4DR6L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr6L00
3S16H 1N32Q 1ASZA 1YEZA 4LUZA 4JCVE 4IO9A 4R4TA 3RR5A 2HHHL 1V43A 3H3VH 4P74A 1XMQL 1PH2A 2L15A 2V1CC 4POGA 4P75A 5FJ8H 3PUZA 4LFBQ 1YJ9A 4A3FH 1EQQA 4A3GG 2JA7G 3ICEA 1X3GA 3HOUG 1KC8C 1L1OC 1QUQA 4LNQA 2UXCL 1HZ9A 3H15A 1L0WA 4HJ9A 2DGYA 3GTMH 4GKJQ 5C44H 2Z0SA 4BY1G 2JA5G 3NEMA 2VUMH 3A5UA 1IBKL 3CXCA 4LFBL 4Y52H 1SE8A 1OXTA 1IXRA 2WAQE 3BZKA 1X56A 3HFZB 4A3EG 4RG1A 4BXXG 4LF7Q 2WB1E 2AWOA 2Y0SE 2XGTA 3BZCA 5C0XG 1E7ZA 4DV0L 3T1HL 4L5RC 4LWCA 1Q86C 3FP9A 3GTJH 1Q1BA 5BR8L 5IYCG 1LTLA 3NENA 2BA0A 5IP7H 4MNOA 2CCZA 4DR4Q 5M5XH 4IJLA 1VQPA 4JI2Q 1KAWA 1GKHA 1U0LA 3RLFA 3AYHB 1UWVA 4DAMA 2JK8A 3F2CA 1YJNA 4LFAL 4X6AH 3J80c 4GOPA 3CCSA 1VQFA 3ULJA 2VY3A 4QL5A 3CPWA 4GLXA 2A19A 5C0XJ 2DUDA 4QJFA 3U58A 3L2PA 3M4QA 3RZOH 3CC4A 2UUAQ 3I55A 3H0GH 2ZM6L 2MNAA 3S14H 2KCTA 3KLWA 3MXNB 2PI2E 1QUQB 3KF6A 3DLLA 2QA4A 1YITA 2NN6I 4MTNA 4DUZQ 3EN2A 3HOUH 4DR5L 3L0OA 1J5EL 4PMWA 1HZCA 4DR1Q 4JV5L 1D7QA 3A5ZB 3A0JA 1IZ6A 4IPDA 1YHAA 3S1NH 4DV3L 1P8LA 2UUAL 2QGQA 2JA5H 2BA1A 2OTJA 2YTVA 4YY3Q 5IT9c 4YWKA 2UXBQ 4B3MQ 4DPGA 4BXXH 1VS0A 4OX9Q 2R7ZG 1A63A 4DV7Q 4HIOA 2D0OA 3RLOA 3STBC 3CMAA 1X65A 4UP7A 1NJIC 1XPUA 3ER0A 4L5QA 2VL6A 4BY7H 4AH6A 3G6EA 4JYAL 4WJ3M 1QVGA 1K8GA 3PIPA 1VQ5A 1GO3E 5IYCH 1SMXA 2HIVA 4AQYQ 3PO2H 4YY3L 2KCMA 2KHJA 2E2JH 3PUWA 3IRBA 3H3VI 3PIOA 1T9HA 2JQOA 1TXYA 1VQ9A 1UE7A 3GTLH 1VQJA 4IFDG 4JI6Q 2KHIA 4YWLA 1X6OA 2WAQG 1K9MC 1CKOA 2K4KA 3U4VA 2JJQA 1SLJA 4KI0A 4YHHL 1X9NA 1BBUA 4AQYL 2JEBI 3ULLA 1HR0W 4QGUA 5LMUQ 2K14A 1CKNA 1VQ7A 1P16A 5IYBG 4JG2A 5C3EG 1XPRA 3KF6B 4HIMA 5M3MG 3OW2A 1O7IA 4A3FG 3UDGA 1Q81C 4OWWB 4OO1G 2K5NA 1GM5A 1M1KC 2VS1A 1U5KA 1N33Q 4DR6Q 4H02A 5J3BA 3ERSX 4NXMQ 2BH2A 4IFDJ 1EWIA 1FL0A 4KHZA 1PH5A 4A4IA 1R9TH 1XMOQ 1IBLQ 2MO1A 4B3RQ 1JJ2A 4IPGA 5LMUL 4IPHA 1TWCH 4DV4Q 2ZTEA 2VUMG 3GTQH 3ZJYC 1CSQA 1VQEA 4Y7NH 2N8NA 4GLVB 1N9WA 3RNUA 4LF5L 2HT1A 5GADC 2F3IA 1XNQL 2IHFA 3CPFA 4DV6Q 1L1OA 3VDYA 1N33L 1QZGA 4NXML 4R4CA 1AH9A 2GVBA 2VQEL 2ZJRA 2HHHQ 1EIFA 1LUZA 3TREA 1IBLL 2K5VA 1KXLA 4A3IG 1YIJA 1XMQQ 2IY5B 3HOWG 1Y14B 1KHIA 1X3FA 1YVCA 2K75A 2OQ0A 4DKAC 4DR7Q 1UEBA 2LXJA 4APVA 4HJAA 4O0AA 1CKMA 1SROA 4R1JA 4DV6L 5E7NA 1HH2P 4GS3A 2FXQA 4QIWE 4JBKA 4DAYB 4O2DA 1PH3A 1W2BA 4TQUS 2UXCQ 1CKNB 4LF6L 2ES2A 4OXPA 5K36G 5DLQE 4A3JH 4JBMA 1RIPA 3M9BA 1RL2A 2ZTCA 3H0GG 5IYBH 5C3EH 1XNRL 4DR7L 3I2ZA 2PI2A 5M3MH 1IBKQ 2WFWA 4GNXC 2GN5A 4JI1Q 4C2MH 2E2IH 3S24A 2VW9A 2ID0A 4C3IH 1WFQA 2JEAI 2N3SA 3U4ZA 3CD6A 3MEFA 1K0RA 3T1HQ 4DV0Q 4JI7Q 1SR3A 3J81c 4KHPL 5BR8Q 1I94L 3S1MH 1VQIA 2UXDL 3KOJA 5C0XI 2CWAA 1L1OB 4JBJA 4JI1L 4C3HH 1EQRA 4L5SA 3E9IA 5AJ3L 4LFAQ 2OTLA 1Q46A 4C3JH 3CCMA 1E1TA 2RHQB 4JI7L 4OWTB 4BY7G 1XPOA 2R92G 1AE3A 4A3IH 3FKIH 3CC2A 3PO2G 1KD1C 1I3QH 3HOWH 4LFCQ 2HIXA 1E3PA 2ZM6Q 4X66Q 3PF4A 1CUKA 3KDFA 1KQSA 3K81C 4BBRH 1JE5A 2VQFL 5C4XH 2UUBL 5LMNW 4YCWA 4DR5Q 4J15A 3CCQA 1N34L 1J5EQ 3UDXA 1IBML 4JV5Q 5IP9H 3RLNA 3T1YL 5H1SE 1MJCA 1C9OA 2K50A 2XTIA 3PV0A 3G4SA 4DV3Q 4JI0L 1FJGQ 1C0AA 2Q2IA 4LF8L 4LFCL 4JI3L 4A3MH 1TWFH 4RMFA 3JC66 4X66L 5IWAL 3GTPH 3Q8DA 3S15H 1NY4A 2I5HA 3KJOA 1A62A 3JAMi 5LMNL 1PV4A 2BH8A 4JOIC 3W1GA 3M3YH 2Z6KC 4JI6L 2OCEA 3L7ZC 4LF9L 2NVYH 1MIUA 4EX5A 3AFPA 5M5YH 1X55A 3PO3G 1PH8A 4JYAQ 1FJGL 1WJJA 1VQLA 3PGZA 4X62L 3I7FA 1KIXA 1VQGA 2E2HH 4BA1I 4PG3A 2B63H 2IX1A 3HOXG 1VQBA 5HY6A 1AE2A 3E9HA 1UE6A 2K52A 1XJVA 4PZ8A 4GLAC 2KENA 4JBWA 1Q82C 4A3DG 3CC7A 2MQHA 4OONA 3CMEA 4YHHQ 2NVQH 2R92H 1PH4A 4MZ9A 3DM3A 3CW2C 4DR3L 1EUJA 3KDFB 3G71A 4B3TL 3CCVA 1VQNA 1QVCA 1PH6A 3J7A5 1SFOH 1N36L 1JT8A 3NBHB 2WP8J 2YTYA 1YHQA 1K3RA 3HKSA 1NBWA 4NXNL 1CSPA 3HOYH 3OYYA 3G48A 4DK3C 3PF5A 2YV5A 2UUCL 4GN5A 2RHSB 4XTCS 3LGJA 3GTGH 1UE5A 1PHJA 1HR0Q 4GN3B 4OO1I 4JI5L 4A3JG 5GAGC 1D8LA 3BJUA 1WOCA 4GOPC 3KYHC 4UP9A 3TRZA 1G6PA 1EIYB 4NB3A 3WWVA 3PSIA 2AMCB 4LF5Q 3W1BA 1DGSA 1XNQQ 4AIMA 3OTOL 1WCMG 1Y1VH 1B70B 4X65L 1TWAH 2VQEQ 1VQHA 3EIVA 3CQZH 5IYDG 2ZJQA 2MFIA 1HR0L 2JA7H 1G51A 2AHOB 3GDEA 3M4PA 1I50H 3PO3H 1S72A 3F1ZA 1OTCA 4GNXA 1VQCA 3TQYA 3J7ZC 1FVIA 1FGUA 4A75A 3HKZG 1L2FA 1TWGH 1HZBA 3UE1A 1C7YA 4A3DH 1SRUA 4P72A 1V1QA 2A1AA 3F2DA 1IYJB 4A3KG 1K73C 1I6HH 1HJPA 3FKIG 4LF6Q 3UDIA 5GAHC 4IJHA 4HJ7A 2CQOA 3KJPA 1PH7A 1N8RC 4DR2L 1EFWA 1QVFA 1XNRQ 2R93H 1WYDA 3EBEA 3I4NH 1BKBA 3I4OA 4BBRG 5FLXc 1BVSA 3STBD 5C4XG 3M7NA 4LF4L 4BBSH 4NPSA 4PZ7A 4P71A 3CCRA 1OXSC 3K7UC 1MKHA 5IP9G 2MO0A 3HOVG 3RZDH 3K80C 4KHPQ 3J80i 3I56A 3S2DH 1QZHA 4DUYQ 4A3MG 1I94Q 2UXDQ 2N78A 3AFQA 1Q12A 3GTOH 4FDBA 2R7FA 4DV5Q 3D0FA 2PQAB 3A74A 2R7DA 2RCNA 2VZAA 4YCVA 3F2BA 4HIKA 1WCMH 5AJ3Q 1B7YB 1OXVA 1J6QA 2I0QA 5IYDH 1EOVA 3AQQA 1HNZQ 2C35B 5JEAG 4GNXB 4DUYL 1HNXL 3KF8B 3TS2A 4ALPA 4B3SL 1W3SA 4DV5L 3S2HH 2HQLA 2B63G 4X64L 3K8AA 2VQFQ 4JOIA 3AEVA 2NVXH 2Z6KA 5EAYA 1Z9FA 2UUBQ 2JA6G 1IBMQ 3I4MH 1N34Q 3S1RH 1K83H 1NE3A 1Q1EA 3PUXA 5FLMH 1YI2A 3T1YQ 1Y1WG 4LUVA 4A3KH 1HNZL 2R6GA 2LSSA 1E1OA 2I5MX 1B8AA 1N32L 4JI0Q 3W5OA 5JEAJ 1NMGA 4HJ8A 1KRTA 4LF8Q 1H95A 4JI3Q 1Q7YC 3K7AH 5IWAQ 3TEHB 2I5LX 3CAMA 1PYSB 4IOAA 1GVPA 5LMNQ 3HOYG 1PFSA 3TS0A 4IOCA 1GD7A 1LM0A 1WI5A 3CP0A 1X54A 4XIGS 4EQ5A 2ZJPA 1VQDA 4LF9Q 3HOVH 4A93G 1HNWQ 1G291 4JC0A 4A76A 3SGIA 4X62Q 5M3FH 3HKZE 1PA6A 1K8AC 1NMFA 2YTXA 1HZAA 4GKJL 1JJCB 1ASYA 1IL2A 3HOZH 2GVAA 3CCEA 1Y1VG 4UP8A 1SN8A 2Q2HA 1HNWL 2JE6I 4DV2Q 3FHWA 3HOXH 2B29A 2CKZB 1MJEA 1S3OA 2PMZE 1VQ8A 1X3EA 1VQKA 4LF7L 2ZTDA 4DR3Q 1YJWA 1VQAA 4B3TQ 4AYBG 1EYGA 4UY8C 4GKKQ 2H5XA 2D62A 1NTGA 5ELNA 5C4JH 1YZ6A 1N36Q 4DR4L 5GQOA 4JI2L 2F52A 2EXDA 2E5LQ 4NXNQ 2F4VQ 2JA6H 4K0KQ 2Q2TA 1Y1WH 2AKWB 4DV2L 4LW1A 2UUCQ 3S17H 4A3GH 2LXKA 2A8VA 2ASBA 1E24A 2AWNA 4JI8Q 5GROA 1M90C 2UU9Q 4JI5Q 2EIFA 5IE8A 4JI4Q 3CCJA 4IFDI 4WJ4A 2R93G 4GKKL 2CFMA 4A3CG 3I4NG 4HIDA 2EQSA 2NN6G 3K0XA 2E5LL 2F4VL 4BY1H 3OTOQ 4BBSG 2D0PA 3RN5A 4K0KL 5JJIA 3S1QH 1A0IA 2JA9A 4X65Q 2YU9H 1VQ6A 4LUOA 2JA8G 3B6YA 4A93H 4A3EH 4A3BG 3U50C 4QQBX 3PUYA 4DUZL 1Z47A 4JI8L 2UU9L 2Q2UA 4DR1L 4JI4L 3RN2A 4A3LG 1JJGA 4HJ5A 3CCLA 4L5TA 2ATWA 1PVOA 3PUVA 4KLKA 5JJLA 2IHEA 4TVAB 3ULPA 1I5FA 4DV1Q 2PQAA 2PNHA 3BU2A 1VQ4A 1VQMA 3GD7A 4B3ML 2UXBL 4OWXB 4OX9L 4DV7L 4GOPB 2E8GA 1E22A 4DK6C 3CCUA 2NVTH 4YCUA 3M4OH 2VNUD 2KBNA 4POFA 5IY0A 5GAEC 2RF4A 3GO5A 1PYBA 3J81i 4DR2Q 4P73A 4R4OA 3J81j 4R4IA 1VCIA 2OQKA 2ALYB 3JAMc 1LYLA 3PCOB 2WB1G 5FJ8G 4DV1L 2Y0SG 2OWOA 4LF4Q 3I4MG 4BA2I 1PH9A 3UE0A 3HOZG 5HGQA 5FLMG 3E0EA 1VQOA 1OXUA 4DNIA 2YYZA 1TWHH 1KRSA 4A3CH 4IPCA 5ELOA 4R4QA 4UPAA 4GN4B 1Q8KA 2N49A 5M5WH 2IX0A 5C44G 3GTKH 1BBWA 1V9PA 1S40A 2CWPA 4ME3A 4YWMA 1JB7A 2JA8H 4PZ6A 4AYBE 2R7ZH 4A3BH 1PH1A 1YBYA 5M3FG 4DR6L 1XTDA 4A3LH 3KFUA 1JMCA 3UDFA 1HNXQ 1KL9A 4QY7A 2QEXA 1UE1A 4B3SQ 1XMOL 4B3RL 4X64Q 2IT1A 5IP7G 4DV4L 3F8TA 5JJKA 2B3GA 1OXXK 2K5HA 3NELA 2NZOA 3CF5A 1YNXA 2NZHA 1YHBA 3D31A 1A8VA 3M85A
chains in the Genus database with same CATH superfamily
2XIWA 3S16H 2BE5D 4IO9A 1UUPA 4X3KA 1V43A 3S2DB 2SNSA 4P74A 5KEEA 5LHY1 4P75A 1G2SA 4CJ1B 1YJ9A 3ND9A 2JA7G 4RHRA 3ND8A 4IUVA 1KC8C 1IHZA 3DWQA 5I6WA 3H15A 2F1MA 4O42A 4GKJQ 3TP8A 5C44H 1PDQA 2JA5G 2RVLA 2Y0SB 3BZKA 1OXTA 4FNFA 3I4MB 4X3SA 1X56A 4Y52H 3HOZB 1HQMC 1K0SA 2WB1E 2AWOA 4L5RC 5C0XG 1E7ZA 2KOLA 3T1HL 4ZAIA 1BDOA 3FP9A 3GTJH 2CCZA 2Q8RE 3D8GA 4IJLA 1VQPA 5IODA 1B50A 1SE3A 2DJFC 5KYIA 3AYHB 1UWVA 1LABA 4XYQA 3K6OA 4DAMA 5C6AA 3F2CA 4X6AH 3BVZA 2L12A 2VY3A 1R4PB 3FVQA 4UHVA 2A19A 1VDZA 3CRLC 4IN3A 3L2PA 3RZOH 3CC4A 1UEAB 2QDLA 3H0GH 5A2QL 3S14H 2PI2E 2JA7H 4A3CG 2NN6I 4MTNA 4UDUC 4DUZQ 3VR6A 4DR5L 3L0OA 1GOZA 3QR8A 3HOXB 4IQZA 3S1NH 4DV3L 1Z6HA 2JA5H 5EQ0A 3SK5A 1J9OA 4YWKA 1VS0A 1ZEQX 3QB3A 1F2MA 1X65A 4UP7A 1E0BA 1XPUA 3ER0A 1ZYRC 1STYA 2VL6A 4OELB 4OEMB 4XT1B 5E1FA 3NQTA 4AH6A 4JYAL 2KECA 1VQ5A 4BWGB 4YY3L 2KHJA 2JA5B 3S1QB 2EY2A 1IW7C 1SSOA 3GTLH 4YWLA 1X6OA 1CKOA 4YHHL 3C2PA 4KI0A 4AQYL 1HR0W 2F0HA 3BS1A 1FR3A 2IJ0A 5C3EG 2PO4A 4HIMA 1JICA 1CQVA 1D5MC 1KDBA 4A3FG 5CC4A 3HEJA 1WTPA 1N33Q 1BF4A 2NVTB 4H02A 4RHSA 1EWIA 4L6TB 1YNND 1PH5A 4A4IA 3NXWA 3BVGA 1GUSA 4DV4Q 1TWCH 5CGKA 3GTQH 1JOOA 1F2LA 4Y7NH 1N9WA 5GADC 2F3IA 2QW7A 3CPFA 1L1OA 4ODGA 4J6HA 4NXML 2Z6BA 2VQEL 1EIFA 2F0FA 2WACA 3TREA 1YIJA 3D4WA 2NTTA 2IY5B 3HOWG 1KHIA 1YVCA 5M5WB 2B2WC 3Q6SA 2MGSA 4ZYSA 2B2VC 4ZKBB 1CKMA 3OW7A 4DV6L 5E7NA 1EWCA 4QIWE 4JBKA 1F77A 5ELDA 1MSGA 1QCBD 3MXGA 2ES2A 4OXPA 1D5ZC 3M9BA 5IIFA 5C3EH 1IBKQ 2GN5A 4C2MH 2E2IH 2C5CA 1EYAA 3MEFA 4DV0Q 1SR3A 1CI3M 5EKIA 5EKKA 4KHPL 5BR8Q 1H9KA 1I94L 3S1MH 5KYLA 5C0XI 2CWAA 4JBJA 4JI1L 4A3FB 1E1TA 4JI7L 4BY7G 1WTXA 1EQTA 2B2TC 3FKIH 3IFTA 2F4IA 5KIXA 3HOWH 3GTMB 4LFCQ 1E3PA 1EYDA 3WOFA 3K81C 4FVMA 4BBRH 4X3UA 1IBML 1J5EQ 1N34L 2PPBC 3UDXA 3RLNA 5H1SE 2K50A 3PV0A 1HPCA 1C0AA 2WINB 3JC66 4TKOB 2I5HA 5FO7B 3ITPA 1A62A 3JAMi 5LMNL 2BH8A 2OCEA 4LF9L 3PO3G 4LK1C 1VQLA 3PGZA 1NCVA 3K59A 1VQGA 4QMGA 3K5LA 3N52A 3A54A 4ILWA 2PNRC 1RJTA 1DYQA 1PFBA 4KTAA 4PZ8A 4GLAC 2KENA 4A3DG 2MQHA 1XWEA 2B8GA 1V1PB 3CW2C 5EBCA 4DR3L 4B3TL 1YHQA 1K3RA 3OYYA 3G6JB 4K2KA 3GTGH 3LGJA 1KABA 4BY7B 2C9OA 4YIJA 4JI5L 5JVG3 1MHWC 1ONLA 3TN2A 1D8LA 3BJUA 5ELEA 4KV6A 4LF5Q 1PRTB 1DGSA 3H6MA 4IALA 4Q0FA 2EPBA 4KN7C 1VQHA 3PO3H 1G51A 3L9AX 3E0JA 4R8NA 1AP0A 