4DR6T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr6T00
4KHPT 2UXBT 2F4VT 4DR1T 4DR3T 1XNQT 4JI6T 4LF6T 2ZM6T 1I94T 2UXDT 2E5LT 4X65T 4B3MT 4K0KT 4JI2T 2UUBT 4LF8T 1XMQT 4DR4T 2HHHT 4DUZT 1HNZT 4DV0T 2UUAT 4DV1T 2UU9T 4DV3T 4AQYT 2VQFT 1J5ET 4DV6T 4LFBT 4LF4T 4JI1T 1XMOT 2UXCT 1FJGT 4JI3T 4NXMT 4JI5T 3OTOT 4X64T 5IWAT 1N36T 4YHHT 4DR6T 1IBMT 1IBKT 1N34T 3T1YT 4DR2T 4DUYT 1HNXT 4GKJT 4YY3T 4DV5T 4LF7T 1IBLT 4X66T 1N33T 1HR0T 4DR7T 1XNRT 4LF5T 4LFAT 4B3TT 4GKKT 4JI0T 4JI8T 4NXNT 4B3ST 4DV4T 2UUCT 5LMUT 4LF9T 4DV2T 5BR8T 5LMNT 4LFCT 4JV5T 1N32T 4DR5T 1HNWT 4OX9T 3T1HT 4JYAT 4DV7T 4JI4T 4B3RT 2VQET 4X62T 4JI7T
chains in the Genus database with same CATH superfamily
2AE9A 4DBRA 4PJMA 1FMWA 5JDMA 5AQOB 3ZYLA 2XQAA 2ZM6T 2X0HA 1JNRA 2KSRA 2DWGA 4Z91A 2UUAT 4F6RC 1YW0A 3T8OA 4UV9B 3MZKB 3BQLA 5HWXA 1WCRA 4YTNA 5IHYA 4JEHB 1XDOA 4EZHA 5LG3A 3RIUC 3IBPA 4TWFA 4IDOA 3OTOT 3PUXF 2V7LA 4IIJE 3M3ZB 3VHLA 2B76A 2BVMA 5FL1A 4HTEA 1IBMT 4HWCA 3PUVF 1KF6A 3KBUA 1HX8A 2KINB 2KMFA 2LHNA 2WU5A 5AQQB 4ZI2C 4PK4A 5AQTB 2Q9QA 3C4XA 4Z8XA 3P7IA 4I55E 2LE8A 4WZXA 3AA7B 1CHUA 4JI8T 3CWZB 3KV9A 4WBOA 4AKGA 1JNZA 2J47A 2MPKA 3N9MA 5FYMA 4YSZA 3L39A 5LMNT 3KVAA 3RF1A 4JYAT 4IE4A 4HWIB 3I1AA 2IUBA 4GYSA 2E9XB 2PJQA 3LFMA 5EZYE 5FXXA 2MOZA 5CA1E 4YFSA 3HKBE 1D0ZA 4EIWA 3WAKA 4HFIA 3W15B 4KP3C 3ZMVB 3MA9A 3CVRA 3U78A 4YJ3E 2BG9C 4X64T 4TX5A 4ZI7E 3LK3B 3Q9DA 2L9QA 2ACXA 3TKLB 2N1GA 3B57A 3GA8A 4AKLA 4UELA 3KVBA 4WW0A 3O1JA 4HGAA 2PFVA 5FXZA 2X0LB 5JDFA 3EABA 3CIRA 3AE7A 3Q5EA 5ADXL 1YXRA 1BR1A 2UUCT 4KI0F 4I0UA 1W9RA 4CXYA 4DMWA 5EK3A 3CK6A 3RKGA 2XAJB 3O1HA 1B7TA 2NR4A 2X9XA 4JI4T 1NENA 1O3XA 3RGLA 2VQET 2MAWA 2X9HA 4PJJA 4JI7T 4DBQA 2CXLA 3N9QA 3ETVA 3RPUA 2H7OA 4HFDA 4HWFA 4JI6T 2C5JA 1FMVA 5AQPB 4LF6T 3NRYA 4X65T 5HXCA 4IE7A 2UU9T 4A5XA 4ISTA 3HKEE 3OPCA 2CEAA 4IDNA 2YOEA 2VKOA 4L5GA 1D0YA 2LKGA 3Q2MA 2D2SA 1T72A 2EHOA 3RLFF 1BR2A 3CKDA 5CFBA 3I0QA 4H9QC 4QHOA 4O4LE 2XTLA 4QXCB 1E1HB 5FY7A 3CX7B 4ZI3C 4DV5T 2VURA 2CHOA 4CZZB 4FI5A 2WMOA 5DABA 5M4YA 3OJAA 4ISSA 4YLHA 5J2TE 2IAKA 3AXJA 2E9XD 3BQIA 2WY2A 4CN1A 3PU8A 3IF8B 5ABEA 2X9WA 1HFAA 4DR5T 5JRCB 4LMJA 1Z0PA 1D1CA 2X66A 3KBTA 3U3IA 3GMIA 2ZM8A 1D1AA 4P0AA 4E7ZA 2XZEA 4HEAA 3AE8A 5JDNA 2LOSA 4JEUB 2E5LT 5AQIB 1HS7A 5JR9A 5HEUA 4UVCB 3LJCA 4IE6A 2V26A 4DUZT 3E08A 2H7VC 2N9DA 1D0XA 4DV3T 1BR4A 3CX6B 4PK6A 3NZPA 4AKRB 2XAFB 3UFGA 1VCSA 1UK5A 3E22E 3PTRB 2WU2A 4UF0B 4ILCA 4ERRA 2XSAA 3K3NA 4DR6T 3A7MA 2WDVA 2C0SA 5L2LA 2DLRA 3HL6A 5LYJE 4WNKA 4H9NC 3PE0A 2RPAA 4J2CA 1W09A 3HKCE 3TLTA 2HH7A 3ETUA 4X66T 4ZS3A 4HFHA 1OXZA 3AE2A 2A9UA 2QYWA 3LK2B 2Z6EA 3C51A 1DU2A 4CN6A 4A56A 2WMNA 4YTPA 4KX6A 1E2AA 5LP6E 4DV2T 4OFZA 4DO0A 5J1GA 5J0ZA 3T1HT 4L0RA 4DV7T 2H89A 2VKJA 4H63V 3BK9A 2UXBT 1XWMA 1WFDA 4H9RC 1KK7A 3FBLA 2FJAA 3AEBA 5CGMA 4U2YA 3FZFB 4DR4T 4QXBB 2XY8B 2HN2A 2Q9QB 2HPJA 2XQYA 3LDQB 5A1LA 2IDOB 2P9BA 1J5ET 4DV6T 2XQ7A 2AXDS 2W2UA 3NRXA 3UULA 4ILAA 3UQ7A 3IA3A 5FVKA 4MLKA 