4DR7O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr7O00
4DV5O 4LFBO 2F4VO 4JI2O 1N36O 1FJGO 2UUAO 4B3MO 4DV2O 4X65O 4DV3O 4JI4O 4LF6O 4JV5O 4LF4O 4LF8O 4LF7O 4YHHO 5FLXN 4JI8O 4DR6O 4X62O 4NXMO 4JYAO 1R1BA 2Z0AA 1XNQO 1XMOO 4X64O 4DV0O 4DR1O 4JI1O 4X66O 1XEQA 2UXCO 1D2DA 2VQFO 1DK1A 1F7YA 4OX9O 2HHHO 4LF9O 4JI7O 5LMUO 4KHPO 4K0KO 3SDLA 1I94O 4NXNO 2JRIA 4JI5O 4AQYO 2LW7A 4GKKO 2VQEO 5BXZA 1IBMO 3J81N 1HNXO 4DUZO 3J7AU 2UU9O 3T1HO 1AB3A 1A32A 4A5UB 1FKAO 4B3TO 1R6TA 5BR8O 1HNWO 1G1XB 3O65A 3F5TA 1J5EO 2ZKOA 4DR7O 1FYJA 2E5LO 4B3SO 4DR4O 2DOSA 2AGAA 4OPAA 3JAMN 5LL6Y 2N74A 2UUCO 3R66A 1IBKO 4JI3O 4LFCO 4YY3O 4OPHA 1N34O 2UXBO 1HNZO 4GKJO 2DJVA 3OTOO 4DR5O 4JI6O 1IBLO 4DV6O 4LF5O 1XMQO 4DUYO 2FKXA 1AILA 5H5NA 1XNRO 2UUBO 3RT3C 4B3RO 1N32O 2UXDO 1HR0O 1YZBA 3T1YO 5IT9N 4DR2O 4LFAO 5LMNO 3M8AA 1X59A 4JI0O 1N33O 5A2QN 4DV1O 4DR3O 4DV7O 2ZM6O 1KUQA 5IWAO 3J80N 4DV4O 5BY1A 1NS1A
chains in the Genus database with same CATH superfamily
1FXVA 5LA6A 4B3TB 3AK1A 2E76B 4ZBMA 2JS3A 2QJ1A 1Q90D 4B3MO 4DV2O 3X2QC 2GSMB 4Q6GA 4J42A 4K3AA 4IYIA 3UO2A 2K9PA 1JQ0A 3JASA 1SERA 4X20A 1IBMB 3ABLB 4PD4F 4FLVA 2WLMA 5LHHA 3L70H 4NTWA 2P22C 2WLIB 1XNQO 2HG5C 3SYOA 3BABA 4XDKA 1ROPA 1G8MA 1D5AA 3DXRA 4FZ0A 4TSFG 2Y4UA 5F2VO 4WF9V 2HHHB 4WFGA 4IL6Z 2DWEC 1GM8A 3ML0A 4NXNO 5KX5B 2VQEO 5IYZA 2LP7A 2A3QA 2YEVA 4QIWF 1M57B 4X1KA 5CA1A 3CEIA 4YY3B 3R65A 2UU9O 1UJWB 2UXXA 4ZHQB 5CA1B 3OM3B 1Q82W 2ZE8A 3ZMZA 5B1BC 2DYRC 2PI4A 3L73H 1Y76B 4JYBA 4OPAA 3VQVA 3STLC 2N74A 5JVDB 2JDIG 4TV9B 1L8DA 4JYCA 1HNZB 2JIZG 2CK3G 4GKJO 3E8BA 2QKSA 4B3MB 2H8PC 3JYCA 2GTAA 1NU1H 3K9SA 1NJIW 3AK2A 5IJ0B 1N32O 5GW7A 5C8YB 1HR0O 1LR1A 4PA6A 3E8GA 4YJ2B 5LHIA 2JK5C 1R3JC 1VQ8V 1OCRC 1QCEA 4JTAB 4B3SB 4K8ZA 2YC0A 1N33O 3P3PA 1GN6A 3BCCH 5LA6B 1RPRA 3W7TA 5BY1A 