4DR6T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr6T00
4JI8T 1HNXT 4DV7T 4GKKT 1N33T 4JI0T 4DV4T 5BR8T 2VQET 4DV1T 2UUCT 4KHPT 4LFCT 4JI7T 4X65T 1IBLT 4DR7T 4LFBT 2UXCT 2ZM6T 4DR3T 4B3ST 4LF5T 4LF4T 4X62T 4DV6T 4X64T 1N34T 4JI6T 4DR6T 1XNRT 2E5LT 4DR2T 2UU9T 4DR1T 1XMOT 4JI1T 2UUBT 5LMNT 4LF6T 3OTOT 4K0KT 1HNZT 1N32T 1IBMT 4AQYT 4YHHT 2UXBT 4DUZT 4JV5T 1HR0T 4JI2T 4NXNT 4LF9T 4DR5T 4OX9T 4LFAT 4DV5T 1I94T 4DV3T 1FJGT 4B3RT 4LF8T 4LF7T 4NXMT 2F4VT 4GKJT 4X66T 2VQFT 4JYAT 4DUYT 4JI4T 4DV2T 3T1HT 2HHHT 1XNQT 1J5ET 1HNWT 2UUAT 5LMUT 4B3MT 1XMQT 4B3TT 5IWAT 4JI5T 4JI3T 4DR4T 4YY3T 1IBKT 1N36T 4DV0T 3T1YT 2UXDT
chains in the Genus database with same CATH superfamily
3AXJB 2BS3A 1VCTA 5L3CB 2Q9QA 4YTMA 3B5MA 4AQGA 5LG4A 3OJAA 2M6IA 3ZC1A 3ZSTA 2UXCT 2V7LA 4LFBT 4H63H 3I1AA 4A97A 1NENA 3WAKA 2NW7A 4HFCA 3RKOA 4FJOA 2UXNB 3E22E 4HWHA 2CPTA 2ZM0A 4QXBB 5AQFB 1D1BA 4OX9T 3DTOA 5ABFB 3UQ4A 4X5TA 2DWKA 3F2EA 5F8PA 2BG9E 2X9XA 2PG8A 4EZ4A 4M1PA 2HHHT 2ACZA 3KBUA 2CXLA 5LJMA 3P50A 4L9IA 2A72A 3HR0A 4KP3C 3ZT7A 4KBMB 4IREA 5AQKB 2BG9A 4YSYA 5LMUT 5DABA 3VKHA 5LOVE 4AKGA 3AAAB 3HKDE 4UF0A 4B3TT 3PU8A 3NKZA 2QA7A 5HEOA 5FL1A 2L9QA 3EVYA 4GKKT 1HX1B 2I59A 4CXWA 4DV4T 4ZOLE 4U7YA 1VOMA 3UUXB 2LSIA 3Q5EA 2LE8A 3AXJA 3C4WA 5LNKA 4HWFA 1MNEA 5DQWA 4X64T 2V5CA 4QKNA 4PAGA 4JI6T 5JDHA 3PURA 4TWFA 2BBHA 2E5LT 3PUWF 5FY7A 3J7Yq 4JI1T 3QB5K 5HEUA 4JEUB 4HEAA 2BBJA 3L09A 3QB5A 4ILAA 5JH7E 2KINB 5AQOB 1E1HB 4QH5A 3R6NA 4CN1A 2LSGA 3AB3B 4NXMT 4TNVA 3RYFE 3P4WA 3AVSA 3ZYKA 4DV2T 2D9DA 2MOZA 4DVDA 1Z0PA 2VB6A 1HX8A 3C4XA 5FVKA 3AE1A 2MTQA 3N9NA 3EDUA 4EXTA 5ABGA 4JI3T 5JR9B 3ETVA 1ZP0A 5FXVA 4BAYB 2WMOA 1D0XA 3N5LA 3FZMB 2WQYA 1UX5A 3Q5XA 1CHUA 2H89A 3ZEFB 1IJ6A 3EAMA 2KZ7B 3KINB 4H9SE 2D5UA 3LBXB 4DR3T 1L0VA 4A56A 3OBVE 3RQUA 3LDQB 4X1KE 5LYJE 4IE4A 5LBQB 2D0TA 3ZC0A 1U4QA 4UV9B 2C0SA 4DR1T 4QX8B 2XAGB 1MNDA 1R8IA 2J4GA 1YW0A 3P4PA 3QUJA 5ABEA 1Y01A 1I6ZA 3UULA 2C5IT 5CJ5A 2E9XB 5HXCA 3ESLA 3P8CD 4Z91A 5EK2A 2WDQA 1H7CA 4GIWA 3CX8B 4UR9A 3ZT5A 2YDSA 3UUMA 3CK6A 2AE9A 1E7PA 4QXHB 2F4VT 4HFHA 4JI4T 3T1HT 3VU7H 4ZI7E 4PFOA 4AKRB 2QVAA 2V6YA 3IHRA 5LBMA 4KUMB 4A98A 4JI5T 5IWAT 2JPFA 2SPCA 5FYMA 3O1HA 4HWDA 5F5WA 4IE5A 3ETUA 2CHOA 4C90A 3MK7C 3RC3A 2A9UA 3AEFA 2I6HA 4CI1B 4CN6A 1KNZA 5IYZE 3KVBA 2XAHB 1GQEA 3KVAA 4I50E 1LRZA 5AQGB 3GN5B 4PK6A 4PJMA 2WSSV 4TV8E 2CCQA 3AA7B 3SRZA 2ODUA 3K3OA 2DI4A 4ZZCA 1XZYA 2UXBT 4K0UA 1XDOA 3AECA 5AFUL 4LF9T 4X1YE 4ERRA 4MLKA 1UUSA 2XAFB 3TKLB 2N2NA 4Z8XA 3KBTA 2OA5A 2K9AA 3ZLIA 1T8BA 2EHOD 4PJJA 4HE8A 4UVBB 3KV6A 3N2GE 4OHFA 4ZEYA 2H88A 3MKDA 3RI5A 1DU2A 2MBGA 3QOFA 2JMKA 4LMJA 3CWZB 5C3JA 3IEEA 1HF8A 2KMFA 4DR4T 3K3NA 3PUSA 3C4ZA 4CQIA 4DV7T 1N33T 3ZCIA 1KNPA 1LVKA 4ZS2A 2B1EA 2XTLA 4KHPT 2JRKA 3F57A 3VRBA 3O1IA 1IBLT 2BKPA 3NWIA 1T7SA 3ZT6A 4NUUA 3HKBE 3HKEE 3OPCA 5A1LA 2NW8A 3PUYF 2IDOB 1WYCA 1M7KA 2LT3A 4QH4A 3FXEB 1NAFA 3MA9A 3E08A 4JUYA 1US7B 1IZNB 3AEBA 3GN5A 2ZLYA 2CXFA 2OLTA 1SE7A 