4DR6T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr6T00
5LMNT 4DR7T 4JI6T 4DR5T 4DV0T 1N33T 4B3MT 1XMOT 4LFAT 4OX9T 4DUYT 5LMUT 2UUAT 1IBKT 4LFCT 2UXCT 4DR4T 4X66T 4JI1T 3T1YT 4GKKT 4DV4T 5BR8T 4DR6T 4DV5T 4LF5T 4LF7T 4JI3T 1N34T 4NXMT 4YHHT 4DR2T 1IBLT 1XMQT 4JI2T 4DV1T 4LF4T 2VQET 4DV6T 2UXBT 1N36T 1HNZT 4NXNT 5IWAT 4B3ST 1N32T 4DV3T 1HNXT 4JI5T 4X65T 2UUCT 2UUBT 1HNWT 2UU9T 4K0KT 4B3TT 4JI4T 3OTOT 4B3RT 4DR3T 2ZM6T 1I94T 1FJGT 1HR0T 4LF9T 4LF6T 4X62T 2UXDT 4DV7T 4YY3T 4JI7T 2HHHT 4JYAT 4JI8T 1J5ET 4KHPT 2VQFT 4GKJT 1IBMT 4JV5T 4DR1T 3T1HT 2E5LT 4LF8T 4X64T 4DUZT 1XNRT 1XNQT 4DV2T 4JI0T 4AQYT 2F4VT 4LFBT
chains in the Genus database with same CATH superfamily
1G8XA 4JI6T 1EZ3A 5JDQA 4DR5T 2VK9A 3E0ZA 3LSVA 3UU5A 5LG3A 4LFAT 3PU8A 3RKGA 3L39A 5HEGA 5IYZE 3U3IA 3RQWA 3ANWB 5FP3A 4OX9T 1J1JA 4Z90A 5LCYA 4YJ2E 5LMUT 2UUAT 4IDZA 3AEAA 4P09A 3T8OA 4DR4T 2LSYA 5GONE 3KV5A 4J2CA 3IF8B 2XHEB 2B1EA 2Q9QD 2KINB 1MMNA 3AAAB 2IDOB 2CLYB 2KSRA 2WZHA 3T1YT 4PJMA 2CE7A 3P4WA 3BQKA 3RKOA 5BR8T 4QX8B 4E7ZA 4EV6A 5JDNA 2WMOA 2ODVA 4LF7T 4ZEYA 1YD8G 1T8BA 2YDRA 3AA6B 4QKNA 5J1GA 3C4ZA 4XZCA 5F5WA 5LGNB 2BG9E 1OWAA 3PUGA 2YK0A 4MLKA 3AE2A 2GK9A 5FNVE 4UR9A 2NTYA 4U74A 1XMQT 3B5MA 2DLRA 4JI2T 3N9QA 3I9WA 2BVMA 3JC6C 3LK42 4G2AA 3IEEA 2V6YA 3SWHA 4L5GA 2NP9A 5ABFA 2FUPA 2KXPB 3OYZA 3ZLIA 3C98B 3OPCA 3HKCE 3PE0A 3SFDA 3N2GE 3ZT5A 2JIWA 2VQET 2V7KA 5KMGP 3UQ7A 4PK6A 5DQVA 2MBGA 1YXRA 1E2AA 2E9XC 3EVYA 3A8YC 4N78D 2L9QA 2L3LA 2W0GA 4O4IE 4B6XA 1S35A 3K3QC 2BKNA 2E5VA 3B13A 2H88A 3K8PC 4IIJE 4DV3T 4NUUA 4X65T 5JDGA 3MKDA 5FY1A 3ZC0A 5JQGE 2RPAA 2IHR1 2A3DA 3O1HA 3ZPOA 3RYIE 1QSDA 4QH1A 3NZPA 3RHWA 3EDUA 3VKGA 2WWUA 5LBMA 3OTOT 4DBQA 3WAKA 5L3EB 3RGLA 4DR3T 2CBIA 1LRZA 2CA5A 3PUAA 5AQHB 5JDMA 2ZM6T 4EZ4A 3CX6B 3J9X1 1NWMX 1D1BA 4O4LE 4QH4A 5FXXA 3EDVA 3PUYF 5M4YA 3SRZA 1HS7A 2WCAA 3ZC1A 1I94T 2V6XA 5KXJA 4TZ4C 2N2NA 3ZN1B 5ABGA 2CWOA 3RIUA 3ZMSB 4X1KE 2LSIA 2V7IA 3Q5WA 4HWHA 2VKHA 4HFBA 5IHYA 3ZN0B 5LNKA 3HL6A 2NWBA 4KBMB 3DP7A 4X62T 3CK6A 4AQFC 4ZI2C 1KNRA 3RLFF 1HG5A 3AE8A 1VCSA 3RIFA 1HG2A 4UF0A 1NEKA 3ZYKA 2P9BA 1MMAA 1S94A 1SUMB 2YEVC 3JAEA 2WDRA 4AKRB 2V5DA 2ZM8A 3TLSA 4H9QC 1U5PA 4L0RA 3LK2B 2JMKA 3QB5K 2ZM2A 3ZMUB 4BAYB 1QLBA 3AE7A 3TKLB 4F6RC 2XQ3A 3C64A 3ZEFB 2H3RA 2LSKA 1MIVA 1IBMT 4DR1T 4JV5T 1IZNB 3RX6A 5DABA 4WBNE 2J4GA 1OEDB 2LM9A 2ACZA 4U72A 5LBQB 3EUHA 1AJ3A 4CXXA 4X64T 2X66A 3ZMZB 2XAGB 2OV9A 3LFMA 5L3CB 2XQ6A 2XZEA 4PJLA 2V7MA 2X0LB 5HEUA 3JCFA 2L8KA 1M62A 2FJEA 2Z6EA 5AQTB 5LHIB 5LHGB 4JI0T 2N9DA 1BR0A 4ZS3A 4EEDA 3C4WA 5CGMA 3N9LA 1LKXA 1HFAA 5LMNT 4QXHB 4DR7T 1HX8A 5FL0A 4BJNA 5HXSA 1YQ3A 2YKSA 4UXNB 4QWNB 4JUYA 5CFBA 1KNZA 5JR9C 2WDQA 4PFOA 4CXYA 4HWDA 2JQKA 1KEYA 2FBWA 2CXFA 2IAKA 2V1DB 2VKJA 5EZYE 2YINA 5LA6E 5FVKA 4YSXA 2OA5A 3S4UA 1UK5A 3HI2A 4GK5E 4M1PA 2VL0A 1G73A 1XDOA 1ZHCA 3CX7B 2QA7A 4U31A 3ZJ2A 3IHRA 3N9PA 4X66T 2Y8DA 2W4XA 3PDYA 4JI1T 3ANWA 1YQ4A 3C50A 5C3JA 3AA1B 1O3XA 4Z91A 3RYCE 