4DR7O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr7O00
2UXCO 4GKKO 1I94O 3M8AA 4LFAO 4YHHO 2UU9O 2VQEO 4DR4O 2LW7A 4DUZO 4X62O 4NXNO 2DJVA 3JAMN 1FYJA 1IBMO 1AB3A 1N36O 1N32O 1G1XB 4X64O 2E5LO 1N33O 1D2DA 4YY3O 4JI6O 5BXZA 4JV5O 4A5UB 1FKAO 4LF5O 4DV5O 2UUBO 2F4VO 4K0KO 4LFBO 4DV2O 2UUAO 1AILA 1DK1A 4B3SO 3J7AU 5LMNO 3R66A 4B3MO 1HNWO 1XEQA 4DV0O 2HHHO 4B3TO 4LF6O 4X66O 4DUYO 3OTOO 4DV6O 1HR0O 1NS1A 5LMUO 1XMOO 4LFCO 2UXBO 2ZKOA 4JI5O 2ZM6O 2DOSA 3O65A 5IWAO 4OPAA 5FLXN 4LF4O 4JI7O 4JI3O 5BY1A 1R6TA 4DR1O 3J81N 1XNRO 4NXMO 4DV7O 3F5TA 2JRIA 4JI0O 4DV3O 5A2QN 2Z0AA 5BR8O 1A32A 3SDLA 4JI8O 4AQYO 1J5EO 4LF9O 1HNZO 4JYAO 3T1YO 5LL6Y 4DR2O 3J80N 3RT3C 2VQFO 2UUCO 3T1HO 4DR3O 4OPHA 1X59A 1R1BA 1FJGO 4DV1O 4DR5O 1F7YA 1XMQO 4JI2O 4JI4O 1XNQO 4DR6O 5IT9N 5H5NA 4KHPO 4JI1O 4LF8O 1YZBA 4DV4O 1IBKO 2N74A 1N34O 4B3RO 2AGAA 2UXDO 4DR7O 1IBLO 4X65O 1KUQA 4LF7O 4OX9O 4GKJO 2FKXA 1HNXO
chains in the Genus database with same CATH superfamily
4HNAB 5E1AC 4O4IA 2YDEA 5KHIA 3CE2A 3OGCC 4X66B 3OTOB 2YIBD 4WBNB 5KUMA 3JSNA 2AHYA 4X62O 2DJVA 2OT5A 4ZBMA 2WWWA 1H2NA 5B5EZ 2PI4A 5EBLC 2Q8VA 1U97A 1S5LZ 3SPCA 4JI6O 2ADQB 1NQTA 2ZNJA 1GTOA 4RO2A 3FYIB 1N0NA 5LXTB 2EILC 4JYAB 4QGPA 5KA6A 2NN4A 2CAZC 1B3QA 3I55V 1SKVA 2E76B 4MT8A 5J9PC 3W7XA 4DR5B 4LF6O 5DEDA 4CH3A 4FMTA 3IGAC 4JI3O 1FXKC 3KG2A 4MVQA 3IJ4A 3JASB 4LF7B 2FYUH 5H9CA 2Z0AA 4J80A 1KP3A 1AP6A 1JX9A 4OXSA 4PA9A 1I94B 3JALA 3S3WA 4W4KA 1GN3A 4LF9O 3LSSA 4IHJB 5J2TB 1NR1A 5LL6Y 1ZLZA 3CCVV 2YIAA 3RT3C 2YIDA 1M4UA 1VEWA 3OE7G 3CRRA 3RVZA 5DN6G 3HKCA 2WLLA 3EVKA 1E79G 4X64B 3OMNB 4U3JB 5JVDA 5K1XA 1Q6HA 2PYLA 2JS3A 2UUBB 3F7VC 3BAAA 2EIKB 3ZRSA 4ABMA 4DR7O 3SYAA 1TAEA 4X65O 1AROP 2FKXA 4QPJA 4FM1A 4GKKO 3FAVA 1IX9A 1OCRC 3JCZA 2A06H 3K9SA 3DGEA 1OHHG 3ABLC 3HKDA 1MMMA 1S3JA 4J10A 5IJ9B 2XTAA 3STLC 3SJCC 4JV5O 4JYCA 4LF5O 2KB1A 5CA0A 1JOYA 1DK1A 1QR9A 3ZS8C 4I9WA 3W7SA 4GX0A 3K04A 2Q68A 1MSDA 1DF5A 4X66O 3OTOO 2JIZG 2V7QG 3HKEA 1PM9A 3LDCA 4FLUA 3O65A 3CSXA 4OPAA 5EBWC 5KHHA 1PL0A 4TQFA 4UCSA 1J5EB 3R65A 4FM0A 3CPWU 1SA0B 3KCXA 2IBZH 2OIGA 3A0BZ 2JK5C 5BR8O 1JFFB 3ETQA 2F95B 2P4VA 4QE7A 1U96A 3P3PA 4JYAO 2JGUA 4J42A 5IY5C 3SYQA 1BMFG 4U7NA 4DR5O 1F7YA 1BCCH 1N32B 4K35A 3T2MA 2PY5A 5IT9N 2A9HA 2N74A 2VWJA 1JJOA 2QKSA 5GONB 2UUAB 2YEVA 4TV8A 4DR4B 4LF7O 3ZJZA 1FFXA 1SETA 4WF9V 1I94O 3O9OA 1RM1C 3U11A 5L3FA 1Z5WA 3UO2A 2KKWA 4CS3A 1YIJV 1Q90D 2W0XA 3DSQA 4WFBV 2P90A 4X64O 1OJHA 2YC0A 2F43G 4BIOA 5JWPA 5IJ0A 2X7RB 2UUBO 4FK5C 1KC8W 2R9RB 1MABG 1HDJA 4N23A 3SPGA 4H0LB 1Y6XA 3G4SV 3UT5B 3K57A 1XBLA 4DR3B 2HLDG 2OWOA 1Q7YW 5JJNB 2WA4A 4DYLA 2GHYA 5LMUO 4FLVA 1K3EA 4Q6GA 4F6RB 4YJ3A 3LSUA 2LGWA 5FLXN 4JASA 2WA3A 1N34B 1PNMA 3H1LH 3OEEG 3G71V 4AQYB 1P4RA 5FL7G 3E83A 2DYRC 4DO2A 1ORQC 3FFQA 5CBGA 3RFRA 3H1IH 3SDLA 1SESA 4NKGB 3WFVA 4LFAB 1YHQV 1YTFD 4O4JA 4X1YA 4D7SA 3DXRB 1S5JA 2DW4A 4OPHA 3THOA 1BE3H 3P30A 2Y69B 3CRQA 1K8AW 5JCOC 5EYPB 2Q5ZA 2BCCH 3VQYA 4YIOA 1I5XA 2CTPA 1AVMA 3P32A 5B1OA 4J11A 5KUKA 5L3GA 4W4LA 5B1AC 5K1PA 1AR1B 4FFBA 1P84F 1V54C 4UV9A 4N21A 5LP6B 1WA8A 1SZXA 1XREA 2HHHB 5GTHZ 2EBOA 4DUYB 4RWUA 1B06A 1M9NA 1BHAA 1KKDA 2EJ7A 1Y76A 3CCLV 1N32O 3K3WA 3RYCA 3AG3C 2JGDB 2Y4UA 2CTQA 1ZWIC 3E8FA 5FNVB 1NU1H 1TUBA 2UUAO 2B1IA 1TVKA 1YVWA 2EULA 4PHZA 1JCHA 1VQLV 1L8DA 4X8AA 2IH3C 1OCCC 4K3AA 2O57A 1WPXA 4JI4B 3SPIA 2LJ2A 1K34A 4NYKA 2AZ0A 2QSAA 3ASOB 4DV4B 1K4CC 2QM7A 4TV9B 2GV9A 5C93A 3A8TA 2JRIA 1ZAUA 3ZEDA 3ETEA 2AHZA 1GKFA 4BWAA 4PA4A 1S5HC 2BTQA 2WLNA 3CJHA 2OCCB 4E4EA 3WB1A 3JAWA 5B3SB 1XL6A 3J80N 3STZC 4ZHQA 3K58A 4DR3O 4G27B 3K5LA 4RAIA 4RQFA 2P4KA 1KD1W 2QDOA 2ODMA 1BL8A 3G6EV 3AG2B 3QNEA 1NI8A 5KX5A 2X6BA 5CA1B 1GM7A 4JAVA 5H5NA 2FL4A 2VWKA 2GBOA 4LFBB 1O9GA 1N34O 1M56B 4LP8A 4ZOLB 3WG7C 3CCUV 1KUQA 5ITZB 1Y74A 1GK9A 1D5AA 4LBEC 4X88A 1JR9A 3JD2A 3M8AA 4PDLA 4LFAO 4MVRA 4O2BA 3A2FA 4X1KA 1ZUQA 2IW5A 3CB2A 1RPRA 2QM8A 4JPRA 2RDCA 2RQ6A 2Q73A 2ETNA 1ZL8A 2EIJB 5CMUA 3CRMA 4H13B 1P7BA 2YXLA 3ABKC 2K9PA 2X0LA 1YF2A 3KCYA 3CP1A 1AI7A 1AI6A 4GZRB 2DN9A 4HNAA 4LR3A 5L3DA 5CBHA 2M7WA 2ZIOA 4DW0A 2VQFB 1IZ3A 3C3SA 1NJIW 4TT3G 2HHHO 4WBNA 4DUYO 3JD4A 3M99B 4DK1A 2JEUA 2DOSA 2EZPA 3AG1B 3RWRD 1V55C 2P6JA 