3F1ZA 3E5SA 5IGDA 2F0IA 1SYBA 4GNXA 4KK7A 1FVIA 4C3HG 2F0OA 1SNPA 1C7YA 4A3DH 4RGTA 1SRUA 4RKBA 1V1QA 1DD2A 3F2DA 2SNMA 1K73C 4LF6Q 1JWMD 1LTBD 1BUVT 1RD9D 3FMCA 4R8IA 1QJOA 1PH7A 1QVFA 1STGA 3KJPA 1XNRQ 4DR2L 2PW5A 1WYDA 3I4NH 5C4XG 2D5DA 1TR5A 3STBD 3M7NA 4P71A 3CCRA 2MO0A 3RZDH 2LFNA 3OMCA 3IFDA 3I56A 4DUYQ 2MP1A 4A3MG 1EU4A 3J80L 2UXDQ 3AFQA 3A74A 2N88A 4YCVA 3OMGA 4XYOA 2L0CA 4ABNA 1I4PA 4NKLA 5G3LD 1LV9A 3RZDB 1BR9A 1ESRA 1JB3A 5EPLA 1PRTF 4RFBA 5T1IA 2B63G 4X64L 1C48A 2VQFQ 2JA6G 1K83H 1Q1EA 5IT9L 1STAA 3T1YQ 4DU9A 2VXWA 2R6GA 1Q3LA 3CKIB 3ZYYX 1N32L 1S5DD 4DFAA 1NMGA 4JI3Q 1H9RA 5A35A 3CAMA 4N9PA 1GVPA 3HOYG 2F0JA 1PFSA 4C3HB 3ONAB 4IOCA 4EQ5A 4XIGS 5CYUA 4X62Q 5M3FH 3J81E 1PA6A 2A6HC 4A3IB 4TSSA 1TU2B 2YTXA 1CQFA 1F2YA 4NDXA 1JJCB 3VA7A 2GVAA 2PCFB 1K8MA 5C4XB 1SN8A 2DY8A 1HTLD 2K5QA 1HNWL 3W2DA 4H7BA 3DEOA 3NTHA 2X6LA 1VQKA 1X3EA 1YJWA 1VQAA 2CH4W 2JN4A 2D62A 4MIUA 4A3MB 3R2TA 5C4JH 3KBXA 2E5LQ 2EDGA 2F3VA 2JA6H 1LTTD 4K0KQ 2R3ZA 1LTGD 3S17H 2LMCB 2NVYB 1LT4D 2Q8TA 5M5YB 4JI8Q 2UU9Q 1G6PA 2EIFA 4IFDI 3CCJA 1G8ZD 3K57A 4GKKL 4HIDA 5EPKA 5EJWA 5FO9B 1JCKB 2F4VL 2B63B 4BBSG 2JA8G 3B6YA 5DNFA 3S17B 2Q2UA 4A3LG 2R92B 3RN2A 4L5TA 3Q0AA 3OPOA 2IHEA 2PQAA 2RCFA 2UXBL 5CV6A 4B3ML 4OX9L 3HOYB 4DV7L 3M4OH 3GV3A 4RH6A 1HRJA 3VR2A 2Z1CA 4R4IA 2ALYB 2WB1G 1PH9A 3E0EA 4DNIA 4C56C 3NQIA 5D3DA 1FNWA 1ILPA 3OWFA 2JA8H 4L8JA 4AYBE 1M4VA 2R7ZH 2QILA 2RA4A 4A3LH 1O7LA 1G2TA 1JMCA 1HNXQ 3SK6A 2QEXA 1J8IA 1XMOL 4B3RL 3GV6A 5IP7G 1WTQA 1B4OA 3F8TA 2B3GA 2MHVA 2K5HA 3I70A 5COYA 2NZHA 4BBSB 3D31A 2WKCA 2FHTA 1A8VA 4NMZA 2JA8B 2F0EA 1ASZA 4LUZA 4JCVE 1XXGA 4XQJA 3H3VH 1PH2A 2L15A 2G9HD 1TS4A 3PUZA 3NK9A 3H3VC 1BCPC 3BDLA 5C5MA 1EQQA 4A3GG 1PTOB 4OO1H 1X3GA 3HOUG 1WTOA 5M9OA 2F0QA 2LKVA 2UXCL 2F0WA 3E3XA 4K2LA 1PMRA 2E2DC 2B2UC 4BY1G 3NEMA 2VUMH 3A5UA 4NW2A 3CXCA 3NTIA 2SEBD 2WB1B 4LFBL 2NVXB 1SE8A 2PQEA 1IXRA 2WAQE 4A3EG 4RG1A 4A3KB 4LF7Q 1JR0D 1DM0B 1Q86C 2DN8A 1Q1BA 1LTLA 3K7AB 5IP7H 4DR4Q 4N8X1 1KAWA 4HN7A 3RLFA 1LLRD 5I2YA 1KDAA 2JK8A 4OIJA 3HOVB 4LMQD 4DGZA 4GOPA 5E4XA 1VQFA 1MI2A 2EY6A 3MXPA 1PYWD 4HR7B 1F9SA 3MWYW 4G57A 2ZM6L 2O2LD 4DXFA 3E6ZX 1SDFA 1S4ZA 4I7AA 3MHBA 1EEID 1STNA 3HOUH 2EJMA 2PZWA 5CV5A 1ENCA 4IPDA 3VYRA 1BNZA 1P8LA 1YNJC 4YY3Q 2F0KA 1MD2D 1PTOF 2K33A 3P7JA 5D3IB 2FFKB 1A63A 1EY9A 1GUOA 2RQXA 2PYKA 4PMBA 4A3GB 5FLXL 3SHLA 2EOTA 1GUGA 1EOTA 3J80E 1ICFB 5C4ZA 1SMXA 4JK1C 4AQYQ 3PO2H 4I7ZC 1NR4A 3D4RA 4BY1B 3IRBA 3H3VI 2YU9B 1RKNA 2KHSA 1VQ9A 1UE7A 1E2WA 1VQJA 4A3EB 2EJFC 3OIQA 4CHTB 1X9NA 1B9MA 1BBUA 1B9NA 3EJIA 1K8OA 4QGUA 5IYBG 3KF6B 5M3MG 3OW2A 5HURA 1LT5D 4PMCA 3UDGA 5IT9E 1QE6A 4KY6A 1U5KA 4DR6Q 4NXMQ 1SYGA 2BH2A 2A69D 2MO1A 4OIKA 5LMUL 1JJ2A 2IL8A 2ZTEA 5ELBA 1CSQA 4GLVB 2H1EA 2IHFA 5CV7A 4DV6Q 5FO8B 1TWHB 4PNYA 2ZJRA 2HHHQ 1XMQQ 1Y14B 3MEHA 1X3FA 3D6WA 1VMPA 2KVMA 2OQ0A 2QKIC 4DKAC 2LXJA 5IGGA 4R1JA 1A15A 1D5XC 3MC0B 4GS3A 4DAYB 1RIPA 2ZTCA 1RODA 3H0GG 5IYBH 1BO0A 3I2ZA 3W3AA 5M3MH 1SYDA 1PLFA 4JI1Q 1GJXA 2JSOA 3MXNA 3VR4A 3S16B 2A74C 2JEAI 4ZUIA 4JI7Q 1K0RA 4RAUC 3J81c 3SEBA 1C4QA 2WV6D 1GHKA 4QUFA 4L5SA 4OGQC 3TDQA 4LFAQ 1Q46A 4C3JH 3CCMA 1FD7D 4OWTB 1GUNA 3DUZA 1XPOA 4IUNA 4J8QA 1AE3A 4Z9CB 1KD1C 1I3QH 5C44B 1V1PA 5E4WC 1CUKA 1KQSA 3MAQA 2UUBL 3D3RA 4YCWA 2L55A 1U4RA 4JV5Q 1T5XD 1O7YA 2XTIA 2D2CC 2K05A 4KKSA 4HCEA 5EBDA 2Q2IA 4CDEC 3GTJB 4LF8L 4RMFA 4X66L 4G7HC 1PV4A 4JOIC 3M3YH 2Z6KC 4JI6L 4QCLA 2F0MA 5I9OA 2NZ1D 1TY0A 1X55A 1FJGL 5ELCA 2P5ZX 3I7FA 1KIXA 2F3WA 3RZOB 1EY4A 3LX0A 4BA1I 2KEDA 2Z8LA 1IL8A 3H0GB 1LTAD 4F8MA 1AE2A 1H9MA 3S14B 1UE6A 2K52A 1XJVA 1H9SB 2JA7B 4JBWA 1Y8OB 3EROA 3A7LA 2TSSA 3CMEA 1HUNA 2Z4IA 2NVQH 1D1IA 1EIGA 4MZ9A 5NUCA 1S5BD 1XTCD 5CV9A 1C8CA 3S1NB 2K5WA 2M9VA 1QVCA 1N36L 1JT8A 3NBHB 2WP8J 3HKSA 1NBWA 4DK3C 2K01A 1HCZA 2VB2X 1SMYD 1O80A 2F0VA 2NVQB 4B9WA 4GOPC 4UP9A 1IKLA 2DNEA 1K28A 3KBGA 3WWVA 2ZXOA 2AMCB 4KMUC 1XNQQ 3OTOL 1Y8NB 1WCMG 1Y1VH 1B70B 4J1MA 3GTLB 1DJRD 2H4OA 3CQZH 3EIVA 4ULLA 5IYDG 2QEJC 5D14A 1LTRD 4DA2A 3U9OA 3PIP3 1S72A 1EZ6A 3QOJA 1OTCA 1JORA 4HCSA 2RBMA 4K6LA 4BS9A 4JVZA 1FGUA 2RDFA 3PIO3 1TWGH 1HZBA 3A55A 5K5PA 2E75C 4QUCA 1IYJB 1DCZA 1I6HH 3FKIG 1WTVA 3IKJA 2L1BA 4IJHA 1EFWA 2R93H 1TWCB 3GTQB 2A68D 4Y7NB 3I4OA 2EYLA 4BBRG 2AQ1B 2DJGC 4PZ7A 1OXSC 2JP1A 1MKHA 4CKBA 4N8FA 4CJ0B 2IWHA 1SNMA 3J80i 1ENFA 1QZHA 5FK9C 1W6KA 1SE4A 2CW0D 4PV1C 3GTOH 3HZXA 3D0FA 1HA5A 3TBIB 4H13C 1WCMH 2GA4B 4QF4A 5AJ3Q 3PQIA 1J6QA 1PRTD 2I0QA 5IYDH 1OO9B 1EOVA 4G7ZC 3AQQA 1RCVD 3KF8B 4IZ8A 1CTMA 1W3SA 3A56A 3BG3A 4DV5L 3S2HH 2HQLA 5C3EB 3K8AA 3AEVA 2EVBA 4XT3B 5EAYA 4C2MB 2E2IB 3S1RH 2RSOA 1Y1WG 2ZT9C 1E1OA 4JI0Q 4HJ8A 3WDNA 4DK1A 2MPMA 3S1MB 5IWAQ 1M8AA 2M2LA 4FF1A 3DXJC 1GD7A 3CP0A 2EYJA 4A93G 3ERQA 1HNWQ 2XRSD 4NP5A 1AW7A 4RCOA 3HKZE 1K8AC 3FKIB 1NMFA 4R9WA 2O5IC 3HOWB 2MUYA 4GKJL 2XSCA 3CCEA 2KEEA 4BBRB 3CRKC 3K0YA 4RGMA 4MN3A 2JE6I 2CKZB 1S3OA 2ZTDA 4P2CB 4AYBG 1EYGA 1YNNC 3AMUA 1STBA 4G4KA 2H5XA 4GKKQ 1NTGA 5JJZA 1LT6D 1E2VA 2EXDA 4NXNQ 2F4VQ 2Q2TA 1Y1WH 2AKWB 1UNSA 4DV2L 2UUCQ 1S5ED 1TT2A 2ASBA 1E24A 2AWNA 4CDDC 1JOQA 1MSHA 4K14A 1DOMA 3I4NG 1NAPA 5JJIA 3R93A 1A2UA 1A0IA 1HXYD 2BOSA 4X65Q 1VQ6A 1GXDC 4A93H 4A3BG 1Y1WB 4QQBX 4DUZL 1HHVA 4JI4L 1EU3A 1X32A 2ZXPA 3GP7A 2ATWA 2QF7A 3MZ5A 3PUVA 5HGTA 3VR3A 3BU2A 2PNHA 2EYHA 4DF7A 1Q90A 3T13A 1NUCA 4DK6C 3CCUA 3GTGB 4A93B 1K3BC 5GAEC 5IY0A 2K28A 3GO5A 1PYBA 4R4OA 1PFNA 2KQ3A 3JAMc 4DV1L 3PCOB 5FJ8G 4IUQA 4LF4Q 3T16A 5HGQA 5IGFA 2CHBD 2YYZA 3PO3B 5ELOA 4U68A 4UPAA 1B3AA 1Q8KA 4RGNA 1WVLA 2IX0A 4FF3A 1BBWA 2KUMA 1S40A 3RD4A 4PZ6A 4A3BH 4A3DB 3CU7A 5M3FG 2AUKA 1TS2A 1KL9A 4ID6A 2NTSA 5A2QE 4B3SQ 1LO5D 5F2DA 4DV4L 3I4NB 5CMDA 3NSWA 2NZOA 1YHBA 4UAIA 2RDGA 2EYFA 3A8JE 3CHBD 4XQQA 3L3OC 3Q24A 2PZUA 5FJ8H 2HCIA 3IL8A 3VR5A 3C1FA 1BXTA 4LFBQ 4CJ2C 1SJHD 5IGEA 1B44D 1L1OC 1U9RA 3J7AF 1RHPA 1L0WA 4HJ9A 2DGYA 2N55A 2Z0SA 3TP6A 3MTSA 5C5LA 1IBKL 5FOBB 3MA2B 3HFZB 3FEWX 1K83B 2A73B 4ZRZA 4DV0L 4LWCA 5BR8L 5IYCG 3NENA 2BA0A 5M5XH 2PMZB 4JI2Q 2L11A 1YJNA 1SXTA 3ULJA 4QL5A 4ZUJA 5M3FB 1ZKOA 1L0XB 3U58A 4QJFA 4HTHA 3M4QA 1IYUA 1F9RA 5M5XB 2MNAA 2KCTA 2I07B 3KLWA 1QUQB 3KF6A 2QA4A 1YITA 1J5EL 4PMWA 2ZXRA 4DR1Q 1D7QA 3JAML 3A5ZB 1PTOD 1IZ6A 5CORA 4KD4A 2UUAL 2KA7A 2BA1A 2TMPA 5C4JB 2YTVA 2OTJA 3I4LA 3H94A 2NYZD 4DPGA 4O1NA 2JA6B 2R7ZG 1RF2D 2D0OA 3STBC 3CMAA 1RDPD 4WJ3M 1QVGA 1K8GA 5BN5A 1GO3E 5IYCH 3I90A 1JC7A 2HIVA 3AB9A 5EKLA 4DN4M 2E2JH 3PUWA 4F88A 1U4MA 1WD0A 5C3XA 1T9HA 4CDCC 2JQOA 3M4YA 1TXYA 1PFMA 1XYIA 3EVQA 3U4VA 2JJQA 1SLJA 5I6YA 1MGSA 2B2YA 4DAYA 3NTKA 1F9QA 3DWPA 3ULLA 5LMUQ 2K14A 1VQ7A 4JG2A 2JXMB 5JAVA 2B39A 1Q81C 1EQVA 4OWWB 4OO1G 2K5NA 1GM5A 4C3IG 3M7GA 4LJZC 1A6XA 3M4OB 5J3BA 4IFDJ 5IGCA 1R9TH 2E76C 3T51B 4QB4A 4IPGA 2NBFA 4IPHA 1QNKA 2VUMG 5DAUA 1LACA 2N8NA 1E2ZA 1ICWA 4LF5L 2F03A 1QZGA 1AH9A 4R4CA 5EGTA 1LUZA 2F0TA 1IBLL 1CZWA 3R8BA 1STHA 4MHEA 2RSNA 4DXGA 2EJGC 3OIPA 4ZKCB 4JW0A 4APVA 1ILQA 1HH2P 2R7ZB 1EIHA 3A7AB 4KY7A 1CKNB 4LF6L 5K36G 4F87A 5DLQE 4A3JH 1VF5C 1RL2A 2PW7A 1XNRL 4DR7L 3O13A 1FYCA 4ZQ3A 2WFWA 4GNXC 2VW9A 4C3IH 1WD1A 1WFQA 4LAAA 2J4XA 2N3SA 3CD6A 3T1HQ 2O5JC 1BCPB 2UXDL 3NBIA 3KOJA 4CKCA 1PZKD 3HRZC 5IGBA 1I4HA 5ISRA 3E9IA 3VYUA 3OWEB 3TZDA 2RHQB 1AZQA 1JOKA 2D9UA 1VF7A 4WRDA 3DEPA 3S9WA 3CC2A 3PO2G 1MBYA 2EY1A 2SDFA 3I8ZA 4X66Q 2VUMB 5L37A 3A8KE 2VQFL 3K5NA 1JE5A 4CDFC 5KGUA 1D1KA 4DR5Q 2A6ED 1V1OA 5IP9H 3T1YL 3OSOA 3P1HA 2FMCA 4DV3Q 2G5DA 1FJGQ 5K36H 1QB5D 2EXZA 4JI3L 1TWFH 3GTPH 3S15H 3KJOA 1PXUA 3BZDB 5ELFA 2AQ3B 3W1GA 1MIUA 2EE1A 3AFPA 4EX5A 4JYAQ 1B3QA 5JEAH 4X62L 2BCOA 4E6IA 2E2HH 3X3MA 2NB0A 4PG3A 2XVSA 4K5XA 2OEOA 1TQOA 4G7OC 5BN4A 3HOUB 3TSSA 1BCPF 5J22A 4YHHQ 3X3NA 3DM3A 1LT3D 3URYA 1EUJA 3KDFB 5TSSA 3G71A 4HMJA 1TS5A 3N6RA 1PH6A 3HG9A 1SFOH 2YTYA 3P75A 3G48A 3PF5A 2YV5A 4GN5A 4XTCS 3I72A 1A3UA 3KK7A 4OO1I 5GAGC 1WOCA 2B2WA 3KYHC 3TRZA 3PO2B 1EIYB 2B2VA 1EY8A 2K32A 3W1BA 2AUJD 2XRQD 1TWAH 1A3TA 1BQQT 2VQEQ 1JQYD 2MFIA 1HR0L 1CM9A 1I50H 4M1UB 2A5HA 1B53A 1ENAA 3KF8A 5JOBA 1G91A 3HKZG 5D65A 1NR2A 4C3JG 2NUCA 3UE1A 4P72A 3QOLA 1EFID 2CQOA 4HEDA 4QIWB 2KCNA 3EBEA 1BKBA 3EQLC 2IX3A 3IAYA 3SVMA 4EQOA 3DWAA 3VYTA 2FINB 4DNTB 1ZYRD 2X69A 5I4DA 3V2TA 3T56B 2B2TA 3C1EA 3K80C 2K7VA 1Q8IA 4KHPQ 1Y69U 3S2DH 1I94Q 2N78A 1Q12A 4FDBA 4DV5Q 2PQAB 2R7DA 2RCNA 5J1ZA 1IW7D 2ICIA 2OF1A 1DONA 5JPMC 1B7YB 1OXVA 3A8IE 4IUPA 1FGBD 2C35B 2LS01 3MFGA 2E74C 1HNXL 3FRPB 4ALPA 1PZID 2F0UA 5EPJA 5M3MB 1EY7A 1IBMQ 3I4MH 1N34Q 1CA6A 1AZPA 3PUXA 3HOZH 5FLMH 4LUVA 1HNZL 2HQEA 2I5MX 5J39A 3W5OA 5JEAJ 1H95A 1AEXA 3Q22A 3TEHB 1SEBD 2I5LX 1PYSB 3KLSX 4IOAA 3LNNA 5LMNQ 3TS0A 1WI5A 4LF9Q 1X54A 3HKZB 2ZJPA 1VQDA 1HQRD 3SDZA 4C3JB 1G291 4JC0A 3SGIA 4FP5D 1I3QB 2G9DA 3T53B 2RKSA 2ENBA 5IOCA 5DEHA 3R3OA 1WTHA 1Y1VG 2Z4HA 4UP8A 2HDLA 4DV2Q 2J7ZA 3HOXH 2B29A 1ZXTA 1VQ8A 4LF7L 1EY0A 4RWSC 5BN3A 4DR3Q 4B3TQ 1CFMA 1ET6A 1QNUA 4UY8C 2A69C 4DR4L 3TP7A 5KRUA 5GQOA 2EZVA 3MXUA 1B1ZA 3M3YB 4I65A 4LW1A 3LWUA 3I73A 4JI5Q 4WJ4A 4K5VA 4JI4Q 1S5CD 4EQPA 2R93G 3LWEA 5I9PA 2CFMA 1SBBB 1EL0A 1BOSA 2D0PA 3J7YW 1SNCA 3S1QH 2JA9A 2DY7A 3QG1A 4C1NK 1Y8PB 4FYDA 5JVH3 3PUYA 1I4GA 1Z47A 2BE5C 3UI2A 1JJGA 3SK4A 4HJ5A 5C0XH 4PQXA 4K8JA 3QO2A 1PVOA 4KLKA 1X3PA 1ESFA 1I5FA 