4HFEA 2EHOB 4WYVA 4DV4T 4X5TA 4OHFA 4A98A 2X0YA 4CN4A 4LF4T 3ETUA 3UFEA 4TN7B 3AEDA 2XQ7A 4XAXB 5H6QB 2FJBA 2LE8A 3N2OA 5AQRB 4LF5T 2W62A 2WM9A 1R8IA 2XM2A 2D0UA 2WU5A 3KBUA 4AXPA 2JPFA 2ZMAA 3GWHA 3H3MA 2DI4A 2ZM0A 4HKAA 4YHHT 4DR2T 2IUBA 4QXBB 4TWHA 5HXHA 3FBLA 4QHOA 2N1GA 2X9HA 3AXJB 4I4TE 4NIQA 4YSZA 2XSBA 4AQGA 2J1DG 2IMLA 3ONLC 4KMCA 1QUUA 2UXXB 3AE6A 2W61A 1X79A 2NR4A 3KDSE 3N9NA 4GYSA 1WR6A 2VWAA 3QK6A 4ILBA 4YJ3E 4EB6E 4UV8B 5JRCA 4Q25A 3UFGA 2NW7A 2I6HA 4H9OC 5JR9B 4JBWF 2MTQA 4IE5A 1HNZT 2KT9A 2V7LA 4O4HE 4A97A 5CJ5A 4B3ST 3I0OA 4X1IE 2RP4A 2CRBA 1Y01A 3MA9A 3ZT6A 4DVDA 5J2TE 2DHRA 3GA8A 4IDQA 2LRLA 4U3CA 1U4QA 4HE8A 2IC6A 3UT5E 4ZZCA 2UUBT 2UUCT 2UU9T 2LSJA 3FZHB 2WDVA 4IE4A 3U78A 3NRYA 1W09A 1ZKEA 2QRXA 2RA1A 3O1JA 4KI0F 5FMNA 4YLHA 4AQFA 4JI4T 1KK7A 4BJMA 2X51A 3C51A 3QC9A 5ABHA 4CZZB 3LK3B 4DNDA 2VL8A 2HPLA 3VHLA 3P4SA 3LG7A 3KFWX 4IE0A 4AKHA 3Q5DA 3IBPA 3PUVF 4H63V 2LHRA 5AQVB 3ZT7A 5HXRA 3QOFA 4CXWA 2VURA 3Q5EA 2H89A 4HEAA 4UELA 2FJAA 5CB4E 1I6ZA 4HFCA 3R6NA 3CWZB 3KBTA 3O4XE 5AQOB 4EIWA 1HR0T 3E22E 3D0TA 2WU2A 4UVCB 1WLXA 2YOEA 5KDMC 3AE5A 2C0SA 2LT3A 4FJOA 2BS3A 4PJNA 4TV9E 5FY7A 2W00A 3F31A 4JLEA 2D0TA 1FMWA 4JI7T 4ZI3C 2WQYA 4IE7A 2NOXA 1VOMA 2KWHA 3CVRA 5LGUB 2CWYA 4JYAT 3R84B 2JQ9A 1MIWA 2MPKA 4H9PC 2Y48B 3ONXA 3PURA 4NUVA 4UVAB 5HAXA 3ZMTB 4GKJT 3EAMA 1Z0PA 4YHJA 5HCMA 5HEOA 2QVAA 4O4JE 4HWFA 1LVKA 3UU3A 5ABEA 3EHZA 3PUZF 2Y6XA 4P1NA 2YU1A 1MNDA 4HFDA 2A72A 2CBJA 4I0UA 4ADZA 2KWIB 4I43B 2CPTA 2DCFA 3ZSTA 5F8PA 3DTOA 1SA0E 2CXLA 2V6YB 4O2AE 4DO0A 4DUZT 4ILUA 4LMJA 4EXTA 2M67A 4MALA 2E8IA 3TLWA 3CQCB 2CLYC 2M6BA 4TNWA 1ZEEA 4AQYT 4WW0A 3MJXA 1L0VA 3UU8A 4EZHA 5A1LA 1D1CA 3IA3A 4PJJA 1FMVA 2LOPA 3UQ4A 3VRAA 1D1AA 3OYXA 2I59A 4ILAA 2C5IT 2XSAA 5AQLB 3WI3A 4ZZBA 3AA0B 1VCTA 3RRCA 4DV0T 3QUJA 2M6IA 2XAHB 3CMLA 4ANJA 1N33T 4CI3B 1XMOT 1UURA 2R6GF 1T72A 3RI5A 4OYJA 5H6RB 3AVSA 5AQGB 4NPPA 3SS1A 3KV4A 5HXCA 4C91A 1IBKT 2X67A 3PUSA 2ACXA 4ZHQE 4MBQA 5FL1A 5FXZA 1MNEA 3ZKRA 3UUBA 1JNRA 2ODUA 2X68A 3PU3A 3GN5A 1Y64B 2PFVA 4I50E 3AE3A 3EI0A 2A2FX 4YTNA 3FZKB 5LHHB 2BKOA 3BQIA 2Q9QB 2XTLA 2E9XA 1KNPA 4TWDA 4U33A 4F8HA 5AQNB 4DV5T 2WP9A 3AB3B 4OK0A 5CA0E 2E2AA 4JI3T 1D0XA 2YU2A 2EHOA 3AVRA 4H9NC 4QH5A 3PV0F 3ZCJA 5F3JA 3QNUA 1W0BA 4IL4A 5JREA 4IDPA 1N34T 4NXMT 2LJLA 4GYRA 5L3GB 3P8CD 2XQYA 2BKPA 3RRWA 4E7SA 4YT0A 1IBLT 4U7IA 5DQWA 4P0AA 3PUXF 4ISTA 4ERRA 2CHNA 2WZIA 2CXDA 2LSGA 2AE9A 2D9DA 3WAJA 3PUQA 1SE7A 3AXJA 3FHNA 3RH3A 2BZBA 4PFPA 4IHJE 3OKQA 2PG8A 2AXDS 1N36T 2UXBT 4IDNA 2K5BB 1H7CA 3KVAA 2W63A 4OFZA 2BVLA 5TAOA 4NXNT 1BR4A 5JRCB 5EK2A 2LM2A 3B57A 5HWXA 3CKDA 3Q9DA 3NKZA 2JQHA 4UIGA 5E0OA 3FZLB 3AE1A 1HNXT 4JI5T 2BG9B 2LHNA 4O2BE 4U7YA 3JC6D 1XWMA 4HWIB 4IGUA 5AQFB 5LJNA 2E9XB 1HNWT 2B76A 4K0KT 5L2LA 4EYYR 2Q9QA 2XM1A 2HH7A 4U2YA 1KFYA 5ABFB 3P50A 4GK0E 4L9IA 2JJ9A 1D0YA 2E9XD 3ESLA 4EEBA 1T98A 5HEHA 1MMGA 2X9XA 4UV9B 2DNXA 1J5WA 3GMIA 3P4QA 5LJMA 2A9UA 2KMFA 2VB6A 3RC3A 5JTGA 3SOLA 