1PNLA 4NTWA 2WLHA 5KA5A 5EIBD 5LXTA 2HVJC 1AP5A 2ITCC 2ZXWC 1QLEB 1WP8A 4CZZA 4G28B 4D7TA 2L6LA 3B09A 5GW7A 1H2KA 1K4DC 3VBBA 4JYBA 1N36B 1R73A 2QTSA 1D5NA 4Q20A 5JQGB 4BW5A 2QR4A 4JI4O 2R70A 4DV4O 1Y66A 3JASA 3QG5A 2QKCA 4WCEV 4J7JA 2WPDG 2X6CA 2JJ2G 4IHJA 4RQEA 5J2TA 1ZSPA 3IFXA 4MVZA 4B3TB 1QVGU 4ASUG 4LFCB 1BQ0A 1FD9A 4LF5B 4U3JA 1XNRB 1THZA 1VIBA 1PPJH 2LW1A 3ABMB 1L0LH 2VRZA 3OTFA 4LFBO 3CCMV 4D6TH 3D36A 1US6A 3UO3A 3ZHTA 4PD4F 2QWRB 1QHTA 3B8NA 3VQWA 2DYSC 3JD1A 1VQ4V 5EK0A 1HNWO 4PA7A 4UCUA 4O4LB 3HKBB 4U7OA 3D3IA 3JSLA 4WFGA 4Z1VA 5IJ9A 3ICXA 5KAFZ 5BR8B 1Y67A 2LO1A 2Y0IA 3CMEV 2HVKC 3CHXA 1M57C 3CCRV 3E35A 3APOA 5CA3A 1NH2D 1O9HA 4CBCA 4YJ2B 4JTAB 2QWOB 3RYFB 3JARB 1Q81W 1LR1A 3HR0A 5BZBA 3ML0A 1PV0A 2VQFO 2QTOA 2PZSA 1PNKA 3BCCH 3ZMSA 2XOKG 4MS2A 2Q0OC 1K7DA 4ZI7B 5LHIA 4X1IB 2X6AA 4JTDB 4UVAA 2R9AA 4FIPC 4BIUA 1Z5VA 1OCZC 3AG4B 3MHSC 4MVMA 1SA0A 2AGAA 4J7ZA 3L70H 4B3SB 4PDRA 1JFFA 1YI2V 1GRJA 1KB9F 1FFTB 4R8CA 5E79Z 1GN6A 5H6QA 2WLMA 3E22B 1CXZB 3Q4HB 3RGBA 1QNMA 2QA4V 3GWKC 2CH7B 3FD9A 1OCOB 1BHBA 2ZM6B 3RYIB 2DE0X 1N36O 3ZBHA 4DV7B 2ZNIA 3N2KB 1XL4A 5GONA 2CK3G 1YJWV 5IYZB 2YIBA 2EZOA 4HBNA 4RUEA 2JEXA 3MD0A 1VQMV 3LSQA 4I4TB 3MAQA 5IDJA 4HZ3A 2PUSA 3SJQC 5LMUB 1SQPH 2ZDIA 1XEQA 1CPYA 5JJJB 3X2QB 2Q67A 2AW9A 2QGNA 4B3TO 4UFZA 4LFCO 5KHGA 3CXHF 4LF8B 1XNRO 3A0RA 3TETA 2Q7GA 4EFEA 1BZKA 2Q4PA 1EZJA 4FLXA 3ZMUA 1EN6A 3CC7V 3UT5A 1VQ7V 4I7ZB 2IJIA 2Q0AA 4MVSA 2IJHA 3N2GB 1XUQA 3BA9A 1LUVA 2JS5A 2E74B 3SR2C 4F6RA 2GUZB 1M93A 1XILA 2Y48A 3BFRA 3SYOA 3ZMVA 5BMVB 3LDEA 2OTLV 4I50B 3TXSA 3SPHA 3U10A 1M5IA 3ZN1A 2CTWA 4F4LA 3OR7C 4LH6A 3FB6C 4ICGA 1AJNA 3CD6V 2FB5A 5EBMC 2EIMB 3DXRA 3LNNA 4CS2A 3UCSC 4UV8A 4DUZO 1VF6A 4NTYA 3S3XA 3TJTA 5A9GA 2R72A 1XI1A 2W6IG 5EYPA 2W6JG 3PJSK 1YSCA 1K92A 3RYHB 2UXXA 2IJKA 3CRAA 1VQ8V 4PI2A 5B66Z 2OCHA 4EB6B 3FKSG 3E89A 4H33A 4I0XB 3LDDA 1G4YB 2JDIG 1H2LA 4H37A 4P30A 1HNZB 1BT8A 4B3SO 2IM9A 5L3BA 4UXNA 1W0KG 5LP6A 3SGIA 4I9QA 2ZE7A 4QIWF 3B4SA 1BS3A 1M56C 3OUSA 3QO8A 3ZHSA 1NH2B 2ZM6O 2YSUB 3OR6C 1VP7A 3AK2A 2JGDA 1H2GA 2EILB 5LBQA 5JH7B 4DV7O 3RN4A 3E2EA 5FNVA 1R3IC 1HNXB 4FZ1A 4J7KA 5L3EA 2HJFC 3BY6A 2UU9B 4GX5A 4LCUC 5IE9A 3AK3A 2DQ3A 3B77A 1VQ5V 2N04A 3CCQV 2EINB 3K06A 2QKAA 1RSOB 1FXKB 1R3JC 3KZIZ 3GWOA 1KQSU 1MZEA 5B1BC 1XDCA 4YIPA 3CXCU 1EFRG 3H9VA 1ROPA 4KXRA 4TV9A 4DK0A 3QF7A 4LF8O 4QNHB 4KP4A 2F66C 4MW8A 3M7MX 2F4VB 2OYQA 1PL4A 3SYPA 4TUYB 1NKDA 1R3KC 1YJ9V 1KYOF 2IJJA 1SS3A 2YS8A 4I55B 1UJWB 3PN1A 4HAMA 2XAJA 3JAMN 4LF4B 3IC7A 5CA1A 1AB3A 3I5DA 4L8JA 5LA6B 1XHXA 5BXZA 1YXBA 4FJCC 1IURA 4ZOLA 2AZ2A 4MSWC 1R6NA 1NBMG 1EN4A 5KHJA 5ITZA 1G6UA 1OCRB 1JQ0A 4JAAA 2UUCB 3T1HB 1MG1A 2DWEC 3ABLB 1R6KA 1WN7A 2CUGA 1R3LC 4UCOA 1B6QA 4JI1B 5DM6V 1XOUA 3ASNC 1VMGA 3B2EE 1M1KW 1N8RW 1VF5B 2IU3A 1YCIA 3OD4A 1ZTEA 4FLTA 1M90W 2QWQB 2UXCB 1A32A 1X4TA 1Q43A 2XAGA 4IIJB 2V4DA 1HNZO 2HP8A 2IH1C 1QU7A 2Q7EA 4TOIA 2ATKC 3GVMA 2FMLA 3U0ZA 1R1BA 2BE3A 2ZCEA 1H2MA 4GX2A 1IBMB 2E3CA 3UM7A 1N33B 1FXVA 1NVPD 2RN9A 1WB8A 1QQCA 4DV5B 5CBFA 4FLYA 1QR8A 4TWKA 4DV2B 5KMGB 3K0DA 1AI5A 1IDSA 3CCSV 4K8ZA 1RP3B 1HNXO 3VQXA 4LNUB 2EJRA 2UU9O 4B7KA 2WLIB 1F4NA 3W7WA 2AXTZ 2C2AA 2PTMA 1LNQA 1HWYA 1DTOA 5JQGA 4DR1B 4IYIA 5H2FZ 1D2DA 2ZIMA 5DECA 3FB8C 2G38A 2F4VO 3G6BA 3WU2Z 4BR6A 1HNWB 3ZHQA 1RM1B 1AILA 4JYYA 3KKYA 1F51A 4PV1B 5EZYB 1QLNA 4Z1MG 3R66A 2R9IA 4B3MO 1PD3A 2E75B 3AK1A 1VQOV 1AJPA 4X20B 2WLJA 4LF4O 5BY1A 3K08A 3J81N 3TK1A 3F5TA 3BPZA 2Q6AA 2KG7B 1IVSA 3MDSA 3EXAA 1EBOA 5KHKA 2EIKC 3AEIA 4UCRA 2F93B 2B1GA 3IAYA 3D36C 4O4LA 3MHHC 4LWSB 3HKBA 2UUCO 3T1HO 2XAFA 5CB4B 2RNBA 4X89A 2GDSA 1YTFB 4O4HB 4EKWA 3IC9A 2GTAA 1XHZA 2DYRB 5FPRA 4JI1O 2DWDC 3ZRWB 4DRXB 4YJ2A 2KSDA 3RYFA 2RJZA 3JARA 2P7TC 2UXCO 2BSKB 3TXQA 4DV0B 3JAKB 2LW7A 1WAZA 3L9DA 2YXHA 4KUMA 2UXBB 1AR4A 1N0JA 4WFEA 5AG2A 1TA8A 1IBMO 4ZI7A 4X1IA 2ZR3A 5B1AB 1N33O 3OW2U 1XQ8A 2HEPA 4DV3B 1V54B 4DV5O 2UXNA 4MVOA 1NTMH 2ADPA 3OMIB 4DV2O 5D5QA 2HFEC 4JI8B 1SERA 3RVYA 3LNMB 4P2ZA 3K0GA 3P3NA 3T1YB 1IXBA 2MK3A 4FPPA 4GYCB 3E22A 4MTXA 3Q4HA 4CC5A 2K1EA 4WFFA 4B08A 2CH7A 1FAFA 4DV1B 5C8YB 2ZR2A 4C7UA 3AG3B 3RYIA 1NS1A 4JI2B 1XNQB 2ZKOA 4LH7A 5LHHA 1H8HG 4DR1O 3N2KA 3QVNA 