4DR7M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr7M02
3GPXA 2UXBM 4OX9M 1Q3BA 1PM5A 4JI1M 1Q39A 1XMQM 4LF8M 4G4NA 5ITYA 4DR3M 2XZFA 5ITQA 2ZM6M 5LMUM 4NXMM 4DR6M 4NRWA 3U6CA 3SAUA 4ITQA 4GKJM 5LMNM 3U6PA 4JI2M 4JV5M 1IBLM 3SAVA 4G4OA 4LF5M 4PD2A 1L1ZA 2ZBKB 3GPPA 1NNJA 2E5LM 1HR0M 4PCZA 3JR4A 4DR7M 4DR2M 1Z5AA 3TWLA 5ITXE 1TDHA 4DR5M 1TDZA 2UXDM 1XNQM 1Q3CA 3J81S 1PJJA 5ITRA 2VQFM 1PJIA 1N34M 4JI4M 3GQ3A 4YHHM 2F5PA 2UUCM 1N32M 3C58A 1MU5A 4MB7A 4NXNM 4X66M 3OTOM 4LFBM 4G4RA 4LFAM 1HNXM 4KHPM 4DR4M 5A2QS 4DV7M 1R2YA 4B3SM 2F5SA 4YY3M 3U6LA 3U6MA 3U6EA 3SAWA 4JYAM 1L2BA 3SARA 5ITTA 4G4QA 1FJGM 4DUYM 2UU9M 3VK8A 4LF7M 3SATA 1Z59A 3GPYA 4B3RM 4DV6M 1IBMM 4AQYM 4DR1M 4X65M 3JR5A 4JI7M 3DOAA 3U6QA 1N36M 4B3MM 2OPFA 2UUBM 4DV4M 3GPUA 1XMOM 4DV2M 1J5EM 1K82A 1L1TA 4B3TM 1XNRM 4PDIA 3GQ4A 5BR8M 4JI5M 4DV1M 2F4VM 4LFCM 1KFVA 2F5OA 2HHHM 3TWMA 1K3XA 4LF4M 3U6DA 1L2CA 5ITXA 4JI3M 3J80S 3GQ5A 3U6SA 1K3WA 4PDGA 4DUZM 4JI8M 3A46A 1EE8A 4LF9M 4K0KM 2F5QA 3A45A 2F5NA 3TWKA 3W0FA 1Z5CA 4X64M 2EA0A 4NRVA 1Z5BA 4CISA 2UXCM 2HKJA 3A42A 5IWAM 3T1YM 4LF6M 4DV3M 2OQ4A 1N33M 3VK7A 3T1HM 2Q2EB 1MX0A 3GP1A 3SASA 5FLXS 1HNZM 4JI6M 2UUAM 1HNWM 1R2ZA 4X62M 2VQEM 1I94M 3GO8A 3J7AS 5ITUA 1IBKM 4GKKM 4JI0M 3JAMS 1L2DA 3U6OA 4DV0M 2XZUA 5IT9S 1XC8A 4DV5M 3SBJA
chains in the Genus database with same CATH superfamily
1QDTA 3AL0C 2QENA 2G8LA 1PM5A 2R4JA 2RRUA 4LF8M 1VQ1A 1T43A 4DR6M 2MROB 1NJGA 1Y8GA 4RF0A 3J7BA 3SAUA 2C5RA 1D0MA 2KNZA 4L78A 1QUSA 2FOIC 4GKJM 2CUZA 5LMNM 3U6PA 1QZEA 2R44A 1HJPA 2EKFA 3PXGA 4JI2M 4JV5M 1V92A 5EP2A 2R46A 3MMPA 4G4OA 4LF5M 1OTRA 3SC3A 2ZAMA 1ORYB 2CHGA 4R3DA 2E5LM 3D8BA 1OJLA 1W5SA 1GLNA 4HLQA 2V6ZM 4FWDA 1TDHA 5EQTA 3TWLA 1DO2A 5ITXE 1R5LA 4B7GA 2R0IA 2CHVA 3J81S 1PJTA 3J27B 3GLIE 2CE7A 4P17A 5EJCA 2BNKA 3GLGB 2UUCM 3C58A 2KZUA 3SYLA 4NXNM 3W68A 4REZA 2HCBA 2KW0A 3GRUA 4D80A 5C18A 2ERCA 2HL7A 1GVNA 2LVQD 4AKGA 1R2YA 4B3SM 3FUXA 4IBKA 4L8RC 1JQJC 3L25A 1T6OA 2V1CA 3U6LA 2Z3XA 5E6JA 3SARA 3ZC7B 4G4QA 5EXTA 4DUYM 4LF7M 3VK8A 4QNRA 4Y28F 4WP2A 3FTDA 3IECA 3GPYA 3UZUA 3VKGA 2DZNB 4BLCA 2VIIA 3AOEA 2B3TA 3BBZA 2DWMA 3DOAA 2DKLA 1N36M 3U60B 1XXHE 3E9SA 5DYIA 2OPFA 2EKKA 4DV4M 4B3TM 1YUBA 4LCBA 1XXHB 2XSZA 3FTCA 2JZ0A 3E21A 3FUUA 2DAKA 3KOWE 3WHKA 7CATA 3HZJA 2K47A 1GL7A 4JI5M 4DBGB 2HHHM 5IREB 1NHGC 5EXXA 4F1IA 1K3XA 3Q8XA 4LF4M 1K3WA 1GABA 3AFHA 1X37A 2I7NA 2G5GX 4JI8M 1GJSA 3A46A 4LY6A 4XBOA 4CIZA 1MN3A 3A45A 4W5WA 1R7RA 3U61A 4S12A 2F5NA 4GIPA 4AW4A 2QPAA 2QQ8A 4OU7A 1UM8A 3U5ZB 3K9PA 3EIEA 3T15A 4R71A 1PJQA 4LJ7A 4LF6M 3LCUA 5H37D 3K2LA 2XF3A 2DZOB 1AUAA 4DV3M 1N33M 3VK7A 3WHLA 4IIWA 2LVNC 3NBIA 1VG5A 2FH0A 4M0WA 3ZH9B 4IJEA 2L09A 5IZ7D 3HHZA 3GRRA 1R4GA 1QUTA 1MX0A 4JI6M 4GHLA 3MHVC 3KVWA 1R2ZA 1HNWM 3PFIA 3RGSA 3GO8A 1I94M 2V1UA 2LVAA 3LQRA 1NY5A 1IM2A 3F92A 5IT9S 1ZV1A 2O25A 1NSFA 2QZ4A 3KOYE 1XC8A 2ZANA 2KA6B 2QHOB 2VDBB 3SBJA 3VLFB 3GPXA 3I4YA 2UXBM 1DGHA 2M60A 2APLA 4F2LA 1G41A 1XMQM 1TF0B 5ITYA 3UGJA 1IY0A 3W67A 3AV0A 3VDUA 2KXEA 1PRBA 1WR1B 2GNOA 2O01F 2X8AA 3CF2A 3GLHE 4NRWA 3E46A 4ITQA 4AI6A 4LZZA 5DYGA 1EFUB 3LCVB 1D0KA 3V76A 2DENA 3GRYA 2YR0A 4B08A 3C3EA 3SAVA 4PD2A 2R62A 3HJ8A 1NNJA 1OIPA 4QHSA 5KQDA 3KP1E 3QAUA 2C9OA 1J09A 2R4EA 3L28A 3JR4A 1ZMUA 1Z5AA 3I04M 1I4WA 1G4AE 3GLHA 3VFDA 4DR5M 2GQFA 3FUVA 2UXDM 2LHGA 4FWHA 1E94E 1Q3CA 1WHCA 2CV2A 2D7EA 1PJIA 3R9XB 4YHHM 4HEOA 1VDLA 4MB7A 4L6V6 2CV0A 2WSEF 3FUWA 4G4RA 4LFAM 1HNXM 1IN8A 2DAMA 2R6FA 3AOEC 2JY7A 2QBYA 2BWBA 2DWZB 4GMQA 4LJ9A 2LXEA 3IG8A 2P5TA 1HQCA 2F5SA 4ZPXA 3QWLA 1L2BA 4IBIA 2H5XA 5JI3E 2MJ5B 3RFWA 2UU9M 3IHPA 4XK8F 3AKZA 1Z59A 1DO0A 3FYCA 4FW9A 1HT2E 1IBMM 4AQYM 2CP8A 4X65M 1D0LA 4II7A 4JI7M 4IBJA 4AKHA 2OO9A 4PT5A 1OIZA 3FKEA 3GLGE 3HHYA 5FSWA 4MM3B 4IBDA 3UMMA 2UUBM 2JY8A 3GPUA 2ZAOA 4BB9A 1BVSA 4GRIA 1L1TA 4I8OA 2XLJA 1QDRA 5BR8M 1VDDA 3RGPA 4DV1M 4MGIE 