2V8SV 2PTFA 5LGTB 3LBXA 4TX5A 5AQIB 3Q2MA 3NZQA 2NTXA 3ZJ1A 2JMHA 3VU7H 1GQEA 4JEUB 2NW8A 3VR9A 2UXNB 2KZ7B 1IJ5A 2VKDA 3N9MA 2K48A 3RQUA 2IC9A 2V5CA 4YFSA 3H37A 3HKEE 1W0AA 3RYFE 2UXDT 2G0UA 5HCJA 2BBJA 2HN2A 2QGSA 3PTRB 4DV7T 4DIDB 4O8SA 2JRKA 1FIOA 2V7JA 2H7OA 2PJQA 3UU4A 1WR0A 3UUNA 3I9YA 4AKLA 4JI8T 3MXZA 1DU2A 1J5ET 3OVUA 3P7IA 1T7SA 1OEDC 4DMVA 2OLTA 3OJAA 4KHPT 2XQ8A 3L3PA 3P4PA 3UTKA 5EK3A 4EYUA 5LYJE 3HKBE 1Z8UA 1ZP0A 3MZKB 5LB7B 5AFUL 2W2UA 2DWKA 1VRBA 3G06A 4JEHB 4X20E 5AQQB 5L3BB 2E5LT 3V5SA 4ZI2D 2BG9C 2XAFB 4WZXA 3NWIA 3OBVE 5ETWA 2WSSV 2LEHA 2LRKA 4MFRA 4LF8T 5LXTE 5J0ZA 3AEBA 3JAFA 4GOUA 4CQIA 5FY0A 4CN6A 5HXEA 4ZOLE 2KNDA 2XUEA 4IE6A 3I0QA 4MHCA 3RYHE 2XQ4A 2CCQA 3X1DA 3AEEA 2X9YA 3EABA 3SFEA 4AIUA 5HYAA 5AQKB 4IREA 1WYCA 5FYMA 4DV2T 5J2UE 2F4VT 1UX4A 5AQUB 4CI2B 2WS3A 5AQMB 4PK4A 5L3DB 2XQ9A 1XDPA 4WNKA 4ZI7E 4CI1B 3FZMB 4UF0B 2LKHA 4B3MT 3TLTA 2HPJA 1JNZA 3A5XA 5ADXL 2ZLYA 3ZYLA 1UGOA 4PK5A 1YKEB 5CA1E 4KX6A 4DUYT 4C90A 4LFCT 2UXCT 3JADA 2W66A 3AE4A 5JDFA 3L8RA 4TNVA 3LJCA 4CN1A 3AAIA 3FBZA 4QXCB 4ISSA 2CEAA 3CQXC 5BMVE 3LDQB 4I55E 3AE9A 2WWVA 1CHUA 4GKKT 3I1AA 3PUWF 4X1YE 3VRBA 2MOZA 4DR6T 4U2ZA 4UEMA 1FEWA 2YN6A 3ZYMA 1OXZA 3VR8A 3ZSSA 1OEDE 1M7KA 3N9OA 4KUMB 5AQJB 2LOSA 2K9AA 2KLQA 2VKOA 4IT4A 2MYSA 2WB5A 5DJQC 4TV8E 5FKYA 5LG4A 2WMNA 2J62A 1MMDA 2EHOC 4H9RC 3TLUA 3V5UA 2X0HA 2VVSA 5AQSB 3W15B 2XQ5A 4DBRA 4ZXLA 5HEJA 3Q5XA 1UX5A 2H7VC 4Z8XA 3AA7B 3AECA 2JQQA 2ES0A 1ZV4X 3BQLA 5C2TA 1IJ6A 5JVDE 2SPCA 2DL1A 2YDSA 3NBXX 2LLYA 2I0MA 5FVLA 4DMWA 3K3NA 4KHZF 1WRDA 4DV1T 3RPUA 2CMRA 1US7B 3KINB 4ZS2A 3UUXB 4TUYE 4HGAA 2PBIA 2XY8B 2CHOA 3VKHA 4UVBB 2MAWA 5KX5E 3TLVA 3ABVA 1HCIA 4P0BA 1CUNA 1MIYA 1HF8A 3M65A 4YTMA 4DV6T 4GIWA 3ZMVB 1X9BA 5IWAT 1W9RA 2YDQA 1WYBA 2V26A 4QX7B 1N32T 4HFVA 3RIUC 5FXVA 4HWCA 2BS4A 2VASA 3HKDE 5FXWA 4EOZB 5LP6E 3FXDB 4EGWA 2J47A 3RC8A 5IUXA 3RIAA 4AKIA 4ASKA 3CIRA 3KVBA 3J7Yq 3CPZA 2QYWA 3F57A 1WFDA 4PNIA 3FB2A 4TWFA 4B3TT 2XPKA 2Q9QC 2BS2A 3P4RA 2XQAA 4K0UA 2IIUA 4AISA 4XBFB 5EK4A 3CX8B 4B3RT 5JH7E 2W67A 3N5LA 3O9XA 1BR2A 1ZOYA 4ZI3D 4V1Av 2C5JA 2XAJB 2BDEA 1YKHB 3HR0A 3LBXB 3MACA 4ILCA 2D5UA 3A7MA 4HN9A 2NW9A 4A56A 5JDHA 1KF6A 2BBHA 3QB5A 3DJBA 3N2KE 2LKGA 3E08A 1UUSA 2WAUA 4G63A 5L4HA 1FJGT 3UU6A 3AEGA 2BG9A 3AAEB 3AEFA 3ONJA 4OYKA 3MK7C 2XJ7A 4LF6T 3CQGB 4LF9T 1HX1B 4WBOA 3F2EA 4YTPA 3GN5B 4YY3T 2HHHT 1XZYA 1HTJF 1NAFA 4HTEA 4YSYA 4FI5A 1WCRA 1BR1A 1V9DA 2CM0A 3O1IA 4LMLA 4LMKA 4EAHA 3FXEB 3PJAJ 4IDOA 4PAGA 5LOVE 3NVOA 3ZCIA 3PJAA 4YXDA 5JDLA 3RF1A 2WY2A 2FJDA 1OEDA 4A5XA 1YW0A 2VQFT 5C8YE 3L09A 1NENA 2K3WA 1B7TA 3C4XA 3KV6A 5L3FB 1LVFA 5JR9A 5L4EA 2HN1A 2VVNA 1E1HB 4H9SE 3T1HT 4H63H 4KP3C 2EHOD 3ETVA 2XASB 1SHZC 3M3ZB 5HWYA 2D2SA 2C5KT 1E7PA 2WBLA 5AQPB 3FZFB 2DWGA 3K3OA 2K24A 4HFIA 3K1SA 4AI6A 4PW8A 3HA4A 1XNRT 4BA9A 1XNQT 4COFA 2XAQB 3H3AA 1IAPA 3NRXA 3UULA 2X9WA 4AKGA 4IL9A 3BK9A 1D0ZA 1UCUA 5L47A 3UUMA 4HFHA 4LFBT 3KV9A 2IW5B