2XASA 2RCVA 3L72H 1VQ6V 5J2UB 5IYZA 3E8BA 3HPLC 2UXDB 2P06A 2CTRA 1TUEB 3CC2V 3JATB 4GKJB 2QM4A 4I4TA 1I7FA 1OCCB 3SJBC 4YHHB 5JJEB 3DC5A 1I5YA 3ABTA 3C90A 5HFLA 5LOVB 4GUNA 5F2VO 4NXNB 3CS5A 3BRCA 2CE4A 4O2AB 2ZDIC 1XMQO 1CP9A 2Y0PA 2ZD9A 1S0VA 1OZ0A 1Q6UA 1W59A 2N05A 1GM9A 4OGQB 4K0KB 3RBZA 2V1DA 4JZGA 4CH5A 4DUZB 2NR5A 1KMIZ 3E8GA 4MVUA 3N2GA 2Q9LA 4WFAV 2QE7G 4DV6B 1WJZA 1SQFA 4XDLA 5HFMA 2GUZA 2H3OA 4JTCB 3TGUH 3D3QA 3G80A 4KL1A 1G1XB 2YI8A 3WG7B 2E5LO 5LYJB 1SC5B 5BMVA 2EINC 2BOBC 4I50A 3I56V 4K8XA 4MW3A 1F23A 4J9YB 2WAMA 1FPOA 3K9AA 3FX7A 2YICA 3VOUA 1W0JG 3B40A 3SJAC 2JVDA 2YI9A 4F6EA 2P22C 4U3FH 4DV0O 1K5QA 2LGQA 3T4ZA 2Y4TA 2UXBO 4UCVA 3RYHA 3ABKB 1VF6C 4EB6A 1R6TA 3DC6A 2Y69C 3E86A 4I0XA 3OEHG 1IBLB 4DV3O 3B8MA 1SF9A 3GB7C 4CH6A 4JI8O 5D5PA 3EFFK 4CH4A 2XAQA 4EEQA 1BQZA 1WB7A 2A7WA 4O4IB 3T1YO 2ZQMA 2WSSG 4GLXA 3ZN0A 5LP6C 1Z2GA 4DV1O 1V55B 3T1CA 4JI2O 1Q5OA 3ETDA 1XNQO 2B5UA 1NR7A 5LGUA 3CC4V 2HKOA 5JH7A 1YZBA 2ZXWB 1B04A 4FFKA 3CCJV 4J9ZB 4DW1A 2JJ1G 3QTCA 3C3TA 2UXDO 4NR1A 1JA8A 1E1RG 1VF7A 4MTOA 3K5OA 1VQPV 4GKJO 4XDKA 5LMNB 4PJ0Z 2NLJC 3CEIA 3LUTB 2D2CB 4UUJC 1YDXA 3E8HA 3UQ8A 5IYBO 4YHHO 2W0FC 3APQA 1HW7A 3VQVA 5EC2C 4FLWA 4X9QA 1RSOA 1URFA 1XMOB 3RW0A 2NNUA 1FXKA 3K5NA 4NXNO 2ZINA 3JYCA 5IWAB 1F4MA 4JI7B 3WB0A 1FYJA 4NB5A 3WB2A 4IYHA 4JI0B 1FKAO 3UKMA 1Q8IA 1G8MA 4K0KO 3ASOC 2QEXV 3OMAB 2Z5UA 4UB6Z 1VQ9V 2P67A 1S76D 3AG7A 3JALB 2CGNA 4TUYA 5CN0A 1SRYA 1GN4A 4MTGA 3W7UA 2OCCC 4TSFG 3OT7A 2LFRA 4GT1A 4I55A 4DXWA 4DV6O 1NT2B 3HKCB 5B3SC 2WLLB 2GSMB 1JPXA 2L35A 1ENVA 4ZKIA 1Y4MA 5JVDB 5LA6A 2ZT9B 1FXHA 3AG2C 3K5MA 3DTUB 1AJQA 2DYSB 5KLVH 4OX9B 1L1FA 4G2KA 1WNSA 2B9ZA 4RUFA 1MA1A 3ZMZA 5LHGA 2EX3A 2QJ1A 3K79A 4LC1A 2HJDA 3FAVB 2MW2B 3JD0A 1L0NH 4PA3A 4XBFA 4CS4A 4IT5A 2LP7A 1ZX3A 3OUFA 1M57B 2ITDC 2XHBA 3HKDB 1FS0G 1H8EG 2PI5A 3ZRVA 1GAXA 4JZ2A 4YXWG 2HG5C 2ZE6A 3T4DA 2EIJC 1IBLO 4R7CA 5CA0B 2XUMA 3W7TA 1EM1A 1J95A 4IIJA 1I0HA 2BOCC 1S72V 1RFYA 2XAHA 3HB3B 2DQ0A 4JI5B 1IXMA 3N27A 3HKEB 3NXSA 1SQVH 1WPBA 2KQXA 1OCZB 2XT9A 4UB8Z 5FPOA 1SQXH 1RPOA 2XNDG 4UVCA 5KMGA 2FTKA 4B3MB 3AG1C 4CC6A 4BAYA 5H6RA 1SQBH 4B7EA 4JGSA 3ZRXA 4LNUA 5LMNO 3BEHA 1Q82W 2PF4E 2ILMA 2WLIA 1VARA 1FJGB 2Q69A 2A0LA 1QLEC 2WLKA 2D3OW 1XMOO 4DR6B 3F7YC 5IWAO 1VQNV 1IBKB 4JI7O 3OGIB 1TGOA 2ZE8A 4HYOA 1WLEA 4B3RB 3L75H 4JI0O 4NVPA 2H94A 2YEVB 4TV8B 3ZHUA 2OTJV 5EZYA 1J5EO 1FFXB 2RMKB 2VQEB 1P7GA 5IYCO 1CEZA 3H1KH 4FZ0A 2LQTA 2M6YA 4X20A 3D8CA 4YY3B 1E1QG 3L71H 2HR3A 2IU0A 2CDYA 2KG7A 4I5SA 1T5EA 5IJ0B 2P5OA 1BGYH 1GN2A 1V9PA 3ABMC 4FVMA 2QWPB 4OX9O 3ZCCA 1H38A 3BHPA 1N4CA 3H1JH 3JD3A 4LWSA 4NTXA 4DR4O 1MOFA 1SZTA 1HR0B 5LGTA 5CB4A 4P9PA 3G67A 4FM2A 2YUAA 1NZ6A 4O4HA 1S77D 1JVMA 3OM3B 1I08A 4YJ3B 5EC1C 2F23A 3QO7A 4NXMB 3CWBH 3FYEB 2LFSA 1YITV 3ZRWA 1PKXA 1K33A 4A5UB 1EN5A 3ZHVA 3ETGA 5IY5B 3H01A 4DRXA 2ZE5A 3K03A 5GTIZ 4UVBA 3H1HH 1GH6A 1GO3F 2BSKA 4DR2B 5JCOA 4O4JB 1QCEA 2GTSA 4BW9A 3JAKA 3ZMTA 4X1YB 4AILC 1WP7A 4AHCA 3SYCA 4TQDA 4JI5O 4KHPB 4FLZA 3ZX6A 1MZFA 2Z3YA 1UFIA 3ABUA 3EHBB 4J41A 5A2QN 1UPGA 1GMGA 3CYOA 4FFBB 2A79B 3AG4C 4AQYO 2PGGA 3BABA 4ZIBA 4JF3A 1WA8B 1OV9A 1XMQB 4IGGA 5C8YA 3CCEV 4X62B 1YEWA 3FB7C 3L73H 3TCUA 1FJGO 4XDJA 3CMAV 4BIZA 1K73W 1NTZH 4WFHA 4DR6O 4R6ZA 4JAUA 1Y76B 1KU9A 1OCOC 4JI6B 3RYCB 1K97A 1PP9H 2Q7HA 1IBKO 5J2UA 4B3RO 3JATA 4UCTA 1EZVH 1BSMA 1LUWA 1TUBB 1NTKH 3OAAG 3SPJA 4H44B 5LGNA 2YXYA 3CRCA 1TVKB 1DLBA 4PA6A 5LOVA 2VQEO 3JCUZ 5B1BB 4LF6B 3ZHRA 2E5LB 1Q3EA 1P49A 4O2AA 3NR7A 3BA8A 3FB5C 3X2QC 4JI3B 1W2BU 5EIBC 4YY3O 4MTFA 1QVFU 3OFNG 4P9OA 4E2LA 4IL6Z 5KAIZ 4LF9B 2BTQB 3CJHB 1QBZA 3J7AU 4QPKA 3BVOA 3JAWB 4PI0A 1YJNV 1SQQH 4AI8A 4Z2WA 3K59A 4ZHQB 1GM8A 1HR0O 1DGSA 1H2SB 4PDMA 1MSWD 5KX5B 5LYJA 1SQGA 1Q86W 2VS0A 3A0HZ 1K9MW 2OIEA 4QE9A 4NXMO 3L74H 4PDVA 4R50A 4DR7B 1AI4A 2ARHA 1COWG 4X65B 1KP2A 5IYDO 4GKKB 1Y74B 2CGOA 3QO5A 2QWNB 4DR2O 3CX5F 4O2BB 3F5WC 4X1KB 1X59A 2H8PC 2EIMC 3ASNB 2PYJA 1VQKV 1KECA 5TISZ 5B1NA 3ZIAG 4EFBA 1JJ2U 1KBHA 1JMKC 4GX1A 2F1MA 1ZL8B 4PELA 4GCZA 4JV5B 1K5SA 1KKCA 4KHPO 1MNGA 2A3QA 2BTOA 2DMXA 5L3CA 4QJFB 1DF4A 1AR5A 4KFMA 1NVPB 1Q6IA 4L87A 1HP8A
chains in the Genus database with same CATH topology