3C3TA 1N0NA 3X2QB 4U3JB 4F4LA 2EIMB 4DR6B 4JI6B 2OIGA 4LP8A 1VQOV 2UUCB 2PTMA 1VQMV 5EK0A 3AG2B 5FPOA 1S3JA 1XQ8A 1K8AW 4JI1O 1SETA 2RN9A 1QVFU 3CJHA 5EZYA 3KG2A 2DWDC 2UXDB 1XL6A 4DUYB 4DV6B 4Z2WA 4JYAB 1IBLB 4E2LA 4JTDB 1WA8A 2D3OW 3APOA 3CCRV 1WJZA 5H9CA 4DUZO 3D36C 2ZDIA 2QTOA 4KHPB 3B2EE 1A32A 3CE2A 5B1BB 2DYRB 1AP5A 4HBNA 2XNDG 4UVAA 5EZYB 1I94B 2W0XA 3ZIAG 2KG7A 1IDSA 5C8YA 2QWOB 1J5EO 2F95B 1DF4A 4DR4O 3CCMV 3SJBC 2VS0A 3CCSV 3SPCA 1N34O 1AJNA 1K92A 1MMMA 1HW7A 1YJWV 3OTOO 4JI2B 3JAWB 1S76D 5KUKA 1R3KC 4AHCA 5JVDA 1AR1B 3OTOB 3ZRVA 1JJ2U 2R9IA 4PDRA 2PUSA 4CH6A 3JARB 5LMUB 3T1YO 1ZL8A 4TT3G 3M8AA 3STZC 3KCXA 1E1QG 4YXWG 4UCSA 2Q7EA 4FLZA 4O4HB 4K8XA 2WLLA 4X1KB 2F4VO 5LMNB 2Q0OC 2RMKB 2EIJC 1MOFA 5B1AC 5IYZB 2ZE7A 1S5JA 1K4CC 3N2GA 1VQ7V 4C7UA 2YI8A 1XOUA 1YDXA 4JGSA 3K04A 2K1EA 1RFYA 4N21A 1OHHG 4XDJA 3T2MA 2E3CA 1D5NA 1LUVA 4B7KA 4FFKA 4IGGA 4X20B 1YSCA 1F4MA 2EINC 2WLLB 1IURA 4ZHQA 1U96A 2MK3A 3S3XA 2QWNB 3LSQA 1MABG 3EXAA 1NTMH 1F4NA 3J7AU 1NR7A 1Y4MA 1ZL8B 3OT7A 2UUAB 2CE4A 2X0LA 2EZPA 1ZUQA 4IIJA 1KB9F 4DR1B 1PV0A 3W7WA 1DGSA 1OV9A 3OEEG 4IT5A 1N8RW 2B5UA 1HR0B 4LFCO 2HJDA 2AZ0A 5CB4A 1GO3F 1K3EA 4LFCB 3FX7A 3JASB 2P90A 5JJJB 4CBCA 3ZHVA 1AI7A 1AJPA 2IJJA 4LC1A 1FS0G 5DM6V 3OGCC 4B3RO 3IAYA 1SESA 3SJQC 2PZSA 3RVZA 1PM9A 1P4RA 3ETDA 4WFHA 4DR3O 3HKDB 3HKDA 2ZXWC 3U0ZA 4J11A 1L0LH 5DN6G 1NBMG 1ZAUA 5TISZ 1N4CA 4UXNA 4DW1A 3OFNG 3WG7C 1WP7A 1QLEC 1NTKH 4LF6O 2ZNJA 4LF8O 4JZ2A 4WFFA 2QDOA 4H0LB 2VQEB 4DR7B 2JGUA 1YEWA 4ZKIA 2JS5A 3HB3B 2D2CB 2EILB 3UQ8A 1YVWA 3B40A 4CC5A 2X6AA 3QO8A 5H2FZ 4O4LB 4PHZA 2A0LA 1QLNA 3ZHRA 4FPPA 4I7ZB 4IIJB 3E8HA 3BRCA 3E22A 5KA6A 3JD4A 4I55B 1LUWA 4NXMB 2LW7A 1B04A 4RQEA 5EC1C 1NH2D 5L3BA 1X4TA 4Z1VA 3HKCB 4FM2A 3K5OA 1AB3A 3SR2C 2FB5A 1GMGA 5L3DA 1H2LA 5BR8O 2BOCC 2GBOA 3RGBA 