5KO3A 2JA2A 1KFVA 2Y0QA 4FCWA 2HAKA 3J2PB 2Z8YM 2CFOA 5ITXA 3SMSA 3U6SA 1L2CA 1G71A 4M9XA 3T6PA 1HT1E 1XHBA 3I4VA 4LF9M 4K0KM 2C99A 4LZJA 2F5QA 3KOZE 4P16A 3GLIA 1XB2B 3UJNA 1SXJB 2XEPA 2G3QA 1Z5CA 4X64M 1YSYA 2BJVA 2UXCM 4CISA 1ZAEA 2HKJA 3A42A 5IWAM 2C96A 4GHAA 3C3DA 3B7ZA 2RKOA 3A98B 3M0EA 3KP0E 5DNYA 2RGHA 2Z4RA 2ZTDA 3I01M 1PGYA 4G3OA 3LVWA 3UK6A 3SASA 2D7GA 5FLXS 3B89A 1HNZM 4XGIA 2UUAM 2N35A 3LW5F 4QHTA 4X62M 2VQEM 3U60A 4AKIA 3KFUG 1GKIA 4GEWA 1NJFA 2L7IA 4IJFA 1ZQ9A 1IXZA 3J7AS 3GLFB 2FS1A 1IBKM 2O5RA 4GKKM 1XXHA 2L2DA 1L2DA 4CJ6A 3H4JA 3U6OA 1H6UA 2L6OA 1KSFX 4OW0A 1QAQA 1G59A 2XFTA 1XWIA 5FTMA 4AZFA 2FE8A 1G3IA 2Z7JA 1Q3BA 1WXQA 2W82A 4NC6A 1Q39A 1VEJA 4UN2B 4JI1M 1CUKA 4I81A 4DR3M 4CHTB 1QQWA 1NHWC 3PVSA 3U61B 2ZM6M 5LMUM 1NV8A 3U5ZA 3U6CA 2LH0A 1HQYE 2BJWA 1TGUA 4I5SA 5GKNA 1FNNA 1OAOC 2JUJA 2JZ1A 2MH8A 1IBLM 4MGZE 4L16A 2QP9X 3HHXA 1NY6A 4LJ5A 1AIPC 2H1RA 2ZTCA 1TH4A 2LWXA 3ZCBB 2K6BA 4PCZA 1HR0M 5EXSA 3SYKA 3KS4A 2JNHA 3B74A 3DFZA 2DXIA 2YQZA 1YE9A 2Y0TA 5EP1A 1XNQM 3W0LB 2FFJA 2C98A 3R8FA 2R45A 4OVZB 3I51A 3L29A 1NNUC 4LRTA 2KZSA 3M7GA 3GQ3A 5F3WA 1DGBA 2DAEA 5KPRA 1N34M 2DWLA 1N32M 1E9RA 1MU5A 3OTOM 4LFBM 3BOSA 4X66M 1E9SA 3CTWB 4LRSA 2BWEA 4D81A 3SMPA 4I4LA 1IN6A 1WIVA 1QVRA 4KT0F 3KDSE 1DGHB 2JXNA 1T3TA 2XH9A 4IBGA 4YY3M 2MR9A 3EIHA 4JYAM 1F4IA 4GC5A 5KPTA 1IXSB 1VEGA 2QCUA 2YNMD 1N75A 3SATA 2CEAA 1W5TA 2X4AA 2JY5A 4AG5A 2WSFF 3KSJA 1UFZA 2OOBA 1IFYA 3U6QA 1IN7A 4B3MM 1VEKA 3HHWA 1GL6A 1TH3A 1XNRM 5FTLA 1V33A 5KQ8A 1J5EM 5EXPA 1K82A 1C7YA 3IG5A 2C9CA 4NOOB 1MJGM 2CWBA 4WW0A 3GQ4A 4LJ8A 3L26A 3HJQA 2KHHA 2F4VM 4LFCM 4L15A 4IBEA 5C1BA 2A5YB 1DGGA 2F5OA 4NL4H 2WSCF 2KDLA 3HJSA 4DUZM 1P3QQ 3HX3A 3TQSA 1EE8A 1KYIA 2DWNA 1IY2A 2J5YA 1LV7A 3BXWA 1OFIA 3DZDA 1QYRA 3FE3A 2QNJA 4NSOB 2LNHC 3W0FA 4M0DA 4B7HA 1GO5A 2D7HA 2DAGA 2J7OA 2DI0A 1Z5BA 2X49A 4NRVA 2EA0A 2QBYB 1S3SA 3NWLA 1LTMA 3T1YM 4GH9A 1C1KA 2J7NA 2OQ4A 4WURA 3PNVA 2VF7A 3C9PA 2FNAA 4M9SA 3KOXE 2LVOC 2DNAA 4Z6YA 2XGNA 1OFHA 1ZMWA 1NVMA 2JP7A 5FTNA 1N77A 1NO1A 2EO2A 2Z4SA 3AJIB 3CGWA 1V34A 3GP1A 4D82A 1NV9A 5EP3A 2XFSA 3E4RA 4AG6A 3L27A 1QAMA 3FRHA 3FYDA 3FTEA 1SXJE 2DAIA 2JY6B 2R18A 4FCVA 2K0BX 2LHCA 4MH0E 4JI0M 1WGNA 5E26A 3JAMS 3GLGA 2XZUA 3VKHA 4CGYB 2I7PA 1RU3A 4DV5M 2DVWB 4JN6A 5JI2E 2EJSA 1JR3E 4JI4M 4Z8XA 1WGLA 2JWSA 4A3VB 4L4UA 4OX9M 2K9DA 3CF0A 4RF1A 5EP4A 4G4NA 1SXJA 3THGA 3GLIB 4IBCA 3HKPA 2XZFA 3KW6A 5ITQA 4NXMM 4KODA 4M9ZA 1IQPA 3KSXA 1DV0A 4JXJA 1IXRC 2MGWA 3HU3A 3B7QA 3HY5A 2Y20A 4BBAA 4QOZC 1DGFA 2CV1A 1JR3A 3GLFE 3B9PA 3FUTA 2ZBKB 1L1ZA 3GPPA 1SG9A 3TL4X 1E32A 4DR7M 4DR2M 1TR8A 4LGYA 2CRUA 4IBFA 1QANA 3ILKA 1TDZA 4LGMA 1IN4A 3VDPA 4MGHA 2HWJA 1IN5A 3FD9A 1PJJA 1G8PA 5ITRA 3GLFA 3CF6E 2VQFM 4FD2A 2VF8A 3T38A 3LVVA 1N78A 3ZQJA 2F5PA 3B7NA 5KPZA 1WJ7A 4KHPM 3HGIA 4DR4M 3HU1A 1D2NA 4LJAA 2EUCA 5BPVA 2LVPC 3TE6A 5A2QS 4DV7M 4FCTA 4G6ZA 3DA1A 3AOGA 3MK6A 1IY1A 4FWGA 3H4MA 3K8ZA 4RKUF 3U6MA 3U6EA 3SAWA 5L8RF 5ITTA 3Q8GA 1FJGM 4GITA 4QOSA 4B3RM 2L7HA 2KEBA 1GJTA 1QZMA 4DV6M 3MJ5A 4MGYE 1L8QA 3KS8A 1OKSA 4FVMA 4DR1M 3JR5A 3FRIA 4LG2A 3LMMA 3NBXX 4Q7JA 2KNAA 4RNAA 1ZMVA 2L4EA 3L2AA 3RE8A 2KRUA 1XMOM 4DV2M 2KRKA 2DHRA 4IBBA 5FTJA 4PDIA 1TH2A 2DZLA 3FTFA 2CHQA 2M5ZA 3TWMA 4MGKE 2WZJA 2L4FA 8CATA 3U6DA 1YLAA 4R7GA 3J80S 4JI3M 4OVZA 4PDGA 3GQ5A 1R6BX 2AHMA 1OAIA 2KNVA 4LJ4A 2QSFX 3K92A 5DFLA 4B7FA 3TPZA 1Z6TA 3TWKA 1SXJD 2R65A 2LTUA 1Q02A 1OQYA 3SFZA 1TTEA 3SHGB 3GRVA 2LBCA 3M6AA 1A5TA 4KO8A 3K1JA 3PNYA 1QAOA 4ANRA 1JR3D 3T1HM 2DHYA 1IXSA 4NSRA 3QYBA 1PJSA 2Y21A 3SHFA 4HL4A 2Q2EB 1JB0F 4QNMA 1J7KA 3GLHB 5FTKA 3KXEC 1EIJA 4EIWA 3HWSA 2NQ8C 4GC9A 1SXJC 2OOAA 3QYEA 5ITUA 2RGOA 3LQQA 4DV0M 3K9OA 4TUWA 4KLNA 4LJ6A 2XSZD 2YFQA 3HU2A 3D8LA
chains in the Genus database with same CATH topology