1OEDA 1X9BA 4AISA 3NZQA 5CB4E 1SHZC 4YJ2E 3H3AA 1M7KA 3N2KE 3J9X1 2JQKA 2SPCA 3PDYA 4Z90A 4KUMB 2NW7A 2QVAA 4AQFC 2OA5A 1H7CA 1OEDE 4YTMA 4CQIA 4YHJA 4XZCA 2I6HA 3AEDA 3OVUA 2K24A 1N32T 2KZ7B 3VR8A 3UU6A 3X1DA 1Y64B 2CRBA 1HTJF 1T8BA 2YDQA 4DVDA 4LMLA 4B3RT 1SE7A 4HFCA 4ZOLE 3WAJA 3LK42 4P09A 2XQ5A 2WP9A 5HEGA 3ZYMA 5E0OA 3NVOA 5HCJA 3ANWB 1XMQT 3EVYA 3UUXB 3SFEA 5L3EB 2VB6A 2NW8A 3B5MA 5IYZE 2JJ9A 1UX5A 4JI1T 2XQ9A 4EGWA 1YD8G 2JQHA 3RHWA 4CI1B 3LBXA 4MBQA 2M67A 2JMKA 3ZT5A 2ODVA 4DMVA 1IAPA 2W0GA 5HEOA 1IBLT 2K48A 4U7YA 2LSIA 2XSBA 2I59A 4U31A 4UVBB 3RC3A 1MNEA 4P0BA 3QB5K 3RIUA 2GK9A 5LOVE 4LF9T 2VVSA 3VRBA 2MBGA 4X1IE 2PTFA 4QH5A 2Q9QD 2WCAA 1D1BA 5L3FB 1Z8UA 3KV5A 5AQNB 2LHRA 2WSSV 5AQLB 2QRXA 2D5UA 4DR1T 3QC9A 4ZEYA 1IJ6A 2B1EA 1J5WA 4Q25A 4U74A 4K0KT 2NP9A 3H3MA 5AQVB 1T7SA 3C98B 2L3LA 3QUJA 2JPFA 3F2EA 4LFBT 3TLVA 2WQYA 1MMAA 3JAEA 3ZYKA 1HG2A 4JI5T 1IZNB 4LMKA 1EZ3A 3M65A 2X0YA 4I50E 4PAGA 5HXSA 4ILUA 4IE5A 1CUNA 3Q5WA 5AQMB 2WBLA 3ZT6A 5LA6E 3GN5B 4JBWF 1XNRT 1AJ3A 4B3TT 4C90A 3ZMUB 3EUHA 3PV0F 3UFEA 2BVLA 2BG9A 5JR9B 2XPKA 2H88A 2KNDA 4HFEA 1MIYA 4OX9T 2JRKA 3PUZF 3P4RA 1UGOA 4YXDA 2Y8DA 2J62A 2UXNB 4KHPT 5CJ5A 2F4VT 1XNQT 4QX8B 2BG9E 4TV9E 4UVAB 2UXDT 4I43B 4HN9A 3L3PA 4IE0A 4MFRA 3ONXA 3AE5A 3AE4A 3C64A 4K0UA 4O2BE 2KWIB 3LG7A 1V9DA 4EAHA 3O4XE 3TLWA 5JREA 4GYRA 5HCMA 4BAYB 5LGTB 2DWKA 5L3BB 1S35A 5LHGB 3UUMA 3FZMB 3KINB 3SS1A 5LJNA 1WYBA 2WDRA 4MHCA 3I9WA 5FXVA 5AQFB 2LLYA 3JCFA 3TLUA 5ABFB 4NUVA 2V7MA 3AVRA 4WYVA 3QNUA 2WWUA 3HI2A 2NW9A 2V5CA 3RH3A 1MNDA 1YQ3A 5L3GB 5KMGP 3HR0A 1S94A 1HNWT 1E7PA 2VKHA 4GOUA 4IL9A 3OBVE 3IHRA 2NOXA 3ZMTB 2XJ7A 4DIDB 3OYXA 5HXRA 2IMLA 3ZT7A 2E9XC 1FIOA 2CXFA 1MMDA 2W61A 3QB5A 1Y01A 2ODUA 4JI2T 2MTQA 4XAXB 5HEHA 3RYFE 1HNZT 1YKHB 5FMNA 5JDLA 4KMCA 3ZKRA 5LJMA 2UXCT 2CE7A 4G2AA 2L8KA 2YDRA 4M1PA 4EOZB 3RYIE 3N2GE 2X68A 1J1JA 1IBKT 3HKDE 4DR2T 2BKPA 1YKEB 1ZEEA 3AECA 2LRLA 3PJAJ 3QOFA 1N33T 5AQUB 4LF5T 3P4QA 4EXTA 4JLEA 5LXTE 5AQKB 4HKAA 2M6IA 5KXJA 5BR8T 4PNIA 1G73A 2W66A 3K3OA 5F3JA 4GIWA 4QH1A 4N78D 4H9SE 2X9YA 4UR9A 5KX5E 3K1SA 2QGSA 1WRDA 3RYHE 3A5XA 4EEDA 2LOPA 3RX6A 3CMLA 1U5PA 4IT4A 5JVDE 1OWAA 4AQYT 2RA1A 4X5TA 3FB2A 3FHNA 5AQJB 3L8RA 3ZSSA 4ADZA 2BBHA 2XHEB 4PJLA 3JADA 1LRZA 3CQXC 4O4IE 2E8IA 1I6ZA 2LM9A 2V7JA 2KWHA 2KLQA 3VKGA 4GK0E 5DJQC 3PJAA 3D0TA 2ZM2A 4CN4A 2DI4A 2LSJA 3MJXA 5AFUL 3UU5A 3SOLA 3PUQA 1MMGA 3ZMZB 1US7B 1UX4A 3SFDA 3PUYF 3TLSA 2FJBA 4UXNB 2W4XA 2HPLA 1QLBA 4H9OC 4ILBA 2XAGB 2H3RA 5FXWA 5L3CB 2V1DB 2BS2A 2Y6XA 2NTXA 1HCIA 5JRCA 2WZIA 4B6XA 4KHZF 2PG8A 2VL0A 3F31A 5LCYA 4AQFA 2DL1A 5JDGA 5HWYA 3UUNA 1KFYA 4O4HE 4LF8T 2G0UA 3JC6D 1FEWA 4P1NA 4AXPA 2YDSA 4NPPA 2VQFT 4HWDA 5C8YE 1L0VA 3O1IA 3PU3A 1HG5A 2DCFA 2CLYB 4EEBA 5FL0A 3K8PC 2VL8A 2K5BB 1WR6A 3CQCB 5CA0E 3PUWF 2BG9B 3C4ZA 1MIWA 5LGNB 3UU4A 4QXHB 3N2OA 4IL4A 3RQUA 3EHZA 4IDZA 1HNXT 2X51A 2W00A 1LVKA 3N9OA 1ZKEA 2YU1A 3ONJA 4CXWA 3UU3A 4O2AE 4MALA 4I4TE 1UUSA 3N9PA 5JH7E 3A8YC 