4BJMA 4AKLA 2R6GF 2E5VA 3RC8A 5LJNA 4NXNT 3ZPOA 3AE7A 2WWVA 4KMCA 3PV0F 4EAHA 4P1NA 2W2UA 4HTEA 3LG7A 2FUPA 3FZHB 3TLWA 5FP3A 3RF1A 1HG5A 3VR9A 1XDPA 2C5KT 3RX6A 3EUHA 4KX6A 3FBLA 3UQ7A 5AQIB 5GONE 4QX7B 1ZV4X 2YEVC 4O4IE 3RH3A 2CLYB 4TV9E 4UXNB 3WI3A 2XQ3A 4IE7A 5L4EA 4U3CA 4AISA 2CBJA 1XWMA 1NWMX 2JQ9A 4X1IE 5HYAA 3F31A 3LK42 2V7KA 5EZYE 3ONLC 5LP6E 4HFEA 5JR9C 4DMWA 2VVSA 2CBIA 4IDQA 1MIVA 4K0KT 2VVNA 2XM1A 1HNZT 2AXDS 2W66A 1VRBA 3UFGA 4L5GA 2L3LA 1UCUA 4PNIA 1MMNA 4U2YA 3NVOA 4IL4A 1I94T 1J1JA 1FMWA 4QH1A 4LF7T 4HWIB 4ZI2C 4TX5A 4FI5A 1BR4A 4GKJT 4DUYT 3ZMUB 3O4XE 2A2FX 3FZKB 2IC6A 3UU8A 5JTGA 4B6XA 2E9XC 4IDOA 1HCIA 2NTXA 2P9BA 5AQHB 3HKCE 4HFBA 3ANWA 2FJAA 2WAUA 4U7IA 3EABA 4P0BA 2BVMA 2BS2A 5HEGA 3VKGA 2LM2A 2WY2A 5JDQA 4AI6A 2MPKA 3UU3A 5KXJA 2D0UA 3TLVA 2X68A 2CRBA 3HA4A 2ZM6T 1UGOA 4TWDA 3VR8A 1X79A 2JQQA 1M62A 1VCSA 2Q9QD 2CEAA 3MZKB 3LSVA 4U74A 4C91A 3GWHA 4CI3B 4G63A 1OEDC 5JQGE 1FEWA 5FXZA 4BJNA 1YKHB 3IF8B 5CA0E 4J2CA 4ZI3C 5LA6E 2Z6EA 3NRYA 4GOUA 4JI2T 2XZEA 4EYYR 2XY8B 3GMIA 4DV3T 4OYKA 4ZHQE 5L3BB 4H63V 3ZJ1A 5JRCB 5KDMC 2FJEA 3KV9A 5CFBA 2YU1A 3DP7A 5LHGB 4H9OC 4E7SA 2V1DB 3IA3A 5LGNB 3PUZF 2X9WA 4KHZF 2B76A 3Q9DA 4PK5A 3TLSA 2KNDA 2HH7A 1WLXA 1AJ3A 1MMAA 3H37A 3U78A 2W67A 2XM2A 5ABFA 5FY1A 1D0YA 1X9BA 4AXPA 3FB2A 2LKHA 2EHOB 4LFCT 4P0AA 4X65T 4ZZBA 5AQQB 5LG3A 2X66A 4IGUA 4MALA 2J47A 4XBFB 2LJLA 4DMVA 3RQWA 3RPUA 3A5XA 3UU4A 3N2KE 2JQKA 2FJDA 1XNRT 3CX7B 1ZEEA 2W62A 4ILCA 4LF6T 3PUXF 2LRLA 1LVFA 4UELA 2K5BB 3PUVF 2NP9A 2H3RA 3NZQA 1U5PA 2DWGA 5FMNA 2VWAA 2KXPB 2DCFA 2K3WA 3I0OA 3AE8A 5L3EB 2ODVA 5JDLA 2WP9A 4YFSA 2CE7A 3ONXA 4GK0E 5FY0A 2VL0A 1ZOYA 4U2ZA 1UK5A 1XNQT 4H9QC 2UUAT 1T72A 4OFZA 2XAQB 3C51A 2LHRA 4PK4A 2ACXA 2V8SV 2HPLA 5JRCA 4YY3T 4UEMA 3T1YT 3PE0A 2QRXA 3CMLA 3JC6D 4F6RC 3OVUA 4JI0T 3ZMZB 4DV1T 3HL6A 2H7VC 4JI7T 5LGTB 4YJ3E 4YT0A 4OK0A 3N9LA 5HXSA 1D0ZA 3C98B 3BQKA 2XQAA 2IAKA 1FIOA 2LHNA 3UU6A 2WBLA 3AEGA 2WU2A 1OEDB 2PFVA 3KV4A 5AQUB 2CLYC 2WS3A 4TZ4C 1HS7A 2VKJA 2UUBT 2X0LB 5JR9A 3D0TA 5H6RB 5AQTB 2LSKA 3E0ZA 4QHOA 3BQLA 3EDVA 4E7ZA 2X67A 3HI2A 3M65A 5C8YE 4YTPA 1QLBA 1O3XA 4QWNB 3LBXA 4YSZA 3PU3A 3ZMSB 4PW8A 4IDNA 1W09A 1S94A 2VASA 1YD8G 4U33A 4ILUA 2MAWA 4ASKA 3P4QA 3AE5A 5H6QB 3VHLA 1EZ3A 3RIAA 2X9HA 3EI0A 1YKEB 5J0ZA 3UUNA 4WBOA 2YDRA 2E9XA 1BR0A 2H7OA 2KLQA 3ZYMA 2CXDA 5BR8T 1CUNA 2WWUA 3C64A 4WNKA 4O4JE 2XQ4A 4IL9A 2IMLA 1B7TA 3CQGB 4B3ST 1JNRA 2YU2A 4DV6T 2YINA 4UIGA 4NIQA 3DJBA 3FZLB 3RIUC 2XAJB 2K48A 1OXZA 4TN7B 3I0QA 3N9MA 3G06A 2QYWA 2LOPA 2KWIB 1OEDE 2ZMAA 3VRAA 3LFMA 3AAIA 4CZZB 4AKIA 3CX6B 2BVLA 4DUZT 1OEDA 1WFDA 2DHRA 2IUBA 2Q9QB 3N2OA 2CWOA 3L8RA 4IE6A 1MMGA 2RP4A 2XQ6A 3AE6A 4WZXA 2XQ5A 4CN4A 3B13A 1J5ET 5E0OA 2UXXB 2M67A 5AQNB 4Z90A 5LB7B 4IDZA 1XMQT 3JCFA 4DO0A 2JIWA 3RGLA 1KEYA 5L2LA 4ZXLA 3CQCB 5JDNA 3BK9A 2UXDT 3A7MA 4JI8T 3H3MA 3M3ZB 5J2TE 2XSBA 4V1Av 5LHHB 4LMLA 3AE9A 5HEHA 3PJAA 2HN2A 2XUEA 4O8SA 1E2AA 5AQMB 2XSAA 5ETWA 1QSDA 4LF4T 3N9QA 