2UXCO 4GKKO 1I94O 3M8AA 4LFAO 4YHHO 2UU9O 2VQEO 4DR4O 2LW7A 4DUZO 4X62O 4NXNO 2DJVA 3JAMN 1FYJA 1IBMO 1AB3A 1N36O 1N32O 1G1XB 4X64O 2E5LO 1N33O 1D2DA 4YY3O 4JI6O 5BXZA 4JV5O 4A5UB 1FKAO 4LF5O 4DV5O 2UUBO 2F4VO 4K0KO 4LFBO 4DV2O 2UUAO 1AILA 1DK1A 4B3SO 3J7AU 5LMNO 3R66A 4B3MO 1HNWO 1XEQA 4DV0O 2HHHO 4B3TO 4LF6O 4X66O 4DUYO 3OTOO 4DV6O 1HR0O 1NS1A 5LMUO 1XMOO 4LFCO 2UXBO 2ZKOA 4JI5O 2ZM6O 2DOSA 3O65A 5IWAO 4OPAA 5FLXN 4LF4O 4JI7O 4JI3O 5BY1A 1R6TA 4DR1O 3J81N 1XNRO 4NXMO 4DV7O 3F5TA 2JRIA 4JI0O 4DV3O 5A2QN 2Z0AA 5BR8O 1A32A 3SDLA 4JI8O 4AQYO 1J5EO 4LF9O 1HNZO 4JYAO 3T1YO 5LL6Y 4DR2O 3J80N 3RT3C 2VQFO 2UUCO 3T1HO 4DR3O 4OPHA 1X59A 1R1BA 1FJGO 4DV1O 4DR5O 1F7YA 1XMQO 4JI2O 4JI4O 1XNQO 4DR6O 5IT9N 5H5NA 4KHPO 4JI1O 4LF8O 1YZBA 4DV4O 1IBKO 2N74A 1N34O 4B3RO 2AGAA 2UXDO 4DR7O 1IBLO 4X65O 1KUQA 4LF7O 4OX9O 4GKJO 2FKXA 1HNXO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC O;  4GKK O;  1I94 O;  3M8A A;  4LFA O;  4YHH O;  2UU9 O;  2VQE O;  4DR4 O;  2LW7 A;  4DUZ O;  4X62 O;  4NXN O;  2DJV A;  3JAM N;  1FYJ A;  1IBM O;  1AB3 A;  1N36 O;  1N32 O;  1G1X B;  4X64 O;  2E5L O;  1N33 O;  1D2D A;  4YY3 O;  4JI6 O;  5BXZ A;  4JV5 O;  4A5U B;  1FKA O;  4LF5 O;  4DV5 O;  2UUB O;  2F4V O;  4K0K O;  4LFB O;  4DV2 O;  2UUA O;  1AIL A;  1DK1 A;  4B3S O;  3J7A U;  5LMN O;  3R66 A;  4B3M O;  1HNW O;  1XEQ A;  4DV0 O;  2HHH O;  4B3T O;  4LF6 O;  4X66 O;  4DUY O;  3OTO O;  4DV6 O;  1HR0 O;  1NS1 A;  5LMU O;  1XMO O;  4LFC O;  2UXB O;  2ZKO A;  4JI5 O;  2ZM6 O;  2DOS A;  3O65 A;  5IWA O;  4OPA A;  5FLX N;  4LF4 O;  4JI7 O;  4JI3 O;  5BY1 A;  1R6T A;  4DR1 O;  3J81 N;  1XNR O;  4NXM O;  4DV7 O;  3F5T A;  2JRI A;  4JI0 O;  4DV3 O;  5A2Q N;  2Z0A A;  5BR8 O;  1A32 A;  3SDL A;  4JI8 O;  4AQY O;  1J5E O;  4LF9 O;  1HNZ O;  4JYA O;  3T1Y O;  5LL6 Y;  4DR2 O;  3J80 N;  3RT3 C;  2VQF O;  2UUC O;  3T1H O;  4DR3 O;  4OPH A;  1X59 A;  1R1B A;  1FJG O;  4DV1 O;  4DR5 O;  1F7Y A;  1XMQ O;  4JI2 O;  4JI4 O;  1XNQ O;  4DR6 O;  5IT9 N;  5H5N A;  4KHP O;  4JI1 O;  4LF8 O;  1YZB A;  4DV4 O;  1IBK O;  2N74 A;  1N34 O;  4B3R O;  2AGA A;  2UXD O;  4DR7 O;  1IBL O;  4X65 O;  1KUQ A;  4LF7 O;  4OX9 O;  4GKJ O;  2FKX A;  1HNX O; 
#chains in the Genus database with same CATH topology
 4HNA B;  5E1A C;  4O4I A;  2YDE A;  5KHI A;  3CE2 A;  3OGC C;  4X66 B;  3OTO B;  2YIB D;  4WBN B;  5KUM A;  3JSN A;  2AHY A;  4X62 O;  2DJV A;  2OT5 A;  4ZBM A;  2WWW A;  1H2N A;  5B5E Z;  2PI4 A;  5EBL C;  2Q8V A;  1U97 A;  1S5L Z;  3SPC A;  4JI6 O;  2ADQ B;  1NQT A;  2ZNJ A;  1GTO A;  4RO2 A;  3FYI B;  1N0N A;  5LXT B;  2EIL C;  4JYA B;  4QGP A;  5KA6 A;  2NN4 A;  2CAZ C;  1B3Q A;  3I55 V;  1SKV A;  2E76 B;  4MT8 A;  5J9P C;  3W7X A;  4DR5 B;  4LF6 O;  5DED A;  4CH3 A;  4FMT A;  3IGA C;  4JI3 O;  1FXK C;  3KG2 A;  4MVQ A;  3IJ4 A;  3JAS B;  4LF7 B;  2FYU H;  5H9C A;  2Z0A A;  4J80 A;  1KP3 A;  1AP6 A;  1JX9 A;  4OXS A;  4PA9 A;  1I94 B;  3JAL A;  3S3W A;  4W4K A;  1GN3 A;  4LF9 O;  3LSS A;  4IHJ B;  5J2T B;  1NR1 A;  5LL6 Y;  1ZLZ A;  3CCV V;  2YIA A;  3RT3 C;  2YID A;  1M4U A;  1VEW A;  3OE7 G;  3CRR A;  3RVZ A;  5DN6 G;  3HKC A;  2WLL A;  3EVK A;  1E79 G;  4X64 B;  3OMN B;  4U3J B;  5JVD A;  5K1X A;  1Q6H A;  2PYL A;  2JS3 A;  2UUB B;  3F7V C;  3BAA A;  2EIK B;  3ZRS A;  4ABM A;  4DR7 O;  3SYA A;  1TAE A;  4X65 O;  1ARO P;  2FKX A;  4QPJ A;  4FM1 A;  4GKK O;  3FAV A;  1IX9 A;  1OCR C;  3JCZ A;  2A06 H;  3K9S A;  3DGE A;  1OHH G;  3ABL C;  3HKD A;  1MMM A;  1S3J A;  4J10 A;  5IJ9 B;  2XTA A;  3STL C;  3SJC C;  4JV5 O;  4JYC A;  4LF5 O;  2KB1 A;  5CA0 A;  1JOY A;  1DK1 A;  1QR9 A;  3ZS8 C;  4I9W A;  3W7S A;  4GX0 A;  3K04 A;  2Q68 A;  1MSD A;  1DF5 A;  4X66 O;  3OTO O;  2JIZ G;  2V7Q G;  3HKE A;  1PM9 A;  3LDC A;  4FLU A;  3O65 A;  3CSX A;  4OPA A;  5EBW C;  5KHH A;  1PL0 A;  4TQF A;  4UCS A;  1J5E B;  3R65 A;  4FM0 A;  3CPW U;  1SA0 B;  3KCX A;  2IBZ H;  2OIG A;  3A0B Z;  2JK5 C;  5BR8 O;  1JFF B;  3ETQ A;  2F95 B;  2P4V A;  4QE7 A;  1U96 A;  3P3P A;  4JYA O;  2JGU A;  4J42 A;  5IY5 C;  3SYQ A;  1BMF G;  4U7N A;  4DR5 O;  1F7Y A;  1BCC H;  1N32 B;  4K35 A;  3T2M A;  2PY5 A;  5IT9 N;  2A9H A;  2N74 A;  2VWJ A;  