3AL0C 2QENA 2G8LA 1PM5A 2R4JA 4LF8M 4DR6M 1NJGA 4RF0A 2C5RA 3J7BA 3SAUA 4L78A 2FOIC 4GKJM 2CUZA 5LMNM 3U6PA 4JI2M 4JV5M 3PXGA 5EP2A 2R46A 4LF5M 4G4OA 3SC3A 2ZAMA 1ORYB 2CHGA 4R3DA 2E5LM 3D8BA 1OJLA 1W5SA 1GLNA 4HLQA 2V6ZM 4FWDA 1TDHA 5EQTA 3TWLA 1DO2A 5ITXE 4B7GA 2CHVA 3J81S 3J27B 2CE7A 5EJCA 2BNKA 3GLGB 2UUCM 3C58A 2KZUA 3SYLA 4NXNM 4REZA 2HCBA 2KW0A 3GRUA 4D80A 5C18A 2ERCA 2HL7A 1GVNA 4AKGA 1R2YA 4B3SM 3FUXA 4IBKA 4L8RC 1JQJC 3L25A 2V1CA 3U6LA 2Z3XA 5E6JA 3SARA 3ZC7B 4G4QA 5EXTA 4DUYM 4LF7M 3VK8A 4QNRA 3FTDA 3GPYA 3VKGA 3UZUA 2DZNB 4BLCA 2VIIA 3AOEA 2DWMA 3DOAA 1N36M 3U60B 5DYIA 3E9SA 2OPFA 4DV4M 4B3TM 1YUBA 4LCBA 1XXHB 2XSZA 3FTCA 3FUUA 3KOWE 4MM3B 3WHKA 7CATA 4JI5M 2K47A 1GL7A 2HHHM 5IREB 1NHGC 5EXXA 1K3XA 3Q8XA 4LF4M 1K3WA 3AFHA 1X37A 2I7NA 2G5GX 4JI8M 3A46A 4LY6A 4XBOA 3A45A 4W5WA 1R7RA 3U61A 4S12A 2F5NA 4GIPA 4AW4A 2QPAA 4OU7A 1UM8A 3U5ZB 3EIEA 3T15A 4LJ7A 4LF6M 5H37D 3K2LA 2XF3A 2DZOB 4DV3M 1N33M 3VK7A 3WHLA 4IIWA 3NBIA 4M0WA 3ZH9B 4IJEA 2L09A 5IZ7D 3HHZA 3GRRA 1MX0A 4JI6M 4GHLA 3MHVC 3KVWA 1R2ZA 1HNWM 3PFIA 3RGSA 3GO8A 1I94M 2V1UA 3LQRA 1NY5A 1IM2A 5IT9S 3KOYE 1NSFA 2QZ4A 1XC8A 2ZANA 2KA6B 3SBJA 3VLFB 3GPXA 3I4YA 2UXBM 1DGHA 2M60A 1G41A 1XMQM 5ITYA 3UGJA 1IY0A 3AV0A 3VDUA 2KXEA 2X8AA 3CF2A 4NRWA 4ITQA 4AI6A 4LZZA 5DYGA 3GRYA 2YR0A 4B08A 3SAVA 4PD2A 2R62A 3HJ8A 1NNJA 4QHSA 5KQDA 3KP1E 3QAUA 2C9OA 1J09A 2R4EA 3L28A 3JR4A 1Z5AA 1I4WA 1G4AE 3GLHA 3VFDA 4DR5M 3FUVA 2UXDM 4FWHA 1E94E 1Q3CA 2CV2A 2D7EA 1PJIA 3R9XB 4YHHM 4MB7A 2CV0A 3FUWA 4G4RA 4LFAM 1HNXM 1IN8A 3AOEC 2QBYA 2DWZB 4GMQA 4LJ9A 2LXEA 3IG8A 2P5TA 1HQCA 2F5SA 4ZPXA 3QWLA 1L2BA 4IBIA 5JI3E 3RFWA 2UU9M 3AKZA 1Z59A 1DO0A 3FYCA 4FW9A 1HT2E 1IBMM 4AQYM 4X65M 4II7A 4JI7M 4IBJA 4AKHA 4PT5A 3FKEA 3HHYA 5FSWA 4IBDA 3UMMA 2UUBM 3GPUA 2ZAOA 4BB9A 4GRIA 1L1TA 4I8OA 2XLJA 5BR8M 1VDDA 3RGPA 4DV1M 4MGIE 5KO3A 2JA2A 1KFVA 2Y0QA 4FCWA 3J2PB 2CFOA 5ITXA 3SMSA 3U6SA 1L2CA 4M9XA 1HT1E 1XHBA 3I4VA 4LF9M 4K0KM 2C99A 4LZJA 2F5QA 3KOZE 4P16A 3GLIA 3UJNA 1SXJB 2XEPA 1Z5CA 4X64M 1YSYA 2BJVA 2UXCM 4CISA 1ZAEA 2HKJA 3A42A 5IWAM 2C96A 4GHAA 2RKOA 3A98B 3M0EA 3KP0E 5DNYA 2RGHA 2Z4RA 3LVWA 3UK6A 3SASA 2D7GA 5FLXS 1HNZM 4XGIA 2UUAM 4QHTA 4X62M 2VQEM 3U60A 4AKIA 3KFUG 1GKIA 4IJFA 1NJFA 2L7IA 1ZQ9A 1IXZA 3J7AS 3GLFB 1IBKM 4GKKM 2O5RA 1XXHA 1L2DA 3U6OA 1H6UA 2L6OA 1KSFX 4OW0A 1QAQA 1G59A 2XFTA 1XWIA 5FTMA 4AZFA 2FE8A 1G3IA 2Z7JA 1Q3BA 1WXQA 2W82A 4JI1M 1Q39A 4I81A 4DR3M 4CHTB 1QQWA 1NHWC 3PVSA 3U61B 2ZM6M 5LMUM 3U5ZA 3U6CA 2LH0A 1HQYE 2BJWA 1TGUA 4I5SA 5GKNA 1FNNA 1IBLM 4MGZE 4L16A 2QP9X 3HHXA 1NY6A 4LJ5A 2H1RA 1TH4A 2LWXA 3ZCBB 1HR0M 4PCZA 5EXSA 3SYKA 3KS4A 3DFZA 2DXIA 2YQZA 1YE9A 2Y0TA 5EP1A 1XNQM 3W0LB 2FFJA 2C98A 3R8FA 2R45A 4OVZB 3I51A 3L29A 1NNUC 4LRTA 2KZSA 3M7GA 3GQ3A 5F3WA 1DGBA 1N34M 5KPRA 2DWLA 4JI4M 1N32M 1E9RA 1MU5A 3OTOM 4LFBM 3BOSA 4X66M 1E9SA 3CTWB 4LRSA 4D81A 3SMPA 4I4LA 1IN6A 1QVRA 3KDSE 1DGHB 1T3TA 2XH9A 4IBGA 4YY3M 3EIHA 4JYAM 4GC5A 5KPTA 1IXSB 2QCUA 2YNMD 1N75A 3SATA 2CEAA 1W5TA 2X4AA 4AG5A 3KSJA 3U6QA 1IN7A 4B3MM 3HHWA 1GL6A 1TH3A 1XNRM 5FTLA 5KQ8A 1J5EM 1K82A 5EXPA 3IG5A 2C9CA 4NOOB 4WW0A 3GQ4A 4LJ8A 3L26A 3HJQA 2F4VM 4LFCM 4L15A 4IBEA 5C1BA 2A5YB 1DGGA 2F5OA 4NL4H 3HJSA 4DUZM 3TQSA 1EE8A 1KYIA 2DWNA 1IY2A 1LV7A 3DZDA 1OFIA 4NSOB 1QYRA 2LNHC 3W0FA 4M0DA 4B7HA 2D7HA 2J7OA 2X49A 1Z5BA 4NRVA 2EA0A 2QBYB 1S3SA 3NWLA 3T1YM 4GH9A 1C1KA 2J7NA 2OQ4A 4WURA 3PNVA 2FNAA 4M9SA 3KOXE 4Z6YA 2XGNA 1OFHA 5FTNA 1NVMA 1N77A 2EO2A 2Z4SA 3AJIB 3GP1A 4D82A 5EP3A 2XFSA 3E4RA 4AG6A 3L27A 1QAMA 3FYDA 3FTEA 1SXJE 2R18A 4FCVA 4MH0E 4JI0M 3GLGA 5E26A 3JAMS 2XZUA 3VKHA 4CGYB 2I7PA 4DV5M 2DVWB 4JN6A 5JI2E 4Z8XA 4A3VB 4OX9M 4L4UA 3CF0A 4RF1A 5EP4A 4G4NA 1SXJA 3THGA 3GLIB 4IBCA 3HKPA 2XZFA 3KW6A 5ITQA 4NXMM 4KODA 4M9ZA 1IQPA 3KSXA 4JXJA 1IXRC 3HU3A 2Y20A 4BBAA 4QOZC 1DGFA 2CV1A 1JR3A 3B9PA 3FUTA 2ZBKB 1L1ZA 3GPPA 3TL4X 1E32A 4DR7M 4DR2M 4LGYA 4IBFA 1QANA 3ILKA 1TDZA 4LGMA 1IN4A 3VDPA 