4H9PC 3AE3A 4X62T 3K1SA 2X0YA 3Q5WA 1IJ5A 1Y64B 1KFYA 2UU9T 5IUXA 4YSXA 2LSYA 2PJQA 4EB6E 3X1DA 3AA1B 2EHOC 3NRXA 2VKDA 3H3AA 3P4SA 4IT4A 2Y6XA 4L0RA 1BR1A 1ZHCA 4PFPA 1G8XA 2GK9A 3O9XA 3Q5DA 1KNRA 5ABHA 5JDFA 2XHEB 4NPPA 2J1DG 5FNVE 4IE0A 3ZN0B 2L8KA 4AKHA 2N9DA 3OYXA 4HGAA 4GYRA 4X66T 4JYAT 4GYSA 3AE2A 1QUUA 2LSJA 2YDQA 3I9YA 5DQVA 5JVDE 3RYCE 5HCMA 2LM9A 2PTFA 3K3QC 3MACA 4I4TE 4XZCA 4TNWA 3A8YC 1HNXT 4CXYA 1HG2A 5HWXA 4KI0F 4YTNA 1YQ3A 2WDVA 2W61A 4HN9A 3OKQA 3SWHA 5DJQC 2LOSA 4H9RC 4LMKA 2OV9A 2E8IA 4IIJE 1S35A 4QXCB 2VK9A 5FXWA 1SA0E 4DR6T 5EK4A 4TWHA 5CA1E 2DLRA 4O2BE 3ZMTB 3RYHE 1YXRA 3I9WA 2LLYA 4YHJA 2YOEA 3ABVA 1ZKEA 5KX5E 5HWYA 2V26A 3J9X1 4JV5T 1LKXA 1HR0T 3RHWA 4DR5T 1BR2A 1SHZC 2XQ9A 3AA6B 3AE4A 2RPAA 2X51A 2NR4A 2CMRA 3ZKRA 5HEJA 2VQFT 2YN6A 3AA0B 3TLUA 2KSRA 2V5DA 2LKGA 4MHCA 5L47A 3WAJA 1WRDA 3SS1A 4ADZA 3RKGA 1N36T 2CM0A 4EGWA 2JJ9A 3FBZA 5HXHA 5FKYA 4O4LE 3QK6A 5M4YA 5LXTE 2NWBA 1D1AA 3UU5A 2W00A 3PJAJ 3LK3B 4I43B 3FHNA 3S4UA 2CWYA 2YKSA 5AQSB 3V5SA 3CIRA 4WYVA 2XQYA 3RRWA 2W0GA 1D1CA 4DBQA 4MFRA 5ADXL 2YK0A 5HCJA 4AQFC 3RIUA 2V7JA 1N32T 1IBMT 2V6YB 3KV5A 4JBWF 2ES0A 2J62A 4GK5E 4CXXA 1W0BA 5C2TA 3MXZA 5J2UE 3U3IA 2WDRA 5AQVB 3ZN1B 1JNZA 2KWHA 4HFIA 4B3RT 3PUQA 2RA1A 2LEHA 5L3FB 4TUYE 3ZJ2A 3RYIE 2XQ8A 4IHJE 2I0MA 2JQHA 4COFA 4WW0A 1T98A 4XAXB 2BKNA 2XJ7A 5AQLB 2K24A 1WYBA 4YLHA 4PJLA 3RLFF 2WZHA 3KDSE 5CB4E 4EOZB 2Q9QC 4F8HA 4P09A 4NUVA 2FBWA 4EZHA 2W63A 2M6BA 1UX4A 2DL1A 2VQET 2V6XA 5LHIB 2WM9A 1HFAA 1MIYA 3ZCJA 3JADA 3JAEA 1WR0A 4U72A 4DBRA 2VKOA 2XQ7A 4JEHB 5F3JA 5JREA 3SFDA 2BZBA 1MIWA 3NZPA 2N1GA 4HFDA 3PTRB 2IHR1 2V7MA 1WCRA 5LMNT 3QC9A 4H9NC 3B57A 5KMGP 3C50A 4MBQA 1NEKA 4ILBA 4UV8B 2QGSA 4ISTA 2EHOA 2G0UA 4Q25A 5LGUB 3TLTA 4IDPA 2VL8A 4LFAT 3AEDA 4DV5T 2WZIA 2CA5A 3T8OA 5HAXA 4WBNE 3K8PC 2BDEA 5BMVE 2BG9C 3AEEA 3RRCA 3UT5E 2ZM8A 5FL0A 2HPJA 3CVRA 3BQIA 2LRKA 2WU5A 3CPZA 4ISSA 4G2AA 1IAPA 1V9DA 4EIWA 2WB5A 4O2AE 3V5UA 1Z8UA 3L3PA 4EEBA 4HKAA 2WMNA 4OYJA 3KFWX 5HXRA 4X20E 4DR7T 3ZMVB 3CQXC 4EV6A 4LF5T 3ZSSA 2NOXA 4CI2B 3AVRA 5AQPB 3AEAA 2C5JA 3CKDA 5L4HA 1HTJF 2Y48B 2HN1A 2XPKA 4DNDA 3SFEA 4DR2T 2CHNA 4EEDA 2VKHA 4HFVA 1KF6A 5JDMA 3OTOT 3QNUA 2V7IA 2IW5B 3O1JA 4YHHT 2IC9A 5FXXA 3IBPA 4YJ2E 2E2AA 3UTKA 4O4HE 3UUBA 2Y8DA 2NW9A 5LCYA 4PJNA 3P7IA 2WCAA 1KK7A 3N9OA 3OYZA 4LF8T 2D2SA 5L3GB 3JC6C 2NTYA 4ZS3A 5FVLA 2PBIA 5J1GA 1MMDA 4ANJA 2X9YA 4DIDB 3PDYA 4HWCA 4B3MT 3P4RA 4I0UA 5JDGA 1WR6A 4DV0T 5EK3A 1G73A 4ZI2D 1OWAA 3SOLA 4UVCB 3RIFA 2UUCT 1W9RA 3PUAA 4YXDA 3UFEA 1FMVA 2VURA 5IHYA 2IIUA 4I55E 2E9XD 4EYUA 3EHZA 1N34T 3GA8A 3ONJA 5AQRB 3FZFB 3NBXX 3L39A 5TAOA 3MJXA 1XMOT 3PUGA 2JMHA 3W15B 2MYSA 5L3DB 2W4XA 2FJBA 4AQYT 4AQFA 3ANWB 1SUMB 4UVAB 5HXEA 2ZM2A 2BS4A 3R84B 4U31A 5CGMA 4BA9A 3LJCA 3N9PA 3LK2B 2BKOA 2A3DA 3ZYLA 1FJGT 2BG9B 4AIUA 3JAFA 1W0AA 4UF0B 2XASB 3FXDB 1YQ4A 4JLEA 1HNWT 3Q2MA 3AAEB 4ZI3D 4A5XA 2X0HA 2DNXA 1J5WA 1IBKT 1UURA 4N78D 2KT9A 5AQJB