chains in the Genus database with same CATH topology
5LMNT 4DR7T 4JI6T 4DR5T 4DV0T 1N33T 4B3MT 1XMOT 4LFAT 4OX9T 4DUYT 5LMUT 2UUAT 1IBKT 4LFCT 2UXCT 4DR4T 4X66T 4JI1T 3T1YT 4GKKT 4DV4T 5BR8T 4DR6T 4DV5T 4LF5T 4LF7T 4JI3T 1N34T 4NXMT 4YHHT 4DR2T 1IBLT 1XMQT 4JI2T 4DV1T 4LF4T 2VQET 4DV6T 2UXBT 1N36T 1HNZT 4NXNT 5IWAT 4B3ST 1N32T 4DV3T 1HNXT 4JI5T 4X65T 2UUCT 2UUBT 1HNWT 2UU9T 4K0KT 4B3TT 4JI4T 3OTOT 4B3RT 4DR3T 2ZM6T 1I94T 1FJGT 1HR0T 4LF9T 4LF6T 4X62T 2UXDT 4DV7T 4YY3T 4JI7T 2HHHT 4JYAT 4JI8T 1J5ET 4KHPT 2VQFT 4GKJT 1IBMT 4JV5T 4DR1T 3T1HT 2E5LT 4LF8T 4X64T 4DUZT 1XNRT 1XNQT 4DV2T 4JI0T 4AQYT 2F4VT 4LFBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN T;  4DR7 T;  4JI6 T;  4DR5 T;  4DV0 T;  1N33 T;  4B3M T;  1XMO T;  4LFA T;  4OX9 T;  4DUY T;  5LMU T;  2UUA T;  1IBK T;  4LFC T;  2UXC T;  4DR4 T;  4X66 T;  4JI1 T;  3T1Y T;  4GKK T;  4DV4 T;  5BR8 T;  4DR6 T;  4DV5 T;  4LF5 T;  4LF7 T;  4JI3 T;  1N34 T;  4NXM T;  4YHH T;  4DR2 T;  1IBL T;  1XMQ T;  4JI2 T;  4DV1 T;  4LF4 T;  2VQE T;  4DV6 T;  2UXB T;  1N36 T;  1HNZ T;  4NXN T;  5IWA T;  4B3S T;  1N32 T;  4DV3 T;  1HNX T;  4JI5 T;  4X65 T;  2UUC T;  2UUB T;  1HNW T;  2UU9 T;  4K0K T;  4B3T T;  4JI4 T;  3OTO T;  4B3R T;  4DR3 T;  2ZM6 T;  1I94 T;  1FJG T;  1HR0 T;  4LF9 T;  4LF6 T;  4X62 T;  2UXD T;  4DV7 T;  4YY3 T;  4JI7 T;  2HHH T;  4JYA T;  4JI8 T;  1J5E T;  4KHP T;  2VQF T;  4GKJ T;  1IBM T;  4JV5 T;  4DR1 T;  3T1H T;  2E5L T;  4LF8 T;  4X64 T;  4DUZ T;  1XNR T;  1XNQ T;  4DV2 T;  4JI0 T;  4AQY T;  2F4V T;  4LFB T; 
#chains in the Genus database with same CATH topology
 1G8X A;  4JI6 T;  1EZ3 A;  5JDQ A;  4DR5 T;  2VK9 A;  3E0Z A;  3LSV A;  3UU5 A;  5LG3 A;  4LFA T;  3PU8 A;  3RKG A;  3L39 A;  5HEG A;  5IYZ E;  3U3I A;  3RQW A;  3ANW B;  5FP3 A;  4OX9 T;  1J1J A;  4Z90 A;  5LCY A;  4YJ2 E;  5LMU T;  2UUA T;  4IDZ A;  3AEA A;  4P09 A;  3T8O A;  4DR4 T;  2LSY A;  5GON E;  3KV5 A;  4J2C A;  3IF8 B;  2XHE B;  2B1E A;  2Q9Q D;  2KIN B;  1MMN A;  3AAA B;  2IDO B;  2CLY B;  2KSR A;  2WZH A;  3T1Y T;  4PJM A;  2CE7 A;  3P4W A;  3BQK A;  3RKO A;  5BR8 T;  4QX8 B;  4E7Z A;  4EV6 A;  5JDN A;  2WMO A;  2ODV A;  4LF7 T;  4ZEY A;  1YD8 G;  1T8B A;  2YDR A;  3AA6 B;  4QKN A;  5J1G A;  3C4Z A;  4XZC A;  5F5W A;  5LGN B;  2BG9 E;  1OWA A;  3PUG A;  2YK0 A;  4MLK A;  3AE2 A;  2GK9 A;  5FNV E;  4UR9 A;  2NTY A;  4U74 A;  1XMQ T;  3B5M A;  2DLR A;  4JI2 T;  3N9Q A;  3I9W A;  2BVM A;  3JC6 C;  3LK4 2;  4G2A A;  3IEE A;  2V6Y A;  3SWH A;  4L5G A;  2NP9 A;  5ABF A;  2FUP A;  2KXP B;  3OYZ A;  3ZLI A;  3C98 B;  3OPC A;  3HKC E;  3PE0 A;  3SFD A;  3N2G E;  3ZT5 A;  2JIW A;  2VQE T;  2V7K A;  5KMG P;  3UQ7 A;  4PK6 A;  5DQV A;  2MBG A;  1YXR A;  1E2A A;  2E9X C;  3EVY A;  3A8Y C;  4N78 D;  2L9Q A;  2L3L A;  2W0G A;  4O4I E;  4B6X A;  1S35 A;  3K3Q C;  2BKN A;  2E5V A;  3B13 A;  2H88 A;  3K8P C;  4IIJ E;  4DV3 T;  4NUU A;  4X65 T;  5JDG A;  3MKD A;  5FY1 A;  3ZC0 A;  5JQG E;  2RPA A;  2IHR 