4MGHA 1IN5A 3FD9A 1PJJA 1G8PA 5ITRA 3GLFA 3CF6E 2VQFM 4FD2A 3T38A 3LVVA 1N78A 2F5PA 5KPZA 4KHPM 3HGIA 4DR4M 3HU1A 1D2NA 4LJAA 2EUCA 5BPVA 5A2QS 3TE6A 4DV7M 4FCTA 4G6ZA 3DA1A 3AOGA 3MK6A 1IY1A 4FWGA 3H4MA 3K8ZA 3U6MA 3U6EA 3SAWA 5ITTA 1FJGM 4GITA 4QOSA 4B3RM 2L7HA 2KEBA 4DV6M 1QZMA 3MJ5A 4MGYE 1L8QA 3KS8A 4DR1M 4FVMA 3JR5A 4LG2A 3LMMA 4RNAA 3L2AA 3RE8A 2KRUA 1XMOM 4DV2M 2KRKA 2DHRA 4IBBA 5FTJA 4PDIA 1TH2A 3FTFA 2CHQA 2M5ZA 3TWMA 4MGKE 3U6DA 8CATA 4R7GA 3J80S 4JI3M 3GQ5A 4OVZA 4PDGA 1R6BX 2AHMA 4LJ4A 3K92A 4B7FA 3TPZA 1Z6TA 3TWKA 1SXJD 2R65A 3SFZA 3SHGB 3GRVA 3M6AA 4KO8A 3K1JA 3PNYA 1QAOA 1JR3D 3T1HM 4NSRA 2Y21A 3SHFA 4HL4A 2Q2EB 4QNMA 1J7KA 3GLHB 5FTKA 3KXEC 4EIWA 3HWSA 2NQ8C 4GC9A 1SXJC 5ITUA 2RGOA 3LQQA 4DV0M 4TUWA 4KLNA 4LJ6A 2XSZD 2YFQA 3HU2A 3D8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPX A;  2UXB M;  4OX9 M;  1Q3B A;  1PM5 A;  4JI1 M;  1Q39 A;  1XMQ M;  4LF8 M;  4G4N A;  5ITY A;  4DR3 M;  2XZF A;  5ITQ A;  2ZM6 M;  5LMU M;  4NXM M;  4DR6 M;  4NRW A;  3U6C A;  3SAU A;  4ITQ A;  4GKJ M;  5LMN M;  3U6P A;  4JI2 M;  4JV5 M;  1IBL M;  3SAV A;  4G4O A;  4LF5 M;  4PD2 A;  1L1Z A;  2ZBK B;  3GPP A;  1NNJ A;  2E5L M;  1HR0 M;  4PCZ A;  3JR4 A;  4DR7 M;  4DR2 M;  1Z5A A;  3TWL A;  5ITX E;  1TDH A;  4DR5 M;  1TDZ A;  2UXD M;  1XNQ M;  1Q3C A;  3J81 S;  1PJJ A;  5ITR A;  2VQF M;  1PJI A;  1N34 M;  4JI4 M;  3GQ3 A;  4YHH M;  2F5P A;  2UUC M;  1N32 M;  3C58 A;  1MU5 A;  4MB7 A;  4NXN M;  4X66 M;  3OTO M;  4LFB M;  4G4R A;  4LFA M;  1HNX M;  4KHP M;  4DR4 M;  5A2Q S;  4DV7 M;  1R2Y A;  4B3S M;  2F5S A;  4YY3 M;  3U6L A;  3U6M A;  3U6E A;  3SAW A;  4JYA M;  1L2B A;  3SAR A;  5ITT A;  4G4Q A;  1FJG M;  4DUY M;  2UU9 M;  3VK8 A;  4LF7 M;  3SAT A;  1Z59 A;  3GPY A;  4B3R M;  4DV6 M;  1IBM M;  4AQY M;  4DR1 M;  4X65 M;  3JR5 A;  4JI7 M;  3DOA A;  3U6Q A;  1N36 M;  4B3M M;  2OPF A;  2UUB M;  4DV4 M;  3GPU A;  1XMO M;  4DV2 M;  1J5E M;  1K82 A;  1L1T A;  4B3T M;  1XNR M;  4PDI A;  3GQ4 A;  5BR8 M;  4JI5 M;  4DV1 M;  2F4V M;  4LFC M;  1KFV A;  2F5O A;  2HHH M;  3TWM A;  1K3X A;  4LF4 M;  3U6D A;  1L2C A;  5ITX A;  4JI3 M;  3J80 S;  3GQ5 A;  3U6S A;  1K3W A;  4PDG A;  4DUZ M;  4JI8 M;  3A46 A;  1EE8 A;  4LF9 M;  4K0K M;  2F5Q A;  3A45 A;  2F5N A;  3TWK A;  3W0F A;  1Z5C A;  4X64 M;  2EA0 A;  4NRV A;  1Z5B A;  4CIS A;  2UXC M;  2HKJ A;  3A42 A;  5IWA M;  3T1Y M;  4LF6 M;  4DV3 M;  2OQ4 A;  1N33 M;  3VK7 A;  3T1H M;  2Q2E B;  1MX0 A;  3GP1 A;  3SAS A;  5FLX S;  1HNZ M;  4JI6 M;  2UUA M;  1HNW M;  1R2Z A;  4X62 M;  2VQE M;  1I94 M;  3GO8 A;  3J7A S;  5ITU A;  1IBK M;  4GKK M;  4JI0 M;  3JAM S;  1L2D A;  3U6O A;  4DV0 M;  2XZU A;  5IT9 S;  1XC8 A;  4DV5 M;  3SBJ A; 
#chains in the Genus database with same CATH topology
 1QDT A;  3AL0 C;  2QEN A;  2G8L A;  1PM5 A;  2R4J A;  2RRU A;  4LF8 M;  1VQ1 A;  1T43 A;  4DR6 M;  2MRO B;  1NJG A;  1Y8G A;  4RF0 A;  3J7B A;  3SAU A;  2C5R A;  1D0M A;  2KNZ A;  4L78 A;  1QUS A;  2FOI C;  4GKJ M;  2CUZ A;  5LMN M;  3U6P A;  1QZE A;  2R44 A;  1HJP A;  2EKF A;  3PXG A;  4JI2 M;  4JV5 M;  1V92 A;  5EP2 A;  2R46 A;  3MMP A;  4G4O A;  4LF5 M;  1OTR A;  3SC3 A;  2ZAM A;  1ORY B;  2CHG A;  4R3D A;  2E5L M;  3D8B A;  1OJL A;  1W5S A;  1GLN A;  4HLQ A;  2V6Z M;  4FWD A;  1TDH A;  5EQT A;  3TWL A;  1DO2 A;  5ITX E;  1R5L A;  4B7G A;  2R0I A;  2CHV A;  3J81 S;  1PJT A;  3J27 B;  3GLI E;  2CE7 A;  4P17 A;  5EJC A;  2BNK A;  3GLG B;  2UUC M;  3C58 A;  2KZU A;  3SYL A;  4NXN M;  3W68 A;  4REZ A;  2HCB A;  2KW0 A;  3GRU A;  4D80 A;  5C18 A;  2ERC A;  2HL7 A;  1GVN A;  2LVQ D;  4AKG A;  1R2Y A;  4B3S M;  3FUX A;  4IBK A;  4L8R C;  1JQJ C;  3L25 A;  1T6O A;  2V1C A;  3U6L A;  2Z3X A;  5E6J A;  3SAR A;  3ZC7 B;  4G4Q A;  5EXT A;  4DUY M;  4LF7 M;  3VK8 A;  4QNR A;  4Y28 F;  4WP2 A;  3FTD A;  3IEC A;  3GPY A;  3UZU A;  3VKG A;  