chains in the Genus database with same CATH topology
4JI8T 1HNXT 4DV7T 4GKKT 1N33T 4JI0T 4DV4T 5BR8T 2VQET 4DV1T 2UUCT 4KHPT 4LFCT 4JI7T 4X65T 1IBLT 4DR7T 4LFBT 2UXCT 2ZM6T 4DR3T 4B3ST 4LF5T 4LF4T 4X62T 4DV6T 4X64T 1N34T 4JI6T 4DR6T 1XNRT 2E5LT 4DR2T 2UU9T 4DR1T 1XMOT 4JI1T 2UUBT 5LMNT 4LF6T 3OTOT 4K0KT 1HNZT 1N32T 1IBMT 4AQYT 4YHHT 2UXBT 4DUZT 4JV5T 1HR0T 4JI2T 4NXNT 4LF9T 4DR5T 4OX9T 4LFAT 4DV5T 1I94T 4DV3T 1FJGT 4B3RT 4LF8T 4LF7T 4NXMT 2F4VT 4GKJT 4X66T 2VQFT 4JYAT 4DUYT 4JI4T 4DV2T 3T1HT 2HHHT 1XNQT 1J5ET 1HNWT 2UUAT 5LMUT 4B3MT 1XMQT 4B3TT 5IWAT 4JI5T 4JI3T 4DR4T 4YY3T 1IBKT 1N36T 4DV0T 3T1YT 2UXDT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 T;  1HNX T;  4DV7 T;  4GKK T;  1N33 T;  4JI0 T;  4DV4 T;  5BR8 T;  2VQE T;  4DV1 T;  2UUC T;  4KHP T;  4LFC T;  4JI7 T;  4X65 T;  1IBL T;  4DR7 T;  4LFB T;  2UXC T;  2ZM6 T;  4DR3 T;  4B3S T;  4LF5 T;  4LF4 T;  4X62 T;  4DV6 T;  4X64 T;  1N34 T;  4JI6 T;  4DR6 T;  1XNR T;  2E5L T;  4DR2 T;  2UU9 T;  4DR1 T;  1XMO T;  4JI1 T;  2UUB T;  5LMN T;  4LF6 T;  3OTO T;  4K0K T;  1HNZ T;  1N32 T;  1IBM T;  4AQY T;  4YHH T;  2UXB T;  4DUZ T;  4JV5 T;  1HR0 T;  4JI2 T;  4NXN T;  4LF9 T;  4DR5 T;  4OX9 T;  4LFA T;  4DV5 T;  1I94 T;  4DV3 T;  1FJG T;  4B3R T;  4LF8 T;  4LF7 T;  4NXM T;  2F4V T;  4GKJ T;  4X66 T;  2VQF T;  4JYA T;  4DUY T;  4JI4 T;  4DV2 T;  3T1H T;  2HHH T;  1XNQ T;  1J5E T;  1HNW T;  2UUA T;  5LMU T;  4B3M T;  1XMQ T;  4B3T T;  5IWA T;  4JI5 T;  4JI3 T;  4DR4 T;  4YY3 T;  1IBK T;  1N36 T;  4DV0 T;  3T1Y T;  2UXD T; 
#chains in the Genus database with same CATH topology
 3AXJ B;  2BS3 A;  1VCT A;  5L3C B;  2Q9Q A;  4YTM A;  3B5M A;  4AQG A;  5LG4 A;  3OJA A;  2M6I A;  3ZC1 A;  3ZST A;  2UXC T;  2V7L A;  4LFB T;  4H63 H;  3I1A A;  4A97 A;  1NEN A;  3WAK A;  2NW7 A;  4HFC A;  3RKO A;  4FJO A;  2UXN B;  3E22 E;  4HWH A;  2CPT A;  2ZM0 A;  4QXB B;  5AQF B;  1D1B A;  4OX9 T;  3DTO A;  5ABF B;  3UQ4 A;  4X5T A;  2DWK A;  3F2E A;  5F8P A;  2BG9 E;  2X9X A;  2PG8 A;  4EZ4 A;  4M1P A;  2HHH T;  2ACZ A;  3KBU A;  2CXL A;  5LJM A;  3P50 A;  4L9I A;  2A72 A;  3HR0 A;  4KP3 C;  3ZT7 A;  4KBM B;  4IRE A;  5AQK B;  2BG9 A;  4YSY A;  5LMU T;  5DAB A;  3VKH A;  5LOV E;  4AKG A;  3AAA B;  3HKD E;  4UF0 A;  4B3T T;  3PU8 A;  3NKZ A;  2QA7 A;  5HEO A;  5FL1 A;  2L9Q A;  3EVY A;  4GKK T;  1HX1 B;  2I59 A;  4CXW A;  4DV4 T;  4ZOL E;  4U7Y A;  1VOM A;  3UUX B;  2LSI A;  3Q5E A;  2LE8 A;  3AXJ A;  3C4W A;  5LNK A;  4HWF A;  1MNE A;  5DQW A;  4X64 T;  2V5C A;  4QKN A;  4PAG A;  4JI6 T;  5JDH A;  3PUR A;  4TWF A;  2BBH A;  2E5L T;  3PUW F;  5FY7 A;  3J7Y q;  4JI1 T;  3QB5 K;  5HEU A;  4JEU B;  4HEA A;  2BBJ A;  3L09 A;  3QB5 A;  4ILA A;  5JH7 E;  2KIN B;  5AQO B;  1E1H B;  4QH5 A;  3R6N A;  4CN1 A;  2LSG A;  3AB3 B;  4NXM T;  4TNV A;  3RYF E;  3P4W A;  3AVS A;  3ZYK A;  4DV2 T;  2D9D A;  2MOZ A;  4DVD A;  1Z0P A;  2VB6 A;  1HX8 A;  3C4X A;  5FVK A;  3AE1 A;  2MTQ A;  3N9N A;  3EDU A;  4EXT