4JI0T 4NXNT 4JUYA 5EK2A 2XM2A 3AEFA 4CI3B 3MK7C 3RC8A 3Q5DA 2QA7A 4HWHA 4ZXLA 2LRKA 4X62T 2C5KT 2BS4A 5HYAA 5JQGE 3RIFA 3SRZA 3KV6A 3N5LA 4AQGA 1NAFA 2YK0A 3RIAA 4ZI2D 2Q9QC 3I9YA 2M6BA 3ABVA 2WZHA 1LVFA 2DNXA 2EHOB 2ZM0A 3UU8A 3AEAA 3PUGA 4E7SA 4JI3T 5GONE 2CA5A 3VKHA 3ZEFB 3N9NA 1ZHCA 1LKXA 5IWAT 4XBFB 4AKHA 4FJOA 5LHIB 3V5SA 3ZPOA 3KFWX 3FBZA 3AXJB 3AVSA 2E5VA 3EDVA 2WWVA 3AE1A 3RRCA 2LKHA 2V6YA 4BA9A 2XUEA 5HAXA 5ABHA 4EV6A 3OYZA 3K3QC 4YSYA 4L9IA 3AA1B 5LMUT 4IDPA 5H6RB 5ETWA 2VKDA 2IC6A 4GK5E 1WR0A 3NWIA 2LM2A 3DP7A 2JMHA 2YEVC 1IJ5A 3AA0B 3RRWA 2WDQA 2BDEA 1M62A 2XQ3A 4NUUA 4ZHQE 3BQKA 3C50A 2VWAA 4QX7B 2CLYC 4DR3T 2BKNA 3RI5A 4X1KE 1W0AA 1I94T 2V7IA 2LSYA 3P4WA 4PJNA 1MIVA 5EK4A 2A72A 4DV1T 3ANWA 2YU2A 1YQ4A 4BJNA 3KDSE 4A97A 3ONLC 2K9AA 2J1DG 1X79A 1G8XA 2IHR1 4EZ4A 1WYCA 4UV8B 4OK0A 4PK5A 4DNDA 2R6GF 4BJMA 1NWMX 4QH4A 1MMNA 4OYKA 2MYSA 5F8PA 3AAAB 2JQ9A 4PFPA 2BZBA 4QKNA 3OKQA 2V7KA 4U2ZA 1SA0E 5JDHA 5AQSB 3S4UA 3ZSTA 3MKDA 4TN7B 2VASA 3WI3A 4DV4T 4KBMB 3AEGA 2XM1A 3AE9A 1ZOYA 4ZZCA 2EHOD 1VCTA 3E0ZA 4AIUA 2LSGA 2CWYA 2BS3A 2EHOC 5C2TA 2VK9A 4U33A 3PURA 4ZS2A 3R84B 4H9PC 3ZC0A 5H6QB 4WBNE 1KNPA 2WAUA 3AEEA 2LSKA 3PUAA 2CWOA 5IUXA 4B3MT 3DJBA 1UCUA 3EI0A 5LB7B 2V5DA 3MXZA 4ZI3D 3ZCIA 2DHRA 4TNWA 2CXDA 4ASKA 4LF4T 1XMOT 3GWHA 2OV9A 3J7Yq 4NXMT 1OEDB 5LGUB 2CM0A 2VVNA 3ZJ2A 2K3WA 5DQVA 4TWHA 2E9XA 3Q5XA 2ZMAA 3G06A 4IREA 4PFOA 5FP3A 3RKOA 5LHHB 2FUPA 3ZC1A 1KNRA 2FJDA 4QWNB 3UUBA 5FVLA 4YSXA 4YY3T 2W62A 1U4QA 3ZCJA 1VRBA 1HR0T 5AQRB 4TWDA 3P8CD 4YT0A 3AE3A 3GN5A 3AAIA 2PBIA 5JR9C 4U7IA 3DTOA 4LFCT 1UURA 2KT9A 5JTGA 1R8IA 3ESLA 4O8SA 4IGUA 1QUUA 2ES0A 2XQ6A 4X1YE 4IHJE 2YINA 2RP4A 1SUMB 3ZN0B 2FBWA 1HX1B 5JDQA 2C5IT 5KDMC 4OYJA 5LBQB 5ABGA 2JQQA 5HXEA 3HA4A 3C4WA 4ZZBA 2YKSA 2XASB 2ZLYA 4EYYR 5L3DB 4AKIA 1KNZA 2D9DA 4A98A 5FY0A 4G63A 5DQWA 1FJGT 3F57A 3RYCE 3MACA 2IIUA 3UTKA 3LBXB 3LSVA 3UQ4A 4NIQA 1VOMA 2XQ8A 3I0OA 1N36T 3SWHA 2NTYA 2A2FX 3ZLIA 2N2NA 4TZ4C 4GKJT 1WLXA 2CBIA 3N9LA 4EB6E 5HXHA 5TAOA 1T98A 4TV8E 3H37A 2D0TA 4ANJA 4AI6A 5BMVE 4C91A 2W63A 4HE8A 4GKKT 4CI2B 5LNKA 4B3ST 4F8HA 2LJLA 3FZHB 5ABFA 3ZN1B 2NWBA 4TUYE 4JV5T 4U3CA 4EYUA 1HF8A 5AQHB 4OHFA 3P4SA 3EDUA 3R6NA 2WM9A 3FXDB 2FJEA 2I0MA 2CHNA 5L47A 2WB5A 3VR9A 2V8SV 2WS3A 4TNVA 1BR0A 2UXXB 2ACZA 3P4PA 2BBJA 1XDPA 2CMRA 2YN6A 5L4HA 3KV4A 4UEMA 1OEDC 1QSDA 3FZLB 2LT3A 4CXXA 3V5UA 2A3DA 2KXPB 1W0BA 2UUBT 3ZMSB 2HHHT 2JIWA 3UT5E 2IC9A 4DV0T 3B13A 4O4JE 4COFA 3AA6B 3NKZA 3FZKB 3AAEB 2HN1A 5HEJA 5LBMA 4PW8A 2V6YB 2D0UA 2IW5B 3ZJ1A 2X67A 5L4EA 5C3JA 2OLTA 3PUSA 4HFVA 3VRAA 1NEKA 4YHHT 2CPTA 2LEHA 1N34T 3L09A 3FXEB 3P50A 3T1YT 5FNVE 2E2AA 4DUYT 3JC6C 5FY1A 5LG4A 2V6XA 2BKOA 2XQ4A 3NBXX 2CBJA 3AB3B 4LF7T 3O9XA 2J4GA 1XZYA 1ZV4X 3CQGB 1KEYA 4U72A 4DR7T 3QK6A 4X20E 4LFAT 4UIGA 2CCQA 4HFBA 3RQWA 2W67A 4UF0A 3CPZA 3CX8B 3EAMA 5AQGB 2Y48B 5FKYA 4IDQA 3IEEA 4V1Av 3AE6A 2XAHB 3VU7H 2XAQB 5J2UE 1ZP0A 4H63H 3JAFA 1GQEA 5F5WA