1JJO A;  2QKS A;  5GON B;  2UUA B;  2YEV A;  4TV8 A;  4DR4 B;  4LF7 O;  3ZJZ A;  1FFX A;  1SET A;  4WF9 V;  1I94 O;  3O9O A;  1RM1 C;  3U11 A;  5L3F A;  1Z5W A;  3UO2 A;  2KKW A;  4CS3 A;  1YIJ V;  1Q90 D;  2W0X A;  3DSQ A;  4WFB V;  2P90 A;  4X64 O;  1OJH A;  2YC0 A;  2F43 G;  4BIO A;  5JWP A;  5IJ0 A;  2X7R B;  2UUB O;  4FK5 C;  1KC8 W;  2R9R B;  1MAB G;  1HDJ A;  4N23 A;  3SPG A;  4H0L B;  1Y6X A;  3G4S V;  3UT5 B;  3K57 A;  1XBL A;  4DR3 B;  2HLD G;  2OWO A;  1Q7Y W;  5JJN B;  2WA4 A;  4DYL A;  2GHY A;  5LMU O;  4FLV A;  1K3E A;  4Q6G A;  4F6R B;  4YJ3 A;  3LSU A;  2LGW A;  5FLX N;  4JAS A;  2WA3 A;  1N34 B;  1PNM A;  3H1L H;  3OEE G;  3G71 V;  4AQY B;  1P4R A;  5FL7 G;  3E83 A;  2DYR C;  4DO2 A;  1ORQ C;  3FFQ A;  5CBG A;  3RFR A;  3H1I H;  3SDL A;  1SES A;  4NKG B;  3WFV A;  4LFA B;  1YHQ V;  1YTF D;  4O4J A;  4X1Y A;  4D7S A;  3DXR B;  1S5J A;  2DW4 A;  4OPH A;  3THO A;  1BE3 H;  3P30 A;  2Y69 B;  3CRQ A;  1K8A W;  5JCO C;  5EYP B;  2Q5Z A;  2BCC H;  3VQY A;  4YIO A;  1I5X A;  2CTP A;  1AVM A;  3P32 A;  5B1O A;  4J11 A;  5KUK A;  5L3G A;  4W4L A;  5B1A C;  5K1P A;  1AR1 B;  4FFB A;  1P84 F;  1V54 C;  4UV9 A;  4N21 A;  5LP6 B;  1WA8 A;  1SZX A;  1XRE A;  2HHH B;  5GTH Z;  2EBO A;  4DUY B;  4RWU A;  1B06 A;  1M9N A;  1BHA A;  1KKD A;  2EJ7 A;  1Y76 A;  3CCL V;  1N32 O;  3K3W A;  3RYC A;  3AG3 C;  2JGD B;  2Y4U A;  2CTQ A;  1ZWI C;  3E8F A;  5FNV B;  1NU1 H;  1TUB A;  2UUA O;  2B1I A;  1TVK A;  1YVW A;  2EUL A;  4PHZ A;  1JCH A;  1VQL V;  1L8D A;  4X8A A;  2IH3 C;  1OCC C;  4K3A A;  2O57 A;  1WPX A;  4JI4 B;  3SPI A;  2LJ2 A;  1K34 A;  4NYK A;  2AZ0 A;  2QSA A;  3ASO B;  4DV4 B;  1K4C C;  2QM7 A;  4TV9 B;  2GV9 A;  5C93 A;  3A8T A;  2JRI A;  1ZAU A;  3ZED A;  3ETE A;  2AHZ A;  1GKF A;  4BWA A;  4PA4 A;  1S5H C;  2BTQ A;  2WLN A;  3CJH A;  2OCC B;  4E4E A;  3WB1 A;  3JAW A;  5B3S B;  1XL6 A;  3J80 N;  3STZ C;  4ZHQ A;  3K58 A;  4DR3 O;  4G27 B;  3K5L A;  4RAI A;  4RQF A;  2P4K A;  1KD1 W;  2QDO A;  2ODM A;  1BL8 A;  3G6E V;  3AG2 B;  3QNE A;  1NI8 A;  5KX5 A;  2X6B A;  5CA1 B;  1GM7 A;  4JAV A;  5H5N A;  2FL4 A;  2VWK A;  2GBO A;  4LFB B;  1O9G A;  1N34 O;  1M56 B;  4LP8 A;  4ZOL B;  3WG7 C;  3CCU V;  1KUQ A;  5ITZ B;  1Y74 A;  1GK9 A;  1D5A A;  4LBE C;  4X88 A;  1JR9 A;  3JD2 A;  3M8A A;  4PDL A;  4LFA O;  4MVR A;  4O2B A;  3A2F A;  4X1K A;  1ZUQ A;  2IW5 A;  3CB2 A;  1RPR A;  2QM8 A;  4JPR A;  2RDC A;  2RQ6 A;  2Q73 A;  2ETN A;  1ZL8 A;  2EIJ B;  5CMU A;  3CRM A;  4H13 B;  1P7B A;  2YXL A;  3ABK C;  2K9P A;  2X0L A;  1YF2 A;  3KCY A;  3CP1 A;  1AI7 A;  1AI6 A;  4GZR B;  2DN9 A;  4HNA A;  4LR3 A;  5L3D A;  5CBH A;  2M7W A;  2ZIO A;  4DW0 A;  2VQF B;  1IZ3 A;  3C3S A;  1NJI W;  4TT3 G;  2HHH O;  4WBN A;  4DUY O;  3JD4 A;  3M99 B;  4DK1 A;  2JEU A;  2DOS A;  2EZP A;  3AG1 B;  3RWR D;  1V55 C;  2P6J A;  1PNL A;  4NTW A;  2WLH A;  5KA5 A;  5EIB D;  5LXT A;  2HVJ C;  1AP5 A;  2ITC C;  2ZXW C;  1QLE B;  1WP8 A;  4CZZ A;  4G28 B;  4D7T A;  2L6L A;  3B09 A;  5GW7 A;  1H2K A;  1K4D C;  3VBB A;  4JYB A;  1N36 B;  1R73 A;  2QTS A;  1D5N A;  4Q20 A;  5JQG B;  4BW5 A;  2QR4 A;  4JI4 O;  2R70 A;  4DV4 O;  1Y66 A;  3JAS A;  3QG5 A;  2QKC A;  4WCE V;  4J7J A;  2WPD G;  2X6C A;  2JJ2 G;  4IHJ A;  4RQE A;  5J2T A;  1ZSP A;  3IFX A;  4MVZ A;  4B3T B;  1QVG U;  4ASU G;  4LFC B;  1BQ0 A;  1FD9 A;  4LF5 B;  4U3J A;  1XNR B;  1THZ A;  1VIB A;  1PPJ H;  2LW1 A;  3ABM B;  1L0L H;  2VRZ A;  3OTF A;  4LFB O;  3CCM V;  4D6T H;  3D36 A;  1US6 A;  3UO3 A;  3ZHT A;  4PD4 F;  2QWR B;  1QHT A;  3B8N A;  3VQW A;  2DYS C;  3JD1 A;  1VQ4 V;  5EK0 A;  1HNW O;  4PA7 A;  4UCU A;  4O4L B;  3HKB B;  4U7O A;  3D3I A;  3JSL A;  4WFG A;  4Z1V A;  5IJ9 A;  3ICX A;  5KAF Z;  5BR8 B;  1Y67 A;  2LO1 A;  2Y0I A;  3CME V;  2HVK C;  3CHX A;  1M57 C;  3CCR V;  3E35 A;  3APO A;  5CA3 A;  1NH2 D;  1O9H A;  4CBC A;  4YJ2 B;  4JTA B;  2QWO B;  3RYF B;  3JAR B;  1Q81 W;  1LR1 A;  3HR0 A;  5BZB A;  3ML0 A;  1PV0 A;  2VQF O;  2QTO A;  2PZS A;  1PNK A;  3BCC H;  3ZMS A;  2XOK G;  4MS2 A;  2Q0O C;  1K7D A;  4ZI7 B;  5LHI A;  4X1I B;  2X6A A;  4JTD B;  4UVA A;  2R9A A;  4FIP C;  4BIU A;  1Z5V