4DV1Q 2CH4A 3NHHA 1VQ4A 4L63B 1RTOA 1EEFD 2EYPA 4GOPB 1E22A 2NVTH 4YCUA 2KBNA 4POFA 2FJ2A 4XQNA 4HAEA 4DR2Q 4P73A 1HFGA 3J81j 3MVVA 1VCIA 5E3FA 1UAPA 3J81L 1LYLA 2OWOA 1HA6A 1QOHA 1WTWA 3UE0A 1Y1VB 1VQOA 1OXUA 3BYYB 2MJ8A 3C3LA 4A3CH 5CV8A 3CQZB 1SYFA 4IPCA 5KNDA 2AQ2B 4R4QA 1TVXA 1AN8A 3K5MA 1ET9A 2N49A 5M5WH 5DM63 3GTKH 2CWPA 4ME3A 2HCCA 4YWMA 1EZ8A 4U673 1SYEA 1TWGB 1YBYA 2HD3A 4DR6L 1I6HB 2HUGA 3UDFA 1UE1A 1CT1D 2Q8IB 1II3A 4X64Q 2IT1A 3QIAA 2R93B 3WOEA 3NELA 4CBVA 3CF5A 2KCCA 3GTKB 4OL7A 3M85A 4K5WA 1N32Q 3SE0A 1YEZA 4B08A 1KDCA 4R4TA 3RR5A 2HHHL 1Z7TA 2J0TD 1XMQL 2V1CC 5KNBA 4POGA 3GTOB 1GHJA 5FLXE 1WCMB 1O7ZA 1EYCA 3DM1A 1F2ZA 5KNCA 4A3FH 2WIIB 2IW3A 3NP8A 3ICEA 4ME5A 4V0BA 3MFYA 1QUQA 4X3TA 4LNQA 1HZ9A 3GTMH 2F0PA 3S2HB 3BYTB 4KD3A 3BDCA 4XXEA 4BXXG 1B2TA 1LTID 1JE4A 3QWNA 4FO2A 3S1RB 4OHJA 2XWJB 3H91A 1JWSD 4DNRB 2Y0SE 2XGTA 3BZCA 2K03A 1L0YB 5C3WA 1SMYC 4MNOA 2LY7A 3BDOA 1QWYA 2CQAA 4MTKA 1GKHA 5LL6S 1U0LA 1I4RA 1KNAA 3K58A 4LFAL 3J80c 4KKTA 3CCSA 3CPWA 4GLXA 5CV4A 2DUDA 5C0XJ 1EY5A 1IYVA 2UUAQ 3I55A 5CBAE 4FXKC 3MXNB 3DLLA 3EN2A 1HZCA 3KUPA 4JV5L 3A0JA 4RCNA 1YHAA 3RUZA 2QGQA 1HTPA 1CHQD 5IT9c 3AU7A 3VA5A 2UXBQ 2FMMA 3TMEA 1SE2A 4B3MQ 1ML0D 4BXXH 2A68C 4OX9Q 1I4QA 4DV7Q 4HIOA 4XDXA 3RLOA 1LTSD 1NJIC 4EGVA 4L5QA 5C4HA 4BY7H 3G6EA 3HP3A 3T4AC 3PIPA 3NWTA 1A3VA 2KCMA 1X3QA 4B9XA 2CW0C 3PIOA 4IFDG 2KHIA 2A6HD 1PRTC 1WTRA 2WAQG 4M8AA 1K9MC 2K4KA 2VB3X 2JEBI 4N9TA 1CKNA 1P16A 1QG7A 1XPRA 1JWUD 4FF2A 4KKUA 1O7IA 1M1KC 4IUTA 2VS1A 4C1NI 1QILA 3ERSX 2QCPX 3DMUA 1FL0A 2BDNA 4KHZA 1IBLQ 1XMOQ 4AYBB 4B3RQ 3K5OA 3HGBA 2K6AA 1TS3A 3ZJYC 1VQEA 3RNUA 1IKMA 4DAPA 2HT1A 1XNQL 1SJED 3VDYA 1N33L 2GVBA 2B8FA 1DOLA 2F0LA 2K5VA 1KXLA 4A3IG 2B2UA 1PZJD 2K75A 4DR7Q 1UEBA 4HJAA 4O0AA 1GUWA 1SROA 4A3BB 2FXQA 4IFDH 3KLRA 1HFNA 1D6EC 4O2DA 1PH3A 1W2BA 4TQUS 3QJYA 2UXCQ 4JBMA 2RDHA 1TY2A 2PI2A 2EYMA 2XNAC 3S24A 2ID0A 5T1GA 4FXGC 2K1BA 3U4ZA 1H9JA 2IPKD 2WAQB 3FDTA 1TIID 4HSVA 1VQIA 1NSNS 1RTNA 1L1OB 1XX8A 3SK8A 1V8QA 1EQRA 4C3HH 1VMCA 5AJ3L 2OTLA 4Q5VA 4KY5A 1U4LA 2L9HA 4HSPA 2R92G 4A3IH 1W6JA 2HIXA 2ZM6Q 3VYSA 2F0NA 3PF4A 1CK1A 3KDFA 5C4XH 1DZ1A 3BVMA 2K04A 5LMNW 1D2BA 1U4PA 4J15A 1I4XA 1KTKA 3CCQA 1C9OA 1MJCA 4K6DA 1AFPA 2WKDA 3G4SA 4JI0L 4LFCL 4A3MH 2R61A 2L4NA 3GQBA 4HMIA 5IWAL 3Q8DA 1NY4A 5DM73 1G6ZA 1KNEA 3TZUA 3L7ZC 2NVYH 3OOCA 1EY6A 5M5YH 1PH8A 2F0SA 1WJJA 1KLGD 4DK0A 2L5TA 1O78A 1A2TA 1GUTA 4K8IA 1BCPD 2B63H 2IX1A 2OT2A 1VQBA 5HY6A 3E9HA 3TP5A 2SOBA 1Q82C 4IURA 1CZGA 3CC7A 4OONA 3I3CA 2R92H 3OHXC 5JPNC 1PH4A 4TRDA 3CCVA 4RA8A 1VQNA 3J7A5 4NXNL 1CSPA 3HOYH 3P20A 2ICEC 2UUCL 2RHSB 1R4QB 1UE5A 1PHJA 5LL6X 1HR0Q 4GN3B 4A3JG 2DNCA 2V4DA 4NB3A 2E2JB 3PSIA 4AIMA 3SXHA 2KJXA 4X65L 2ZJQA 2X6GA 2AHOB 3GDEA 3M4PA 5AFWA 3NWSA 2OXPA 3RMHA 1VQCA 3TQYA 2PZTA 3J7ZC 4A75A 2F0DA 1L2FA 4WORA 3PMFA 2JYOA 1SNOA 2Z9HA 2A1AA 4A3KG 3EA6A 1HJPA 3UDIA 1YNJD 1R9TB 3R2IA 5GAHC 4HJ7A 4S3SA 1N8RC 5FLXc 1BVSA 1EWHA 4LF4L 4BBSH 4NPSA 4RGOS 3U9SA 3K7UC 5IP9G 3HOVG 3DHQA 3HS0C 4V190 3SR1A 2R7FA 1S5FD 3F2BA 2VZAA 4HIKA 3I91A 3J7AV 1PTOH 5FKAC 1HNZQ 5JEAG 4GNXB 4DUYL 3TS2A 4A3JB 4B3SL 1PTOC 5CR3A 3H09A 1TKWB 5G3LF 1KAAA 4JOIA 2NVXH 2Z6KA 3NPPA 1Z9FA 2UUBQ 1CHPD 1NE3A 4C3IB 1T5EA 1YI2A 1H9SA 4A3KH 2LSSA 1B8AA 4RKLA 4LF8Q 1KRTA 1Q7YC 5CBEE 3K7AH 1CA5A 4DAVA 3NBHA 4JI6Q 1LM0A 1SNDA 2NWGA 3HOVH 5I2XA 4IUUA 4A76A 1STEA 2EYOA 4H44C 1HZAA 1NNXA 4GZYC 1ASYA 1IL2A 2Q2HA 3NUCA 3FHWA 1HUMA 3V05A 1MJEA 1BBXC 4EQNA 2PMZE 4ZCKA 4KJOA 1SNQA 1TWFB 5ELNA 1YZ6A 1N36Q 3GTPB 3Q23A 3FPPA 3S15B 1KLUD 4JI2L 2F52A 1FNUA 4EVOA 2K5DA 4A3GH 2LXKA 4H0LC 2A8VA 5GROA 4ZLTF 1M90C 5IE8A 4FF4A 2I46A 2E2HB 2EQSA 2BDOA 2NN6G 3K0XA 4ZK9B 2E5LL 4BY1H 3OTOQ 3RN5A 4K0KL 2YU9H 4LUOA 4A3EH 3U50C 4JI8L 2UU9L 4DR1L 3CCLA 2XN9C 5JJLA 4KHVA 1I6VC 4TVAB 3ULPA 1SFOB 3FPUB 1VQMA 2EY5A 3GD7A 4OWXB 1DOKA 2E8GA 2VNUD 2O4XA 2RF4A 4WJWA 4CGYB 3J81i 3NE5B 2HDMA 1F9PA 4KJNA 2OQKA 2Y0SG 3I4MG 4BA2I 3D6CA 2QDBA 3HOZG 5FLMG 1TWAB 1TWHH 1KRSA 3D4DA 3EFXD 1SYCA 4KN4C 2M00A 1I50B 4GN4B 1DXMA 2NN6H 2CVRA 3C46A 5C44G 2XWBB 1V9PA 1JB7A 3G7LA 1PH1A 3V96A 3KLSA 1XTDA 1SAPA 2A6EC 3KFUA 4JPBW 4WFN3 4QY7A 4FXDA 4F7XA 1FNVA 2B2YC 3F2UA 5JJKA 1OXXK 4CKEA 1YNXA 3JAME 2F0GA 3HOXG
chains in the Genus database with same CATH topology
3S16H 1N32Q 1ASZA 1YEZA 4LUZA 4JCVE 4IO9A 4R4TA 3RR5A 2HHHL 1V43A 3H3VH 4P74A 1XMQL 1PH2A 2L15A 2V1CC 4POGA 4P75A 5FJ8H 3PUZA 4LFBQ 1YJ9A 4A3FH 1EQQA 4A3GG 2JA7G 3ICEA 1X3GA 3HOUG 1KC8C 1L1OC 1QUQA 4LNQA 2UXCL 1HZ9A 3H15A 1L0WA 4HJ9A 2DGYA 3GTMH 4GKJQ 5C44H 2Z0SA 4BY1G 2JA5G 3NEMA 2VUMH 3A5UA 1IBKL 3CXCA 4LFBL 4Y52H 1SE8A 1OXTA 1IXRA 2WAQE 3BZKA 1X56A 3HFZB 4A3EG 4RG1A 4BXXG 4LF7Q 2WB1E 2AWOA 2Y0SE 2XGTA 3BZCA 5C0XG 1E7ZA 4DV0L 3T1HL 4L5RC 4LWCA 1Q86C 3FP9A 3GTJH 1Q1BA 5BR8L 5IYCG 1LTLA 3NENA 2BA0A 5IP7H 4MNOA 2CCZA 4DR4Q 5M5XH 4IJLA 1VQPA 4JI2Q 1KAWA 1GKHA 1U0LA 3RLFA 3AYHB 1UWVA 4DAMA 2JK8A 3F2CA 1YJNA 4LFAL 4X6AH 3J80c 4GOPA 3CCSA 1VQFA 3ULJA 2VY3A 4QL5A 3CPWA 4GLXA 2A19A 5C0XJ 2DUDA 4QJFA 3U58A 3L2PA 3M4QA 3RZOH 3CC4A 2UUAQ 3I55A 3H0GH 2ZM6L 2MNAA 3S14H 2KCTA 3KLWA 3MXNB 2PI2E 1QUQB 3KF6A 3DLLA 2QA4A 1YITA 2NN6I 4MTNA 4DUZQ 3EN2A 3HOUH 4DR5L 3L0OA 1J5EL 4PMWA 1HZCA 4DR1Q 4JV5L 1D7QA 3A5ZB 3A0JA 1IZ6A 4IPDA 1YHAA 3S1NH 4DV3L 1P8LA 2UUAL 2QGQA 2JA5H 2BA1A 2OTJA 2YTVA 4YY3Q 5IT9c 4YWKA 2UXBQ 4B3MQ 4DPGA 4BXXH 1VS0A 4OX9Q 2R7ZG 1A63A 4DV7Q 4HIOA 2D0OA 3RLOA 3STBC 3CMAA 1X65A 4UP7A 1NJIC 1XPUA 3ER0A 4L5QA 2VL6A 4BY7H 4AH6A 3G6EA 4JYAL 4WJ3M 1QVGA 1K8GA 3PIPA 1VQ5A 1GO3E 5IYCH 1SMXA 2HIVA 4AQYQ 3PO2H 4YY3L 2KCMA 2KHJA 2E2JH 3PUWA 3IRBA 3H3VI 3PIOA 1T9HA 2JQOA 1TXYA 1VQ9A 1UE7A 3GTLH 1VQJA 4IFDG 4JI6Q 2KHIA 4YWLA 1X6OA 2WAQG 1K9MC 1CKOA 2K4KA 3U4VA 2JJQA 1SLJA 4KI0A 4YHHL 1X9NA 1BBUA 4AQYL 2JEBI 3ULLA 1HR0W 4QGUA 5LMUQ 2K14A 1CKNA 1VQ7A 1P16A 5IYBG 4JG2A 5C3EG 1XPRA 3KF6B 4HIMA 5M3MG 3OW2A 1O7IA 4A3FG 3UDGA 1Q81C 4OWWB 4OO1G 2K5NA 1GM5A 1M1KC 2VS1A 1U5KA 1N33Q 4DR6Q 4H02A 5J3BA 3ERSX 4NXMQ 2BH2A 4IFDJ 1EWIA 1FL0A 4KHZA 1PH5A 4A4IA 1R9TH 1XMOQ 1IBLQ 2MO1A 4B3RQ 1JJ2A 4IPGA 5LMUL 4IPHA 1TWCH 4DV4Q 2ZTEA 2VUMG 3GTQH 3ZJYC 1CSQA 1VQEA 4Y7NH 2N8NA 4GLVB 1N9WA 3RNUA 4LF5L 2HT1A 5GADC 2F3IA 1XNQL 2IHFA 3CPFA 4DV6Q 1L1OA 3VDYA 1N33L 1QZGA 4NXML 4R4CA 1AH9A 2GVBA 2VQEL 2ZJRA 2HHHQ 1EIFA 1LUZA 3TREA 1IBLL 2K5VA 1KXLA 4A3IG 1YIJA 1XMQQ 2IY5B 3HOWG 1Y14B 1KHIA 1X3FA 1YVCA 2K75A 2OQ0A 4DKAC 4DR7Q 1UEBA 2LXJA 4APVA 4HJAA 4O0AA 1CKMA 1SROA 4R1JA 4DV6L 5E7NA 1HH2P 4GS3A 2FXQA 4QIWE 4JBKA 4DAYB 4O2DA 1PH3A 1W2BA 4TQUS 2UXCQ 1CKNB 4LF6L 2ES2A 4OXPA 5K36G 5DLQE 4A3JH 4JBMA 1RIPA 3M9BA 1RL2A 2ZTCA 3H0GG 5IYBH 5C3EH 1XNRL 4DR7L 3I2ZA 2PI2A 5M3MH 1IBKQ 2WFWA 4GNXC 2GN5A 4JI1Q 4C2MH 2E2IH 3S24A 2VW9A 2ID0A 4C3IH 1WFQA 2JEAI 2N3SA 3U4ZA 3CD6A 3MEFA 1K0RA 3T1HQ 4DV0Q 4JI7Q 1SR3A 3J81c 4KHPL 5BR8Q 1I94L 3S1MH 1VQIA 2UXDL 3KOJA 5C0XI 2CWAA 1L1OB 4JBJA 4JI1L 4C3HH 1EQRA 4L5SA 3E9IA 5AJ3L 4LFAQ 2OTLA 1Q46A 4C3JH 3CCMA 1E1TA 2RHQB 4JI7L 4OWTB 4BY7G 1XPOA 2R92G 1AE3A 4A3IH 3FKIH 3CC2A 3PO2G 1KD1C 1I3QH 3HOWH 4LFCQ 2HIXA 1E3PA 2ZM6Q 4X66Q 3PF4A 1CUKA 3KDFA 1KQSA 3K81C 4BBRH 1JE5A 2VQFL 5C4XH 2UUBL 5LMNW 4YCWA 4DR5Q 4J15A 3CCQA 1N34L 1J5EQ 3UDXA 1IBML 4JV5Q 5IP9H 3RLNA 3T1YL 5H1SE 1MJCA 1C9OA 2K50A 2XTIA 3PV0A 3G4SA 4DV3Q 4JI0L 1FJGQ 1C0AA 2Q2IA 4LF8L 4LFCL 4JI3L 4A3MH 1TWFH 4RMFA 3JC66 4X66L 5IWAL 3GTPH 3Q8DA 3S15H 1NY4A 2I5HA 3KJOA 1A62A 3JAMi 5LMNL 1PV4A 2BH8A 4JOIC 3W1GA 3M3YH 2Z6KC 4JI6L 2OCEA 3L7ZC 4LF9L 2NVYH 1MIUA 4EX5A 3AFPA 5M5YH 1X55A 3PO3G 1PH8A 4JYAQ 1FJGL 1WJJA 1VQLA 3PGZA 4X62L 3I7FA 1KIXA 1VQGA 2E2HH 4BA1I 4PG3A 2B63H 2IX1A 3HOXG 1VQBA 5HY6A 1AE2A 3E9HA 1UE6A 2K52A 1XJVA 4PZ8A 4GLAC 2KENA 4JBWA 1Q82C 4A3DG 3CC7A 2MQHA 4OONA 3CMEA 4YHHQ 2NVQH 2R92H 1PH4A 4MZ9A 3DM3A 3CW2C 4DR3L 1EUJA 3KDFB 3G71A 4B3TL 3CCVA 1VQNA 1QVCA 1PH6A 3J7A5 1SFOH 1N36L 1JT8A 3NBHB 2WP8J 2YTYA 1YHQA 1K3RA 3HKSA 1NBWA 4NXNL 1CSPA 3HOYH 3OYYA 3G48A 4DK3C 3PF5A 2YV5A 2UUCL 4GN5A 2RHSB 4XTCS 3LGJA 3GTGH 1UE5A 1PHJA 1HR0Q 4GN3B 4OO1I 4JI5L 4A3JG 5GAGC 1D8LA 3BJUA 1WOCA 4GOPC 3KYHC 4UP9A 3TRZA 1G6PA 1EIYB 4NB3A 3WWVA 3PSIA 2AMCB 4LF5Q 3W1BA 1DGSA 1XNQQ 4AIMA 3OTOL 1WCMG 1Y1VH 1B70B 4X65L 1TWAH 2VQEQ 1VQHA 3EIVA 3CQZH 5IYDG 2ZJQA 2MFIA 1HR0L 2JA7H 1G51A 2AHOB 3GDEA 3M4PA 1I50H 3PO3H 1S72A 3F1ZA 1OTCA 4GNXA 1VQCA 3TQYA 3J7ZC 1FVIA 1FGUA 4A75A 3HKZG 1L2FA 1TWGH 1HZBA 3UE1A 1C7YA 4A3DH 1SRUA 4P72A 1V1QA 2A1AA 3F2DA 1IYJB 4A3KG 1K73C 1I6HH 1HJPA 3FKIG 4LF6Q 3UDIA 5GAHC 4IJHA 4HJ7A 2CQOA 3KJPA 1PH7A 1N8RC 4DR2L 1EFWA 1QVFA 1XNRQ 2R93H 1WYDA 3EBEA 3I4NH 1BKBA 3I4OA 4BBRG 5FLXc 1BVSA 3STBD 5C4XG 3M7NA 4LF4L 4BBSH 4NPSA 4PZ7A 4P71A 3CCRA 1OXSC 3K7UC 1MKHA 5IP9G 2MO0A 3HOVG 3RZDH 3K80C 4KHPQ 3J80i 3I56A 3S2DH 1QZHA 4DUYQ 4A3MG 1I94Q 2UXDQ 2N78A 3AFQA 1Q12A 3GTOH 4FDBA 2R7FA 4DV5Q 3D0FA 2PQAB 3A74A 2R7DA 2RCNA 2VZAA 4YCVA 3F2BA 4HIKA 1WCMH 5AJ3Q 1B7YB 1OXVA 1J6QA 2I0QA 5IYDH 1EOVA 3AQQA 1HNZQ 2C35B 5JEAG 4GNXB 4DUYL 1HNXL 3KF8B 3TS2A 4ALPA 4B3SL 1W3SA 4DV5L 3S2HH 2HQLA 2B63G 4X64L 3K8AA 2VQFQ 4JOIA 3AEVA 2NVXH 2Z6KA 5EAYA 1Z9FA 2UUBQ 2JA6G 1IBMQ 3I4MH 1N34Q 3S1RH 1K83H 1NE3A 1Q1EA 3PUXA 5FLMH 1YI2A 3T1YQ 1Y1WG 4LUVA 4A3KH 1HNZL 2R6GA 2LSSA 1E1OA 2I5MX 1B8AA 1N32L 4JI0Q 