chains in the Genus database with same CATH topology
4KHPT 2UXBT 2F4VT 4DR1T 4DR3T 1XNQT 4JI6T 4LF6T 2ZM6T 1I94T 2UXDT 2E5LT 4X65T 4B3MT 4K0KT 4JI2T 2UUBT 4LF8T 1XMQT 4DR4T 2HHHT 4DUZT 1HNZT 4DV0T 2UUAT 4DV1T 2UU9T 4DV3T 4AQYT 2VQFT 1J5ET 4DV6T 4LFBT 4LF4T 4JI1T 1XMOT 2UXCT 1FJGT 4JI3T 4NXMT 4JI5T 3OTOT 4X64T 5IWAT 1N36T 4YHHT 4DR6T 1IBMT 1IBKT 1N34T 3T1YT 4DR2T 4DUYT 1HNXT 4GKJT 4YY3T 4DV5T 4LF7T 1IBLT 4X66T 1N33T 1HR0T 4DR7T 1XNRT 4LF5T 4LFAT 4B3TT 4GKKT 4JI0T 4JI8T 4NXNT 4B3ST 4DV4T 2UUCT 5LMUT 4LF9T 4DV2T 5BR8T 5LMNT 4LFCT 4JV5T 1N32T 4DR5T 1HNWT 4OX9T 3T1HT 4JYAT 4DV7T 4JI4T 4B3RT 2VQET 4X62T 4JI7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP T;  2UXB T;  2F4V T;  4DR1 T;  4DR3 T;  1XNQ T;  4JI6 T;  4LF6 T;  2ZM6 T;  1I94 T;  2UXD T;  2E5L T;  4X65 T;  4B3M T;  4K0K T;  4JI2 T;  2UUB T;  4LF8 T;  1XMQ T;  4DR4 T;  2HHH T;  4DUZ T;  1HNZ T;  4DV0 T;  2UUA T;  4DV1 T;  2UU9 T;  4DV3 T;  4AQY T;  2VQF T;  1J5E T;  4DV6 T;  4LFB T;  4LF4 T;  4JI1 T;  1XMO T;  2UXC T;  1FJG T;  4JI3 T;  4NXM T;  4JI5 T;  3OTO T;  4X64 T;  5IWA T;  1N36 T;  4YHH T;  4DR6 T;  1IBM T;  1IBK T;  1N34 T;  3T1Y T;  4DR2 T;  4DUY T;  1HNX T;  4GKJ T;  4YY3 T;  4DV5 T;  4LF7 T;  1IBL T;  4X66 T;  1N33 T;  1HR0 T;  4DR7 T;  1XNR T;  4LF5 T;  4LFA T;  4B3T T;  4GKK T;  4JI0 T;  4JI8 T;  4NXN T;  4B3S T;  4DV4 T;  2UUC T;  5LMU T;  4LF9 T;  4DV2 T;  5BR8 T;  5LMN T;  4LFC T;  4JV5 T;  1N32 T;  4DR5 T;  1HNW T;  4OX9 T;  3T1H T;  4JYA T;  4DV7 T;  4JI4 T;  4B3R T;  2VQE T;  4X62 T;  4JI7 T; 
#chains in the Genus database with same CATH topology
 2AE9 A;  4DBR A;  4PJM A;  1FMW A;  5JDM A;  5AQO B;  3ZYL A;  2XQA A;  2ZM6 T;  2X0H A;  1JNR A;  2KSR A;  2DWG A;  4Z91 A;  2UUA T;  4F6R C;  1YW0 A;  3T8O A;  4UV9 B;  3MZK B;  3BQL A;  5HWX A;  1WCR A;  4YTN A;  5IHY A;  4JEH B;  1XDO A;  4EZH A;  5LG3 A;  3RIU C;  3IBP A;  4TWF A;  4IDO A;  3OTO T;  3PUX F;  2V7L A;  4IIJ E;  3M3Z B;  3VHL A;  2B76 A;  2BVM A;  5FL1 A;  4HTE A;  1IBM T;  4HWC A;  3PUV F;  1KF6 A;  3KBU A;  1HX8 A;  2KIN B;  2KMF A;  2LHN A;  2WU5 A;  5AQQ B;  4ZI2 C;  4PK4 A;  5AQT B;  2Q9Q A;  3C4X A;  4Z8X A;  3P7I A;  4I55 E;  2LE8 A;  4WZX A;  3AA7 B;  1CHU A;  4JI8 T;  3CWZ B;  3KV9 A;  4WBO A;  4AKG A;  1JNZ A;  2J47 A;  2MPK A;  3N9M A;  5FYM A;  4YSZ A;  3L39 A;  5LMN T;  3KVA A;  3RF1 A;  4JYA T;  4IE4 A;  4HWI B;  3I1A A;  2IUB A;  4GYS A;  2E9X B;  2PJQ A;  3LFM A;  5EZY E;  5FXX A;  2MOZ A;  5CA1 E;  4YFS A;  3HKB E;  1D0Z A;  4EIW A;  3WAK A;  4HFI A;  3W15 B;  4KP3 C;  3ZMV B;  3MA9 A;  3CVR A;  3U78 A;  4YJ3 E;  2BG9 C;  4X64 T;  4TX5 A;  4ZI7 E;  3LK3 B;  3Q9D A;  2L9Q A;  2ACX A;  3TKL B;  2N1G A;  3B57 A;  3GA8 A;  4AKL A;  4UEL A;  3KVB A;  4WW0 A;  3O1J A;  4HGA A;  2PFV A;  5FXZ A;  2X0L B;  5JDF A;  3EAB A;  3CIR A;  3AE7 A;  3Q5E A;  5ADX L;  1YXR A;  1BR1 A;  2UUC T;  4KI0 F;  4I0U A;  1W9R A;  4CXY A;  4DMW A;  5EK3 A;  3CK6 A;  3RKG A;  2XAJ B;  3O1H