2DZN B;  4BLC A;  2VII A;  3AOE A;  2B3T A;  3BBZ A;  2DWM A;  3DOA A;  2DKL A;  1N36 M;  3U60 B;  1XXH E;  3E9S A;  5DYI A;  2OPF A;  2EKK A;  4DV4 M;  4B3T M;  1YUB A;  4LCB A;  1XXH B;  2XSZ A;  3FTC A;  2JZ0 A;  3E21 A;  3FUU A;  2DAK A;  3KOW E;  3WHK A;  7CAT A;  3HZJ A;  2K47 A;  1GL7 A;  4JI5 M;  4DBG B;  2HHH M;  5IRE B;  1NHG C;  5EXX A;  4F1I A;  1K3X A;  3Q8X A;  4LF4 M;  1K3W A;  1GAB A;  3AFH A;  1X37 A;  2I7N A;  2G5G X;  4JI8 M;  1GJS A;  3A46 A;  4LY6 A;  4XBO A;  4CIZ A;  1MN3 A;  3A45 A;  4W5W A;  1R7R A;  3U61 A;  4S12 A;  2F5N A;  4GIP A;  4AW4 A;  2QPA A;  2QQ8 A;  4OU7 A;  1UM8 A;  3U5Z B;  3K9P A;  3EIE A;  3T15 A;  4R71 A;  1PJQ A;  4LJ7 A;  4LF6 M;  3LCU A;  5H37 D;  3K2L A;  2XF3 A;  2DZO B;  1AUA A;  4DV3 M;  1N33 M;  3VK7 A;  3WHL A;  4IIW A;  2LVN C;  3NBI A;  1VG5 A;  2FH0 A;  4M0W A;  3ZH9 B;  4IJE A;  2L09 A;  5IZ7 D;  3HHZ A;  3GRR A;  1R4G A;  1QUT A;  1MX0 A;  4JI6 M;  4GHL A;  3MHV C;  3KVW A;  1R2Z A;  1HNW M;  3PFI A;  3RGS A;  3GO8 A;  1I94 M;  2V1U A;  2LVA A;  3LQR A;  1NY5 A;  1IM2 A;  3F92 A;  5IT9 S;  1ZV1 A;  2O25 A;  1NSF A;  2QZ4 A;  3KOY E;  1XC8 A;  2ZAN A;  2KA6 B;  2QHO B;  2VDB B;  3SBJ A;  3VLF B;  3GPX A;  3I4Y A;  2UXB M;  1DGH A;  2M60 A;  2APL A;  4F2L A;  1G41 A;  1XMQ M;  1TF0 B;  5ITY A;  3UGJ A;  1IY0 A;  3W67 A;  3AV0 A;  3VDU A;  2KXE A;  1PRB A;  1WR1 B;  2GNO A;  2O01 F;  2X8A A;  3CF2 A;  3GLH E;  4NRW A;  3E46 A;  4ITQ A;  4AI6 A;  4LZZ A;  5DYG A;  1EFU B;  3LCV B;  1D0K A;  3V76 A;  2DEN A;  3GRY A;  2YR0 A;  4B08 A;  3C3E A;  3SAV A;  4PD2 A;  2R62 A;  3HJ8 A;  1NNJ A;  1OIP A;  4QHS A;  5KQD A;  3KP1 E;  3QAU A;  2C9O A;  1J09 A;  2R4E A;  3L28 A;  3JR4 A;  1ZMU A;  1Z5A A;  3I04 M;  1I4W A;  1G4A E;  3GLH A;  3VFD A;  4DR5 M;  2GQF A;  3FUV A;  2UXD M;  2LHG A;  4FWH A;  1E94 E;  1Q3C A;  1WHC A;  2CV2 A;  2D7E A;  1PJI A;  3R9X B;  4YHH M;  4HEO A;  1VDL A;  4MB7 A;  4L6V 6;  2CV0 A;  2WSE F;  3FUW A;  4G4R A;  4LFA M;  1HNX M;  1IN8 A;  2DAM A;  2R6F A;  3AOE C;  2JY7 A;  2QBY A;  2BWB A;  2DWZ B;  4GMQ A;  4LJ9 A;  2LXE A;  3IG8 A;  2P5T A;  1HQC A;  2F5S A;  4ZPX A;  3QWL A;  1L2B A;  4IBI A;  2H5X A;  5JI3 E;  2MJ5 B;  3RFW A;  2UU9 M;  3IHP A;  4XK8 F;  3AKZ A;  1Z59 A;  1DO0 A;  3FYC A;  4FW9 A;  1HT2 E;  1IBM M;  4AQY M;  2CP8 A;  4X65 M;  1D0L A;  4II7 A;  4JI7 M;  4IBJ A;  4AKH A;  2OO9 A;  4PT5 A;  1OIZ A;  3FKE A;  3GLG E;  3HHY A;  5FSW A;  4MM3 B;  4IBD A;  3UMM A;  2UUB M;  2JY8 A;  3GPU A;  2ZAO A;  4BB9 A;  1BVS A;  4GRI A;  1L1T A;  4I8O A;  2XLJ A;  1QDR A;  5BR8 M;  1VDD A;  3RGP A;  4DV1 M;  4MGI E;  5KO3 A;  2JA2 A;  1KFV A;  2Y0Q A;  4FCW A;  2HAK A;  3J2P B;  2Z8Y M;  2CFO A;  5ITX A;  3SMS A;  3U6S A;  1L2C A;  1G71 A;  4M9X A;  3T6P A;  1HT1 E;  1XHB A;  3I4V A;  4LF9 M;  4K0K M;  2C99 A;  4LZJ A;  2F5Q A;  3KOZ E;  4P16 A;  3GLI A;  1XB2 B;  3UJN A;  1SXJ B;  2XEP A;  2G3Q A;  1Z5C A;  4X64 M;  1YSY A;  2BJV A;  2UXC M;  4CIS A;  1ZAE A;  2HKJ A;  3A42 A;  5IWA M;  2C96 A;  4GHA A;  3C3D A;  3B7Z A;  2RKO A;  3A98 B;  3M0E A;  3KP0 E;  5DNY A;  2RGH A;  2Z4R A;  2ZTD A;  3I01 M;  1PGY A;  4G3O A;  3LVW A;  3UK6 A;  3SAS A;  2D7G A;  5FLX S;  3B89 A;  1HNZ M;  4XGI A;  2UUA M;  2N35 A;  3LW5 F;  4QHT A;  4X62 M;  2VQE M;  3U60 A;  4AKI A;  3KFU G;  1GKI A;  4GEW A;  1NJF A;  2L7I A;  4IJF A;  1ZQ9 A;  1IXZ A;  3J7A S;  3GLF B;  2FS1 A;  1IBK M;  2O5R A;  4GKK M;  1XXH A;  2L2D A;  1L2D A;  4CJ6 A;  3H4J A;  3U6O A;  1H6U A;  2L6O A;  1KSF X;  4OW0 A;  1QAQ A;  1G59 A;  2XFT A;  1XWI A;  5FTM A;  4AZF A;  2FE8 A;  1G3I A;  2Z7J A;  1Q3B A;  1WXQ A;  2W82 A;  4NC6 A;  1Q39 A;  1VEJ A;  4UN2 B;  4JI1 M;  1CUK A;  4I81 A;  4DR3 M;  4CHT B;  1QQW A;  1NHW C;  3PVS A;  3U61 B;  2ZM6 M;  5LMU M;  1NV8 A;  3U5Z A;  3U6C A;  2LH0 A;  1HQY E;  2BJW