY A;  2LXK A;  1T9H A;  2ZM6 L;  4LF4 Q;  4OX9 L;  2Q2U A;  1TWG H;  1YHQ A;  1QVG A;  4AIM A;  2XGT A;  1Q46 A;  4KHP Q;  3K80 C;  2WAQ G;  1KIX A;  3U4V A;  1MKH A;  3RZD H;  2UU9 Q;  3ULJ A;  1YIT A;  4UP7 A;  5C0X I;  3CCS A;  2AMC B;  4HIK A;  4HIO A;  4L5Q A;  1XTD A;  1YVC A;  2DGY A;  3CCR A;  4JI7 Q;  3M9B A;  4NB3 A;  4IFD G;  2F4V Q;  3ULP A;  5LMN L;  1PH7 A;  2D62 A;  2ZTE A;  2UU9 L;  1SRO A;  2GVB A;  4BY7 G;  1HZ9 A;  4X65 Q;  4A3G H;  2K52 A;  1Q81 C;  2MQH A;  2NN6 G;  1A8V A;  4YCV A;  2R93 H;  1EIF A;  4JBW A;  1G51 A;  1TWF H;  2MNA A;  1XNQ L;  3GTO H;  3MEF A;  1HJP A;  4LFC L;  4BY1 G;  4DV6 Q;  1V9P A;  3RN2 A;  4YWL A;  3DLL A;  2ZJQ A;  3K8A A;  2NVY H;  4A93 H;  1YJ9 A;  3F2D A;  4JOI C;  3HOU H;  3HKZ G;  3TRZ A;  2UUC L;  3F2B A;  4O0A A;  3PUV A;  5FJ8 H;  3S1N H;  4A3B H;  5GAE C;  2R92 G;  5C4J H;  4DR3 L;  4JC0 A;  1J6Q A;  2OTL A;  3HKZ E;  1HNZ Q;  1WFQ A;  3KOJ A;  1XPO A;  5AJ3 Q;  1VQM A;  1XNR Q;  3CC7 A;  4NXN L;  1Q86 C;  4P72 A;  2NVX H;  1VQN A;  3RLF A;  4NXM Q;  2NVT H;  2I5L X;  1VQB A;  5LMU L;  5H1S E;  4B3R L;  1QUQ A;  1LYL A;  1BVS A;  4JI8 L;  4JI6 L;  2NVQ H;  2NZH A;  3HOY H;  2I5M X;  3HOX H;  3PIO A;  4DV0 L;  1SMX A;  1XMO Q;  4LFA L;  1I50 H;  3T1H L;  2PI2 A;  4YWM A;  4OXP A;  5FLM H;  4DR5 Q;  2UXC L;  4RG1 A;  3L2P A;  4GNX A;  4C2M H;  1Q82 C;  3K81 C;  4MZ9 A;  4LF9 Q;  1JE5 A;  4IPC A;  3CPW A;  1Q1B A;  3KF6 A;  3M4P A;  4B3S Q;  3OTO L;  4GOP C;  4A93 G;  3UE0 A;  2ES2 A;  2UUA Q;  4X62 L;  4L5S A;  4JBJ A;  1IYJ B;  3Q8D A;  3CMA A;  5ELN A;  2ZM6 Q;  2YTV A;  3JC6 6;  4BBS H;  3CCL A;  3I4N H;  4OO1 G;  2N8N A;  3J81 c;  2Y0S E;  4DR1 L;  2UUB Q;  4PZ8 A;  3NBH B;  3EIV A;  1V1Q A;  1WJJ A;  2EXD A;  4C3I H;  5IWA L;  4UPA A;  3W5O A;  1YJN A;  3H3V I;  2B63 G;  2VNU D;  4HJ7 A;  4WJ4 A;  3GTJ H;  4DR7 L;  1CKN A;  1GVP A;  1Y1V G;  4LUZ A;  4DR2 L;  3CD6 A;  5C3E H;  4A3I H;  2LSS A;  2F4V L;  2UXD Q;  1TWH H;  4Y7N H;  1OXU A;  5GAD C;  4YHH Q;  3CXC A;  4JI0 Q;  2JA8 G;  1PH3 A;  2VS1 A;  4DV3 L;  3PO3 G;  1CUK A;  1GKH A;  1I3Q H;  1OTC A;  2BA0 A;  1HNW Q;  4GLV B;  1QZG A;  1YEZ A;  1B7Y B;  1YHA A;  4JI2 Q;  4K0K L;  3AQQ A;  4A3M G;  4OON A;  2HIV A;  5AJ3 L;  2NZO A;  5C0X J;  4UY8 C;  4BY1 H;  3ERS X;  1AE3 A;  1X6O A;  2VZA A;  5M5W H;  1NMF A;  4A4I A;  4A3M H;  1HNZ L;  3F2C A;  4LF6 L;  2QGQ A;  1BBU A;  5GQO A;  4GS3 A;  1I94 Q;  1PH5 A;  4IO9 A;  3AYH B;  4BA2 I;  1EWI A;  5C4X H;  1QZH A;  1JJC B;  4LF9 L;  4LUV A;  1EFW A;  2PMZ E;  3GTM H;  1YBY A;  3H15 A;  2IHE A;  3K7U C;  3D0F A;  4HJ5 A;  1E7Z A;  1L1O A;  4FDB A;  2D0P A;  3CCE A;  3PV0 A;  2MFI A;  