3ZJZA 2DYSC 3JSNA 2AW9A 3A0BZ 2DOSA 2AGAA 3JAMN 3AG3B 3QTCA 4NB5A 1IVSA 2ZINA 1PL0A 1WB7A 3ZRSA 2ZQMA 3SPHA 1M5IA 5CBFA 4DR4B 2E74B 3CCUV 3ABMC 4JI5B 3ZS8C 2RCVA 3N2KA 4FFBB 1JA8A 3L74H 1XUQA 3W7UA 1NVPB 3CCQV 1ZX3A 4NTXA 5IT9N 5LMNO 2QSAA 4DV1O 3DC6A 3UT5A 1TVKB 1NS1A 2XAFA 5EC2C 2W6JG 1H8HG 2F43G 5JQGB 4MVSA 1BGYH 4QE7A 3D36A 4EFEA 4I4TB 1U97A 2XAHA 4O2AB 4BWAA 4X1YB 2KQXA 4JYYA 2WLIA 1OCZC 5LOVB 2FTKA 2MW2B 1ZLZA 2VQFO 3BAAA 2QA4V 2R72A 3P30A 3RBZA 1I94O 1FFTB 4MTFA 2BE3A 3L9DA 1GN2A 1F51A 4P9OA 4N23A 3T1HO 1XI1A 2VWKA 3H1LH 5GONA 4A5UB 2YICA 5J2TB 2WLKA 2GUZA 2DW4A 1R3LC 4YJ3A 3K08A 1Y74B 4I0XB 3SYCA 4B7EA 1K34A 1CP9A 2G38A 1S5HC 1TUBA 2M7WA 4YHHB 2DQ3A 4HNAA 3THOA 1IBKO 4MT8A 1HNZO 3ABMB 1K4DC 1P49A 2V7QG 1SQBH 1GAXA 4R7CA 3IC9A 2IU3A 2A79B 2L35A 5GTIZ 3OMAB 2ZNIA 3FB5C 4AI8A 5KHIA 1MZFA 3CHXA 2Q8VA 2Q9LA 4J9YB 4UB6Z 3E8FA 2BCCH 1YXBA 3ZHUA 5HFLA 3QNEA 4LBEC 3T1HB 3FAVA 1K9MW 3HKEB 1KU9A 3F7VC 3NR7A 4JI8O 2GDSA 3ABKC 1H2SB 2ILMA 4FLYA 5J2UA 4RUFA 1PKXA 5JCOA 3LDCA 2Y4TA 1GKFA 2OCCB 3JD3A 1Y76A 3WB0A 1YHQV 1GRJA 5IYCO 4OGQB 1TGOA 4B3RB 1BE3H 3JALB 4UCUA 2JRIA 5CBHA 2OTJV 4UFZA 5DEDA 3ICXA 4EKWA 1ZWIC 3SPIA 4GT1A 3T1CA 4R6ZA 3S3WA 2WLJA 1JFFB 1NZ6A 2XAGA 2XAJA 1K73W 5JWPA 5KX5A 1T5EA 4WFBV 4PDMA 2RNBA 1JCHA 4D7SA 1R6TA 1G6UA 3GVMA 1OCCC 4NXNB 1H38A 5EBMC 1AROP 3DXRB 5JH7B 5B3SB 3TJTA 2EZOA 5LP6B 2B1IA 4TQFA 1E1RG 4UCRA 4JI3O 1GM9A 2PI5A 2EIJB 3CMEV 4ABMA 2Q4PA 1MNGA 3QG5A 2KG7B 1NT2B 3CRQA 1B6QA 4LF5O 2QM8A 2JJ2G 2ADPA 2A06H 1XILA 1AI4A 2ARHA 1E79G 3OGIB 3O9OA 1WA8B 2QGNA 1GN3A 3CYOA 1MSDA 2ADQB 4I50A 3B77A 3ZMUA 2LGWA 3ZEDA 2EINB 4XBFA 2CH7B 2Q7HA 2OTLV 4BW9A 5FPRA 4BIOA 1PD3A 4FZ1A 1IBKB 5L3EA 2OCCC 2AHZA 4X64O 2VRZA 3I55V 3QO5A 3D8CA 3CC7V 4X66O 3RYHA 1W2BU 1OCOB 1QU7A 5LGTA 2YXYA 1F7YA 2GV9A 4QPJA 2AHYA 