A;  1TGU A;  4I5S A;  5GKN A;  1FNN A;  1OAO C;  2JUJ A;  2JZ1 A;  2MH8 A;  1IBL M;  4MGZ E;  4L16 A;  2QP9 X;  3HHX A;  1NY6 A;  4LJ5 A;  1AIP C;  2H1R A;  2ZTC A;  1TH4 A;  2LWX A;  3ZCB B;  2K6B A;  4PCZ A;  1HR0 M;  5EXS A;  3SYK A;  3KS4 A;  2JNH A;  3B74 A;  3DFZ A;  2DXI A;  2YQZ A;  1YE9 A;  2Y0T A;  5EP1 A;  1XNQ M;  3W0L B;  2FFJ A;  2C98 A;  3R8F A;  2R45 A;  4OVZ B;  3I51 A;  3L29 A;  1NNU C;  4LRT A;  2KZS A;  3M7G A;  3GQ3 A;  5F3W A;  1DGB A;  2DAE A;  5KPR A;  1N34 M;  2DWL A;  1N32 M;  1E9R A;  1MU5 A;  3OTO M;  4LFB M;  3BOS A;  4X66 M;  1E9S A;  3CTW B;  4LRS A;  2BWE A;  4D81 A;  3SMP A;  4I4L A;  1IN6 A;  1WIV A;  1QVR A;  4KT0 F;  3KDS E;  1DGH B;  2JXN A;  1T3T A;  2XH9 A;  4IBG A;  4YY3 M;  2MR9 A;  3EIH A;  4JYA M;  1F4I A;  4GC5 A;  5KPT A;  1IXS B;  1VEG A;  2QCU A;  2YNM D;  1N75 A;  3SAT A;  2CEA A;  1W5T A;  2X4A A;  2JY5 A;  4AG5 A;  2WSF F;  3KSJ A;  1UFZ A;  2OOB A;  1IFY A;  3U6Q A;  1IN7 A;  4B3M M;  1VEK A;  3HHW A;  1GL6 A;  1TH3 A;  1XNR M;  5FTL A;  1V33 A;  5KQ8 A;  1J5E M;  5EXP A;  1K82 A;  1C7Y A;  3IG5 A;  2C9C A;  4NOO B;  1MJG M;  2CWB A;  4WW0 A;  3GQ4 A;  4LJ8 A;  3L26 A;  3HJQ A;  2KHH A;  2F4V M;  4LFC M;  4L15 A;  4IBE A;  5C1B A;  2A5Y B;  1DGG A;  2F5O A;  4NL4 H;  2WSC F;  2KDL A;  3HJS A;  4DUZ M;  1P3Q Q;  3HX3 A;  3TQS A;  1EE8 A;  1KYI A;  2DWN A;  1IY2 A;  2J5Y A;  1LV7 A;  3BXW A;  1OFI A;  3DZD A;  1QYR A;  3FE3 A;  2QNJ A;  4NSO B;  2LNH C;  3W0F A;  4M0D A;  4B7H A;  1GO5 A;  2D7H A;  2DAG A;  2J7O A;  2DI0 A;  1Z5B A;  2X49 A;  4NRV A;  2EA0 A;  2QBY B;  1S3S A;  3NWL A;  1LTM A;  3T1Y M;  4GH9 A;  1C1K A;  2J7N A;  2OQ4 A;  4WUR A;  3PNV A;  2VF7 A;  3C9P A;  2FNA A;  4M9S A;  3KOX E;  2LVO C;  2DNA A;  4Z6Y A;  2XGN A;  1OFH A;  1ZMW A;  1NVM A;  2JP7 A;  5FTN A;  1N77 A;  1NO1 A;  2EO2 A;  2Z4S A;  3AJI B;  3CGW A;  1V34 A;  3GP1 A;  4D82 A;  1NV9 A;  5EP3 A;  2XFS A;  3E4R A;  4AG6 A;  3L27 A;  1QAM A;  3FRH A;  3FYD A;  3FTE A;  1SXJ E;  2DAI A;  2JY6 B;  2R18 A;  4FCV A;  2K0B X;  2LHC A;  4MH0 E;  4JI0 M;  1WGN A;  5E26 A;  3JAM S;  3GLG A;  2XZU A;  3VKH A;  4CGY B;  2I7P A;  1RU3 A;  4DV5 M;  2DVW B;  4JN6 A;  5JI2 E;  2EJS A;  1JR3 E;  4JI4 M;  4Z8X A;  1WGL A;  2JWS A;  4A3V B;  4L4U A;  4OX9 M;  2K9D A;  3CF0 A;  4RF1 A;  5EP4 A;  4G4N A;  1SXJ A;  3THG A;  3GLI B;  4IBC A;  3HKP A;  2XZF A;  3KW6 A;  5ITQ A;  4NXM M;  4KOD A;  4M9Z A;  1IQP A;  3KSX A;  1DV0 A;  4JXJ A;  1IXR C;  2MGW A;  3HU3 A;  3B7Q A;  3HY5 A;  2Y20 A;  4BBA A;  4QOZ C;  1DGF A;  2CV1 A;  1JR3 A;  3GLF E;  3B9P A;  3FUT A;  2ZBK B;  1L1Z A;  3GPP A;  1SG9 A;  3TL4 X;  1E32 A;  4DR7 M;  4DR2 M;  1TR8 A;  4LGY A;  2CRU A;  4IBF A;  1QAN A;  3ILK A;  1TDZ A;  4LGM A;  1IN4 A;  3VDP A;  4MGH A;  2HWJ A;  1IN5 A;  3FD9 A;  1PJJ A;  1G8P A;  5ITR A;  3GLF A;  3CF6 E;  2VQF M;  4FD2 A;  2VF8 A;  3T38 A;  3LVV A;  1N78 A;  3ZQJ A;  2F5P A;  3B7N A;  5KPZ A;  1WJ7 A;  4KHP M;  3HGI A;  4DR4 M;  3HU1 A;  1D2N A;  4LJA A;  2EUC A;  5BPV A;  2LVP C;  3TE6 A;  5A2Q S;  4DV7 M;  4FCT A;  4G6Z A;  3DA1 A;  3AOG A;  3MK6 A;  1IY1 A;  4FWG A;  3H4M A;  3K8Z A;  4RKU F;  3U6M A;  3U6E A;  3SAW A;  5L8R F;  5ITT A;  3Q8G A;  1FJG M;  4GIT A;  4QOS A;  4B3R M;  2L7H A;  2KEB A;  1GJT A;  1QZM A;  4DV6 M;  3MJ5 A;  4MGY E;  1L8Q A;  3KS8 A;  1OKS A;  4FVM A;  4DR1 M;  3JR5 A;  3FRI A;  4LG2 A;  3LMM A;  3NBX X;  4Q7J A;  2KNA A;  4RNA A;  1ZMV A;  2L4E A;  3L2A A;  3RE8 A;  2KRU A;  1XMO M;  4DV2 M;  2KRK A;  2DHR A;  4IBB A;  5FTJ A;  4PDI A;  1TH2 A;  2DZL A;  3FTF A;  2CHQ A;  2M5Z A;  3TWM A;  4MGK E;  2WZJ A;  2L4F A;  8CAT A;  3U6D A;  1YLA A;  4R7G A;  3J80 S;  4JI3 M;  4OVZ A;  4PDG A;  3GQ5 A;  1R6B X;  2AHM A;  1OAI A;  2KNV A;  4LJ4 A;  2QSF X;  3K92 A;  5DFL A;  4B7F A;  3TPZ A;  1Z6T A;  3TWK A;  1SXJ D;  2R65 A;  2LTU A;  1Q02 A;  1OQY A;  3SFZ A;  1TTE A;  3SHG B;  3GRV A;  2LBC A;  3M6A A;  1A5T A;  4KO8 A;  3K1J A;  3PNY A;  1QAO A;  4ANR A;  1JR3 D;  3T1H M;  2DHY A;  1IXS A;  4NSR A;  3QYB A;  1PJS A;  2Y21 A;  3SHF A;  4HL4 A;  2Q2E B;  1JB0 F;  4QNM A;  1J7K A;  3GLH B;  5FTK A;  3KXE C;  1EIJ A;  4EIW A;  3HWS A;  2NQ8 C;  4GC9 A;  1SXJ C;  2OOA A;  3QYE A;  5ITU A;  2RGO A;  3LQQ A;  4DV0 M;  3K9O A;  4TUW A;  4KLN A;  4LJ6 A;  2XSZ D;  2YFQ A;  3HU2 A;  3D8L A; 