A;  1B7T A;  2NR4 A;  2X9X A;  4JI4 T;  1NEN A;  1O3X A;  3RGL A;  2VQE T;  2MAW A;  2X9H A;  4PJJ A;  4JI7 T;  4DBQ A;  2CXL A;  3N9Q A;  3ETV A;  3RPU A;  2H7O A;  4HFD A;  4HWF A;  4JI6 T;  2C5J A;  1FMV A;  5AQP B;  4LF6 T;  3NRY A;  4X65 T;  5HXC A;  4IE7 A;  2UU9 T;  4A5X A;  4IST A;  3HKE E;  3OPC A;  2CEA A;  4IDN A;  2YOE A;  2VKO A;  4L5G A;  1D0Y A;  2LKG A;  3Q2M A;  2D2S A;  1T72 A;  2EHO A;  3RLF F;  1BR2 A;  3CKD A;  5CFB A;  3I0Q A;  4H9Q C;  4QHO A;  4O4L E;  2XTL A;  4QXC B;  1E1H B;  5FY7 A;  3CX7 B;  4ZI3 C;  4DV5 T;  2VUR A;  2CHO A;  4CZZ B;  4FI5 A;  2WMO A;  5DAB A;  5M4Y A;  3OJA A;  4ISS A;  4YLH A;  5J2T E;  2IAK A;  3AXJ A;  2E9X D;  3BQI A;  2WY2 A;  4CN1 A;  3PU8 A;  3IF8 B;  5ABE A;  2X9W A;  1HFA A;  4DR5 T;  5JRC B;  4LMJ A;  1Z0P A;  1D1C A;  2X66 A;  3KBT A;  3U3I A;  3GMI A;  2ZM8 A;  1D1A A;  4P0A A;  4E7Z A;  2XZE A;  4HEA A;  3AE8 A;  5JDN A;  2LOS A;  4JEU B;  2E5L T;  5AQI B;  1HS7 A;  5JR9 A;  5HEU A;  4UVC B;  3LJC A;  4IE6 A;  2V26 A;  4DUZ T;  3E08 A;  2H7V C;  2N9D A;  1D0X A;  4DV3 T;  1BR4 A;  3CX6 B;  4PK6 A;  3NZP A;  4AKR B;  2XAF B;  3UFG A;  1VCS A;  1UK5 A;  3E22 E;  3PTR B;  2WU2 A;  4UF0 B;  4ILC A;  4ERR A;  2XSA A;  3K3N A;  4DR6 T;  3A7M A;  2WDV A;  2C0S A;  5L2L A;  2DLR A;  3HL6 A;  5LYJ E;  4WNK A;  4H9N C;  3PE0 A;  2RPA A;  4J2C A;  1W09 A;  3HKC E;  3TLT A;  2HH7 A;  3ETU A;  4X66 T;  4ZS3 A;  4HFH A;  1OXZ A;  3AE2 A;  2A9U A;  2QYW A;  3LK2 B;  2Z6E A;  3C51 A;  1DU2 A;  4CN6 A;  4A56 A;  2WMN A;  4YTP A;  4KX6 A;  1E2A A;  5LP6 E;  4DV2 T;  4OFZ A;  4DO0 A;  5J1G A;  5J0Z A;  3T1H T;  4L0R A;  4DV7 T;  2H89 A;  2VKJ A;  4H63 V;  3BK9 A;  2UXB T;  1XWM A;  1WFD A;  4H9R C;  1KK7 A;  3FBL A;  2FJA A;  3AEB A;  5CGM A;  4U2Y A;  3FZF B;  4DR4 T;  4QXB B;  2XY8 B;  2HN2 A;  2Q9Q B;  2HPJ A;  2XQY A;  3LDQ B;  5A1L A;  2IDO B;  2P9B A;  1J5E T;  4DV6 T;  2XQ7 A;  2AXD S;  2W2U A;  3NRX A;  3UUL A;  4ILA A;  3UQ7 A;  3IA3 A;  5FVK A;  4MLK A;  1OED A;  1X9B A;  4AIS A;  3NZQ A;  5CB4 E;  1SHZ C;  4YJ2 E;  3H3A A;  1M7K A;  3N2K E;  3J9X 1;  2JQK A;  2SPC A;  3PDY A;  4Z90 A;  4KUM B;  2NW7 A;  2QVA A;  4AQF C;  2OA5 A;  1H7C A;  1OED E;  4YTM A;  4CQI A;  4YHJ A;  4XZC A;  2I6H A;  3AED A;  3OVU A;  2K24 A;  1N32 T;  2KZ7 B;  3VR8 A;  3UU6 A;  3X1D A;  1Y64 B;  2CRB A;  1HTJ F;  1T8B A;  2YDQ A;  4DVD A;  4LML A;  4B3R T;  1SE7 A;  4HFC A;  4ZOL E;  3WAJ A;  3LK4 2;  4P09 A;  2XQ5 A;  2WP9 A;  5HEG A;  3ZYM A;  5E0O A;  3NVO A;  5HCJ A;  3ANW B;  1XMQ T;  3EVY A;  3UUX B;  3SFE A;  5L3E B;  2VB6 A;  2NW8 A;  3B5M A;  5IYZ E;  2JJ9 A;  1UX5 A;  4JI1 T;  2XQ9 A;  4EGW A;  1YD8 G;  2JQH A;  3RHW A;  4CI1 B;  3LBX A;  4MBQ A;  2M67 A;  2JMK A;  3ZT5 A;  2ODV A;  4DMV A;  1IAP A;  2W0G A;  5HEO A;  1IBL T;  2K48 A;  4U7Y A;  2LSI A;  2XSB A;  2I59 A;  4U31 A;  4UVB B;  3RC3 A;  1MNE A;  4P0B A;  3QB5 K;  3RIU A;  2GK9 A;  5LOV E;  4LF9 T;  