3W5OA 5JEAJ 1NMGA 4HJ8A 1KRTA 4LF8Q 1H95A 4JI3Q 1Q7YC 3K7AH 5IWAQ 3TEHB 2I5LX 3CAMA 1PYSB 4IOAA 1GVPA 5LMNQ 3HOYG 1PFSA 3TS0A 4IOCA 1GD7A 1LM0A 1WI5A 3CP0A 1X54A 4XIGS 4EQ5A 2ZJPA 1VQDA 4LF9Q 3HOVH 4A93G 1HNWQ 1G291 4JC0A 4A76A 3SGIA 4X62Q 5M3FH 3HKZE 1PA6A 1K8AC 1NMFA 2YTXA 1HZAA 4GKJL 1JJCB 1ASYA 1IL2A 3HOZH 2GVAA 3CCEA 1Y1VG 4UP8A 1SN8A 2Q2HA 1HNWL 2JE6I 4DV2Q 3FHWA 3HOXH 2B29A 2CKZB 1MJEA 1S3OA 2PMZE 1VQ8A 1X3EA 1VQKA 4LF7L 2ZTDA 4DR3Q 1YJWA 1VQAA 4B3TQ 4AYBG 1EYGA 4UY8C 4GKKQ 2H5XA 2D62A 1NTGA 5ELNA 5C4JH 1YZ6A 1N36Q 4DR4L 5GQOA 4JI2L 2F52A 2EXDA 2E5LQ 4NXNQ 2F4VQ 2JA6H 4K0KQ 2Q2TA 1Y1WH 2AKWB 4DV2L 4LW1A 2UUCQ 3S17H 4A3GH 2LXKA 2A8VA 2ASBA 1E24A 2AWNA 4JI8Q 5GROA 1M90C 2UU9Q 4JI5Q 2EIFA 5IE8A 4JI4Q 3CCJA 4IFDI 4WJ4A 2R93G 4GKKL 2CFMA 4A3CG 3I4NG 4HIDA 2EQSA 2NN6G 3K0XA 2E5LL 2F4VL 4BY1H 3OTOQ 4BBSG 2D0PA 3RN5A 4K0KL 5JJIA 3S1QH 1A0IA 2JA9A 4X65Q 2YU9H 1VQ6A 4LUOA 2JA8G 3B6YA 4A93H 4A3EH 4A3BG 3U50C 4QQBX 3PUYA 4DUZL 1Z47A 4JI8L 2UU9L 2Q2UA 4DR1L 4JI4L 3RN2A 4A3LG 1JJGA 4HJ5A 3CCLA 4L5TA 2ATWA 1PVOA 3PUVA 4KLKA 5JJLA 2IHEA 4TVAB 3ULPA 1I5FA 4DV1Q 2PQAA 2PNHA 3BU2A 1VQ4A 1VQMA 3GD7A 4B3ML 2UXBL 4OWXB 4OX9L 4DV7L 4GOPB 2E8GA 1E22A 4DK6C 3CCUA 2NVTH 4YCUA 3M4OH 2VNUD 2KBNA 4POFA 5IY0A 5GAEC 2RF4A 3GO5A 1PYBA 3J81i 4DR2Q 4P73A 4R4OA 3J81j 4R4IA 1VCIA 2OQKA 2ALYB 3JAMc 1LYLA 3PCOB 2WB1G 5FJ8G 4DV1L 2Y0SG 2OWOA 4LF4Q 3I4MG 4BA2I 1PH9A 3UE0A 3HOZG 5HGQA 5FLMG 3E0EA 1VQOA 1OXUA 4DNIA 2YYZA 1TWHH 1KRSA 4A3CH 4IPCA 5ELOA 4R4QA 4UPAA 4GN4B 1Q8KA 2N49A 5M5WH 2IX0A 5C44G 3GTKH 1BBWA 1V9PA 1S40A 2CWPA 4ME3A 4YWMA 1JB7A 2JA8H 4PZ6A 4AYBE 2R7ZH 4A3BH 1PH1A 1YBYA 5M3FG 4DR6L 1XTDA 4A3LH 3KFUA 1JMCA 3UDFA 1HNXQ 1KL9A 4QY7A 2QEXA 1UE1A 4B3SQ 1XMOL 4B3RL 4X64Q 2IT1A 5IP7G 4DV4L 3F8TA 5JJKA 2B3GA 1OXXK 2K5HA 3NELA 2NZOA 3CF5A 1YNXA 2NZHA 1YHBA 3D31A 1A8VA 3M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 H;  1N32 Q;  1ASZ A;  1YEZ A;  4LUZ A;  4JCV E;  4IO9 A;  4R4T A;  3RR5 A;  2HHH L;  1V43 A;  3H3V H;  4P74 A;  1XMQ L;  1PH2 A;  2L15 A;  2V1C C;  4POG A;  4P75 A;  5FJ8 H;  3PUZ A;  4LFB Q;  1YJ9 A;  4A3F H;  1EQQ A;  4A3G G;  2JA7 G;  3ICE A;  1X3G A;  3HOU G;  1KC8 C;  1L1O C;  1QUQ A;  4LNQ A;  2UXC L;  1HZ9 A;  3H15 A;  1L0W A;  4HJ9 A;  2DGY A;  3GTM H;  4GKJ Q;  5C44 H;  2Z0S A;  4BY1 G;  2JA5 G;  3NEM A;  2VUM H;  3A5U A;  1IBK L;  3CXC A;  4LFB L;  4Y52 H;  1SE8 A;  1OXT A;  1IXR A;  2WAQ E;  3BZK A;  1X56 A;  3HFZ B;  4A3E G;  4RG1 A;  4BXX G;  4LF7 Q;  2WB1 E;  2AWO A;  2Y0S E;  2XGT A;  3BZC A;  5C0X G;  1E7Z A;  4DV0 L;  3T1H L;  4L5R C;  4LWC A;  1Q86 C;  3FP9 A;  3GTJ H;  1Q1B A;  5BR8 L;  5IYC G;  1LTL A;  3NEN A;  2BA0 A;  5IP7 H;  4MNO A;  2CCZ A;  4DR4 Q;  5M5X H;  4IJL A;  1VQP A;  4JI2 Q;  1KAW A;  1GKH A;  1U0L A;  3RLF A;  3AYH B;  1UWV A;  4DAM A;  2JK8 A;  3F2C A;  1YJN A;  4LFA L;  4X6A H;  3J80 c;  4GOP A;  3CCS A;  1VQF A;  3ULJ A;  2VY3 A;  4QL5 A;  3CPW A;  4GLX A;  2A19 A;  5C0X J;  2DUD A;  4QJF A;  3U58 A;  3L2P A;  3M4Q A;  3RZO H;  3CC4 A;  2UUA Q;  3I55 A;  3H0G H;  2ZM6 L;  2MNA A;  3S14 H;  2KCT A;  3KLW A;  3MXN B;  2PI2 E;  1QUQ B;  3KF6 A;  3DLL A;  2QA4 A;  1YIT A;  2NN6 I;  4MTN A;  4DUZ Q;  3EN2 A;  3HOU H;  4DR5 L;  3L0O A;  1J5E L;  4PMW A;  1HZC A;  4DR1 Q;  4JV5 L;  1D7Q A;  3A5Z B;  3A0J A;  1IZ6 A;  4IPD A;  1YHA A;  3S1N H;  4DV3 L;  1P8L A;  2UUA L;  2QGQ A;  2JA5 H;  2BA1 A;  2OTJ A;  2YTV A;  4YY3 Q;  5IT9 c;  4YWK A;  2UXB Q;  4B3M Q;  4DPG A;  4BXX H;  1VS0 A;  4OX9 Q;  2R7Z G;  1A63 A;  4DV7 Q;  4HIO A;  2D0O A;  3RLO A;  3STB C;  3CMA A;  1X65 A;  4UP7 A;  1NJI C;  1XPU A;  3ER0 A;  4L5Q A;  2VL6 A;  4BY7 H;  4AH6 A;  3G6E A;  4JYA L;  4WJ3 M;  1QVG A;  1K8G A;  3PIP A;  1VQ5 A;  1GO3 E;  5IYC H;  1SMX A;  2HIV A;  4AQY Q;  3PO2 H;  4YY3 L;  2KCM A;  2KHJ A;  2E2J H;  3PUW A;  3IRB A;  3H3V I;  3PIO A;  1T9H A;  2JQO A;  1TXY A;  1VQ9 A;  1UE7 A;  3GTL H;  1VQJ A;  4IFD G;  4JI6 Q;  2KHI A;  4YWL A;  1X6O A;  2WAQ G;  1K9M C;  1CKO A;  2K4K A;  3U4V A;  2JJQ A;  1SLJ A;  4KI0 A;  4YHH L;  1X9N A;  1BBU A;  4AQY L;  2JEB I;  3ULL A;  1HR0 W;  4QGU A;  5LMU Q;  2K14 A;  1CKN A;  1VQ7 A;  1P16 A;  5IYB G;  4JG2 A;  5C3E G;  1XPR A;  3KF6 B;  4HIM A;  5M3M G;  3OW2 A;  1O7I A;  4A3F G;  3UDG A;  1Q81 C;  4OWW B;  4OO1 G;  2K5N A;  1GM5 A;  1M1K C;  2VS1 A;  1U5K A;  1N33 Q;  4DR6 Q;  4H02 A;  5J3B A;  3ERS X;  4NXM Q;  2BH2 A;  4IFD J;  1EWI A;  1FL0 A;  4KHZ A;  1PH5 A;  4A4I A;  1R9T H;  1XMO Q;  1IBL Q;  2MO1 A;  4B3R Q;  1JJ2 A;  4IPG A;  5LMU L;  4IPH A;  1TWC H;  4DV4 Q;  2ZTE A;  2VUM G;  3GTQ H;  3ZJY C;  1CSQ A;  1VQE A;  4Y7N H;  2N8N A;  4GLV B;  1N9W A;  3RNU A;  4LF5 L;  2HT1 A;  5GAD C;  2F3I A;  1XNQ L;  2IHF A;  3CPF A;  4DV6 Q;  1L1O A;  3VDY A;  1N33 L;  1QZG A;  4NXM L;  4R4C A;  1AH9 A;  2GVB A;  2VQE L;  2ZJR A;  2HHH Q;  1EIF A;  1LUZ A;  3TRE A;  1IBL L;  2K5V A;  1KXL A;  4A3I G;  1YIJ A;  1XMQ Q;  2IY5 B;  3HOW G;  1Y14 B;  1KHI A;  1X3F A;  1YVC A;  2K75 A;  2OQ0 A;  4DKA C;  4DR7 Q;  1UEB A;  2LXJ A;  4APV A;  4HJA A;  4O0A A;  1CKM A;  1SRO A;  4R1J A;  4DV6 L;  5E7N A;  1HH2 P;  4GS3 A;  2FXQ A;  4QIW E;  4JBK A;  4DAY B;  4O2D A;  1PH3 A;  1W2B A;  4TQU S;  2UXC Q;  1CKN B;  4LF6 L;  2ES2 A;  4OXP A;  5K36 G;  5DLQ E;  4A3J H;  4JBM A;  1RIP A;  3M9B A;  1RL2 A;  2ZTC A;  3H0G G;  5IYB H;  5C3E H;  1XNR L;  4DR7 L;  3I2Z A;  2PI2 A;  5M3M H;  1IBK Q;  2WFW A;  4GNX C;  2GN5 A;  4JI1 Q;  4C2M H;  2E2I H;  3S24 A;  2VW9 A;  2ID0 A;  4C3I H;  1WFQ A;  2JEA I;  2N3S A;  3U4Z A;  3CD6 A;  3MEF A;  1K0R A;  3T1H Q;  4DV0 Q;  4JI7 Q;  1SR3 A;  3J81 c;  4KHP L;  5BR8 Q;  1I94 L;  3S1M H;  1VQI A;  2UXD L;  3KOJ A;  5C0X I;  2CWA A;  1L1O B;  4JBJ A;  4JI1 L;  4C3H H;  1EQR A;  4L5S A;  3E9I A;  5AJ3 L;  4LFA Q;  2OTL A;  1Q46 A;  4C3J H;  3CCM A;  1E1T A;  2RHQ B;  4JI7 L;  4OWT B;  4BY7 G;  1XPO A;  2R92 G;  1AE3 A;  4A3I H;  3FKI H;  3CC2 A;  3PO2 G;  1KD1 C;  1I3Q H;  3HOW H;  4LFC Q;  2HIX A;  1E3P A;  2ZM6 Q;  4X66 Q;  3PF4 A;  1CUK A;  3KDF A;  1KQS A;  3K81 C;  4BBR H;  1JE5 A;  2VQF L;  5C4X H;  2UUB L;  5LMN W;  4YCW A;  4DR5 Q;  4J15 A;  3CCQ A;  1N34 L;  1J5E Q;  3UDX A;  1IBM L;  4JV5 Q;  5IP9 H;  3RLN A;  3T1Y L;  5H1S E;  1MJC A;  1C9O A;  2K50 A;  2XTI A;  3PV0 A;  3G4S A;  4DV3 Q;  4JI0 L;  1FJG Q;  1C0A A;  2Q2I A;  4LF8 L;  4LFC L;  4JI3 L;  4A3M H;  1TWF H;  4RMF A;  3JC6 6;  4X66 L;  5IWA L;  3GTP H;  3Q8D A;  3S15 H;  1NY4 A;  2I5H A;  3KJO A;  1A62 A;  3JAM i;  5LMN L;  1PV4 A;  2BH8 A;  4JOI C;  3W1G A;  3M3Y H;  2Z6K C;  4JI6 L;  2OCE A;  3L7Z C;  4LF9 L;  2NVY H;  1MIU A;  4EX5 A;  3AFP A;  5M5Y H;  1X55 A;  3PO3 G;  1PH8 A;  4JYA Q;  1FJG L;  1WJJ A;  1VQL A;  3PGZ A;  4X62 L;  3I7F A;  1KIX A;  1VQG A;  2E2H H;  4BA1 I;  4PG3 A;  2B63 H;  2IX1 A;  3HOX G;  1VQB A;  5HY6 A;  1AE2 A;  3E9H A;  1UE6 A;  2K52 A;  1XJV A;  4PZ8 A;  4GLA C;  2KEN A;  4JBW A;  1Q82 C;  4A3D G;  3CC7 A;  2MQH A;  4OON A;  3CME A;  4YHH Q;  2NVQ H;  2R92 H;  1PH4 A;  4MZ9 A;  3DM3 A;  3CW2 C;  4DR3 L;  1EUJ A;  3KDF B;  3G71 A;  4B3T L;  3CCV A;  1VQN A;  1QVC A;  1PH6 A;  3J7A 5;  1SFO H;  1N36 L;  1JT8 A;  3NBH B;  2WP8 J;  2YTY A;  1YHQ A;  1K3R A;  3HKS A;  1NBW A;  4NXN L;  1CSP A;  3HOY H;  3OYY A;  3G48 A;  4DK3 C;  3PF5 A;  2YV5 A;  2UUC L;  4GN5 A;  2RHS B;  4XTC S;  3LGJ A;  3GTG H;  1UE5 A;  1PHJ A;  1HR0 Q;  4GN3 B;  4OO1 I;  4JI5 L;  4A3J G;  5GAG C;  1D8L A;  3BJU A;  1WOC A;  4GOP C;  3KYH C;  4UP9 A;  3TRZ A;  1G6P A;  1EIY B;  4NB3 A;  3WWV A;  3PSI A;  2AMC B;  4LF5 Q;  3W1B A;  1DGS A;  1XNQ Q;  4AIM A;  3OTO L;  1WCM G;  1Y1V H;  1B70 B;  4X65 L;  1TWA H;  2VQE Q;  1VQH A;  3EIV A;  3CQZ H;  5IYD G;  2ZJQ A;  2MFI A;  1HR0 L;  2JA7 H;  1G51 A;  2AHO B;  3GDE A;  3M4P A;  1I50 H;  3PO3 H;  1S72 A;  3F1Z A;  1OTC A;  4GNX A;  1VQC A;  3TQY A;  3J7Z C;  1FVI A;  1FGU A;  4A75 A;  3HKZ G;  1L2F A;  1TWG H;  1HZB A;  3UE1 A;  1C7Y A;  4A3D H;  1SRU A;  4P72 A;  1V1Q A;  2A1A A;  3F2D A;  1IYJ B;  4A3K G;  1K73 C;  1I6H H;  1HJP A;  3FKI G;  4LF6 Q;  3UDI A;  5GAH C;  4IJH A;  4HJ7 A;  2CQO A;  3KJP A;  1PH7 A;  1N8R C;  4DR2 L;  1EFW A;  1QVF A;  1XNR Q;  2R93 H;  1WYD A;  3EBE A;  3I4N H;  1BKB A;  3I4O A;  4BBR G;  5FLX c;  1BVS A;  3STB D;  5C4X G;  3M7N A;  4LF4 L;  4BBS H;  4NPS A;  4PZ7 A;  4P71 A;  3CCR A;  1OXS C;  3K7U C;  1MKH A;  5IP9 G;  2MO0 A;  3HOV G;  3RZD H;  3K80 C;  4KHP Q;  3J80 i;  3I56 A;  3S2D H;  1QZH A;  4DUY Q;  4A3M G;  1I94 Q;  2UXD Q;  2N78 A;  3AFQ A;  1Q12 A;  3GTO H;  4FDB A;  2R7F A;  4DV5 Q;  3D0F A;  2PQA B;  3A74 A;  2R7D A;  2RCN A;  2VZA A;  4YCV A;  3F2B A;  4HIK A;  1WCM H;  5AJ3 Q;  1B7Y B;  1OXV A;  1J6Q A;  2I0Q A;  5IYD H;  1EOV A;  3AQQ A;  1HNZ Q;  2C35 B;  5JEA G;  4GNX B;  4DUY L;  1HNX L;  3KF8 B;  3TS2 A;  4ALP A;  4B3S L;  1W3S A;  4DV5 L;  3S2H H;  2HQL A;  2B63 G;  4X64 L;  3K8A A;  2VQF Q;  4JOI A;  3AEV A;  2NVX H;  2Z6K A;  5EAY A;  1Z9F A;  2UUB Q;  2JA6 G;  1IBM Q;  3I4M H;  1N34 Q;  3S1R H;  1K83 H;  1NE3 A;  1Q1E A;  3PUX A;  5FLM H;  1YI2 A;  3T1Y Q;  1Y1W G;  4LUV A;  