1;  2A3D A;  3O1H A;  3ZPO A;  3RYI E;  1QSD A;  4QH1 A;  3NZP A;  3RHW A;  3EDU A;  3VKG A;  2WWU A;  5LBM A;  3OTO T;  4DBQ A;  3WAK A;  5L3E B;  3RGL A;  4DR3 T;  2CBI A;  1LRZ A;  2CA5 A;  3PUA A;  5AQH B;  5JDM A;  2ZM6 T;  4EZ4 A;  3CX6 B;  3J9X 1;  1NWM X;  1D1B A;  4O4L E;  4QH4 A;  5FXX A;  3EDV A;  3PUY F;  5M4Y A;  3SRZ A;  1HS7 A;  2WCA A;  3ZC1 A;  1I94 T;  2V6X A;  5KXJ A;  4TZ4 C;  2N2N A;  3ZN1 B;  5ABG A;  2CWO A;  3RIU A;  3ZMS B;  4X1K E;  2LSI A;  2V7I A;  3Q5W A;  4HWH A;  2VKH A;  4HFB A;  5IHY A;  3ZN0 B;  5LNK A;  3HL6 A;  2NWB A;  4KBM B;  3DP7 A;  4X62 T;  3CK6 A;  4AQF C;  4ZI2 C;  1KNR A;  3RLF F;  1HG5 A;  3AE8 A;  1VCS A;  3RIF A;  1HG2 A;  4UF0 A;  1NEK A;  3ZYK A;  2P9B A;  1MMA A;  1S94 A;  1SUM B;  2YEV C;  3JAE A;  2WDR A;  4AKR B;  2V5D A;  2ZM8 A;  3TLS A;  4H9Q C;  1U5P A;  4L0R A;  3LK2 B;  2JMK A;  3QB5 K;  2ZM2 A;  3ZMU B;  4BAY B;  1QLB A;  3AE7 A;  3TKL B;  4F6R C;  2XQ3 A;  3C64 A;  3ZEF B;  2H3R A;  2LSK A;  1MIV A;  1IBM T;  4DR1 T;  4JV5 T;  1IZN B;  3RX6 A;  5DAB A;  4WBN E;  2J4G A;  1OED B;  2LM9 A;  2ACZ A;  4U72 A;  5LBQ B;  3EUH A;  1AJ3 A;  4CXX A;  4X64 T;  2X66 A;  3ZMZ B;  2XAG B;  2OV9 A;  3LFM A;  5L3C B;  2XQ6 A;  2XZE A;  4PJL A;  2V7M A;  2X0L B;  5HEU A;  3JCF A;  2L8K A;  1M62 A;  2FJE A;  2Z6E A;  5AQT B;  5LHI B;  5LHG B;  4JI0 T;  2N9D A;  1BR0 A;  4ZS3 A;  4EED A;  3C4W A;  5CGM A;  3N9L A;  1LKX A;  1HFA A;  5LMN T;  4QXH B;  4DR7 T;  1HX8 A;  5FL0 A;  4BJN A;  5HXS A;  1YQ3 A;  2YKS A;  4UXN B;  4QWN B;  4JUY A;  5CFB A;  1KNZ A;  5JR9 C;  2WDQ A;  4PFO A;  4CXY A;  4HWD A;  2JQK A;  1KEY A;  2FBW A;  2CXF A;  2IAK A;  2V1D B;  2VKJ A;  5EZY E;  2YIN A;  5LA6 E;  5FVK A;  4YSX A;  2OA5 A;  3S4U A;  1UK5 A;  3HI2 A;  4GK5 E;  4M1P A;  2VL0 A;  1G73 A;  1XDO A;  1ZHC A;  3CX7 B;  2QA7 A;  4U31 A;  3ZJ2 A;  3IHR A;  3N9P A;  4X66 T;  2Y8D A;  2W4X A;  3PDY A;  4JI1 T;  3ANW A;  1YQ4 A;  3C50 A;  5C3J A;  3AA1 B;  1O3X A;  4Z91 A;  3RYC E;  4HFE A;  2EHO B;  4WYV A;  4DV4 T;  4X5T A;  4OHF A;  4A98 A;  2X0Y A;  4CN4 A;  4LF4 T;  3ETU A;  3UFE A;  4TN7 B;  3AED A;  2XQ7 A;  4XAX B;  5H6Q B;  2FJB A;  2LE8 A;  3N2O A;  5AQR B;  4LF5 T;  2W62 A;  2WM9 A;  1R8I A;  2XM2 A;  2D0U A;  2WU5 A;  3KBU A;  4AXP A;  2JPF A;  2ZMA A;  3GWH A;  3H3M A;  2DI4 A;  2ZM0 A;  4HKA A;  4YHH T;  4DR2 T;  2IUB A;  4QXB B;  4TWH A;  5HXH A;  3FBL A;  4QHO A;  2N1G A;  2X9H A;  3AXJ B;  4I4T E;  4NIQ A;  4YSZ A;  2XSB A;  4AQG A;  2J1D G;  2IML A;  3ONL C;  4KMC A;  1QUU A;  2UXX B;  3AE6 A;  2W61 A;  1X79 A;  2NR4 A;  3KDS E;  3N9N A;  4GYS A;  1WR6 A;  2VWA A;  3QK6 A;  4ILB A;  4YJ3 E;  4EB6 E;  4UV8 B;  5JRC A;  4Q25 A;  3UFG A;  2NW7 A;  2I6H A;  4H9O C;  5JR9 B;  4JBW F;  2MTQ A;  4IE5 A;  1HNZ T;  2KT9 A;  2V7L A;  4O4H E;  4A97 A;  5CJ5 A;  4B3S T;  3I0O A;  4X1I E;  2RP4 A;  2CRB A;  1Y01 A;  3MA9 A;  3ZT6 A;  4DVD A;  5J2T E;  2DHR A;  3GA8 A;  