#chains in the Genus database with same CATH homology
 3AL0 C;  2QEN A;  2G8L A;  1PM5 A;  2R4J A;  4LF8 M;  4DR6 M;  1NJG A;  4RF0 A;  2C5R A;  3J7B A;  3SAU A;  4L78 A;  2FOI C;  4GKJ M;  2CUZ A;  5LMN M;  3U6P A;  4JI2 M;  4JV5 M;  3PXG A;  5EP2 A;  2R46 A;  4LF5 M;  4G4O A;  3SC3 A;  2ZAM A;  1ORY B;  2CHG A;  4R3D A;  2E5L M;  3D8B A;  1OJL A;  1W5S A;  1GLN A;  4HLQ A;  2V6Z M;  4FWD A;  1TDH A;  5EQT A;  3TWL A;  1DO2 A;  5ITX E;  4B7G A;  2CHV A;  3J81 S;  3J27 B;  2CE7 A;  5EJC A;  2BNK A;  3GLG B;  2UUC M;  3C58 A;  2KZU A;  3SYL A;  4NXN M;  4REZ A;  2HCB A;  2KW0 A;  3GRU A;  4D80 A;  5C18 A;  2ERC A;  2HL7 A;  1GVN A;  4AKG A;  1R2Y A;  4B3S M;  3FUX A;  4IBK A;  4L8R C;  1JQJ C;  3L25 A;  2V1C A;  3U6L A;  2Z3X A;  5E6J A;  3SAR A;  3ZC7 B;  4G4Q A;  5EXT A;  4DUY M;  4LF7 M;  3VK8 A;  4QNR A;  3FTD A;  3GPY A;  3VKG A;  3UZU A;  2DZN B;  4BLC A;  2VII A;  3AOE A;  2DWM A;  3DOA A;  1N36 M;  3U60 B;  5DYI A;  3E9S A;  2OPF A;  4DV4 M;  4B3T M;  1YUB A;  4LCB A;  1XXH B;  2XSZ A;  3FTC A;  3FUU A;  3KOW E;  4MM3 B;  3WHK A;  7CAT A;  4JI5 M;  2K47 A;  1GL7 A;  2HHH M;  5IRE B;  1NHG C;  5EXX A;  1K3X A;  3Q8X A;  4LF4 M;  1K3W A;  3AFH A;  1X37 A;  2I7N A;  2G5G X;  4JI8 M;  3A46 A;  4LY6 A;  4XBO A;  3A45 A;  4W5W A;  1R7R A;  3U61 A;  4S12 A;  2F5N A;  4GIP A;  4AW4 A;  2QPA A;  4OU7 A;  1UM8 A;  3U5Z B;  3EIE A;  3T15 A;  4LJ7 A;  4LF6 M;  5H37 D;  3K2L A;  2XF3 A;  2DZO B;  4DV3 M;  1N33 M;  3VK7 A;  3WHL A;  4IIW A;  3NBI A;  4M0W A;  3ZH9 B;  4IJE A;  2L09 A;  5IZ7 D;  3HHZ A;  3GRR A;  1MX0 A;  4JI6 M;  4GHL A;  3MHV C;  3KVW A;  1R2Z A;  1HNW M;  3PFI A;  3RGS A;  3GO8 A;  1I94 M;  2V1U A;  3LQR A;  1NY5 A;  1IM2 A;  5IT9 S;  3KOY E;  1NSF A;  2QZ4 A;  1XC8 A;  2ZAN A;  2KA6 B;  3SBJ A;  3VLF B;  3GPX A;  3I4Y A;  2UXB M;  1DGH A;  2M60 A;  1G41 A;  1XMQ M;  5ITY A;  3UGJ A;  1IY0 A;  3AV0 A;  3VDU A;  2KXE A;  2X8A A;  3CF2 A;  4NRW A;  4ITQ A;  4AI6 A;  4LZZ A;  5DYG A;  3GRY A;  2YR0 A;  4B08 A;  3SAV A;  4PD2 A;  2R62 A;  3HJ8 A;  1NNJ A;  4QHS A;  5KQD A;  3KP1 E;  3QAU A;  2C9O A;  1J09 A;  2R4E A;  3L28 A;  3JR4 A;  1Z5A A;  1I4W A;  1G4A E;  3GLH A;  3VFD A;  4DR5 M;  3FUV A;  2UXD M;  4FWH A;  1E94 E;  1Q3C A;  2CV2 A;  2D7E A;  1PJI A;  3R9X B;  4YHH M;  4MB7 A;  2CV0 A;  3FUW A;  4G4R A;  4LFA M;  1HNX M;  1IN8 A;  3AOE C;  2QBY A;  2DWZ B;  4GMQ A;  4LJ9 A;  2LXE A;  3IG8 A;  2P5T A;  1HQC A;  2F5S A;  4ZPX A;  3QWL A;  1L2B A;  4IBI A;  5JI3 E;  3RFW A;  2UU9 M;  3AKZ A;  1Z59 A;  1DO0 A;  3FYC A;  4FW9 A;  1HT2 E;  1IBM M;  4AQY M;  4X65 M;  4II7 A;  4JI7 M;  4IBJ A;  4AKH A;  4PT5 A;  3FKE A;  3HHY A;  5FSW A;  4IBD A;  3UMM A;  2UUB M;  3GPU A;  2ZAO A;  4BB9 A;  4GRI A;  1L1T A;  4I8O A;  2XLJ A;  5BR8 M;  1VDD A;  3RGP A;  4DV1 M;  4MGI E;  5KO3 A;  2JA2 A;  1KFV A;  2Y0Q A;  4FCW A;  3J2P B;  2CFO A;  5ITX A;  3SMS A;  3U6S A;  1L2C A;  4M9X A;  1HT1 E;  1XHB A;  3I4V A;  4LF9 M;  4K0K M;  2C99 A;  4LZJ A;  2F5Q A;  3KOZ E;  4P16 A;  3GLI A;  3UJN A;  1SXJ B;  2XEP A;  1Z5C A;  4X64 M;  1YSY A;  2BJV A;  2UXC M;  4CIS A;  1ZAE A;  2HKJ A;  3A42 A;  5IWA M;  2C96 A;  4GHA A;  2RKO A;  3A98 B;  3M0E A;  3KP0 E;  5DNY A;  2RGH A;  2Z4R A;  3LVW A;  3UK6 A;  3SAS A;  2D7G A;  5FLX S;  1HNZ M;  4XGI A;  2UUA M;  4QHT