2VVS A;  3VRB A;  2MBG A;  4X1I E;  2PTF A;  4QH5 A;  2Q9Q D;  2WCA A;  1D1B A;  5L3F B;  1Z8U A;  3KV5 A;  5AQN B;  2LHR A;  2WSS V;  5AQL B;  2QRX A;  2D5U A;  4DR1 T;  3QC9 A;  4ZEY A;  1IJ6 A;  2B1E A;  1J5W A;  4Q25 A;  4U74 A;  4K0K T;  2NP9 A;  3H3M A;  5AQV B;  1T7S A;  3C98 B;  2L3L A;  3QUJ A;  2JPF A;  3F2E A;  4LFB T;  3TLV A;  2WQY A;  1MMA A;  3JAE A;  3ZYK A;  1HG2 A;  4JI5 T;  1IZN B;  4LMK A;  1EZ3 A;  3M65 A;  2X0Y A;  4I50 E;  4PAG A;  5HXS A;  4ILU A;  4IE5 A;  1CUN A;  3Q5W A;  5AQM B;  2WBL A;  3ZT6 A;  5LA6 E;  3GN5 B;  4JBW F;  1XNR T;  1AJ3 A;  4B3T T;  4C90 A;  3ZMU B;  3EUH A;  3PV0 F;  3UFE A;  2BVL A;  2BG9 A;  5JR9 B;  2XPK A;  2H88 A;  2KND A;  4HFE A;  1MIY A;  4OX9 T;  2JRK A;  3PUZ F;  3P4R A;  1UGO A;  4YXD A;  2Y8D A;  2J62 A;  2UXN B;  4KHP T;  5CJ5 A;  2F4V T;  1XNQ T;  4QX8 B;  2BG9 E;  4TV9 E;  4UVA B;  2UXD T;  4I43 B;  4HN9 A;  3L3P A;  4IE0 A;  4MFR A;  3ONX A;  3AE5 A;  3AE4 A;  3C64 A;  4K0U A;  4O2B E;  2KWI B;  3LG7 A;  1V9D A;  4EAH A;  3O4X E;  3TLW A;  5JRE A;  4GYR A;  5HCM A;  4BAY B;  5LGT B;  2DWK A;  5L3B B;  1S35 A;  5LHG B;  3UUM A;  3FZM B;  3KIN B;  3SS1 A;  5LJN A;  1WYB A;  2WDR A;  4MHC A;  3I9W A;  5FXV A;  5AQF B;  2LLY A;  3JCF A;  3TLU A;  5ABF B;  4NUV A;  2V7M A;  3AVR A;  4WYV A;  3QNU A;  2WWU A;  3HI2 A;  2NW9 A;  2V5C A;  3RH3 A;  1MND A;  1YQ3 A;  5L3G B;  5KMG P;  3HR0 A;  1S94 A;  1HNW T;  1E7P A;  2VKH A;  4GOU A;  4IL9 A;  3OBV E;  3IHR A;  2NOX A;  3ZMT B;  2XJ7 A;  4DID B;  3OYX A;  5HXR A;  2IML A;  3ZT7 A;  2E9X C;  1FIO A;  2CXF A;  1MMD A;  2W61 A;  3QB5 A;  1Y01 A;  2ODU A;  4JI2 T;  2MTQ A;  4XAX B;  5HEH A;  3RYF E;  1HNZ T;  1YKH B;  5FMN A;  5JDL A;  4KMC A;  3ZKR A;  5LJM A;  2UXC T;  2CE7 A;  4G2A A;  2L8K A;  2YDR A;  4M1P A;  4EOZ B;  3RYI E;  3N2G E;  2X68 A;  1J1J A;  1IBK T;  3HKD E;  4DR2 T;  2BKP A;  1YKE B;  1ZEE A;  3AEC A;  2LRL A;  3PJA J;  3QOF A;  1N33 T;  5AQU B;  4LF5 T;  3P4Q A;  4EXT A;  4JLE A;  5LXT E;  5AQK B;  4HKA A;  2M6I A;  5KXJ A;  5BR8 T;  4PNI A;  1G73 A;  2W66 A;  3K3O A;  5F3J A;  4GIW A;  4QH1 A;  4N78 D;  4H9S E;  2X9Y A;  4UR9 A;  5KX5 E;  3K1S A;  2QGS A;  1WRD A;  3RYH E;  3A5X A;  4EED A;  2LOP A;  3RX6 A;  3CML A;  1U5P A;  4IT4 A;  5JVD E;  1OWA A;  4AQY T;  2RA1 A;  4X5T A;  3FB2 A;  3FHN A;  5AQJ B;  3L8R A;  3ZSS A;  4ADZ A;  2BBH A;  2XHE B;  4PJL A;  3JAD A;  1LRZ A;  3CQX C;  4O4I E;  2E8I A;  1I6Z A;  2LM9 A;  2V7J A;  2KWH A;  2KLQ A;  3VKG A;  4GK0 E;  5DJQ C;  3PJA A;  3D0T A;  2ZM2 A;  4CN4 A;  2DI4 A;  2LSJ A;  3MJX A;  5AFU L;  3UU5 A;  3SOL A;  3PUQ A;  1MMG A;  3ZMZ B;  1US7 B;  1UX4 A;  3SFD A;  3PUY F;  3TLS A;  2FJB A;  4UXN B;  2W4X A;  2HPL A;  1QLB A;  4H9O C;  4ILB A;  2XAG B;  2H3R A;  5FXW A;  5L3C B;  2V1D B;  2BS2 A;  2Y6X A;  2NTX A;  1HCI A;  5JRC A;  2WZI A;  4B6X A;  4KHZ F;  2PG8 A;  2VL0 A;  3F31 A;  5LCY A;  4AQF A;  2DL1 A;  5JDG A;  5HWY