A;  5ABG A;  4JI3 T;  5JR9 B;  3ETV A;  1ZP0 A;  5FXV A;  4BAY B;  2WMO A;  1D0X A;  3N5L A;  3FZM B;  2WQY A;  1UX5 A;  3Q5X A;  1CHU A;  2H89 A;  3ZEF B;  1IJ6 A;  3EAM A;  2KZ7 B;  3KIN B;  4H9S E;  2D5U A;  3LBX B;  4DR3 T;  1L0V A;  4A56 A;  3OBV E;  3RQU A;  3LDQ B;  4X1K E;  5LYJ E;  4IE4 A;  5LBQ B;  2D0T A;  3ZC0 A;  1U4Q A;  4UV9 B;  2C0S A;  4DR1 T;  4QX8 B;  2XAG B;  1MND A;  1R8I A;  2J4G A;  1YW0 A;  3P4P A;  3QUJ A;  5ABE A;  1Y01 A;  1I6Z A;  3UUL A;  2C5I T;  5CJ5 A;  2E9X B;  5HXC A;  3ESL A;  3P8C D;  4Z91 A;  5EK2 A;  2WDQ A;  1H7C A;  4GIW A;  3CX8 B;  4UR9 A;  3ZT5 A;  2YDS A;  3UUM A;  3CK6 A;  2AE9 A;  1E7P A;  4QXH B;  2F4V T;  4HFH A;  4JI4 T;  3T1H T;  3VU7 H;  4ZI7 E;  4PFO A;  4AKR B;  2QVA A;  2V6Y A;  3IHR A;  5LBM A;  4KUM B;  4A98 A;  4JI5 T;  5IWA T;  2JPF A;  2SPC A;  5FYM A;  3O1H A;  4HWD A;  5F5W A;  4IE5 A;  3ETU A;  2CHO A;  4C90 A;  3MK7 C;  3RC3 A;  2A9U A;  3AEF A;  2I6H A;  4CI1 B;  4CN6 A;  1KNZ A;  5IYZ E;  3KVB A;  2XAH B;  1GQE A;  3KVA A;  4I50 E;  1LRZ A;  5AQG B;  3GN5 B;  4PK6 A;  4PJM A;  2WSS V;  4TV8 E;  2CCQ A;  3AA7 B;  3SRZ A;  2ODU A;  3K3O A;  2DI4 A;  4ZZC A;  1XZY A;  2UXB T;  4K0U A;  1XDO A;  3AEC A;  5AFU L;  4LF9 T;  4X1Y E;  4ERR A;  4MLK A;  1UUS A;  2XAF B;  3TKL B;  2N2N A;  4Z8X A;  3KBT A;  2OA5 A;  2K9A A;  3ZLI A;  1T8B A;  2EHO D;  4PJJ A;  4HE8 A;  4UVB B;  3KV6 A;  3N2G E;  4OHF A;  4ZEY A;  2H88 A;  3MKD A;  3RI5 A;  1DU2 A;  2MBG A;  3QOF A;  2JMK A;  4LMJ A;  3CWZ B;  5C3J A;  3IEE A;  1HF8 A;  2KMF A;  4DR4 T;  3K3N A;  3PUS A;  3C4Z A;  4CQI A;  4DV7 T;  1N33 T;  3ZCI A;  1KNP A;  1LVK A;  4ZS2 A;  2B1E A;  2XTL A;  4KHP T;  2JRK A;  3F57 A;  3VRB A;  3O1I A;  1IBL T;  2BKP A;  3NWI A;  1T7S A;  3ZT6 A;  4NUU A;  3HKB E;  3HKE E;  3OPC A;  5A1L A;  2NW8 A;  3PUY F;  2IDO B;  1WYC A;  1M7K A;  2LT3 A;  4QH4 A;  3FXE B;  1NAF A;  3MA9 A;  3E08 A;  4JUY A;  1US7 B;  1IZN B;  3AEB A;  3GN5 A;  2ZLY A;  2CXF A;  2OLT A;  1SE7 A;  4BJM A;  4AKL A;  2R6G F;  2E5V A;  3RC8 A;  5LJN A;  4NXN T;  3ZPO A;  3AE7 A;  2WWV A;  4KMC A;  3PV0 F;  4EAH A;  4P1N A;  2W2U A;  4HTE A;  3LG7 A;  2FUP A;  3FZH B;  3TLW A;  5FP3 A;  3RF1 A;  1HG5 A;  3VR9 A;  1XDP A;  2C5K T;  3RX6 A;  3EUH A;  4KX6 A;  3FBL A;  3UQ7 A;  5AQI B;  5GON E;  4QX7 B;  1ZV4 X;  2YEV C;  4O4I E;  3RH3 A;  2CLY B;  4TV9 E;  4UXN B;  3WI3 A;  2XQ3 A;  4IE7 A;  5L4E A;  4U3C A;  4AIS A;  2CBJ A;  1XWM A;  1NWM X;  2JQ9 A;  4X1I E;  5HYA A;  3F31 A;  3LK4 2;  2V7K A;  5EZY E;  3ONL C;  5LP6 E;  4HFE A;  5JR9 C;  4DMW A;  2VVS A;  2CBI A;  4IDQ A;  1MIV A;  4K0K T;  2VVN A;  2XM1 A;  1HNZ T;  2AXD S;  2W66 A;  1VRB A;  3UFG A;  4L5G A;  2L3L A;  1UCU A;  4PNI A;  1MMN A;  4U2Y A;  3NVO A;  4IL4 A;  1I94 T;  1J1J A;  1FMW A;  4QH1 A;  4LF7 T;  4HWI B;  4ZI2 C;  4TX5 A;  4FI5 A;  1BR4 A;  4GKJ T;  4DUY T;  3ZMU B;  3O4X E;  2A2F X;  3FZK B;  2IC6 A;  3UU8 A;  5JTG A;  