1NE3 A;  1N8R C;  3RR5 A;  1EQR A;  1U0L A;  4DUZ L;  1FL0 A;  4X66 L;  3JAM i;  4JBK A;  3G48 A;  3J81 j;  2JK8 A;  4JI4 Q;  3M7N A;  5IE8 A;  1I6H H;  3LGJ A;  2PNH A;  1N36 L;  4DV5 L;  1VQO A;  3PO3 H;  1B8A A;  3U50 C;  1VQ4 A;  3GD7 A;  3H0G G;  2R93 G;  1VS0 A;  3I2Z A;  1KD1 C;  1M1K C;  1JMC A;  4KI0 A;  2B29 A;  5FLM G;  2JEB I;  1AE2 A;  4R4I A;  1SN8 A;  3I56 A;  3RNU A;  3S17 H;  2UUB L;  2UUC Q;  4DUY Q;  4KHP L;  3FP9 A;  3PSI A;  1Y14 B;  1YIJ A;  3HOW G;  2KBN A;  1WCM G;  1N33 Q;  2JJQ A;  2E5L L;  1VQJ A;  2AWO A;  2K5V A;  4GKK L;  3I4M H;  3FKI H;  4A3K H;  3S14 H;  3OYY A;  4DR4 L;  5ELO A;  4B3M Q;  5M3M H;  4A3K G;  3DM3 A;  1IBL Q;  2ALY B;  3HOV G;  3EBE A;  2MO0 A;  1HZB A;  4MTN A;  3M85 A;  5HY6 A;  4P71 A;  2E2I H;  4QJF A;  4A3E G;  5IYB G;  1A62 A;  2Q2H A;  4C3H H;  2R7F A;  4LUO A;  4A3D G;  5GAG C;  1Q12 A;  4X65 L;  3AEV A;  5C3E G;  1KC8 C;  1IXR A;  2JQO A;  4XTC S;  1VQ7 A;  4A3C H;  1KRS A;  1XMQ L;  1GO3 E;  3NEM A;  3CCV A;  4B3T L;  1FJG Q;  4DR6 L;  5GAH C;  1PYS B;  3HOY G;  4A3L H;  5LMN W;  2VUM G;  3TS0 A;  1A0I A;  3BU2 A;  2E8G A;  2VW9 A;  1Y1W H;  2EQS A;  3RN5 A;  2VUM H;  3CAM A;  1KL9 A;  4X64 Q;  3KJP A;  2UXB L;  3CC4 A;  4DR3 Q;  1WI5 A;  4Y52 H;  4LFB L;  1E1T A;  5JEA J;  1IBL L;  4ME3 A;  2K50 A;  3CQZ H;  3PUY A;  2OCE A;  4YY3 Q;  3I4M G;  1CKN B;  4NPS A;  1YI2 A;  5GRO A;  1J5E Q;  1GD7 A;  3HOU G;  4DUY L;  3KFU A;  3T1Y Q;  4JV5 Q;  4POG A;  5JEA G;  2R7Z G;  3PF5 A;  3M4Q A;  1YJW A;  3CP0 A;  4X64 L;  2UXB Q;  5M3F G;  1SE8 A;  5IYC H;  4IOC A;  1L1O B;  1YNX A;  1EOV A;  3FHW A;  1XPU A;  3T1H Q;  2UXC Q;  1CKO A;  5IYC G;  1X65 A;  5LMN Q;  4OWW B;  1SFO H;  2B63 H;  4IFD J;  4DK3 C;  2CKZ B;  4JI5 Q;  2KEN A;  1K8G A;  4BXX H;  4JYA Q;  3GDE A;  3RLN A;  5IP7 H;  2R7D A;  3UDG A;  2BH2 A;  2PQA B;  2A19 A;  1JB7 A;  4BXX G;  2HHH L;  4DV4 Q;  4GNX B;  2JA7 G;  5IY0 A;  2I5H A;  3HOZ H;  3M3Y H;  2ZTC A;  4AYB G;  4DR1 Q;  2ID0 A;  4A3J H;  3T1Y L;  4EQ5 A;  4P74 A;  1QUQ B;  4AQY Q;  4A3J G;  2OWO A;  3S16 H;  4R4C A;  4GKK Q;  3STB C;  1WYD A;  4X62 Q;  2IY5 B;  3M4O H;  3S2D H;  1RIP A;  3U58 A;  1KHI A;  5M3M G;  2CWP A;  2HT1 A;  1G6P A;  4LFB Q;  1NTG A;  1E3P A;  1P8L A;  4PG3 A;  4APV A;  1S72 A;  3W1G A;  1VQ5 A;  4LNQ A;  3A5U A;  2QEX A;  2OQK A;  4DV3 Q;  4A3E H;  5IYB H;  3S24 A;  3GTP H;  4IPD A;  3MXN B;  4DV0 Q;  3E0E A;  4TVA B;  4DR7 Q;  4DV1 Q;  2KCM A;  2UXD L;  4A76 A;  1CSQ A;  3KLW A;  1XMQ Q;  4B3T Q;  1Y1V H;  3PUX A;  2JEA I;  4A3C G;  1JJG A;  4HJA A;  3UDI A;  3NEN A;  4JG2 A;  3H0G H;  4YWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...