A;  3UUN A;  1KFY A;  4O4H E;  4LF8 T;  2G0U A;  3JC6 D;  1FEW A;  4P1N A;  4AXP A;  2YDS A;  4NPP A;  2VQF T;  4HWD A;  5C8Y E;  1L0V A;  3O1I A;  3PU3 A;  1HG5 A;  2DCF A;  2CLY B;  4EEB A;  5FL0 A;  3K8P C;  2VL8 A;  2K5B B;  1WR6 A;  3CQC B;  5CA0 E;  3PUW F;  2BG9 B;  3C4Z A;  1MIW A;  5LGN B;  3UU4 A;  4QXH B;  3N2O A;  4IL4 A;  3RQU A;  3EHZ A;  4IDZ A;  1HNX T;  2X51 A;  2W00 A;  1LVK A;  3N9O A;  1ZKE A;  2YU1 A;  3ONJ A;  4CXW A;  3UU3 A;  4O2A E;  4MAL A;  4I4T E;  1UUS A;  3N9P A;  5JH7 E;  3A8Y C;  4JI0 T;  4NXN T;  4JUY A;  5EK2 A;  2XM2 A;  3AEF A;  4CI3 B;  3MK7 C;  3RC8 A;  3Q5D A;  2QA7 A;  4HWH A;  4ZXL A;  2LRK A;  4X62 T;  2C5K T;  2BS4 A;  5HYA A;  5JQG E;  3RIF A;  3SRZ A;  3KV6 A;  3N5L A;  4AQG A;  1NAF A;  2YK0 A;  3RIA A;  4ZI2 D;  2Q9Q C;  3I9Y A;  2M6B A;  3ABV A;  2WZH A;  1LVF A;  2DNX A;  2EHO B;  2ZM0 A;  3UU8 A;  3AEA A;  3PUG A;  4E7S A;  4JI3 T;  5GON E;  2CA5 A;  3VKH A;  3ZEF B;  3N9N A;  1ZHC A;  1LKX A;  5IWA T;  4XBF B;  4AKH A;  4FJO A;  5LHI B;  3V5S A;  3ZPO A;  3KFW X;  3FBZ A;  3AXJ B;  3AVS A;  2E5V A;  3EDV A;  2WWV A;  3AE1 A;  3RRC A;  2LKH A;  2V6Y A;  4BA9 A;  2XUE A;  5HAX A;  5ABH A;  4EV6 A;  3OYZ A;  3K3Q C;  4YSY A;  4L9I A;  3AA1 B;  5LMU T;  4IDP A;  5H6R B;  5ETW A;  2VKD A;  2IC6 A;  4GK5 E;  1WR0 A;  3NWI A;  2LM2 A;  3DP7 A;  2JMH A;  2YEV C;  1IJ5 A;  3AA0 B;  3RRW A;  2WDQ A;  2BDE A;  1M62 A;  2XQ3 A;  4NUU A;  4ZHQ E;  3BQK A;  3C50 A;  2VWA A;  4QX7 B;  2CLY C;  4DR3 T;  2BKN A;  3RI5 A;  4X1K E;  1W0A A;  1I94 T;  2V7I A;  2LSY A;  3P4W A;  4PJN A;  1MIV A;  5EK4 A;  2A72 A;  4DV1 T;  3ANW A;  2YU2 A;  1YQ4 A;  4BJN A;  3KDS E;  4A97 A;  3ONL C;  2K9A A;  2J1D G;  1X79 A;  1G8X A;  2IHR 1;  4EZ4 A;  1WYC A;  4UV8 B;  4OK0 A;  4PK5 A;  4DND A;  2R6G F;  4BJM A;  1NWM X;  4QH4 A;  1MMN A;  4OYK A;  2MYS A;  5F8P A;  3AAA B;  2JQ9 A;  4PFP A;  2BZB A;  4QKN A;  3OKQ A;  2V7K A;  4U2Z A;  1SA0 E;  5JDH A;  5AQS B;  3S4U A;  3ZST A;  3MKD A;  4TN7 B;  2VAS A;  3WI3 A;  4DV4 T;  4KBM B;  3AEG A;  2XM1 A;  3AE9 A;  1ZOY A;  4ZZC A;  2EHO D;  1VCT A;  3E0Z A;  4AIU A;  2LSG A;  2CWY A;  2BS3 A;  2EHO C;  5C2T A;  2VK9 A;  4U33 A;  3PUR A;  4ZS2 A;  3R84 B;  4H9P C;  3ZC0 A;  5H6Q B;  4WBN E;  1KNP A;  2WAU A;  3AEE A;  2LSK A;  3PUA A;  2CWO A;  5IUX A;  4B3M T;  3DJB A;  1UCU A;  3EI0 A;  5LB7 B;  2V5D A;  3MXZ A;  4ZI3 D;  3ZCI A;  2DHR A;  4TNW A;  2CXD A;  4ASK A;  4LF4 T;  1XMO T;  3GWH A;  2OV9 A;  3J7Y q;  4NXM T;  1OED B;  5LGU B;  2CM0 A;  2VVN A;  3ZJ2 A;  2K3W A;  5DQV A;  4TWH A;  2E9X A;  3Q5X A;  2ZMA A;  3G06 A;  4IRE A;  4PFO A;  5FP3 A;  3RKO A;  5LHH B;  2FUP A;  3ZC1 A;  1KNR A;  2FJD A;  4QWN B;  3UUB A;  5FVL A;  4YSX A;  4YY3 T;  2W62 A;  1U4Q A;  3ZCJ A;  1VRB A;  1HR0 T;  5AQR B;  4TWD A;  3P8C D;  4YT0 A;  3AE3 A;  3GN5 A;  3AAI A;  2PBI A;  5JR9 C;  4U7I A;  3DTO A;  4LFC T;  1UUR A;  2KT9 A;  5JTG A;  1R8I A;  