A;  1OCZ C;  3AG4 B;  3MHS C;  4MVM A;  1SA0 A;  2AGA A;  4J7Z A;  3L70 H;  4B3S B;  4PDR A;  1JFF A;  1YI2 V;  1GRJ A;  1KB9 F;  1FFT B;  4R8C A;  5E79 Z;  1GN6 A;  5H6Q A;  2WLM A;  3E22 B;  1CXZ B;  3Q4H B;  3RGB A;  1QNM A;  2QA4 V;  3GWK C;  2CH7 B;  3FD9 A;  1OCO B;  1BHB A;  2ZM6 B;  3RYI B;  2DE0 X;  1N36 O;  3ZBH A;  4DV7 B;  2ZNI A;  3N2K B;  1XL4 A;  5GON A;  2CK3 G;  1YJW V;  5IYZ B;  2YIB A;  2EZO A;  4HBN A;  4RUE A;  2JEX A;  3MD0 A;  1VQM V;  3LSQ A;  4I4T B;  3MAQ A;  5IDJ A;  4HZ3 A;  2PUS A;  3SJQ C;  5LMU B;  1SQP H;  2ZDI A;  1XEQ A;  1CPY A;  5JJJ B;  3X2Q B;  2Q67 A;  2AW9 A;  2QGN A;  4B3T O;  4UFZ A;  4LFC O;  5KHG A;  3CXH F;  4LF8 B;  1XNR O;  3A0R A;  3TET A;  2Q7G A;  4EFE A;  1BZK A;  2Q4P A;  1EZJ A;  4FLX A;  3ZMU A;  1EN6 A;  3CC7 V;  3UT5 A;  1VQ7 V;  4I7Z B;  2IJI A;  2Q0A A;  4MVS A;  2IJH A;  3N2G B;  1XUQ A;  3BA9 A;  1LUV A;  2JS5 A;  2E74 B;  3SR2 C;  4F6R A;  2GUZ B;  1M93 A;  1XIL A;  2Y48 A;  3BFR A;  3SYO A;  3ZMV A;  5BMV B;  3LDE A;  2OTL V;  4I50 B;  3TXS A;  3SPH A;  3U10 A;  1M5I A;  3ZN1 A;  2CTW A;  4F4L A;  3OR7 C;  4LH6 A;  3FB6 C;  4ICG A;  1AJN A;  3CD6 V;  2FB5 A;  5EBM C;  2EIM B;  3DXR A;  3LNN A;  4CS2 A;  3UCS C;  4UV8 A;  4DUZ O;  1VF6 A;  4NTY A;  3S3X A;  3TJT A;  5A9G A;  2R72 A;  1XI1 A;  2W6I G;  5EYP A;  2W6J G;  3PJS K;  1YSC A;  1K92 A;  3RYH B;  2UXX A;  2IJK A;  3CRA A;  1VQ8 V;  4PI2 A;  5B66 Z;  2OCH A;  4EB6 B;  3FKS G;  3E89 A;  4H33 A;  4I0X B;  3LDD A;  1G4Y B;  2JDI G;  1H2L A;  4H37 A;  4P30 A;  1HNZ B;  1BT8 A;  4B3S O;  2IM9 A;  5L3B A;  4UXN A;  1W0K G;  5LP6 A;  3SGI A;  4I9Q A;  2ZE7 A;  4QIW F;  3B4S A;  1BS3 A;  1M56 C;  3OUS A;  3QO8 A;  3ZHS A;  1NH2 B;  2ZM6 O;  2YSU B;  3OR6 C;  1VP7 A;  3AK2 A;  2JGD A;  1H2G A;  2EIL B;  5LBQ A;  5JH7 B;  4DV7 O;  3RN4 A;  3E2E A;  5FNV A;  1R3I C;  1HNX B;  4FZ1 A;  4J7K A;  5L3E A;  2HJF C;  3BY6 A;  2UU9 B;  4GX5 A;  4LCU C;  5IE9 A;  3AK3 A;  2DQ3 A;  3B77 A;  1VQ5 V;  2N04 A;  3CCQ V;  2EIN B;  3K06 A;  2QKA A;  1RSO B;  1FXK B;  1R3J C;  3KZI Z;  3GWO A;  1KQS U;  1MZE A;  5B1B C;  1XDC A;  4YIP A;  3CXC U;  1EFR G;  3H9V A;  1ROP A;  4KXR A;  4TV9 A;  4DK0 A;  3QF7 A;  4LF8 O;  4QNH B;  4KP4 A;  2F66 C;  4MW8 A;  3M7M X;  2F4V B;  2OYQ A;  1PL4 A;  3SYP A;  4TUY B;  1NKD A;  1R3K C;  1YJ9 V;  1KYO F;  2IJJ A;  1SS3 A;  2YS8 A;  4I55 B;  1UJW B;  3PN1 A;  4HAM A;  2XAJ A;  3JAM N;  4LF4 B;  3IC7 A;  5CA1 A;  1AB3 A;  3I5D A;  4L8J A;  5LA6 B;  1XHX A;  5BXZ A;  1YXB A;  4FJC C;  1IUR A;  4ZOL A;  2AZ2 A;  4MSW C;  1R6N A;  1NBM G;  1EN4 A;  5KHJ A;  5ITZ A;  1G6U A;  1OCR B;  1JQ0 A;  4JAA A;  2UUC B;  3T1H B;  1MG1 A;  2DWE C;  3ABL B;  1R6K A;  1WN7 A;  2CUG A;  1R3L C;  4UCO A;  1B6Q A;  4JI1 B;  5DM6 V;  1XOU A;  3ASN C;  1VMG A;  3B2E E;  1M1K W;  1N8R W;  1VF5 B;  2IU3 A;  1YCI A;  3OD4 A;  1ZTE A;  4FLT A;  1M90 W;  2QWQ B;  2UXC B;  1A32 A;  1X4T A;  1Q43 A;  2XAG A;  4IIJ B;  2V4D A;  1HNZ O;  2HP8 A;  2IH1 C;  1QU7 A;  2Q7E A;  4TOI A;  2ATK C;  3GVM A;  2FML A;  3U0Z A;  1R1B A;  2BE3 A;  2ZCE A;  1H2M A;  4GX2 A;  1IBM B;  2E3C A;  3UM7 A;  1N33 B;  1FXV A;  1NVP D;  2RN9 A;  1WB8 A;  1QQC A;  4DV5 B;  5CBF A;  4FLY A;  1QR8 A;  4TWK A;  4DV2 B;  5KMG B;  3K0D A;  1AI5 A;  1IDS A;  3CCS V;  4K8Z A;  1RP3 B;  1HNX O;  3VQX A;  4LNU B;  2EJR A;  2UU9 O;  4B7K A;  2WLI B;  1F4N A;  3W7W A;  2AXT Z;  2C2A A;  2PTM A;  1LNQ A;  1HWY A;  1DTO A;  5JQG A;  4DR1 B;  4IYI A;  5H2F Z;  1D2D A;  2ZIM A;  5DEC A;  3FB8 C;  2G38 A;  2F4V O;  3G6B A;  3WU2 Z;  4BR6 A;  1HNW B;  3ZHQ A;  1RM1 B;  1AIL A;  4JYY A;  3KKY A;  1F51 A;  4PV1 B;  5EZY B;  1QLN A;  4Z1M G;  3R66 A;  2R9I A;  4B3M O;  1PD3 A;  2E75 B;  3AK1 A;  1VQO V;  1AJP A;  4X20 B;  2WLJ A;  4LF4 O;  5BY1 A;  3K08 A;  3J81 N;  3TK1 A;  3F5T A;  3BPZ A;  2Q6A A;  2KG7 B;  1IVS A;  3MDS A;  3EXA A;  1EBO A;  5KHK A;  2EIK C;  3AEI A;  4UCR A;  2F93 B;  2B1G A;  3IAY A;  3D36 C;  4O4L A;  3MHH C;  4LWS B;  3HKB A;  2UUC O;  3T1H O;  2XAF A;  5CB4 B;  2RNB A;  4X89 A;  2GDS A;  1YTF B;  4O4H B;  4EKW A;  3IC9 A;  2GTA A;  1XHZ A;  2DYR B;  5FPR A;  4JI1 