4IDQ A;  2LRL A;  4U3C A;  1U4Q A;  4HE8 A;  2IC6 A;  3UT5 E;  4ZZC A;  2UUB T;  2UUC T;  2UU9 T;  2LSJ A;  3FZH B;  2WDV A;  4IE4 A;  3U78 A;  3NRY A;  1W09 A;  1ZKE A;  2QRX A;  2RA1 A;  3O1J A;  4KI0 F;  5FMN A;  4YLH A;  4AQF A;  4JI4 T;  1KK7 A;  4BJM A;  2X51 A;  3C51 A;  3QC9 A;  5ABH A;  4CZZ B;  3LK3 B;  4DND A;  2VL8 A;  2HPL A;  3VHL A;  3P4S A;  3LG7 A;  3KFW X;  4IE0 A;  4AKH A;  3Q5D A;  3IBP A;  3PUV F;  4H63 V;  2LHR A;  5AQV B;  3ZT7 A;  5HXR A;  3QOF A;  4CXW A;  2VUR A;  3Q5E A;  2H89 A;  4HEA A;  4UEL A;  2FJA A;  5CB4 E;  1I6Z A;  4HFC A;  3R6N A;  3CWZ B;  3KBT A;  3O4X E;  5AQO B;  4EIW A;  1HR0 T;  3E22 E;  3D0T A;  2WU2 A;  4UVC B;  1WLX A;  2YOE A;  5KDM C;  3AE5 A;  2C0S A;  2LT3 A;  4FJO A;  2BS3 A;  4PJN A;  4TV9 E;  5FY7 A;  2W00 A;  3F31 A;  4JLE A;  2D0T A;  1FMW A;  4JI7 T;  4ZI3 C;  2WQY A;  4IE7 A;  2NOX A;  1VOM A;  2KWH A;  3CVR A;  5LGU B;  2CWY A;  4JYA T;  3R84 B;  2JQ9 A;  1MIW A;  2MPK A;  4H9P C;  2Y48 B;  3ONX A;  3PUR A;  4NUV A;  4UVA B;  5HAX A;  3ZMT B;  4GKJ T;  3EAM A;  1Z0P A;  4YHJ A;  5HCM A;  5HEO A;  2QVA A;  4O4J E;  4HWF A;  1LVK A;  3UU3 A;  5ABE A;  3EHZ A;  3PUZ F;  2Y6X A;  4P1N A;  2YU1 A;  1MND A;  4HFD A;  2A72 A;  2CBJ A;  4I0U A;  4ADZ A;  2KWI B;  4I43 B;  2CPT A;  2DCF A;  3ZST A;  5F8P A;  3DTO A;  1SA0 E;  2CXL A;  2V6Y B;  4O2A E;  4DO0 A;  4DUZ T;  4ILU A;  4LMJ A;  4EXT A;  2M67 A;  4MAL A;  2E8I A;  3TLW A;  3CQC B;  2CLY C;  2M6B A;  4TNW A;  1ZEE A;  4AQY T;  4WW0 A;  3MJX A;  1L0V A;  3UU8 A;  4EZH A;  5A1L A;  1D1C A;  3IA3 A;  4PJJ A;  1FMV A;  2LOP A;  3UQ4 A;  3VRA A;  1D1A A;  3OYX A;  2I59 A;  4ILA A;  2C5I T;  2XSA A;  5AQL B;  3WI3 A;  4ZZB A;  3AA0 B;  1VCT A;  3RRC A;  4DV0 T;  3QUJ A;  2M6I A;  2XAH B;  3CML A;  4ANJ A;  1N33 T;  4CI3 B;  1XMO T;  1UUR A;  2R6G F;  1T72 A;  3RI5 A;  4OYJ A;  5H6R B;  3AVS A;  5AQG B;  4NPP A;  3SS1 A;  3KV4 A;  5HXC A;  4C91 A;  1IBK T;  2X67 A;  3PUS A;  2ACX A;  4ZHQ E;  4MBQ A;  5FL1 A;  5FXZ A;  1MNE A;  3ZKR A;  3UUB A;  1JNR A;  2ODU A;  2X68 A;  3PU3 A;  3GN5 A;  1Y64 B;  2PFV A;  4I50 E;  3AE3 A;  3EI0 A;  2A2F X;  4YTN A;  3FZK B;  5LHH B;  2BKO A;  3BQI A;  2Q9Q B;  2XTL A;  2E9X A;  1KNP A;  4TWD A;  4U33 A;  4F8H A;  5AQN B;  4DV5 T;  2WP9 A;  3AB3 B;  4OK0 A;  5CA0 E;  2E2A A;  4JI3 T;  1D0X A;  2YU2 A;  2EHO A;  3AVR A;  4H9N C;  4QH5 A;  3PV0 F;  3ZCJ A;  5F3J A;  3QNU A;  1W0B A;  4IL4 A;  5JRE A;  4IDP A;  1N34 T;  4NXM T;  2LJL A;  4GYR A;  5L3G B;  3P8C D;  2XQY A;  2BKP A;  3RRW A;  4E7S A;  4YT0 A;  1IBL T;  4U7I A;  5DQW A;  4P0A A;  3PUX F;  4IST A;  4ERR A;  2CHN A;  2WZI A;  2CXD A;  2LSG A;  2AE9 A;  2D9D A;  3WAJ A;  3PUQ A;  1SE7 A;  3AXJ A;  3FHN A;  3RH3 A;  2BZB A;  4PFP A;  4IHJ E;  3OKQ A;  2PG8 A;  2AXD S;  1N36 T;  2UXB T;  4IDN A;  2K5B B;  1H7C A;  3KVA A;  2W63 A;  4OFZ A;  2BVL A;  5TAO A;  4NXN T;  1BR4 A;  5JRC B;  5EK2 A;  2LM2 A;  3B57 