3ESL A;  4O8S A;  4IGU A;  1QUU A;  2ES0 A;  2XQ6 A;  4X1Y E;  4IHJ E;  2YIN A;  2RP4 A;  1SUM B;  3ZN0 B;  2FBW A;  1HX1 B;  5JDQ A;  2C5I T;  5KDM C;  4OYJ A;  5LBQ B;  5ABG A;  2JQQ A;  5HXE A;  3HA4 A;  3C4W A;  4ZZB A;  2YKS A;  2XAS B;  2ZLY A;  4EYY R;  5L3D B;  4AKI A;  1KNZ A;  2D9D A;  4A98 A;  5FY0 A;  4G63 A;  5DQW A;  1FJG T;  3F57 A;  3RYC E;  3MAC A;  2IIU A;  3UTK A;  3LBX B;  3LSV A;  3UQ4 A;  4NIQ A;  1VOM A;  2XQ8 A;  3I0O A;  1N36 T;  3SWH A;  2NTY A;  2A2F X;  3ZLI A;  2N2N A;  4TZ4 C;  4GKJ T;  1WLX A;  2CBI A;  3N9L A;  4EB6 E;  5HXH A;  5TAO A;  1T98 A;  4TV8 E;  3H37 A;  2D0T A;  4ANJ A;  4AI6 A;  5BMV E;  4C91 A;  2W63 A;  4HE8 A;  4GKK T;  4CI2 B;  5LNK A;  4B3S T;  4F8H A;  2LJL A;  3FZH B;  5ABF A;  3ZN1 B;  2NWB A;  4TUY E;  4JV5 T;  4U3C A;  4EYU A;  1HF8 A;  5AQH B;  4OHF A;  3P4S A;  3EDU A;  3R6N A;  2WM9 A;  3FXD B;  2FJE A;  2I0M A;  2CHN A;  5L47 A;  2WB5 A;  3VR9 A;  2V8S V;  2WS3 A;  4TNV A;  1BR0 A;  2UXX B;  2ACZ A;  3P4P A;  2BBJ A;  1XDP A;  2CMR A;  2YN6 A;  5L4H A;  3KV4 A;  4UEM A;  1OED C;  1QSD A;  3FZL B;  2LT3 A;  4CXX A;  3V5U A;  2A3D A;  2KXP B;  1W0B A;  2UUB T;  3ZMS B;  2HHH T;  2JIW A;  3UT5 E;  2IC9 A;  4DV0 T;  3B13 A;  4O4J E;  4COF A;  3AA6 B;  3NKZ A;  3FZK B;  3AAE B;  2HN1 A;  5HEJ A;  5LBM A;  4PW8 A;  2V6Y B;  2D0U A;  2IW5 B;  3ZJ1 A;  2X67 A;  5L4E A;  5C3J A;  2OLT A;  3PUS A;  4HFV A;  3VRA A;  1NEK A;  4YHH T;  2CPT A;  2LEH A;  1N34 T;  3L09 A;  3FXE B;  3P50 A;  3T1Y T;  5FNV E;  2E2A A;  4DUY T;  3JC6 C;  5FY1 A;  5LG4 A;  2V6X A;  2BKO A;  2XQ4 A;  3NBX X;  2CBJ A;  3AB3 B;  4LF7 T;  3O9X A;  2J4G A;  1XZY A;  1ZV4 X;  3CQG B;  1KEY A;  4U72 A;  4DR7 T;  3QK6 A;  4X20 E;  4LFA T;  4UIG A;  2CCQ A;  4HFB A;  3RQW A;  2W67 A;  4UF0 A;  3CPZ A;  3CX8 B;  3EAM A;  5AQG B;  2Y48 B;  5FKY A;  4IDQ A;  3IEE A;  4V1A v;  3AE6 A;  2XAH B;  3VU7 H;  2XAQ B;  5J2U E;  1ZP0 A;  4H63 H;  3JAF A;  1GQE A;  5F5W A; 
#chains in the Genus database with same CATH homology
 4KHP T;  2UXB T;  2F4V T;  4DR1 T;  4DR3 T;  1XNQ T;  4JI6 T;  4LF6 T;  2ZM6 T;  1I94 T;  2UXD T;  2E5L T;  4X65 T;  4B3M T;  4K0K T;  4JI2 T;  2UUB T;  4LF8 T;  1XMQ T;  4DR4 T;  2HHH T;  4DUZ T;  1HNZ T;  4DV0 T;  2UUA T;  4DV1 T;  2UU9 T;  4DV3 T;  4AQY T;  2VQF T;  1J5E T;  4DV6 T;  4LFB T;  4LF4 T;  4JI1 T;  1XMO T;  2UXC T;  1FJG T;  4JI3 T;  4NXM T;  4JI5 T;  3OTO T;  4X64 T;  5IWA T;  1N36 T;  4YHH T;  4DR6 T;  1IBM T;  1IBK T;  1N34 T;  3T1Y T;  4DR2 T;  4DUY T;  1HNX T;  4GKJ T;  4YY3 T;  4DV5 T;  4LF7 T;  1IBL T;  4X66 T;  1N33 T;  1HR0 T;  4DR7 T;  1XNR T;  4LF5 T;  4LFA T;  4B3T T;  4GKK T;  4JI0 T;  4JI8 T;  4NXN T;  4B3S T;  4DV4 T;  2UUC T;  5LMU T;  4LF9 T;  4DV2 T;  5BR8 T;  5LMN T;  4LFC T;  4JV5 T;  1N32 T;  4DR5 T;  1HNW T;  4OX9 T;  3T1H T;  4JYA T;  4DV7 T;  4JI4 T;  4B3R T;  2VQE T;  4X62 T;  4JI7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...