O;  2DWD C;  3ZRW B;  4DRX B;  4YJ2 A;  2KSD A;  3RYF A;  2RJZ A;  3JAR A;  2P7T C;  2UXC O;  2BSK B;  3TXQ A;  4DV0 B;  3JAK B;  2LW7 A;  1WAZ A;  3L9D A;  2YXH A;  4KUM A;  2UXB B;  1AR4 A;  1N0J A;  4WFE A;  5AG2 A;  1TA8 A;  1IBM O;  4ZI7 A;  4X1I A;  2ZR3 A;  5B1A B;  1N33 O;  3OW2 U;  1XQ8 A;  2HEP A;  4DV3 B;  1V54 B;  4DV5 O;  2UXN A;  4MVO A;  1NTM H;  2ADP A;  3OMI B;  4DV2 O;  5D5Q A;  2HFE C;  4JI8 B;  1SER A;  3RVY A;  3LNM B;  4P2Z A;  3K0G A;  3P3N A;  3T1Y B;  1IXB A;  2MK3 A;  4FPP A;  4GYC B;  3E22 A;  4MTX A;  3Q4H A;  4CC5 A;  2K1E A;  4WFF A;  4B08 A;  2CH7 A;  1FAF A;  4DV1 B;  5C8Y B;  2ZR2 A;  4C7U A;  3AG3 B;  3RYI A;  1NS1 A;  4JI2 B;  1XNQ B;  2ZKO A;  4LH7 A;  5LHH A;  1H8H G;  4DR1 O;  3N2K A;  3QVN A;  2XAS A;  2RCV A;  3L72 H;  1VQ6 V;  5J2U B;  5IYZ A;  3E8B A;  3HPL C;  2UXD B;  2P06 A;  2CTR A;  1TUE B;  3CC2 V;  3JAT B;  4GKJ B;  2QM4 A;  4I4T A;  1I7F A;  1OCC B;  3SJB C;  4YHH B;  5JJE B;  3DC5 A;  1I5Y A;  3ABT A;  3C90 A;  5HFL A;  5LOV B;  4GUN A;  5F2V O;  4NXN B;  3CS5 A;  3BRC A;  2CE4 A;  4O2A B;  2ZDI C;  1XMQ O;  1CP9 A;  2Y0P A;  2ZD9 A;  1S0V A;  1OZ0 A;  1Q6U A;  1W59 A;  2N05 A;  1GM9 A;  4OGQ B;  4K0K B;  3RBZ A;  2V1D A;  4JZG A;  4CH5 A;  4DUZ B;  2NR5 A;  1KMI Z;  3E8G A;  4MVU A;  3N2G A;  2Q9L A;  4WFA V;  2QE7 G;  4DV6 B;  1WJZ A;  1SQF A;  4XDL A;  5HFM A;  2GUZ A;  2H3O A;  4JTC B;  3TGU H;  3D3Q A;  3G80 A;  4KL1 A;  1G1X B;  2YI8 A;  3WG7 B;  2E5L O;  5LYJ B;  1SC5 B;  5BMV A;  2EIN C;  2BOB C;  4I50 A;  3I56 V;  4K8X A;  4MW3 A;  1F23 A;  4J9Y B;  2WAM A;  1FPO A;  3K9A A;  3FX7 A;  2YIC A;  3VOU A;  1W0J G;  3B40 A;  3SJA C;  2JVD A;  2YI9 A;  4F6E A;  2P22 C;  4U3F H;  4DV0 O;  1K5Q A;  2LGQ A;  3T4Z A;  2Y4T A;  2UXB O;  4UCV A;  3RYH A;  3ABK B;  1VF6 C;  4EB6 A;  1R6T A;  3DC6 A;  2Y69 C;  3E86 A;  4I0X A;  3OEH G;  1IBL B;  4DV3 O;  3B8M A;  1SF9 A;  3GB7 C;  4CH6 A;  4JI8 O;  5D5P A;  3EFF K;  4CH4 A;  2XAQ A;  4EEQ A;  1BQZ A;  1WB7 A;  2A7W A;  4O4I B;  3T1Y O;  2ZQM A;  2WSS G;  4GLX A;  3ZN0 A;  5LP6 C;  1Z2G A;  4DV1 O;  1V55 B;  3T1C A;  4JI2 O;  1Q5O A;  3ETD A;  1XNQ O;  2B5U A;  1NR7 A;  5LGU A;  3CC4 V;  2HKO A;  5JH7 A;  1YZB A;  2ZXW B;  1B04 A;  4FFK A;  3CCJ V;  4J9Z B;  4DW1 A;  2JJ1 G;  3QTC A;  3C3T A;  2UXD O;  4NR1 A;  1JA8 A;  1E1R G;  1VF7 A;  4MTO A;  3K5O A;  1VQP V;  4GKJ O;  4XDK A;  5LMN B;  4PJ0 Z;  2NLJ C;  3CEI A;  3LUT B;  2D2C B;  4UUJ C;  1YDX A;  3E8H A;  3UQ8 A;  5IYB O;  4YHH O;  2W0F C;  3APQ A;  1HW7 A;  3VQV A;  5EC2 C;  4FLW A;  4X9Q A;  1RSO A;  1URF A;  1XMO B;  3RW0 A;  2NNU A;  1FXK A;  3K5N A;  4NXN O;  2ZIN A;  3JYC A;  5IWA B;  1F4M A;  4JI7 B;  3WB0 A;  1FYJ A;  4NB5 A;  3WB2 A;  4IYH A;  4JI0 B;  1FKA O;  3UKM A;  1Q8I A;  1G8M A;  4K0K O;  3ASO C;  2QEX V;  3OMA B;  2Z5U A;  4UB6 Z;  1VQ9 V;  2P67 A;  1S76 D;  3AG7 A;  3JAL B;  2CGN A;  4TUY A;  5CN0 A;  1SRY A;  1GN4 A;  4MTG A;  3W7U A;  2OCC C;  4TSF G;  3OT7 A;  2LFR A;  4GT1 A;  4I55 A;  4DXW A;  4DV6 O;  1NT2 B;  3HKC B;  5B3S C;  2WLL B;  2GSM B;  1JPX A;  2L35 A;  1ENV A;  4ZKI A;  1Y4M A;  5JVD B;  5LA6 A;  2ZT9 B;  1FXH A;  3AG2 C;  3K5M A;  3DTU B;  1AJQ A;  2DYS B;  5KLV H;  4OX9 B;  1L1F A;  4G2K A;  1WNS A;  2B9Z A;  4RUF A;  1MA1 A;  3ZMZ A;  5LHG A;  2EX3 A;  2QJ1 A;  3K79 A;  4LC1 A;  2HJD A;  3FAV B;  2MW2 B;  3JD0 A;  1L0N H;  4PA3 A;  4XBF A;  4CS4 A;  4IT5 A;  2LP7 A;  1ZX3 A;  3OUF A;  1M57 B;  2ITD C;  2XHB A;  3HKD B;  1FS0 G;  1H8E G;  2PI5 A;  3ZRV A;  1GAX A;  4JZ2 A;  4YXW G;  2HG5 C;  2ZE6 A;  3T4D A;  2EIJ C;  1IBL O;  4R7C A;  5CA0 B;  2XUM A;  3W7T A;  1EM1 A;  1J95 A;  4IIJ A;  1I0H A;  2BOC C;  1S72 V;  1RFY A;  2XAH A;  3HB3 B;  2DQ0 A;  4JI5 B;  1IXM A;  3N27 A;  3HKE B;  3NXS A;  1SQV H;  1WPB A;  2KQX A;  1OCZ B;  2XT9 A;  4UB8 Z;  5FPO A;  1SQX H;  1RPO A;  2XND G;  4UVC A;  5KMG A;  2FTK A;  4B3M B;  3AG1 C;  4CC6 A;  4BAY A;  5H6R A;  1SQB H;  4B7E A;  4JGS A;  3ZRX A;  4LNU A;  5LMN O;  3BEH A;  1Q82 W;  2PF4 E;  2ILM A;  2WLI A;  1VAR A;  1FJG B;  2Q69 A;  2A0L A;  1QLE C;  2WLK A;  2D3O W;  1XMO O;  4DR6 B;  3F7Y C;  5IWA O;  