4A3K H;  1HNZ L;  2R6G A;  2LSS A;  1E1O A;  2I5M X;  1B8A A;  1N32 L;  4JI0 Q;  3W5O A;  5JEA J;  1NMG A;  4HJ8 A;  1KRT A;  4LF8 Q;  1H95 A;  4JI3 Q;  1Q7Y C;  3K7A H;  5IWA Q;  3TEH B;  2I5L X;  3CAM A;  1PYS B;  4IOA A;  1GVP A;  5LMN Q;  3HOY G;  1PFS A;  3TS0 A;  4IOC A;  1GD7 A;  1LM0 A;  1WI5 A;  3CP0 A;  1X54 A;  4XIG S;  4EQ5 A;  2ZJP A;  1VQD A;  4LF9 Q;  3HOV H;  4A93 G;  1HNW Q;  1G29 1;  4JC0 A;  4A76 A;  3SGI A;  4X62 Q;  5M3F H;  3HKZ E;  1PA6 A;  1K8A C;  1NMF A;  2YTX A;  1HZA A;  4GKJ L;  1JJC B;  1ASY A;  1IL2 A;  3HOZ H;  2GVA A;  3CCE A;  1Y1V G;  4UP8 A;  1SN8 A;  2Q2H A;  1HNW L;  2JE6 I;  4DV2 Q;  3FHW A;  3HOX H;  2B29 A;  2CKZ B;  1MJE A;  1S3O A;  2PMZ E;  1VQ8 A;  1X3E A;  1VQK A;  4LF7 L;  2ZTD A;  4DR3 Q;  1YJW A;  1VQA A;  4B3T Q;  4AYB G;  1EYG A;  4UY8 C;  4GKK Q;  2H5X A;  2D62 A;  1NTG A;  5ELN A;  5C4J H;  1YZ6 A;  1N36 Q;  4DR4 L;  5GQO A;  4JI2 L;  2F52 A;  2EXD A;  2E5L Q;  4NXN Q;  2F4V Q;  2JA6 H;  4K0K Q;  2Q2T A;  1Y1W H;  2AKW B;  4DV2 L;  4LW1 A;  2UUC Q;  3S17 H;  4A3G H;  2LXK A;  2A8V A;  2ASB A;  1E24 A;  2AWN A;  4JI8 Q;  5GRO A;  1M90 C;  2UU9 Q;  4JI5 Q;  2EIF A;  5IE8 A;  4JI4 Q;  3CCJ A;  4IFD I;  4WJ4 A;  2R93 G;  4GKK L;  2CFM A;  4A3C G;  3I4N G;  4HID A;  2EQS A;  2NN6 G;  3K0X A;  2E5L L;  2F4V L;  4BY1 H;  3OTO Q;  4BBS G;  2D0P A;  3RN5 A;  4K0K L;  5JJI A;  3S1Q H;  1A0I A;  2JA9 A;  4X65 Q;  2YU9 H;  1VQ6 A;  4LUO A;  2JA8 G;  3B6Y A;  4A93 H;  4A3E H;  4A3B G;  3U50 C;  4QQB X;  3PUY A;  4DUZ L;  1Z47 A;  4JI8 L;  2UU9 L;  2Q2U A;  4DR1 L;  4JI4 L;  3RN2 A;  4A3L G;  1JJG A;  4HJ5 A;  3CCL A;  4L5T A;  2ATW A;  1PVO A;  3PUV A;  4KLK A;  5JJL A;  2IHE A;  4TVA B;  3ULP A;  1I5F A;  4DV1 Q;  2PQA A;  2PNH A;  3BU2 A;  1VQ4 A;  1VQM A;  3GD7 A;  4B3M L;  2UXB L;  4OWX B;  4OX9 L;  4DV7 L;  4GOP B;  2E8G A;  1E22 A;  4DK6 C;  3CCU A;  2NVT H;  4YCU A;  3M4O H;  2VNU D;  2KBN A;  4POF A;  5IY0 A;  5GAE C;  2RF4 A;  3GO5 A;  1PYB A;  3J81 i;  4DR2 Q;  4P73 A;  4R4O A;  3J81 j;  4R4I A;  1VCI A;  2OQK A;  2ALY B;  3JAM c;  1LYL A;  3PCO B;  2WB1 G;  5FJ8 G;  4DV1 L;  2Y0S G;  2OWO A;  4LF4 Q;  3I4M G;  4BA2 I;  1PH9 A;  3UE0 A;  3HOZ G;  5HGQ A;  5FLM G;  3E0E A;  1VQO A;  1OXU A;  4DNI A;  2YYZ A;  1TWH H;  1KRS A;  4A3C H;  4IPC A;  5ELO A;  4R4Q A;  4UPA A;  4GN4 B;  1Q8K A;  2N49 A;  5M5W H;  2IX0 A;  5C44 G;  3GTK H;  1BBW A;  1V9P A;  1S40 A;  2CWP A;  4ME3 A;  4YWM A;  1JB7 A;  2JA8 H;  4PZ6 A;  4AYB E;  2R7Z H;  4A3B H;  1PH1 A;  1YBY A;  5M3F G;  4DR6 L;  1XTD A;  4A3L H;  3KFU A;  1JMC A;  3UDF A;  1HNX Q;  1KL9 A;  4QY7 A;  2QEX A;  1UE1 A;  4B3S Q;  1XMO L;  4B3R L;  4X64 Q;  2IT1 A;  5IP7 G;  4DV4 L;  3F8T A;  5JJK A;  2B3G A;  1OXX K;  2K5H A;  3NEL A;  2NZO A;  3CF5 A;  1YNX A;  2NZH A;  1YHB A;  3D31 A;  1A8V A;  3M85 A; 
#chains in the Genus database with same CATH topology
 2XIW A;  3S16 H;  2BE5 D;  4IO9 A;  1UUP A;  4X3K A;  1V43 A;  3S2D B;  2SNS A;  4P74 A;  5KEE A;  5LHY 1;  4P75 A;  1G2S A;  4CJ1 B;  1YJ9 A;  3ND9 A;  2JA7 G;  4RHR A;  3ND8 A;  4IUV A;  1KC8 C;  1IHZ A;  3DWQ A;  5I6W A;  3H15 A;  2F1M A;  4O42 A;  4GKJ Q;  3TP8 A;  5C44 H;  1PDQ A;  2JA5 G;  2RVL A;  2Y0S B;  3BZK A;  1OXT A;  4FNF A;  3I4M B;  4X3S A;  1X56 A;  4Y52 H;  3HOZ B;  1HQM C;  1K0S A;  2WB1 E;  2AWO A;  4L5R C;  5C0X G;  1E7Z A;  2KOL A;  3T1H L;  4ZAI A;  1BDO A;  3FP9 A;  3GTJ H;  2CCZ A;  2Q8R E;  3D8G A;  4IJL A;  1VQP A;  5IOD A;  1B50 A;  1SE3 A;  2DJF C;  5KYI A;  3AYH B;  1UWV A;  1LAB A;  4XYQ A;  3K6O A;  4DAM A;  5C6A A;  3F2C A;  4X6A H;  3BVZ A;  2L12 A;  2VY3 A;  1R4P B;  3FVQ A;  4UHV A;  2A19 A;  1VDZ A;  3CRL C;  4IN3 A;  3L2P A;  3RZO H;  3CC4 A;  1UEA B;  2QDL A;  3H0G H;  5A2Q L;  3S14 H;  2PI2 E;  2JA7 H;  4A3C G;  2NN6 I;  4MTN A;  4UDU C;  4DUZ Q;  3VR6 A;  4DR5 L;  3L0O A;  1GOZ A;  3QR8 A;  3HOX B;  4IQZ A;  3S1N H;  4DV3 L;  1Z6H A;  2JA5 H;  5EQ0 A;  3SK5 A;  1J9O A;  4YWK A;  1VS0 A;  1ZEQ X;  3QB3 A;  1F2M A;  1X65 A;  4UP7 A;  1E0B A;  1XPU A;  3ER0 A;  1ZYR C;  1STY A;  2VL6 A;  4OEL B;  4OEM B;  4XT1 B;  5E1F A;  3NQT A;  4AH6 A;  4JYA L;  2KEC A;  1VQ5 A;  4BWG B;  4YY3 L;  2KHJ A;  2JA5 B;  3S1Q B;  2EY2 A;  1IW7 C;  1SSO A;  3GTL H;  4YWL A;  1X6O A;  1CKO A;  4YHH L;  3C2P A;  4KI0 A;  4AQY L;  1HR0 W;  2F0H A;  3BS1 A;  1FR3 A;  2IJ0 A;  5C3E G;  2PO4 A;  4HIM A;  1JIC A;  1CQV A;  1D5M C;  1KDB A;  4A3F G;  5CC4 A;  3HEJ A;  1WTP A;  1N33 Q;  1BF4 A;  2NVT B;  4H02 A;  4RHS A;  1EWI A;  4L6T B;  1YNN D;  1PH5 A;  4A4I A;  3NXW A;  3BVG A;  1GUS A;  4DV4 Q;  1TWC H;  5CGK A;  3GTQ H;  1JOO A;  1F2L A;  4Y7N H;  1N9W A;  5GAD C;  2F3I A;  2QW7 A;  3CPF A;  1L1O A;  4ODG A;  4J6H A;  4NXM L;  2Z6B A;  2VQE L;  1EIF A;  2F0F A;  2WAC A;  3TRE A;  1YIJ A;  3D4W A;  2NTT A;  2IY5 B;  3HOW G;  1KHI A;  1YVC A;  5M5W B;  2B2W C;  3Q6S A;  2MGS A;  4ZYS A;  2B2V C;  4ZKB B;  1CKM A;  3OW7 A;  4DV6 L;  5E7N A;  1EWC A;  4QIW E;  4JBK A;  1F77 A;  5ELD A;  1MSG A;  1QCB D;  3MXG A;  2ES2 A;  4OXP A;  1D5Z C;  3M9B A;  5IIF A;  5C3E H;  1IBK Q;  2GN5 A;  4C2M H;  2E2I H;  2C5C A;  1EYA A;  3MEF A;  4DV0 Q;  1SR3 A;  1CI3 M;  5EKI A;  5EKK A;  4KHP L;  5BR8 Q;  1H9K A;  1I94 L;  3S1M H;  5KYL A;  5C0X I;  2CWA A;  4JBJ A;  4JI1 L;  4A3F B;  1E1T A;  4JI7 L;  4BY7 G;  1WTX A;  1EQT A;  2B2T C;  3FKI H;  3IFT A;  2F4I A;  5KIX A;  3HOW H;  3GTM B;  4LFC Q;  1E3P A;  1EYD A;  3WOF A;  3K81 C;  4FVM A;  4BBR H;  4X3U A;  1IBM L;  1J5E Q;  1N34 L;  2PPB C;  3UDX A;  3RLN A;  5H1S E;  2K50 A;  3PV0 A;  1HPC A;  1C0A A;  2WIN B;  3JC6 6;  4TKO B;  2I5H A;  5FO7 B;  3ITP A;  1A62 A;  3JAM i;  5LMN L;  2BH8 A;  2OCE A;  4LF9 L;  3PO3 G;  4LK1 C;  1VQL A;  3PGZ A;  1NCV A;  3K59 A;  1VQG A;  4QMG A;  3K5L A;  3N52 A;  3A54 A;  4ILW A;  2PNR C;  1RJT A;  1DYQ A;  1PFB A;  4KTA A;  4PZ8 A;  4GLA C;  2KEN A;  4A3D G;  2MQH A;  1XWE A;  2B8G A;  1V1P B;  3CW2 C;  5EBC A;  4DR3 L;  4B3T L;  1YHQ A;  1K3R A;  3OYY A;  3G6J B;  4K2K A;  3GTG H;  3LGJ A;  1KAB A;  4BY7 B;  2C9O A;  4YIJ A;  4JI5 L;  5JVG 3;  1MHW C;  1ONL A;  3TN2 A;  1D8L A;  3BJU A;  5ELE A;  4KV6 A;  4LF5 Q;  1PRT B;  1DGS A;  3H6M A;  4IAL A;  4Q0F A;  2EPB A;  4KN7 C;  1VQH A;  3PO3 H;  1G51 A;  3L9A X;  3E0J A;  4R8N A;  1AP0 A;  3F1Z A;  3E5S A;  5IGD A;  2F0I A;  1SYB A;  4GNX A;  4KK7 A;  1FVI A;  4C3H G;  2F0O A;  1SNP A;  1C7Y A;  4A3D H;  4RGT A;  1SRU A;  4RKB A;  1V1Q A;  1DD2 A;  3F2D A;  2SNM A;  1K73 C;  4LF6 Q;  1JWM D;  1LTB D;  1BUV T;  1RD9 D;  3FMC A;  4R8I A;  1QJO A;  1PH7 A;  1QVF A;  1STG A;  3KJP A;  1XNR Q;  4DR2 L;  2PW5 A;  1WYD A;  3I4N H;  5C4X G;  2D5D A;  1TR5 A;  3STB D;  3M7N A;  4P71 A;  3CCR A;  2MO0 A;  3RZD H;  2LFN A;  3OMC A;  3IFD A;  3I56 A;  4DUY Q;  2MP1 A;  4A3M G;  1EU4 A;  3J80 L;  2UXD Q;  3AFQ A;  3A74 A;  2N88 A;  4YCV A;  3OMG A;  4XYO A;  2L0C A;  4ABN A;  1I4P A;  4NKL A;  5G3L D;  1LV9 A;  3RZD B;  1BR9 A;  1ESR A;  1JB3 A;  5EPL A;  1PRT F;  4RFB A;  5T1I A;  2B63 G;  4X64 L;  1C48 A;  2VQF Q;  2JA6 G;  1K83 H;  1Q1E A;  5IT9 L;  1STA A;  3T1Y Q;  4DU9 A;  2VXW A;  2R6G A;  1Q3L A;  3CKI B;  3ZYY X;  1N32 L;  1S5D D;  4DFA A;  1NMG A;  4JI3 Q;  1H9R A;  5A35 A;  3CAM A;  4N9P A;  1GVP A;  3HOY G;  2F0J A;  1PFS A;  4C3H B;  3ONA B;  4IOC A;  4EQ5 A;  4XIG S;  5CYU A;  4X62 Q;  5M3F H;  3J81 E;  1PA6 A;  2A6H C;  4A3I B;  4TSS A;  1TU2 B;  2YTX A;  1CQF A;  1F2Y A;  4NDX A;  1JJC B;  3VA7 A;  2GVA A;  2PCF B;  1K8M A;  5C4X B;  1SN8 A;  2DY8 A;  1HTL D;  2K5Q A;  1HNW L;  3W2D A;  4H7B A;  3DEO A;  3NTH A;  2X6L A;  1VQK A;  1X3E A;  1YJW A;  1VQA A;  2CH4 W;  2JN4 A;  2D62 A;  4MIU A;  4A3M B;  3R2T A;  5C4J H;  3KBX A;  2E5L Q;  2EDG A;  2F3V A;  2JA6 H;  1LTT D;  4K0K Q;  2R3Z A;  1LTG D;  3S17 H;  2LMC B;  2NVY B;  1LT4 D;  2Q8T A;  5M5Y B;  4JI8 Q;  2UU9 Q;  1G6P A;  2EIF A;  4IFD I;  3CCJ A;  1G8Z D;  3K57 A;  4GKK L;  4HID A;  5EPK A;  5EJW A;  5FO9 B;  1JCK B;  2F4V L;  2B63 B;  4BBS G;  2JA8 G;  3B6Y A;  5DNF A;  3S17 B;  2Q2U A;  4A3L G;  2R92 B;  3RN2 A;  4L5T A;  3Q0A A;  3OPO A;  2IHE A;  2PQA A;  2RCF A;  2UXB L;  5CV6 A;  4B3M L;  4OX9 L;  3HOY B;  4DV7 L;  3M4O H;  3GV3 A;  4RH6 A;  1HRJ A;  3VR2 A;  2Z1C A;  4R4I A;  2ALY B;  2WB1 G;  1PH9 A;  3E0E A;  4DNI A;  4C56 C;  3NQI A;  5D3D A;  1FNW A;  1ILP A;  3OWF A;  2JA8 H;  4L8J A;  4AYB E;  1M4V A;  2R7Z H;  2QIL A;  2RA4 A;  4A3L H;  1O7L A;  1G2T A;  1JMC A;  1HNX Q;  3SK6 A;  2QEX A;  1J8I A;  1XMO L;  4B3R L;  3GV6 A;  5IP7 G;  1WTQ A;  1B4O A;  3F8T A;  2B3G A;  2MHV A;  2K5H A;  3I70 A;  5COY A;  2NZH A;  4BBS B;  3D31 A;  2WKC A;  2FHT A;  1A8V A;  4NMZ A;  2JA8 B;  2F0E A;  1ASZ A;  4LUZ A;  4JCV E;  1XXG A;  4XQJ A;  3H3V H;  1PH2 A;  2L15 A;  2G9H D;  1TS4 A;  3PUZ A;  3NK9 A;  3H3V C;  1BCP C;  3BDL A;  5C5M A;  1EQQ A;  4A3G G;  1PTO B;  4OO1 H;  1X3G A;  3HOU G;  1WTO A;  5M9O A;  2F0Q A;  2LKV A;  2UXC L;  2F0W A;  3E3X A;  4K2L A;  1PMR A;  2E2D C;  2B2U C;  4BY1 G;  3NEM A;  2VUM H;  3A5U A;  4NW2 A;  3CXC A;  3NTI A;  2SEB D;  2WB1 B;  