4B6X A;  2E9X C;  4IDO A;  1HCI A;  2NTX A;  2P9B A;  5AQH B;  3HKC E;  4HFB A;  3ANW A;  2FJA A;  2WAU A;  4U7I A;  3EAB A;  4P0B A;  2BVM A;  2BS2 A;  5HEG A;  3VKG A;  2LM2 A;  2WY2 A;  5JDQ A;  4AI6 A;  2MPK A;  3UU3 A;  5KXJ A;  2D0U A;  3TLV A;  2X68 A;  2CRB A;  3HA4 A;  2ZM6 T;  1UGO A;  4TWD A;  3VR8 A;  1X79 A;  2JQQ A;  1M62 A;  1VCS A;  2Q9Q D;  2CEA A;  3MZK B;  3LSV A;  4U74 A;  4C91 A;  3GWH A;  4CI3 B;  4G63 A;  1OED C;  5JQG E;  1FEW A;  5FXZ A;  4BJN A;  1YKH B;  3IF8 B;  5CA0 E;  4J2C A;  4ZI3 C;  5LA6 E;  2Z6E A;  3NRY A;  4GOU A;  4JI2 T;  2XZE A;  4EYY R;  2XY8 B;  3GMI A;  4DV3 T;  4OYK A;  4ZHQ E;  5L3B B;  4H63 V;  3ZJ1 A;  5JRC B;  5KDM C;  2FJE A;  3KV9 A;  5CFB A;  2YU1 A;  3DP7 A;  5LHG B;  4H9O C;  4E7S A;  2V1D B;  3IA3 A;  5LGN B;  3PUZ F;  2X9W A;  4KHZ F;  2B76 A;  3Q9D A;  4PK5 A;  3TLS A;  2KND A;  2HH7 A;  1WLX A;  1AJ3 A;  1MMA A;  3H37 A;  3U78 A;  2W67 A;  2XM2 A;  5ABF A;  5FY1 A;  1D0Y A;  1X9B A;  4AXP A;  3FB2 A;  2LKH A;  2EHO B;  4LFC T;  4P0A A;  4X65 T;  4ZZB A;  5AQQ B;  5LG3 A;  2X66 A;  4IGU A;  4MAL A;  2J47 A;  4XBF B;  2LJL A;  4DMV A;  3RQW A;  3RPU A;  3A5X A;  3UU4 A;  3N2K E;  2JQK A;  2FJD A;  1XNR T;  3CX7 B;  1ZEE A;  2W62 A;  4ILC A;  4LF6 T;  3PUX F;  2LRL A;  1LVF A;  4UEL A;  2K5B B;  3PUV F;  2NP9 A;  2H3R A;  3NZQ A;  1U5P A;  2DWG A;  5FMN A;  2VWA A;  2KXP B;  2DCF A;  2K3W A;  3I0O A;  3AE8 A;  5L3E B;  2ODV A;  5JDL A;  2WP9 A;  4YFS A;  2CE7 A;  3ONX A;  4GK0 E;  5FY0 A;  2VL0 A;  1ZOY A;  4U2Z A;  1UK5 A;  1XNQ T;  4H9Q C;  2UUA T;  1T72 A;  4OFZ A;  2XAQ B;  3C51 A;  2LHR A;  4PK4 A;  2ACX A;  2V8S V;  2HPL A;  5JRC A;  4YY3 T;  4UEM A;  3T1Y T;  3PE0 A;  2QRX A;  3CML A;  3JC6 D;  4F6R C;  3OVU A;  4JI0 T;  3ZMZ B;  4DV1 T;  3HL6 A;  2H7V C;  4JI7 T;  5LGT B;  4YJ3 E;  4YT0 A;  4OK0 A;  3N9L A;  5HXS A;  1D0Z A;  3C98 B;  3BQK A;  2XQA A;  2IAK A;  1FIO A;  2LHN A;  3UU6 A;  2WBL A;  3AEG A;  2WU2 A;  1OED B;  2PFV A;  3KV4 A;  5AQU B;  2CLY C;  2WS3 A;  4TZ4 C;  1HS7 A;  2VKJ A;  2UUB T;  2X0L B;  5JR9 A;  3D0T A;  5H6R B;  5AQT B;  2LSK A;  3E0Z A;  4QHO A;  3BQL A;  3EDV A;  4E7Z A;  2X67 A;  3HI2 A;  3M65 A;  5C8Y E;  4YTP A;  1QLB A;  1O3X A;  4QWN B;  3LBX A;  4YSZ A;  3PU3 A;  3ZMS B;  4PW8 A;  4IDN A;  1W09 A;  1S94 A;  2VAS A;  1YD8 G;  4U33 A;  4ILU A;  2MAW A;  4ASK A;  3P4Q A;  3AE5 A;  5H6Q B;  3VHL A;  1EZ3 A;  3RIA A;  2X9H A;  3EI0 A;  1YKE B;  5J0Z A;  3UUN A;  4WBO A;  2YDR A;  2E9X A;  1BR0 A;  2H7O A;  2KLQ A;  3ZYM A;  2CXD A;  5BR8 T;  1CUN A;  2WWU A;  3C64 A;  4WNK A;  4O4J E;  2XQ4 A;  4IL9 A;  2IML A;  1B7T A;  3CQG B;  4B3S T;  1JNR A;  2YU2 A;  4DV6 T;  2YIN A;  4UIG A;  4NIQ A;  3DJB A;  3FZL B;  3RIU C;  2XAJ B;  2K48 A;  1OXZ A;  4TN7 B;  3I0Q A;  3N9M A;  3G06 A;  2QYW A;  2LOP A;  2KWI B;  1OED E;  2ZMA A;  3VRA A;  3LFM A;  3AAI A;  4CZZ B;  4AKI A;  3CX6 B;  2BVL A;  4DUZ T;  1OED A;  1WFD A;  