A;  5HWX A;  3CKD A;  3Q9D A;  3NKZ A;  2JQH A;  4UIG A;  5E0O A;  3FZL B;  3AE1 A;  1HNX T;  4JI5 T;  2BG9 B;  2LHN A;  4O2B E;  4U7Y A;  3JC6 D;  1XWM A;  4HWI B;  4IGU A;  5AQF B;  5LJN A;  2E9X B;  1HNW T;  2B76 A;  4K0K T;  5L2L A;  4EYY R;  2Q9Q A;  2XM1 A;  2HH7 A;  4U2Y A;  1KFY A;  5ABF B;  3P50 A;  4GK0 E;  4L9I A;  2JJ9 A;  1D0Y A;  2E9X D;  3ESL A;  4EEB A;  1T98 A;  5HEH A;  1MMG A;  2X9X A;  4UV9 B;  2DNX A;  1J5W A;  3GMI A;  3P4Q A;  5LJM A;  2A9U A;  2KMF A;  2VB6 A;  3RC3 A;  5JTG A;  3SOL A;  2V8S V;  2PTF A;  5LGT B;  3LBX A;  4TX5 A;  5AQI B;  3Q2M A;  3NZQ A;  2NTX A;  3ZJ1 A;  2JMH A;  3VU7 H;  1GQE A;  4JEU B;  2NW8 A;  3VR9 A;  2UXN B;  2KZ7 B;  1IJ5 A;  2VKD A;  3N9M A;  2K48 A;  3RQU A;  2IC9 A;  2V5C A;  4YFS A;  3H37 A;  3HKE E;  1W0A A;  3RYF E;  2UXD T;  2G0U A;  5HCJ A;  2BBJ A;  2HN2 A;  2QGS A;  3PTR B;  4DV7 T;  4DID B;  4O8S A;  2JRK A;  1FIO A;  2V7J A;  2H7O A;  2PJQ A;  3UU4 A;  1WR0 A;  3UUN A;  3I9Y A;  4AKL A;  4JI8 T;  3MXZ A;  1DU2 A;  1J5E T;  3OVU A;  3P7I A;  1T7S A;  1OED C;  4DMV A;  2OLT A;  3OJA A;  4KHP T;  2XQ8 A;  3L3P A;  3P4P A;  3UTK A;  5EK3 A;  4EYU A;  5LYJ E;  3HKB E;  1Z8U A;  1ZP0 A;  3MZK B;  5LB7 B;  5AFU L;  2W2U A;  2DWK A;  1VRB A;  3G06 A;  4JEH B;  4X20 E;  5AQQ B;  5L3B B;  2E5L T;  3V5S A;  4ZI2 D;  2BG9 C;  2XAF B;  4WZX A;  3NWI A;  3OBV E;  5ETW A;  2WSS V;  2LEH A;  2LRK A;  4MFR A;  4LF8 T;  5LXT E;  5J0Z A;  3AEB A;  3JAF A;  4GOU A;  4CQI A;  5FY0 A;  4CN6 A;  5HXE A;  4ZOL E;  2KND A;  2XUE A;  4IE6 A;  3I0Q A;  4MHC A;  3RYH E;  2XQ4 A;  2CCQ A;  3X1D A;  3AEE A;  2X9Y A;  3EAB A;  3SFE A;  4AIU A;  5HYA A;  5AQK B;  4IRE A;  1WYC A;  5FYM A;  4DV2 T;  5J2U E;  2F4V T;  1UX4 A;  5AQU B;  4CI2 B;  2WS3 A;  5AQM B;  4PK4 A;  5L3D B;  2XQ9 A;  1XDP A;  4WNK A;  4ZI7 E;  4CI1 B;  3FZM B;  4UF0 B;  2LKH A;  4B3M T;  3TLT A;  2HPJ A;  1JNZ A;  3A5X A;  5ADX L;  2ZLY A;  3ZYL A;  1UGO A;  4PK5 A;  1YKE B;  5CA1 E;  4KX6 A;  4DUY T;  4C90 A;  4LFC T;  2UXC T;  3JAD A;  2W66 A;  3AE4 A;  5JDF A;  3L8R A;  4TNV A;  3LJC A;  4CN1 A;  3AAI A;  3FBZ A;  4QXC B;  4ISS A;  2CEA A;  3CQX C;  5BMV E;  3LDQ B;  4I55 E;  3AE9 A;  2WWV A;  1CHU A;  4GKK T;  3I1A A;  3PUW F;  4X1Y E;  3VRB A;  2MOZ A;  4DR6 T;  4U2Z A;  4UEM A;  1FEW A;  2YN6 A;  3ZYM A;  1OXZ A;  3VR8 A;  3ZSS A;  1OED E;  1M7K A;  3N9O A;  4KUM B;  5AQJ B;  2LOS A;  2K9A A;  2KLQ A;  2VKO A;  4IT4 A;  2MYS A;  2WB5 A;  5DJQ C;  4TV8 E;  5FKY A;  5LG4 A;  2WMN A;  2J62 A;  1MMD A;  2EHO C;  4H9R C;  3TLU A;  3V5U A;  2X0H A;  2VVS A;  5AQS B;  3W15 B;  2XQ5 A;  4DBR A;  4ZXL A;  5HEJ A;  3Q5X A;  1UX5 A;  2H7V C;  4Z8X A;  3AA7 B;  3AEC A;  2JQQ A;  2ES0 A;  1ZV4 X;  3BQL A;  5C2T A;  1IJ6 A;  5JVD E;  2SPC A;  2DL1 A;  2YDS A;  3NBX X;  2LLY A;  2I0M A;  5FVL A;  4DMW A;  3K3N A;  4KHZ F;  1WRD A;  4DV1 T;  3RPU A;  2CMR A;  1US7 B;  3KIN B;  4ZS2 A;  3UUX B;  4TUY E;  