4LFB L;  2NVX B;  1SE8 A;  2PQE A;  1IXR A;  2WAQ E;  4A3E G;  4RG1 A;  4A3K B;  4LF7 Q;  1JR0 D;  1DM0 B;  1Q86 C;  2DN8 A;  1Q1B A;  1LTL A;  3K7A B;  5IP7 H;  4DR4 Q;  4N8X 1;  1KAW A;  4HN7 A;  3RLF A;  1LLR D;  5I2Y A;  1KDA A;  2JK8 A;  4OIJ A;  3HOV B;  4LMQ D;  4DGZ A;  4GOP A;  5E4X A;  1VQF A;  1MI2 A;  2EY6 A;  3MXP A;  1PYW D;  4HR7 B;  1F9S A;  3MWY W;  4G57 A;  2ZM6 L;  2O2L D;  4DXF A;  3E6Z X;  1SDF A;  1S4Z A;  4I7A A;  3MHB A;  1EEI D;  1STN A;  3HOU H;  2EJM A;  2PZW A;  5CV5 A;  1ENC A;  4IPD A;  3VYR A;  1BNZ A;  1P8L A;  1YNJ C;  4YY3 Q;  2F0K A;  1MD2 D;  1PTO F;  2K33 A;  3P7J A;  5D3I B;  2FFK B;  1A63 A;  1EY9 A;  1GUO A;  2RQX A;  2PYK A;  4PMB A;  4A3G B;  5FLX L;  3SHL A;  2EOT A;  1GUG A;  1EOT A;  3J80 E;  1ICF B;  5C4Z A;  1SMX A;  4JK1 C;  4AQY Q;  3PO2 H;  4I7Z C;  1NR4 A;  3D4R A;  4BY1 B;  3IRB A;  3H3V I;  2YU9 B;  1RKN A;  2KHS A;  1VQ9 A;  1UE7 A;  1E2W A;  1VQJ A;  4A3E B;  2EJF C;  3OIQ A;  4CHT B;  1X9N A;  1B9M A;  1BBU A;  1B9N A;  3EJI A;  1K8O A;  4QGU A;  5IYB G;  3KF6 B;  5M3M G;  3OW2 A;  5HUR A;  1LT5 D;  4PMC A;  3UDG A;  5IT9 E;  1QE6 A;  4KY6 A;  1U5K A;  4DR6 Q;  4NXM Q;  1SYG A;  2BH2 A;  2A69 D;  2MO1 A;  4OIK A;  5LMU L;  1JJ2 A;  2IL8 A;  2ZTE A;  5ELB A;  1CSQ A;  4GLV B;  2H1E A;  2IHF A;  5CV7 A;  4DV6 Q;  5FO8 B;  1TWH B;  4PNY A;  2ZJR A;  2HHH Q;  1XMQ Q;  1Y14 B;  3MEH A;  1X3F A;  3D6W A;  1VMP A;  2KVM A;  2OQ0 A;  2QKI C;  4DKA C;  2LXJ A;  5IGG A;  4R1J A;  1A15 A;  1D5X C;  3MC0 B;  4GS3 A;  4DAY B;  1RIP A;  2ZTC A;  1ROD A;  3H0G G;  5IYB H;  1BO0 A;  3I2Z A;  3W3A A;  5M3M H;  1SYD A;  1PLF A;  4JI1 Q;  1GJX A;  2JSO A;  3MXN A;  3VR4 A;  3S16 B;  2A74 C;  2JEA I;  4ZUI A;  4JI7 Q;  1K0R A;  4RAU C;  3J81 c;  3SEB A;  1C4Q A;  2WV6 D;  1GHK A;  4QUF A;  4L5S A;  4OGQ C;  3TDQ A;  4LFA Q;  1Q46 A;  4C3J H;  3CCM A;  1FD7 D;  4OWT B;  1GUN A;  3DUZ A;  1XPO A;  4IUN A;  4J8Q A;  1AE3 A;  4Z9C B;  1KD1 C;  1I3Q H;  5C44 B;  1V1P A;  5E4W C;  1CUK A;  1KQS A;  3MAQ A;  2UUB L;  3D3R A;  4YCW A;  2L55 A;  1U4R A;  4JV5 Q;  1T5X D;  1O7Y A;  2XTI A;  2D2C C;  2K05 A;  4KKS A;  4HCE A;  5EBD A;  2Q2I A;  4CDE C;  3GTJ B;  4LF8 L;  4RMF A;  4X66 L;  4G7H C;  1PV4 A;  4JOI C;  3M3Y H;  2Z6K C;  4JI6 L;  4QCL A;  2F0M A;  5I9O A;  2NZ1 D;  1TY0 A;  1X55 A;  1FJG L;  5ELC A;  2P5Z X;  3I7F A;  1KIX A;  2F3W A;  3RZO B;  1EY4 A;  3LX0 A;  4BA1 I;  2KED A;  2Z8L A;  1IL8 A;  3H0G B;  1LTA D;  4F8M A;  1AE2 A;  1H9M A;  3S14 B;  1UE6 A;  2K52 A;  1XJV A;  1H9S B;  2JA7 B;  4JBW A;  1Y8O B;  3ERO A;  3A7L A;  2TSS A;  3CME A;  1HUN A;  2Z4I A;  2NVQ H;  1D1I A;  1EIG A;  4MZ9 A;  5NUC A;  1S5B D;  1XTC D;  5CV9 A;  1C8C A;  3S1N B;  2K5W A;  2M9V A;  1QVC A;  1N36 L;  1JT8 A;  3NBH B;  2WP8 J;  3HKS A;  1NBW A;  4DK3 C;  2K01 A;  1HCZ A;  2VB2 X;  1SMY D;  1O80 A;  2F0V A;  2NVQ B;  4B9W A;  4GOP C;  4UP9 A;  1IKL A;  2DNE A;  1K28 A;  3KBG A;  3WWV A;  2ZXO A;  2AMC B;  4KMU C;  1XNQ Q;  3OTO L;  1Y8N B;  1WCM G;  1Y1V H;  1B70 B;  4J1M A;  3GTL B;  1DJR D;  2H4O A;  3CQZ H;  3EIV A;  4ULL A;  5IYD G;  2QEJ C;  5D14 A;  1LTR D;  4DA2 A;  3U9O A;  3PIP 3;  1S72 A;  1EZ6 A;  3QOJ A;  1OTC A;  1JOR A;  4HCS A;  2RBM A;  4K6L A;  4BS9 A;  4JVZ A;  1FGU A;  2RDF A;  3PIO 3;  1TWG H;  1HZB A;  3A55 A;  5K5P A;  2E75 C;  4QUC A;  1IYJ B;  1DCZ A;  1I6H H;  3FKI G;  1WTV A;  3IKJ A;  2L1B A;  4IJH A;  1EFW A;  2R93 H;  1TWC B;  3GTQ B;  2A68 D;  4Y7N B;  3I4O A;  2EYL A;  4BBR G;  2AQ1 B;  2DJG C;  4PZ7 A;  1OXS C;  2JP1 A;  1MKH A;  4CKB A;  4N8F A;  4CJ0 B;  2IWH A;  1SNM A;  3J80 i;  1ENF A;  1QZH A;  5FK9 C;  1W6K A;  1SE4 A;  2CW0 D;  4PV1 C;  3GTO H;  3HZX A;  3D0F A;  1HA5 A;  3TBI B;  4H13 C;  1WCM H;  2GA4 B;  4QF4 A;  5AJ3 Q;  3PQI A;  1J6Q A;  1PRT D;  2I0Q A;  5IYD H;  1OO9 B;  1EOV A;  4G7Z C;  3AQQ A;  1RCV D;  3KF8 B;  4IZ8 A;  1CTM A;  1W3S A;  3A56 A;  3BG3 A;  4DV5 L;  3S2H H;  2HQL A;  5C3E B;  3K8A A;  3AEV A;  2EVB A;  4XT3 B;  5EAY A;  4C2M B;  2E2I B;  3S1R H;  2RSO A;  1Y1W G;  2ZT9 C;  1E1O A;  4JI0 Q;  4HJ8 A;  3WDN A;  4DK1 A;  2MPM A;  3S1M B;  5IWA Q;  1M8A A;  2M2L A;  4FF1 A;  3DXJ C;  1GD7 A;  3CP0 A;  2EYJ A;  4A93 G;  3ERQ A;  1HNW Q;  2XRS D;  4NP5 A;  1AW7 A;  4RCO A;  3HKZ E;  1K8A C;  3FKI B;  1NMF A;  4R9W A;  2O5I C;  3HOW B;  2MUY A;  4GKJ L;  2XSC A;  3CCE A;  2KEE A;  4BBR B;  3CRK C;  3K0Y A;  4RGM A;  4MN3 A;  2JE6 I;  2CKZ B;  1S3O A;  2ZTD A;  4P2C B;  4AYB G;  1EYG A;  1YNN C;  3AMU A;  1STB A;  4G4K A;  2H5X A;  4GKK Q;  1NTG A;  5JJZ A;  1LT6 D;  1E2V A;  2EXD A;  4NXN Q;  2F4V Q;  2Q2T A;  1Y1W H;  2AKW B;  1UNS A;  4DV2 L;  2UUC Q;  1S5E D;  1TT2 A;  2ASB A;  1E24 A;  2AWN A;  4CDD C;  1JOQ A;  1MSH A;  4K14 A;  1DOM A;  3I4N G;  1NAP A;  5JJI A;  3R93 A;  1A2U A;  1A0I A;  1HXY D;  2BOS A;  4X65 Q;  1VQ6 A;  1GXD C;  4A93 H;  4A3B G;  1Y1W B;  4QQB X;  4DUZ L;  1HHV A;  4JI4 L;  1EU3 A;  1X32 A;  2ZXP A;  3GP7 A;  2ATW A;  2QF7 A;  3MZ5 A;  3PUV A;  5HGT A;  3VR3 A;  3BU2 A;  2PNH A;  2EYH A;  4DF7 A;  1Q90 A;  3T13 A;  1NUC A;  4DK6 C;  3CCU A;  3GTG B;  4A93 B;  1K3B C;  5GAE C;  5IY0 A;  2K28 A;  3GO5 A;  1PYB A;  4R4O A;  1PFN A;  2KQ3 A;  3JAM c;  4DV1 L;  3PCO B;  5FJ8 G;  4IUQ A;  4LF4 Q;  3T16 A;  5HGQ A;  5IGF A;  2CHB D;  2YYZ A;  3PO3 B;  5ELO A;  4U68 A;  4UPA A;  1B3A A;  1Q8K A;  4RGN A;  1WVL A;  2IX0 A;  4FF3 A;  1BBW A;  2KUM A;  1S40 A;  3RD4 A;  4PZ6 A;  4A3B H;  4A3D B;  3CU7 A;  5M3F G;  2AUK A;  1TS2 A;  1KL9 A;  4ID6 A;  2NTS A;  5A2Q E;  4B3S Q;  1LO5 D;  5F2D A;  4DV4 L;  3I4N B;  5CMD A;  3NSW A;  2NZO A;  1YHB A;  4UAI A;  2RDG A;  2EYF A;  3A8J E;  3CHB D;  4XQQ A;  3L3O C;  3Q24 A;  2PZU A;  5FJ8 H;  2HCI A;  3IL8 A;  3VR5 A;  3C1F A;  1BXT A;  4LFB Q;  4CJ2 C;  1SJH D;  5IGE A;  1B44 D;  1L1O C;  1U9R A;  3J7A F;  1RHP A;  1L0W A;  4HJ9 A;  2DGY A;  2N55 A;  2Z0S A;  3TP6 A;  3MTS A;  5C5L A;  1IBK L;  5FOB B;  3MA2 B;  3HFZ B;  3FEW X;  1K83 B;  2A73 B;  4ZRZ A;  4DV0 L;  4LWC A;  5BR8 L;  5IYC G;  3NEN A;  2BA0 A;  5M5X H;  2PMZ B;  4JI2 Q;  2L11 A;  1YJN A;  1SXT A;  3ULJ A;  4QL5 A;  4ZUJ A;  5M3F B;  1ZKO A;  1L0X B;  3U58 A;  4QJF A;  4HTH A;  3M4Q A;  1IYU A;  1F9R A;  5M5X B;  2MNA A;  2KCT A;  2I07 B;  3KLW A;  1QUQ B;  3KF6 A;  2QA4 A;  1YIT A;  1J5E L;  4PMW A;  2ZXR A;  4DR1 Q;  1D7Q A;  3JAM L;  3A5Z B;  1PTO D;  1IZ6 A;  5COR A;  4KD4 A;  2UUA L;  2KA7 A;  2BA1 A;  2TMP A;  5C4J B;  2YTV A;  2OTJ A;  3I4L A;  3H94 A;  2NYZ D;  4DPG A;  4O1N A;  2JA6 B;  2R7Z G;  1RF2 D;  2D0O A;  3STB C;  3CMA A;  1RDP D;  4WJ3 M;  1QVG A;  1K8G A;  5BN5 A;  1GO3 E;  5IYC H;  3I90 A;  1JC7 A;  2HIV A;  3AB9 A;  5EKL A;  4DN4 M;  2E2J H;  3PUW A;  4F88 A;  1U4M A;  1WD0 A;  5C3X A;  1T9H A;  4CDC C;  2JQO A;  3M4Y A;  1TXY A;  1PFM A;  1XYI A;  3EVQ A;  3U4V A;  2JJQ A;  1SLJ A;  5I6Y A;  1MGS A;  2B2Y A;  4DAY A;  3NTK A;  1F9Q A;  3DWP A;  3ULL A;  5LMU Q;  2K14 A;  1VQ7 A;  4JG2 A;  2JXM B;  5JAV A;  2B39 A;  1Q81 C;  1EQV A;  4OWW B;  4OO1 G;  2K5N A;  1GM5 A;  4C3I G;  3M7G A;  4LJZ C;  1A6X A;  3M4O B;  5J3B A;  4IFD J;  5IGC A;  1R9T H;  2E76 C;  3T51 B;  4QB4 A;  4IPG A;  2NBF A;  4IPH A;  1QNK A;  2VUM G;  5DAU A;  1LAC A;  2N8N A;  1E2Z A;  1ICW A;  4LF5 L;  2F03 A;  1QZG A;  1AH9 A;  4R4C A;  5EGT A;  1LUZ A;  2F0T A;  1IBL L;  1CZW A;  3R8B A;  1STH A;  4MHE A;  2RSN A;  4DXG A;  2EJG C;  3OIP A;  4ZKC B;  4JW0 A;  4APV A;  1ILQ A;  1HH2 P;  2R7Z B;  1EIH A;  3A7A B;  4KY7 A;  1CKN B;  4LF6 L;  5K36 G;  4F87 A;  5DLQ E;  4A3J H;  1VF5 C;  1RL2 A;  2PW7 A;  1XNR L;  4DR7 L;  3O13 A;  1FYC A;  4ZQ3 A;  2WFW A;  4GNX C;  2VW9 A;  4C3I H;  1WD1 A;  1WFQ A;  4LAA A;  2J4X A;  2N3S A;  3CD6 A;  3T1H Q;  2O5J C;  1BCP B;  2UXD L;  3NBI A;  3KOJ A;  4CKC A;  1PZK D;  3HRZ C;  5IGB A;  1I4H A;  5ISR A;  3E9I A;  3VYU A;  3OWE B;  3TZD A;  2RHQ B;  1AZQ A;  1JOK A;  2D9U A;  1VF7 A;  4WRD A;  3DEP A;  3S9W A;  3CC2 A;  3PO2 G;  1MBY A;  2EY1 A;  2SDF A;  3I8Z A;  4X66 Q;  2VUM B;  5L37 A;  3A8K E;  2VQF L;  3K5N A;  1JE5 A;  4CDF C;  5KGU A;  1D1K A;  4DR5 Q;  2A6E D;  1V1O A;  5IP9 H;  3T1Y L;  3OSO A;  3P1H A;  2FMC A;  4DV3 Q;  2G5D A;  1FJG Q;  5K36 H;  1QB5 D;  2EXZ A;  4JI3 L;  1TWF H;  3GTP H;  3S15 H;  3KJO A;  1PXU A;  3BZD B;  5ELF A;  2AQ3 B;  3W1G A;  1MIU A;  2EE1 A;  3AFP A;  4EX5 A;  4JYA Q;  1B3Q A;  5JEA H;  4X62 L;  2BCO A;  4E6I A;  2E2H H;  3X3M A;  2NB0 A;  4PG3 A;  2XVS A;  4K5X A;  2OEO A;  1TQO A;  4G7O C;  5BN4 A;  3HOU B;  3TSS A;  1BCP F;  5J22 A;  4YHH Q;  3X3N A;  3DM3 A;  1LT3 D;  3URY A;  1EUJ A;  3KDF B;  5TSS A;  3G71 A;  4HMJ A;  1TS5 A;  3N6R A;  1PH6 A;  3HG9 A;  1SFO H;  2YTY A;  3P75 A;  3G48 A;  3PF5 A;  2YV5 A;  4GN5 A;  4XTC S;  3I72 A;  1A3U A;  3KK7 A;  4OO1 I;  5GAG C;  1WOC A;  2B2W A;  3KYH C;  3TRZ A;  3PO2 B;  1EIY B;  2B2V A;  1EY8 A;  2K32 A;  3W1B A;  2AUJ D;  2XRQ D;  1TWA H;  1A3T A;  1BQQ T;  2VQE Q;  1JQY D;  2MFI A;  1HR0 L;  1CM9 A;  1I50 H;  4M1U B;  2A5H A;  1B53 A;  1ENA A;  3KF8 A;  5JOB A;  1G91 A;  3HKZ G;  5D65 A;  1NR2 