2DHR A;  2IUB A;  2Q9Q B;  3N2O A;  2CWO A;  3L8R A;  4IE6 A;  1MMG A;  2RP4 A;  2XQ6 A;  3AE6 A;  4WZX A;  2XQ5 A;  4CN4 A;  3B13 A;  1J5E T;  5E0O A;  2UXX B;  2M67 A;  5AQN B;  4Z90 A;  5LB7 B;  4IDZ A;  1XMQ T;  3JCF A;  4DO0 A;  2JIW A;  3RGL A;  1KEY A;  5L2L A;  4ZXL A;  3CQC B;  5JDN A;  3BK9 A;  2UXD T;  3A7M A;  4JI8 T;  3H3M A;  3M3Z B;  5J2T E;  2XSB A;  4V1A v;  5LHH B;  4LML A;  3AE9 A;  5HEH A;  3PJA A;  2HN2 A;  2XUE A;  4O8S A;  1E2A A;  5AQM B;  2XSA A;  5ETW A;  1QSD A;  4LF4 T;  3N9Q A;  4H9P C;  3AE3 A;  4X62 T;  3K1S A;  2X0Y A;  3Q5W A;  1IJ5 A;  1Y64 B;  1KFY A;  2UU9 T;  5IUX A;  4YSX A;  2LSY A;  2PJQ A;  4EB6 E;  3X1D A;  3AA1 B;  2EHO C;  3NRX A;  2VKD A;  3H3A A;  3P4S A;  4IT4 A;  2Y6X A;  4L0R A;  1BR1 A;  1ZHC A;  4PFP A;  1G8X A;  2GK9 A;  3O9X A;  3Q5D A;  1KNR A;  5ABH A;  5JDF A;  2XHE B;  4NPP A;  2J1D G;  5FNV E;  4IE0 A;  3ZN0 B;  2L8K A;  4AKH A;  2N9D A;  3OYX A;  4HGA A;  4GYR A;  4X66 T;  4JYA T;  4GYS A;  3AE2 A;  1QUU A;  2LSJ A;  2YDQ A;  3I9Y A;  5DQV A;  5JVD E;  3RYC E;  5HCM A;  2LM9 A;  2PTF A;  3K3Q C;  3MAC A;  4I4T E;  4XZC A;  4TNW A;  3A8Y C;  1HNX T;  4CXY A;  1HG2 A;  5HWX A;  4KI0 F;  4YTN A;  1YQ3 A;  2WDV A;  2W61 A;  4HN9 A;  3OKQ A;  3SWH A;  5DJQ C;  2LOS A;  4H9R C;  4LMK A;  2OV9 A;  2E8I A;  4IIJ E;  1S35 A;  4QXC B;  2VK9 A;  5FXW A;  1SA0 E;  4DR6 T;  5EK4 A;  4TWH A;  5CA1 E;  2DLR A;  4O2B E;  3ZMT B;  3RYH E;  1YXR A;  3I9W A;  2LLY A;  4YHJ A;  2YOE A;  3ABV A;  1ZKE A;  5KX5 E;  5HWY A;  2V26 A;  3J9X 1;  4JV5 T;  1LKX A;  1HR0 T;  3RHW A;  4DR5 T;  1BR2 A;  1SHZ C;  2XQ9 A;  3AA6 B;  3AE4 A;  2RPA A;  2X51 A;  2NR4 A;  2CMR A;  3ZKR A;  5HEJ A;  2VQF T;  2YN6 A;  3AA0 B;  3TLU A;  2KSR A;  2V5D A;  2LKG A;  4MHC A;  5L47 A;  3WAJ A;  1WRD A;  3SS1 A;  4ADZ A;  3RKG A;  1N36 T;  2CM0 A;  4EGW A;  2JJ9 A;  3FBZ A;  5HXH A;  5FKY A;  4O4L E;  3QK6 A;  5M4Y A;  5LXT E;  2NWB A;  1D1A A;  3UU5 A;  2W00 A;  3PJA J;  3LK3 B;  4I43 B;  3FHN A;  3S4U A;  2CWY A;  2YKS A;  5AQS B;  3V5S A;  3CIR A;  4WYV A;  2XQY A;  3RRW A;  2W0G A;  1D1C A;  4DBQ A;  4MFR A;  5ADX L;  2YK0 A;  5HCJ A;  4AQF C;  3RIU A;  2V7J A;  1N32 T;  1IBM T;  2V6Y B;  3KV5 A;  4JBW F;  2ES0 A;  2J62 A;  4GK5 E;  4CXX A;  1W0B A;  5C2T A;  3MXZ A;  5J2U E;  3U3I A;  2WDR A;  5AQV B;  3ZN1 B;  1JNZ A;  2KWH A;  4HFI A;  4B3R T;  3PUQ A;  2RA1 A;  2LEH A;  5L3F B;  4TUY E;  3ZJ2 A;  3RYI E;  2XQ8 A;  4IHJ E;  2I0M A;  2JQH A;  4COF A;  4WW0 A;  1T98 A;  4XAX B;  2BKN A;  2XJ7 A;  5AQL B;  2K24 A;  1WYB A;  4YLH A;  4PJL A;  3RLF F;  2WZH A;  3KDS E;  5CB4 E;  4EOZ B;  2Q9Q C;  4F8H A;  4P09 A;  4NUV A;  2FBW A;  4EZH A;  2W63 A;  2M6B A;  1UX4 A;  2DL1 A;  2VQE T;  2V6X A;  5LHI B;  2WM9 A;  1HFA A;  1MIY A;  3ZCJ A;  3JAD A;  3JAE A;  1WR0 A;  4U72 A;  4DBR A;  2VKO A;  2XQ7 A;  4JEH B;  5F3J A;  5JRE A;  3SFD A;  2BZB A;  1MIW A;  3NZP A;  2N1G A;  4HFD A;  3PTR