1VQN V;  1IBK B;  4JI7 O;  3OGI B;  1TGO A;  2ZE8 A;  4HYO A;  1WLE A;  4B3R B;  3L75 H;  4JI0 O;  4NVP A;  2H94 A;  2YEV B;  4TV8 B;  3ZHU A;  2OTJ V;  5EZY A;  1J5E O;  1FFX B;  2RMK B;  2VQE B;  1P7G A;  5IYC O;  1CEZ A;  3H1K H;  4FZ0 A;  2LQT A;  2M6Y A;  4X20 A;  3D8C A;  4YY3 B;  1E1Q G;  3L71 H;  2HR3 A;  2IU0 A;  2CDY A;  2KG7 A;  4I5S A;  1T5E A;  5IJ0 B;  2P5O A;  1BGY H;  1GN2 A;  1V9P A;  3ABM C;  4FVM A;  2QWP B;  4OX9 O;  3ZCC A;  1H38 A;  3BHP A;  1N4C A;  3H1J H;  3JD3 A;  4LWS A;  4NTX A;  4DR4 O;  1MOF A;  1SZT A;  1HR0 B;  5LGT A;  5CB4 A;  4P9P A;  3G67 A;  4FM2 A;  2YUA A;  1NZ6 A;  4O4H A;  1S77 D;  1JVM A;  3OM3 B;  1I08 A;  4YJ3 B;  5EC1 C;  2F23 A;  3QO7 A;  4NXM B;  3CWB H;  3FYE B;  2LFS A;  1YIT V;  3ZRW A;  1PKX A;  1K33 A;  4A5U B;  1EN5 A;  3ZHV A;  3ETG A;  5IY5 B;  3H01 A;  4DRX A;  2ZE5 A;  3K03 A;  5GTI Z;  4UVB A;  3H1H H;  1GH6 A;  1GO3 F;  2BSK A;  4DR2 B;  5JCO A;  4O4J B;  1QCE A;  2GTS A;  4BW9 A;  3JAK A;  3ZMT A;  4X1Y B;  4AIL C;  1WP7 A;  4AHC A;  3SYC A;  4TQD A;  4JI5 O;  4KHP B;  4FLZ A;  3ZX6 A;  1MZF A;  2Z3Y A;  1UFI A;  3ABU A;  3EHB B;  4J41 A;  5A2Q N;  1UPG A;  1GMG A;  3CYO A;  4FFB B;  2A79 B;  3AG4 C;  4AQY O;  2PGG A;  3BAB A;  4ZIB A;  4JF3 A;  1WA8 B;  1OV9 A;  1XMQ B;  4IGG A;  5C8Y A;  3CCE V;  4X62 B;  1YEW A;  3FB7 C;  3L73 H;  3TCU A;  1FJG O;  4XDJ A;  3CMA V;  4BIZ A;  1K73 W;  1NTZ H;  4WFH A;  4DR6 O;  4R6Z A;  4JAU A;  1Y76 B;  1KU9 A;  1OCO C;  4JI6 B;  3RYC B;  1K97 A;  1PP9 H;  2Q7H A;  1IBK O;  5J2U A;  4B3R O;  3JAT A;  4UCT A;  1EZV H;  1BSM A;  1LUW A;  1TUB B;  1NTK H;  3OAA G;  3SPJ A;  4H44 B;  5LGN A;  2YXY A;  3CRC A;  1TVK B;  1DLB A;  4PA6 A;  5LOV A;  2VQE O;  3JCU Z;  5B1B B;  4LF6 B;  3ZHR A;  2E5L B;  1Q3E A;  1P49 A;  4O2A A;  3NR7 A;  3BA8 A;  3FB5 C;  3X2Q C;  4JI3 B;  1W2B U;  5EIB C;  4YY3 O;  4MTF A;  1QVF U;  3OFN G;  4P9O A;  4E2L A;  4IL6 Z;  5KAI Z;  4LF9 B;  2BTQ B;  3CJH B;  1QBZ A;  3J7A U;  4QPK A;  3BVO A;  3JAW B;  4PI0 A;  1YJN V;  1SQQ H;  4AI8 A;  4Z2W A;  3K59 A;  4ZHQ B;  1GM8 A;  1HR0 O;  1DGS A;  1H2S B;  4PDM A;  1MSW D;  5KX5 B;  5LYJ A;  1SQG A;  1Q86 W;  2VS0 A;  3A0H Z;  1K9M W;  2OIE A;  4QE9 A;  4NXM O;  3L74 H;  4PDV A;  4R50 A;  4DR7 B;  1AI4 A;  2ARH A;  1COW G;  4X65 B;  1KP2 A;  5IYD O;  4GKK B;  1Y74 B;  2CGO A;  3QO5 A;  2QWN B;  4DR2 O;  3CX5 F;  4O2B B;  3F5W C;  4X1K B;  1X59 A;  2H8P C;  2EIM C;  3ASN B;  2PYJ A;  1VQK V;  1KEC A;  5TIS Z;  5B1N A;  3ZIA G;  4EFB A;  1JJ2 U;  1KBH A;  1JMK C;  4GX1 A;  2F1M A;  1ZL8 B;  4PEL A;  4GCZ A;  4JV5 B;  1K5S A;  1KKC A;  4KHP O;  1MNG A;  2A3Q A;  2BTO A;  2DMX A;  5L3C A;  4QJF B;  1DF4 A;  1AR5 A;  4KFM A;  1NVP B;  1Q6I A;  4L87 A;  1HP8 A; 
#chains in the Genus database with same CATH homology
 2UXC O;  4GKK O;  1I94 O;  3M8A A;  4LFA O;  4YHH O;  2UU9 O;  2VQE O;  4DR4 O;  2LW7 A;  4DUZ O;  4X62 O;  4NXN O;  2DJV A;  3JAM N;  1FYJ A;  1IBM O;  1AB3 A;  1N36 O;  1N32 O;  1G1X B;  4X64 O;  2E5L O;  1N33 O;  1D2D A;  4YY3 O;  4JI6 O;  5BXZ A;  4JV5 O;  4A5U B;  1FKA O;  4LF5 O;  4DV5 O;  2UUB O;  2F4V O;  4K0K O;  4LFB O;  4DV2 O;  2UUA O;  1AIL A;  1DK1 A;  4B3S O;  3J7A U;  5LMN O;  3R66 A;  4B3M O;  1HNW O;  1XEQ A;  4DV0 O;  2HHH O;  4B3T O;  4LF6 O;  4X66 O;  4DUY O;  3OTO O;  4DV6 O;  1HR0 O;  1NS1 A;  5LMU O;  1XMO O;  4LFC O;  2UXB O;  2ZKO A;  4JI5 O;  2ZM6 O;  2DOS A;  3O65 A;  5IWA O;  4OPA A;  5FLX N;  4LF4 O;  4JI7 O;  4JI3 O;  5BY1 A;  1R6T A;  4DR1 O;  3J81 N;  1XNR O;  4NXM O;  4DV7 O;  3F5T A;  2JRI A;  4JI0 O;  4DV3 O;  5A2Q N;  2Z0A A;  5BR8 O;  1A32 A;  3SDL A;  4JI8 O;  4AQY O;  1J5E O;  4LF9 O;  1HNZ O;  4JYA O;  3T1Y O;  5LL6 Y;  4DR2 O;  3J80 N;  3RT3 C;  2VQF O;  2UUC O;  3T1H O;  4DR3 O;  4OPH A;  1X59 A;  1R1B A;  1FJG O;  4DV1 O;  4DR5 O;  1F7Y A;  1XMQ O;  4JI2 O;  4JI4 O;  1XNQ O;  4DR6 O;  5IT9 N;  5H5N A;  4KHP O;  4JI1 O;  4LF8 O;  1YZB A;  4DV4 O;  1IBK O;  2N74 A;  1N34 O;  4B3R O;  2AGA A;  2UXD O;  4DR7 O;  1IBL O;  4X65 O;  1KUQ A;  4LF7 O;  4OX9 O;  4GKJ O;  2FKX A;  1HNX O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...