A;  4C3J G;  2NUC A;  3UE1 A;  4P72 A;  3QOL A;  1EFI D;  2CQO A;  4HED A;  4QIW B;  2KCN A;  3EBE A;  1BKB A;  3EQL C;  2IX3 A;  3IAY A;  3SVM A;  4EQO A;  3DWA A;  3VYT A;  2FIN B;  4DNT B;  1ZYR D;  2X69 A;  5I4D A;  3V2T A;  3T56 B;  2B2T A;  3C1E A;  3K80 C;  2K7V A;  1Q8I A;  4KHP Q;  1Y69 U;  3S2D H;  1I94 Q;  2N78 A;  1Q12 A;  4FDB A;  4DV5 Q;  2PQA B;  2R7D A;  2RCN A;  5J1Z A;  1IW7 D;  2ICI A;  2OF1 A;  1DON A;  5JPM C;  1B7Y B;  1OXV A;  3A8I E;  4IUP A;  1FGB D;  2C35 B;  2LS0 1;  3MFG A;  2E74 C;  1HNX L;  3FRP B;  4ALP A;  1PZI D;  2F0U A;  5EPJ A;  5M3M B;  1EY7 A;  1IBM Q;  3I4M H;  1N34 Q;  1CA6 A;  1AZP A;  3PUX A;  3HOZ H;  5FLM H;  4LUV A;  1HNZ L;  2HQE A;  2I5M X;  5J39 A;  3W5O A;  5JEA J;  1H95 A;  1AEX A;  3Q22 A;  3TEH B;  1SEB D;  2I5L X;  1PYS B;  3KLS X;  4IOA A;  3LNN A;  5LMN Q;  3TS0 A;  1WI5 A;  4LF9 Q;  1X54 A;  3HKZ B;  2ZJP A;  1VQD A;  1HQR D;  3SDZ A;  4C3J B;  1G29 1;  4JC0 A;  3SGI A;  4FP5 D;  1I3Q B;  2G9D A;  3T53 B;  2RKS A;  2ENB A;  5IOC A;  5DEH A;  3R3O A;  1WTH A;  1Y1V G;  2Z4H A;  4UP8 A;  2HDL A;  4DV2 Q;  2J7Z A;  3HOX H;  2B29 A;  1ZXT A;  1VQ8 A;  4LF7 L;  1EY0 A;  4RWS C;  5BN3 A;  4DR3 Q;  4B3T Q;  1CFM A;  1ET6 A;  1QNU A;  4UY8 C;  2A69 C;  4DR4 L;  3TP7 A;  5KRU A;  5GQO A;  2EZV A;  3MXU A;  1B1Z A;  3M3Y B;  4I65 A;  4LW1 A;  3LWU A;  3I73 A;  4JI5 Q;  4WJ4 A;  4K5V A;  4JI4 Q;  1S5C D;  4EQP A;  2R93 G;  3LWE A;  5I9P A;  2CFM A;  1SBB B;  1EL0 A;  1BOS A;  2D0P A;  3J7Y W;  1SNC A;  3S1Q H;  2JA9 A;  2DY7 A;  3QG1 A;  4C1N K;  1Y8P B;  4FYD A;  5JVH 3;  3PUY A;  1I4G A;  1Z47 A;  2BE5 C;  3UI2 A;  1JJG A;  3SK4 A;  4HJ5 A;  5C0X H;  4PQX A;  4K8J A;  3QO2 A;  1PVO A;  4KLK A;  1X3P A;  1ESF A;  1I5F A;  4DV1 Q;  2CH4 A;  3NHH A;  1VQ4 A;  4L63 B;  1RTO A;  1EEF D;  2EYP A;  4GOP B;  1E22 A;  2NVT H;  4YCU A;  2KBN A;  4POF A;  2FJ2 A;  4XQN A;  4HAE A;  4DR2 Q;  4P73 A;  1HFG A;  3J81 j;  3MVV A;  1VCI A;  5E3F A;  1UAP A;  3J81 L;  1LYL A;  2OWO A;  1HA6 A;  1QOH A;  1WTW A;  3UE0 A;  1Y1V B;  1VQO A;  1OXU A;  3BYY B;  2MJ8 A;  3C3L A;  4A3C H;  5CV8 A;  3CQZ B;  1SYF A;  4IPC A;  5KND A;  2AQ2 B;  4R4Q A;  1TVX A;  1AN8 A;  3K5M A;  1ET9 A;  2N49 A;  5M5W H;  5DM6 3;  3GTK H;  2CWP A;  4ME3 A;  2HCC A;  4YWM A;  1EZ8 A;  4U67 3;  1SYE A;  1TWG B;  1YBY A;  2HD3 A;  4DR6 L;  1I6H B;  2HUG A;  3UDF A;  1UE1 A;  1CT1 D;  2Q8I B;  1II3 A;  4X64 Q;  2IT1 A;  3QIA A;  2R93 B;  3WOE A;  3NEL A;  4CBV A;  3CF5 A;  2KCC A;  3GTK B;  4OL7 A;  3M85 A;  4K5W A;  1N32 Q;  3SE0 A;  1YEZ A;  4B08 A;  1KDC A;  4R4T A;  3RR5 A;  2HHH L;  1Z7T A;  2J0T D;  1XMQ L;  2V1C C;  5KNB A;  4POG A;  3GTO B;  1GHJ A;  5FLX E;  1WCM B;  1O7Z A;  1EYC A;  3DM1 A;  1F2Z A;  5KNC A;  4A3F H;  2WII B;  2IW3 A;  3NP8 A;  3ICE A;  4ME5 A;  4V0B A;  3MFY A;  1QUQ A;  4X3T A;  4LNQ A;  1HZ9 A;  3GTM H;  2F0P A;  3S2H B;  3BYT B;  4KD3 A;  3BDC A;  4XXE A;  4BXX G;  1B2T A;  1LTI D;  1JE4 A;  3QWN A;  4FO2 A;  3S1R B;  4OHJ A;  2XWJ B;  3H91 A;  1JWS D;  4DNR B;  2Y0S E;  2XGT A;  3BZC A;  2K03 A;  1L0Y B;  5C3W A;  1SMY C;  4MNO A;  2LY7 A;  3BDO A;  1QWY A;  2CQA A;  4MTK A;  1GKH A;  5LL6 S;  1U0L A;  1I4R A;  1KNA A;  3K58 A;  4LFA L;  3J80 c;  4KKT A;  3CCS A;  3CPW A;  4GLX A;  5CV4 A;  2DUD A;  5C0X J;  1EY5 A;  1IYV A;  2UUA Q;  3I55 A;  5CBA E;  4FXK C;  3MXN B;  3DLL A;  3EN2 A;  1HZC A;  3KUP A;  4JV5 L;  3A0J A;  4RCN A;  1YHA A;  3RUZ A;  2QGQ A;  1HTP A;  1CHQ D;  5IT9 c;  3AU7 A;  3VA5 A;  2UXB Q;  2FMM A;  3TME A;  1SE2 A;  4B3M Q;  1ML0 D;  4BXX H;  2A68 C;  4OX9 Q;  1I4Q A;  4DV7 Q;  4HIO A;  4XDX A;  3RLO A;  1LTS D;  1NJI C;  4EGV A;  4L5Q A;  5C4H A;  4BY7 H;  3G6E A;  3HP3 A;  3T4A C;  3PIP A;  3NWT A;  1A3V A;  2KCM A;  1X3Q A;  4B9X A;  2CW0 C;  3PIO A;  4IFD G;  2KHI A;  2A6H D;  1PRT C;  1WTR A;  2WAQ G;  4M8A A;  1K9M C;  2K4K A;  2VB3 X;  2JEB I;  4N9T A;  1CKN A;  1P16 A;  1QG7 A;  1XPR A;  1JWU D;  4FF2 A;  4KKU A;  1O7I A;  1M1K C;  4IUT A;  2VS1 A;  4C1N I;  1QIL A;  3ERS X;  2QCP X;  3DMU A;  1FL0 A;  2BDN A;  4KHZ A;  1IBL Q;  1XMO Q;  4AYB B;  4B3R Q;  3K5O A;  3HGB A;  2K6A A;  1TS3 A;  3ZJY C;  1VQE A;  3RNU A;  1IKM A;  4DAP A;  2HT1 A;  1XNQ L;  1SJE D;  3VDY A;  1N33 L;  2GVB A;  2B8F A;  1DOL A;  2F0L A;  2K5V A;  1KXL A;  4A3I G;  2B2U A;  1PZJ D;  2K75 A;  4DR7 Q;  1UEB A;  4HJA A;  4O0A A;  1GUW A;  1SRO A;  4A3B B;  2FXQ A;  4IFD H;  3KLR A;  1HFN A;  1D6E C;  4O2D A;  1PH3 A;  1W2B A;  4TQU S;  3QJY A;  2UXC Q;  4JBM A;  2RDH A;  1TY2 A;  2PI2 A;  2EYM A;  2XNA C;  3S24 A;  2ID0 A;  5T1G A;  4FXG C;  2K1B A;  3U4Z A;  1H9J A;  2IPK D;  2WAQ B;  3FDT A;  1TII D;  4HSV A;  1VQI A;  1NSN S;  1RTN A;  1L1O B;  1XX8 A;  3SK8 A;  1V8Q A;  1EQR A;  4C3H H;  1VMC A;  5AJ3 L;  2OTL A;  4Q5V A;  4KY5 A;  1U4L A;  2L9H A;  4HSP A;  2R92 G;  4A3I H;  1W6J A;  2HIX A;  2ZM6 Q;  3VYS A;  2F0N A;  3PF4 A;  1CK1 A;  3KDF A;  5C4X H;  1DZ1 A;  3BVM A;  2K04 A;  5LMN W;  1D2B A;  1U4P A;  4J15 A;  1I4X A;  1KTK A;  3CCQ A;  1C9O A;  1MJC A;  4K6D A;  1AFP A;  2WKD A;  3G4S A;  4JI0 L;  4LFC L;  4A3M H;  2R61 A;  2L4N A;  3GQB A;  4HMI A;  5IWA L;  3Q8D A;  1NY4 A;  5DM7 3;  1G6Z A;  1KNE A;  3TZU A;  3L7Z C;  2NVY H;  3OOC A;  1EY6 A;  5M5Y H;  1PH8 A;  2F0S A;  1WJJ A;  1KLG D;  4DK0 A;  2L5T A;  1O78 A;  1A2T A;  1GUT A;  4K8I A;  1BCP D;  2B63 H;  2IX1 A;  2OT2 A;  1VQB A;  5HY6 A;  3E9H A;  3TP5 A;  2SOB A;  1Q82 C;  4IUR A;  1CZG A;  3CC7 A;  4OON A;  3I3C A;  2R92 H;  3OHX C;  5JPN C;  1PH4 A;  4TRD A;  3CCV A;  4RA8 A;  1VQN A;  3J7A 5;  4NXN L;  1CSP A;  3HOY H;  3P20 A;  2ICE C;  2UUC L;  2RHS B;  1R4Q B;  1UE5 A;  1PHJ A;  5LL6 X;  1HR0 Q;  4GN3 B;  4A3J G;  2DNC A;  2V4D A;  4NB3 A;  2E2J B;  3PSI A;  4AIM A;  3SXH A;  2KJX A;  4X65 L;  2ZJQ A;  2X6G A;  2AHO B;  3GDE A;  3M4P A;  5AFW A;  3NWS A;  2OXP A;  3RMH A;  1VQC A;  3TQY A;  2PZT A;  3J7Z C;  4A75 A;  2F0D A;  1L2F A;  4WOR A;  3PMF A;  2JYO A;  1SNO A;  2Z9H A;  2A1A A;  4A3K G;  3EA6 A;  1HJP A;  3UDI A;  1YNJ D;  1R9T B;  3R2I A;  5GAH C;  4HJ7 A;  4S3S A;  1N8R C;  5FLX c;  1BVS A;  1EWH A;  4LF4 L;  4BBS H;  4NPS A;  4RGO S;  3U9S A;  3K7U C;  5IP9 G;  3HOV G;  3DHQ A;  3HS0 C;  4V19 0;  3SR1 A;  2R7F A;  1S5F D;  3F2B A;  2VZA A;  4HIK A;  3I91 A;  3J7A V;  1PTO H;  5FKA C;  1HNZ Q;  5JEA G;  4GNX B;  4DUY L;  3TS2 A;  4A3J B;  4B3S L;  1PTO C;  5CR3 A;  3H09 A;  1TKW B;  5G3L F;  1KAA A;  4JOI A;  2NVX H;  2Z6K A;  3NPP A;  1Z9F A;  2UUB Q;  1CHP D;  1NE3 A;  4C3I B;  1T5E A;  1YI2 A;  1H9S A;  4A3K H;  2LSS A;  1B8A A;  4RKL A;  4LF8 Q;  1KRT A;  1Q7Y C;  5CBE E;  3K7A H;  1CA5 A;  4DAV A;  3NBH A;  4JI6 Q;  1LM0 A;  1SND A;  2NWG A;  3HOV H;  5I2X A;  4IUU A;  4A76 A;  1STE A;  2EYO A;  4H44 C;  1HZA A;  1NNX A;  4GZY C;  1ASY A;  1IL2 A;  2Q2H A;  3NUC A;  3FHW A;  1HUM A;  3V05 A;  1MJE A;  1BBX C;  4EQN A;  2PMZ E;  4ZCK A;  4KJO A;  1SNQ A;  1TWF B;  5ELN A;  1YZ6 A;  1N36 Q;  3GTP B;  3Q23 A;  3FPP A;  3S15 B;  1KLU D;  4JI2 L;  2F52 A;  1FNU A;  4EVO A;  2K5D A;  4A3G H;  2LXK A;  4H0L C;  2A8V A;  5GRO A;  4ZLT F;  1M90 C;  5IE8 A;  4FF4 A;  2I46 A;  2E2H B;  2EQS A;  2BDO A;  2NN6 G;  3K0X A;  4ZK9 B;  2E5L L;  4BY1 H;  3OTO Q;  3RN5 A;  4K0K L;  2YU9 H;  4LUO A;  4A3E H;  3U50 C;  4JI8 L;  2UU9 L;  4DR1 L;  3CCL A;  2XN9 C;  5JJL A;  4KHV A;  1I6V C;  4TVA B;  3ULP A;  1SFO B;  3FPU B;  1VQM A;  2EY5 A;  3GD7 A;  4OWX B;  1DOK A;  2E8G A;  2VNU D;  2O4X A;  2RF4 A;  4WJW A;  4CGY B;  3J81 i;  3NE5 B;  2HDM A;  1F9P A;  4KJN A;  2OQK A;  2Y0S G;  3I4M G;  4BA2 I;  3D6C A;  2QDB A;  3HOZ G;  5FLM G;  1TWA B;  1TWH H;  1KRS A;  3D4D A;  3EFX D;  1SYC A;  4KN4 C;  2M00 A;  1I50 B;  4GN4 B;  1DXM A;  2NN6 H;  2CVR A;  3C46 A;  5C44 G;  2XWB B;  1V9P A;  1JB7 A;  3G7L A;  1PH1 A;  3V96 A;  3KLS A;  1XTD A;  1SAP A;  2A6E C;  3KFU A;  4JPB W;  4WFN 3;  4QY7 A;  4FXD A;  4F7X A;  1FNV A;  2B2Y C;  3F2U A;  5JJK A;  1OXX K;  4CKE A;  1YNX A;  3JAM E;  2F0G A;  3HOX G; 
#chains in the Genus database with same CATH homology