A;  4X62 M;  2VQE M;  3U60 A;  4AKI A;  3KFU G;  1GKI A;  4IJF A;  1NJF A;  2L7I A;  1ZQ9 A;  1IXZ A;  3J7A S;  3GLF B;  1IBK M;  4GKK M;  2O5R A;  1XXH A;  1L2D A;  3U6O A;  1H6U A;  2L6O A;  1KSF X;  4OW0 A;  1QAQ A;  1G59 A;  2XFT A;  1XWI A;  5FTM A;  4AZF A;  2FE8 A;  1G3I A;  2Z7J A;  1Q3B A;  1WXQ A;  2W82 A;  4JI1 M;  1Q39 A;  4I81 A;  4DR3 M;  4CHT B;  1QQW A;  1NHW C;  3PVS A;  3U61 B;  2ZM6 M;  5LMU M;  3U5Z A;  3U6C A;  2LH0 A;  1HQY E;  2BJW A;  1TGU A;  4I5S A;  5GKN A;  1FNN A;  1IBL M;  4MGZ E;  4L16 A;  2QP9 X;  3HHX A;  1NY6 A;  4LJ5 A;  2H1R A;  1TH4 A;  2LWX A;  3ZCB B;  1HR0 M;  4PCZ A;  5EXS A;  3SYK A;  3KS4 A;  3DFZ A;  2DXI A;  2YQZ A;  1YE9 A;  2Y0T A;  5EP1 A;  1XNQ M;  3W0L B;  2FFJ A;  2C98 A;  3R8F A;  2R45 A;  4OVZ B;  3I51 A;  3L29 A;  1NNU C;  4LRT A;  2KZS A;  3M7G A;  3GQ3 A;  5F3W A;  1DGB A;  1N34 M;  5KPR A;  2DWL A;  4JI4 M;  1N32 M;  1E9R A;  1MU5 A;  3OTO M;  4LFB M;  3BOS A;  4X66 M;  1E9S A;  3CTW B;  4LRS A;  4D81 A;  3SMP A;  4I4L A;  1IN6 A;  1QVR A;  3KDS E;  1DGH B;  1T3T A;  2XH9 A;  4IBG A;  4YY3 M;  3EIH A;  4JYA M;  4GC5 A;  5KPT A;  1IXS B;  2QCU A;  2YNM D;  1N75 A;  3SAT A;  2CEA A;  1W5T A;  2X4A A;  4AG5 A;  3KSJ A;  3U6Q A;  1IN7 A;  4B3M M;  3HHW A;  1GL6 A;  1TH3 A;  1XNR M;  5FTL A;  5KQ8 A;  1J5E M;  1K82 A;  5EXP A;  3IG5 A;  2C9C A;  4NOO B;  4WW0 A;  3GQ4 A;  4LJ8 A;  3L26 A;  3HJQ A;  2F4V M;  4LFC M;  4L15 A;  4IBE A;  5C1B A;  2A5Y B;  1DGG A;  2F5O A;  4NL4 H;  3HJS A;  4DUZ M;  3TQS A;  1EE8 A;  1KYI A;  2DWN A;  1IY2 A;  1LV7 A;  3DZD A;  1OFI A;  4NSO B;  1QYR A;  2LNH C;  3W0F A;  4M0D A;  4B7H A;  2D7H A;  2J7O A;  2X49 A;  1Z5B A;  4NRV A;  2EA0 A;  2QBY B;  1S3S A;  3NWL A;  3T1Y M;  4GH9 A;  1C1K A;  2J7N A;  2OQ4 A;  4WUR A;  3PNV A;  2FNA A;  4M9S A;  3KOX E;  4Z6Y A;  2XGN A;  1OFH A;  5FTN A;  1NVM A;  1N77 A;  2EO2 A;  2Z4S A;  3AJI B;  3GP1 A;  4D82 A;  5EP3 A;  2XFS A;  3E4R A;  4AG6 A;  3L27 A;  1QAM A;  3FYD A;  3FTE A;  1SXJ E;  2R18 A;  4FCV A;  4MH0 E;  4JI0 M;  3GLG A;  5E26 A;  3JAM S;  2XZU A;  3VKH A;  4CGY B;  2I7P A;  4DV5 M;  2DVW B;  4JN6 A;  5JI2 E;  4Z8X A;  4A3V B;  4OX9 M;  4L4U A;  3CF0 A;  4RF1 A;  5EP4 A;  4G4N A;  1SXJ A;  3THG A;  3GLI B;  4IBC A;  3HKP A;  2XZF A;  3KW6 A;  5ITQ A;  4NXM M;  4KOD A;  4M9Z A;  1IQP A;  3KSX A;  4JXJ A;  1IXR C;  3HU3 A;  2Y20 A;  4BBA A;  4QOZ C;  1DGF A;  2CV1 A;  1JR3 A;  3B9P A;  3FUT A;  2ZBK B;  1L1Z A;  3GPP A;  3TL4 X;  1E32 A;  4DR7 M;  4DR2 M;  4LGY A;  4IBF A;  1QAN A;  3ILK A;  1TDZ A;  4LGM A;  1IN4 A;  3VDP A;  4MGH A;  1IN5 A;  3FD9 A;  1PJJ A;  1G8P A;  5ITR A;  3GLF A;  3CF6 E;  2VQF M;  4FD2 A;  3T38 A;  3LVV A;  1N78 A;  2F5P A;  5KPZ A;  4KHP M;  3HGI A;  4DR4 M;  3HU1 A;  1D2N A;  4LJA A;  2EUC A;  5BPV A;  5A2Q S;  3TE6 A;  4DV7 M;  4FCT A;  4G6Z A;  3DA1 A;  3AOG A;  3MK6 A;  1IY1 A;  4FWG A;  3H4M A;  3K8Z A;  3U6M A;  3U6E A;  3SAW A;  5ITT A;  1FJG M;  4GIT A;  4QOS A;  4B3R M;  2L7H A;  2KEB A;  4DV6 M;  1QZM A;  3MJ5 A;  4MGY E;  1L8Q A;  3KS8 A;  4DR1 M;  4FVM A;  3JR5 A;  4LG2 A;  3LMM A;  4RNA A;  3L2A A;  3RE8 A;  2KRU A;  1XMO M;  4DV2 M;  2KRK A;  2DHR A;  4IBB A;  5FTJ A;  4PDI A;  1TH2 A;  3FTF A;  2CHQ A;  2M5Z A;  3TWM A;  4MGK E;  3U6D A;  8CAT A;  4R7G A;  3J80 S;  4JI3 M;  3GQ5 A;  4OVZ A;  4PDG A;  1R6B X;  2AHM A;  4LJ4 A;  3K92 A;  4B7F A;  3TPZ A;  1Z6T A;  3TWK A;  1SXJ D;  2R65 A;  3SFZ A;  3SHG B;  3GRV A;  3M6A A;  4KO8 A;  3K1J A;  3PNY A;  1QAO A;  1JR3 D;  3T1H M;  4NSR A;  2Y21 A;  3SHF A;  4HL4 A;  2Q2E B;  4QNM A;  1J7K A;  3GLH B;  5FTK A;  3KXE C;  4EIW A;  3HWS A;  2NQ8 C;  4GC9 A;  1SXJ C;  5ITU A;  2RGO A;  3LQQ A;  4DV0 M;  4TUW A;  4KLN A;  4LJ6 A;  2XSZ D;  2YFQ A;  3HU2 A;  3D8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...