B;  2IHR 1;  2V7M A;  1WCR A;  5LMN T;  3QC9 A;  4H9N C;  3B57 A;  5KMG P;  3C50 A;  4MBQ A;  1NEK A;  4ILB A;  4UV8 B;  2QGS A;  4IST A;  2EHO A;  2G0U A;  4Q25 A;  5LGU B;  3TLT A;  4IDP A;  2VL8 A;  4LFA T;  3AED A;  4DV5 T;  2WZI A;  2CA5 A;  3T8O A;  5HAX A;  4WBN E;  3K8P C;  2BDE A;  5BMV E;  2BG9 C;  3AEE A;  3RRC A;  3UT5 E;  2ZM8 A;  5FL0 A;  2HPJ A;  3CVR A;  3BQI A;  2LRK A;  2WU5 A;  3CPZ A;  4ISS A;  4G2A A;  1IAP A;  1V9D A;  4EIW A;  2WB5 A;  4O2A E;  3V5U A;  1Z8U A;  3L3P A;  4EEB A;  4HKA A;  2WMN A;  4OYJ A;  3KFW X;  5HXR A;  4X20 E;  4DR7 T;  3ZMV B;  3CQX C;  4EV6 A;  4LF5 T;  3ZSS A;  2NOX A;  4CI2 B;  3AVR A;  5AQP B;  3AEA A;  2C5J A;  3CKD A;  5L4H A;  1HTJ F;  2Y48 B;  2HN1 A;  2XPK A;  4DND A;  3SFE A;  4DR2 T;  2CHN A;  4EED A;  2VKH A;  4HFV A;  1KF6 A;  5JDM A;  3OTO T;  3QNU A;  2V7I A;  2IW5 B;  3O1J A;  4YHH T;  2IC9 A;  5FXX A;  3IBP A;  4YJ2 E;  2E2A A;  3UTK A;  4O4H E;  3UUB A;  2Y8D A;  2NW9 A;  5LCY A;  4PJN A;  3P7I A;  2WCA A;  1KK7 A;  3N9O A;  3OYZ A;  4LF8 T;  2D2S A;  5L3G B;  3JC6 C;  2NTY A;  4ZS3 A;  5FVL A;  2PBI A;  5J1G A;  1MMD A;  4ANJ A;  2X9Y A;  4DID B;  3PDY A;  4HWC A;  4B3M T;  3P4R A;  4I0U A;  5JDG A;  1WR6 A;  4DV0 T;  5EK3 A;  1G73 A;  4ZI2 D;  1OWA A;  3SOL A;  4UVC B;  3RIF A;  2UUC T;  1W9R A;  3PUA A;  4YXD A;  3UFE A;  1FMV A;  2VUR A;  5IHY A;  2IIU A;  4I55 E;  2E9X D;  4EYU A;  3EHZ A;  1N34 T;  3GA8 A;  3ONJ A;  5AQR B;  3FZF B;  3NBX X;  3L39 A;  5TAO A;  3MJX A;  1XMO T;  3PUG A;  2JMH A;  3W15 B;  2MYS A;  5L3D B;  2W4X A;  2FJB A;  4AQY T;  4AQF A;  3ANW B;  1SUM B;  4UVA B;  5HXE A;  2ZM2 A;  2BS4 A;  3R84 B;  4U31 A;  5CGM A;  4BA9 A;  3LJC A;  3N9P A;  3LK2 B;  2BKO A;  2A3D A;  3ZYL A;  1FJG T;  2BG9 B;  4AIU A;  3JAF A;  1W0A A;  4UF0 B;  2XAS B;  3FXD B;  1YQ4 A;  4JLE A;  1HNW T;  3Q2M A;  3AAE B;  4ZI3 D;  4A5X A;  2X0H A;  2DNX A;  1J5W A;  1IBK T;  1UUR A;  4N78 D;  2KT9 A;  5AQJ B; 
#chains in the Genus database with same CATH homology
 4JI8 T;  1HNX T;  4DV7 T;  4GKK T;  1N33 T;  4JI0 T;  4DV4 T;  5BR8 T;  2VQE T;  4DV1 T;  2UUC T;  4KHP T;  4LFC T;  4JI7 T;  4X65 T;  1IBL T;  4DR7 T;  4LFB T;  2UXC T;  2ZM6 T;  4DR3 T;  4B3S T;  4LF5 T;  4LF4 T;  4X62 T;  4DV6 T;  4X64 T;  1N34 T;  4JI6 T;  4DR6 T;  1XNR T;  2E5L T;  4DR2 T;  2UU9 T;  4DR1 T;  1XMO T;  4JI1 T;  2UUB T;  5LMN T;  4LF6 T;  3OTO T;  4K0K T;  1HNZ T;  1N32 T;  1IBM T;  4AQY T;  4YHH T;  2UXB T;  4DUZ T;  4JV5 T;  1HR0 T;  4JI2 T;  4NXN T;  4LF9 T;  4DR5 T;  4OX9 T;  4LFA T;  4DV5 T;  1I94 T;  4DV3 T;  1FJG T;  4B3R T;  4LF8 T;  4LF7 T;  4NXM T;  2F4V T;  4GKJ T;  4X66 T;  2VQF T;  4JYA T;  4DUY T;  4JI4 T;  4DV2 T;  3T1H T;  2HHH T;  1XNQ T;  1J5E T;  1HNW T;  2UUA T;  5LMU T;  4B3M T;  1XMQ T;  4B3T T;  5IWA T;  4JI5 T;  4JI3 T;  4DR4 T;  4YY3 T;  1IBK T;  1N36 T;  4DV0 T;  3T1Y T;  2UXD T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...