 3S16 H;  1N32 Q;  1ASZ A;  1YEZ A;  4LUZ A;  4JCV E;  4IO9 A;  4R4T A;  3RR5 A;  2HHH L;  1V43 A;  3H3V H;  4P74 A;  1XMQ L;  1PH2 A;  2L15 A;  2V1C C;  4POG A;  4P75 A;  5FJ8 H;  3PUZ A;  4LFB Q;  1YJ9 A;  4A3F H;  1EQQ A;  4A3G G;  2JA7 G;  3ICE A;  1X3G A;  3HOU G;  1KC8 C;  1L1O C;  1QUQ A;  4LNQ A;  2UXC L;  1HZ9 A;  3H15 A;  1L0W A;  4HJ9 A;  2DGY A;  3GTM H;  4GKJ Q;  5C44 H;  2Z0S A;  4BY1 G;  2JA5 G;  3NEM A;  2VUM H;  3A5U A;  1IBK L;  3CXC A;  4LFB L;  4Y52 H;  1SE8 A;  1OXT A;  1IXR A;  2WAQ E;  3BZK A;  1X56 A;  3HFZ B;  4A3E G;  4RG1 A;  4BXX G;  4LF7 Q;  2WB1 E;  2AWO A;  2Y0S E;  2XGT A;  3BZC A;  5C0X G;  1E7Z A;  4DV0 L;  3T1H L;  4L5R C;  4LWC A;  1Q86 C;  3FP9 A;  3GTJ H;  1Q1B A;  5BR8 L;  5IYC G;  1LTL A;  3NEN A;  2BA0 A;  5IP7 H;  4MNO A;  2CCZ A;  4DR4 Q;  5M5X H;  4IJL A;  1VQP A;  4JI2 Q;  1KAW A;  1GKH A;  1U0L A;  3RLF A;  3AYH B;  1UWV A;  4DAM A;  2JK8 A;  3F2C A;  1YJN A;  4LFA L;  4X6A H;  3J80 c;  4GOP A;  3CCS A;  1VQF A;  3ULJ A;  2VY3 A;  4QL5 A;  3CPW A;  4GLX A;  2A19 A;  5C0X J;  2DUD A;  4QJF A;  3U58 A;  3L2P A;  3M4Q A;  3RZO H;  3CC4 A;  2UUA Q;  3I55 A;  3H0G H;  2ZM6 L;  2MNA A;  3S14 H;  2KCT A;  3KLW A;  3MXN B;  2PI2 E;  1QUQ B;  3KF6 A;  3DLL A;  2QA4 A;  1YIT A;  2NN6 I;  4MTN A;  4DUZ Q;  3EN2 A;  3HOU H;  4DR5 L;  3L0O A;  1J5E L;  4PMW A;  1HZC A;  4DR1 Q;  4JV5 L;  1D7Q A;  3A5Z B;  3A0J A;  1IZ6 A;  4IPD A;  1YHA A;  3S1N H;  4DV3 L;  1P8L A;  2UUA L;  2QGQ A;  2JA5 H;  2BA1 A;  2OTJ A;  2YTV A;  4YY3 Q;  5IT9 c;  4YWK A;  2UXB Q;  4B3M Q;  4DPG A;  4BXX H;  1VS0 A;  4OX9 Q;  2R7Z G;  1A63 A;  4DV7 Q;  4HIO A;  2D0O A;  3RLO A;  3STB C;  3CMA A;  1X65 A;  4UP7 A;  1NJI C;  1XPU A;  3ER0 A;  4L5Q A;  2VL6 A;  4BY7 H;  4AH6 A;  3G6E A;  4JYA L;  4WJ3 M;  1QVG A;  1K8G A;  3PIP A;  1VQ5 A;  1GO3 E;  5IYC H;  1SMX A;  2HIV A;  4AQY Q;  3PO2 H;  4YY3 L;  2KCM A;  2KHJ A;  2E2J H;  3PUW A;  3IRB A;  3H3V I;  3PIO A;  1T9H A;  2JQO A;  1TXY A;  1VQ9 A;  1UE7 A;  3GTL H;  1VQJ A;  4IFD G;  4JI6 Q;  2KHI A;  4YWL A;  1X6O A;  2WAQ G;  1K9M C;  1CKO A;  2K4K A;  3U4V A;  2JJQ A;  1SLJ A;  4KI0 A;  4YHH L;  1X9N A;  1BBU A;  4AQY L;  2JEB I;  3ULL A;  1HR0 W;  4QGU A;  5LMU Q;  2K14 A;  1CKN A;  1VQ7 A;  1P16 A;  5IYB G;  4JG2 A;  5C3E G;  1XPR A;  3KF6 B;  4HIM A;  5M3M G;  3OW2 A;  1O7I A;  4A3F G;  3UDG A;  1Q81 C;  4OWW B;  4OO1 G;  2K5N A;  1GM5 A;  1M1K C;  2VS1 A;  1U5K A;  1N33 Q;  4DR6 Q;  4H02 A;  5J3B A;  3ERS X;  4NXM Q;  2BH2 A;  4IFD J;  1EWI A;  1FL0 A;  4KHZ A;  1PH5 A;  4A4I A;  1R9T H;  1XMO Q;  1IBL Q;  2MO1 A;  4B3R Q;  1JJ2 A;  4IPG A;  5LMU L;  4IPH A;  1TWC H;  4DV4 Q;  2ZTE A;  2VUM G;  3GTQ H;  3ZJY C;  1CSQ A;  1VQE A;  4Y7N H;  2N8N A;  4GLV B;  1N9W A;  3RNU A;  4LF5 L;  2HT1 A;  5GAD C;  2F3I A;  1XNQ L;  2IHF A;  3CPF A;  4DV6 Q;  1L1O A;  3VDY A;  1N33 L;  1QZG A;  4NXM L;  4R4C A;  1AH9 A;  2GVB A;  2VQE L;  2ZJR A;  2HHH Q;  1EIF A;  1LUZ A;  3TRE A;  1IBL L;  2K5V A;  1KXL A;  4A3I G;  1YIJ A;  1XMQ Q;  2IY5 B;  3HOW G;  1Y14 B;  1KHI A;  1X3F A;  1YVC A;  2K75 A;  2OQ0 A;  4DKA C;  4DR7 Q;  1UEB A;  2LXJ A;  4APV A;  4HJA A;  4O0A A;  1CKM A;  1SRO A;  4R1J A;  4DV6 L;  5E7N A;  1HH2 P;  4GS3 A;  2FXQ A;  4QIW E;  4JBK A;  4DAY B;  4O2D A;  1PH3 A;  1W2B A;  4TQU S;  2UXC Q;  1CKN B;  4LF6 L;  2ES2 A;  4OXP A;  5K36 G;  5DLQ E;  4A3J H;  4JBM A;  1RIP A;  3M9B A;  1RL2 A;  2ZTC A;  3H0G G;  5IYB H;  5C3E H;  1XNR L;  4DR7 L;  3I2Z A;  2PI2 A;  5M3M H;  1IBK Q;  2WFW A;  4GNX C;  2GN5 A;  4JI1 Q;  4C2M H;  2E2I H;  3S24 A;  2VW9 A;  2ID0 A;  4C3I H;  1WFQ A;  2JEA I;  2N3S A;  3U4Z A;  3CD6 A;  3MEF A;  1K0R A;  3T1H Q;  4DV0 Q;  4JI7 Q;  1SR3 A;  3J81 c;  4KHP L;  5BR8 Q;  1I94 L;  3S1M H;  1VQI A;  2UXD L;  3KOJ A;  5C0X I;  2CWA A;  1L1O B;  4JBJ A;  4JI1 L;  4C3H H;  1EQR A;  4L5S A;  3E9I A;  5AJ3 L;  4LFA Q;  2OTL A;  1Q46 A;  4C3J H;  3CCM A;  1E1T A;  2RHQ B;  4JI7 L;  4OWT B;  4BY7 G;  1XPO A;  2R92 G;  1AE3 A;  4A3I H;  3FKI H;  3CC2 A;  3PO2 G;  1KD1 C;  1I3Q H;  3HOW H;  4LFC Q;  2HIX A;  1E3P A;  2ZM6 Q;  4X66 Q;  3PF4 A;  1CUK A;  3KDF A;  1KQS A;  3K81 C;  4BBR H;  1JE5 A;  2VQF L;  5C4X H;  2UUB L;  5LMN W;  4YCW A;  4DR5 Q;  4J15 A;  3CCQ A;  1N34 L;  1J5E Q;  3UDX A;  1IBM L;  4JV5 Q;  5IP9 H;  3RLN A;  3T1Y L;  5H1S E;  1MJC A;  1C9O A;  2K50 A;  2XTI A;  3PV0 A;  3G4S A;  4DV3 Q;  4JI0 L;  1FJG Q;  1C0A A;  2Q2I A;  4LF8 L;  4LFC L;  4JI3 L;  4A3M H;  1TWF H;  4RMF A;  3JC6 6;  4X66 L;  5IWA L;  3GTP H;  3Q8D A;  3S15 H;  1NY4 A;  2I5H A;  3KJO A;  1A62 A;  3JAM i;  5LMN L;  1PV4 A;  2BH8 A;  4JOI C;  3W1G A;  3M3Y H;  2Z6K C;  4JI6 L;  2OCE A;  3L7Z C;  4LF9 L;  2NVY H;  1MIU A;  4EX5 A;  3AFP A;  5M5Y H;  1X55 A;  3PO3 G;  1PH8 A;  4JYA Q;  1FJG L;  1WJJ A;  1VQL A;  3PGZ A;  4X62 L;  3I7F A;  1KIX A;  1VQG A;  2E2H H;  4BA1 I;  4PG3 A;  2B63 H;  2IX1 A;  3HOX G;  1VQB A;  5HY6 A;  1AE2 A;  3E9H A;  1UE6 A;  2K52 A;  1XJV A;  4PZ8 A;  4GLA C;  2KEN A;  4JBW A;  1Q82 C;  4A3D G;  3CC7 A;  2MQH A;  4OON A;  3CME A;  4YHH Q;  2NVQ H;  2R92 H;  1PH4 A;  4MZ9 A;  3DM3 A;  3CW2 C;  4DR3 L;  1EUJ A;  3KDF B;  3G71 A;  4B3T L;  3CCV A;  1VQN A;  1QVC A;  1PH6 A;  3J7A 5;  1SFO H;  1N36 L;  1JT8 A;  3NBH B;  2WP8 J;  2YTY A;  1YHQ A;  1K3R A;  3HKS A;  1NBW A;  4NXN L;  1CSP A;  3HOY H;  3OYY A;  3G48 A;  4DK3 C;  3PF5 A;  2YV5 A;  2UUC L;  4GN5 A;  2RHS B;  4XTC S;  3LGJ A;  3GTG H;  1UE5 A;  1PHJ A;  1HR0 Q;  4GN3 B;  4OO1 I;  4JI5 L;  4A3J G;  5GAG C;  1D8L A;  3BJU A;  1WOC A;  4GOP C;  3KYH C;  4UP9 A;  3TRZ A;  1G6P A;  1EIY B;  4NB3 A;  3WWV A;  3PSI A;  2AMC B;  4LF5 Q;  3W1B A;  1DGS A;  1XNQ Q;  4AIM A;  3OTO L;  1WCM G;  1Y1V H;  1B70 B;  4X65 L;  1TWA H;  2VQE Q;  1VQH A;  3EIV A;  3CQZ H;  5IYD G;  2ZJQ A;  2MFI A;  1HR0 L;  2JA7 H;  1G51 A;  2AHO B;  3GDE A;  3M4P A;  1I50 H;  3PO3 H;  1S72 A;  3F1Z A;  1OTC A;  4GNX A;  1VQC A;  3TQY A;  3J7Z C;  1FVI A;  1FGU A;  4A75 A;  3HKZ G;  1L2F A;  1TWG H;  1HZB A;  3UE1 A;  1C7Y A;  4A3D H;  1SRU A;  4P72 A;  1V1Q A;  2A1A A;  3F2D A;  1IYJ B;  4A3K G;  1K73 C;  1I6H H;  1HJP A;  3FKI G;  4LF6 Q;  3UDI A;  5GAH C;  4IJH A;  4HJ7 A;  2CQO A;  3KJP A;  1PH7 A;  1N8R C;  4DR2 L;  1EFW A;  1QVF A;  1XNR Q;  2R93 H;  1WYD A;  3EBE A;  3I4N H;  1BKB A;  3I4O A;  4BBR G;  5FLX c;  1BVS A;  3STB D;  5C4X G;  3M7N A;  4LF4 L;  4BBS H;  4NPS A;  4PZ7 A;  4P71 A;  3CCR A;  1OXS C;  3K7U C;  1MKH A;  5IP9 G;  2MO0 A;  3HOV G;  3RZD H;  3K80 C;  4KHP Q;  3J80 i;  3I56 A;  3S2D H;  1QZH A;  4DUY Q;  4A3M G;  1I94 Q;  2UXD Q;  2N78 A;  3AFQ A;  1Q12 A;  3GTO H;  4FDB A;  2R7F A;  4DV5 Q;  3D0F A;  2PQA B;  3A74 A;  2R7D A;  2RCN A;  2VZA A;  4YCV A;  3F2B A;  4HIK A;  1WCM H;  5AJ3 Q;  1B7Y B;  1OXV A;  1J6Q A;  2I0Q A;  5IYD H;  1EOV A;  3AQQ A;  1HNZ Q;  2C35 B;  5JEA G;  4GNX B;  4DUY L;  1HNX L;  3KF8 B;  3TS2 A;  4ALP A;  4B3S L;  1W3S A;  4DV5 L;  3S2H H;  2HQL A;  2B63 G;  4X64 L;  3K8A A;  2VQF Q;  4JOI A;  3AEV A;  2NVX H;  2Z6K A;  5EAY A;  1Z9F A;  2UUB Q;  2JA6 G;  1IBM Q;  3I4M H;  1N34 Q;  3S1R H;  1K83 H;  1NE3 A;  1Q1E A;  3PUX A;  5FLM H;  1YI2 A;  3T1Y Q;  1Y1W G;  4LUV A;  4A3K H;  1HNZ L;  2R6G A;  2LSS A;  1E1O A;  2I5M X;  1B8A A;  1N32 L;  4JI0 Q;  3W5O A;  5JEA J;  1NMG A;  4HJ8 A;  1KRT A;  4LF8 Q;  1H95 A;  4JI3 Q;  1Q7Y C;  3K7A H;  5IWA Q;  3TEH B;  2I5L X;  3CAM A;  1PYS B;  4IOA A;  1GVP A;  5LMN Q;  3HOY G;  1PFS A;  3TS0 A;  4IOC A;  1GD7 A;  1LM0 A;  1WI5 A;  3CP0 A;  1X54 A;  4XIG S;  4EQ5 A;  2ZJP A;  1VQD A;  4LF9 Q;  3HOV H;  4A93 G;  1HNW Q;  1G29 1;  4JC0 A;  4A76 A;  3SGI A;  4X62 Q;  5M3F H;  3HKZ E;  1PA6 A;  1K8A C;  1NMF A;  2YTX A;  1HZA A;  4GKJ L;  1JJC B;  1ASY A;  1IL2 A;  3HOZ H;  2GVA A;  3CCE A;  1Y1V G;  4UP8 A;  1SN8 A;  2Q2H A;  1HNW L;  2JE6 I;  4DV2 Q;  3FHW A;  3HOX H;  2B29 A;  2CKZ B;  1MJE A;  1S3O A;  2PMZ E;  1VQ8 A;  1X3E A;  1VQK A;  4LF7 L;  2ZTD A;  4DR3 Q;  1YJW A;  1VQA A;  4B3T Q;  4AYB G;  1EYG A;  4UY8 C;  4GKK Q;  2H5X A;  2D62 A;  1NTG A;  5ELN A;  5C4J H;  1YZ6 A;  1N36 Q;  4DR4 L;  5GQO A;  4JI2 L;  2F52 A;  2EXD A;  2E5L Q;  4NXN Q;  2F4V Q;  2JA6 H;  4K0K Q;  2Q2T A;  1Y1W H;  2AKW B;  4DV2 L;  4LW1 A;  2UUC Q;  3S17 H;  4A3G H;  2LXK A;  2A8V A;  2ASB A;  1E24 A;  2AWN A;  4JI8 Q;  5GRO A;  1M90 C;  2UU9 Q;  4JI5 Q;  2EIF A;  5IE8 A;  4JI4 Q;  3CCJ A;  4IFD I;  4WJ4 A;  2R93 G;  4GKK L;  2CFM A;  4A3C G;  3I4N G;  4HID A;  2EQS A;  2NN6 G;  3K0X A;  2E5L L;  2F4V L;  4BY1 H;  3OTO Q;  4BBS G;  2D0P A;  3RN5 A;  4K0K L;  5JJI A;  3S1Q H;  1A0I A;  2JA9 A;  4X65 Q;  2YU9 H;  1VQ6 A;  4LUO A;  2JA8 G;  3B6Y A;  4A93 H;  4A3E H;  4A3B G;  3U50 C;  4QQB X;  3PUY A;  4DUZ L;  1Z47 A;  4JI8 L;  2UU9 L;  2Q2U A;  4DR1 L;  4JI4 L;  3RN2 A;  4A3L G;  1JJG A;  4HJ5 A;  3CCL A;  4L5T A;  2ATW A;  1PVO A;  3PUV A;  4KLK A;  5JJL A;  2IHE A;  4TVA B;  3ULP A;  1I5F A;  4DV1 Q;  2PQA A;  2PNH A;  3BU2 A;  1VQ4 A;  1VQM A;  3GD7 A;  4B3M L;  2UXB L;  4OWX B;  4OX9 L;  4DV7 L;  4GOP B;  2E8G A;  1E22 A;  4DK6 C;  3CCU A;  2NVT H;  4YCU A;  3M4O H;  2VNU D;  2KBN A;  4POF A;  5IY0 A;  5GAE C;  2RF4 A;  3GO5 A;  1PYB A;  3J81 i;  4DR2 Q;  4P73 A;  4R4O A;  3J81 j;  4R4I A;  1VCI A;  2OQK A;  2ALY B;  3JAM c;  1LYL A;  3PCO B;  2WB1 G;  5FJ8 G;  4DV1 L;  2Y0S G;  2OWO A;  4LF4 Q;  3I4M G;  4BA2 I;  1PH9 A;  3UE0 A;  3HOZ G;  5HGQ A;  5FLM G;  3E0E A;  1VQO A;  1OXU A;  4DNI A;  2YYZ A;  1TWH H;  1KRS A;  4A3C H;  4IPC A;  5ELO A;  4R4Q A;  4UPA A;  4GN4 B;  1Q8K A;  2N49 A;  5M5W H;  2IX0 A;  5C44 G;  3GTK H;  1BBW A;  1V9P A;  1S40 A;  2CWP A;  4ME3 A;  4YWM A;  1JB7 A;  2JA8 H;  4PZ6 A;  4AYB E;  2R7Z H;  4A3B H;  1PH1 A;  1YBY A;  5M3F G;  4DR6 L;  1XTD A;  4A3L H;  3KFU A;  1JMC A;  3UDF A;  1HNX Q;  1KL9 A;  4QY7 A;  2QEX A;  1UE1 A;  4B3S Q;  1XMO L;  4B3R L;  4X64 Q;  2IT1 A;  5IP7 G;  4DV4 L;  3F8T A;  5JJK A;  2B3G A;  1OXX K;  2K5H A;  3NEL A;  2NZO A;  3CF5 A;  1YNX A;  2NZH A;  1YHB A;  3D31 A;  1A8V A;  3M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...