4HGA A;  2PBI A;  2XY8 B;  2CHO A;  3VKH A;  4UVB B;  2MAW A;  5KX5 E;  3TLV A;  3ABV A;  1HCI A;  4P0B A;  1CUN A;  1MIY A;  1HF8 A;  3M65 A;  4YTM A;  4DV6 T;  4GIW A;  3ZMV B;  1X9B A;  5IWA T;  1W9R A;  2YDQ A;  1WYB A;  2V26 A;  4QX7 B;  1N32 T;  4HFV A;  3RIU C;  5FXV A;  4HWC A;  2BS4 A;  2VAS A;  3HKD E;  5FXW A;  4EOZ B;  5LP6 E;  3FXD B;  4EGW A;  2J47 A;  3RC8 A;  5IUX A;  3RIA A;  4AKI A;  4ASK A;  3CIR A;  3KVB A;  3J7Y q;  3CPZ A;  2QYW A;  3F57 A;  1WFD A;  4PNI A;  3FB2 A;  4TWF A;  4B3T T;  2XPK A;  2Q9Q C;  2BS2 A;  3P4R A;  2XQA A;  4K0U A;  2IIU A;  4AIS A;  4XBF B;  5EK4 A;  3CX8 B;  4B3R T;  5JH7 E;  2W67 A;  3N5L A;  3O9X A;  1BR2 A;  1ZOY A;  4ZI3 D;  4V1A v;  2C5J A;  2XAJ B;  2BDE A;  1YKH B;  3HR0 A;  3LBX B;  3MAC A;  4ILC A;  2D5U A;  3A7M A;  4HN9 A;  2NW9 A;  4A56 A;  5JDH A;  1KF6 A;  2BBH A;  3QB5 A;  3DJB A;  3N2K E;  2LKG A;  3E08 A;  1UUS A;  2WAU A;  4G63 A;  5L4H A;  1FJG T;  3UU6 A;  3AEG A;  2BG9 A;  3AAE B;  3AEF A;  3ONJ A;  4OYK A;  3MK7 C;  2XJ7 A;  4LF6 T;  3CQG B;  4LF9 T;  1HX1 B;  4WBO A;  3F2E A;  4YTP A;  3GN5 B;  4YY3 T;  2HHH T;  1XZY A;  1HTJ F;  1NAF A;  4HTE A;  4YSY A;  4FI5 A;  1WCR A;  1BR1 A;  1V9D A;  2CM0 A;  3O1I A;  4LML A;  4LMK A;  4EAH A;  3FXE B;  3PJA J;  4IDO A;  4PAG A;  5LOV E;  3NVO A;  3ZCI A;  3PJA A;  4YXD A;  5JDL A;  3RF1 A;  2WY2 A;  2FJD A;  1OED A;  4A5X A;  1YW0 A;  2VQF T;  5C8Y E;  3L09 A;  1NEN A;  2K3W A;  1B7T A;  3C4X A;  3KV6 A;  5L3F B;  1LVF A;  5JR9 A;  5L4E A;  2HN1 A;  2VVN A;  1E1H B;  4H9S E;  3T1H T;  4H63 H;  4KP3 C;  2EHO D;  3ETV A;  2XAS B;  1SHZ C;  3M3Z B;  5HWY A;  2D2S A;  2C5K T;  1E7P A;  2WBL A;  5AQP B;  3FZF B;  2DWG A;  3K3O A;  2K24 A;  4HFI A;  3K1S A;  4AI6 A;  4PW8 A;  3HA4 A;  1XNR T;  4BA9 A;  1XNQ T;  4COF A;  2XAQ B;  3H3A A;  1IAP A;  3NRX A;  3UUL A;  2X9W A;  4AKG A;  4IL9 A;  3BK9 A;  1D0Z A;  1UCU A;  5L47 A;  3UUM A;  4HFH A;  4LFB T;  3KV9 A;  2IW5 B; 
#chains in the Genus database with same CATH homology
 5LMN T;  4DR7 T;  4JI6 T;  4DR5 T;  4DV0 T;  1N33 T;  4B3M T;  1XMO T;  4LFA T;  4OX9 T;  4DUY T;  5LMU T;  2UUA T;  1IBK T;  4LFC T;  2UXC T;  4DR4 T;  4X66 T;  4JI1 T;  3T1Y T;  4GKK T;  4DV4 T;  5BR8 T;  4DR6 T;  4DV5 T;  4LF5 T;  4LF7 T;  4JI3 T;  1N34 T;  4NXM T;  4YHH T;  4DR2 T;  1IBL T;  1XMQ T;  4JI2 T;  4DV1 T;  4LF4 T;  2VQE T;  4DV6 T;  2UXB T;  1N36 T;  1HNZ T;  4NXN T;  5IWA T;  4B3S T;  1N32 T;  4DV3 T;  1HNX T;  4JI5 T;  4X65 T;  2UUC T;  2UUB T;  1HNW T;  2UU9 T;  4K0K T;  4B3T T;  4JI4 T;  3OTO T;  4B3R T;  4DR3 T;  2ZM6 T;  1I94 T;  1FJG T;  1HR0 T;  4LF9 T;  4LF6 T;  4X62 T;  2UXD T;  4DV7 T;  4YY3 T;  4JI7 T;  2HHH T;  4JYA T;  4JI8 T;  1J5E T;  4KHP T;  2VQF T;  4GKJ T;  1IBM T;  4JV5 T;  4DR1 T;  3T1H T;  2E5L T;  4LF8 T;  4X64 T;  4DUZ T;  1XNR T;  1XNQ T;  4DV2 T;  4JI0 T;  4AQY T;  2F4V T;  4LFB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...