4CS2A 3UKMA 1P84F 2EILC 2QEXV 3L75H 4DRXA 3PJSK 4GX0A 3LNNA 1L0NH 1OZ0A 3DTUB 4TUYB 1XBLA 3VOUA 1SQPH 4MVZA 2BTOA 1I5XA 4X8AA 5IJ0A 4AILC 2F66C 3FB6C 4O4JA 3ASOC 1I08A 2BOBC 1HNWO 1FFXB 5CA0A 4BR6A 3WB1A 4HYOA 2Q0AA 4PJ0Z 3ZCCA 2ZE6A 4GCZA 5KHJA 3OW2U 1V55B 4P9PA 1FPOA 1IZ3A 3OUSA 4DUZB 4RAIA 3CRRA 1XMQB 3AG4B 3P32A 2YI9A 4QE9A 2GTSA 4W4KA 4DYLA 3EFFK 4QPKA 2A7WA 3A8TA 2P4VA 3BPZA 1Q7YW 3RT3C 2YS8A 1EZJA 5KA5A 2E5LB 3H1IH 4PELA 1H2MA 4TV8B 4X1IB 1KUQA 1B3QA 2QWRB 3Q4HA 4JTCB 1JVMA 4PI0A 5BR8B 5IY5C 1VQ9V 4DV5O 4LFBO 4WBNA 3ZX6A 1K33A 5E79Z 4MW3A 2UUAO 1FXKB 5CA3A 4UB8Z 4LNUB 3CC2V 1VP7A 4YHHO 5FLXN 3K5NA 2DQ0A 3JAKB 2XHBA 4DR6O 1THZA 4W4LA 1IXBA 4NXMO 1B06A 3TCUA 4DW0A 4DXWA 4R50A 5LGNA 4GLXA 2Z0AA 3RVYA 3APQA 1K5QA 1W0JG 1H2KA 2M6YA 4ZI7A 4UUJC 4DK1A 2YIBD 1Q8IA 1XEQA 1D2DA 4QJFB 1DK1A 4LF9B 2B1GA 4K0KO 2HFEC 2WPDG 1N32B 3L72H 3M7MX 2W0FC 4H33A 4DV3B 3BY6A 4PA4A 1JOYA 3K5LA 2JGDA 5ITZB 4L8JA 5CMUA 3UO3A 1BZKA 2ZM6B 4YIPA 3CX5F 5BMVA 4GX1A 4UCTA 3HKBA 3OMIB 2F4VB 3CCEV 1N0JA 1COWG 1G1XB 5CBGA 4O2BB 3B8NA 4KL1A 5LBQA 5LL6Y 2Z5UA 3SYQA 3AG4C 2LQTA 2YSUB 4OPHA 3L71H 1M4UA 1IX9A 3QF7A 1M9NA 4MVUA 2AZ2A 3VQYA 4CH5A 2RDCA 3LNMB 1CXZB 1GM7A 4KUMA 5D5PA 1I5YA 3K0GA 3JATA 2CTWA 2LFRA 4R8CA 2KKWA 3U10A 3ZHQA 4DV1B 2PYJA 2BSKB 5EIBD 3TETA 2UUBB 4DV4O 1J95A 3CMAV 4I50B 1V54B 4MVQA 1XNQB 4KXRA 1K7DA 1QR9A 1AP6A 3CPWU 2QE7G 2JGDB 4RQFA 3ZMVA 3ZRWB 2Q68A 2HVJC 4DV2B 5KAFZ 3T4ZA 2Q73A 4JYAO 5B5EZ 2KSDA 4Z1MG 4DV0O 2V4DA 5IWAB 4MW8A 4ZI7B 1EM1A 2PF4E 3MAQA 1VQNV 3H9VA 3M99B 1JR9A 4FIPC 5IYDO 1SQGA 1VEWA 2YIDA 4LH7A 4UCVA 1WP8A 3ZBHA 3JD2A 1S5LZ 5D5QA 2BTQA 1PNKA 3MD0A 5KMGA 2Y69B 5EYPB 3UCSC 1WPBA 1WB8A 4IHJA 3FB7C 4F6EA 2PY5A 1AR4A 5J9PC 4B3SO 1N33B 1R6KA 4ZOLA 5CN0A 1VF5B 3E35A 3OEHG 2UXBO 2KB1A 1M57C 2ODMA 5C93A 2ZE5A 1H2NA 4FMTA 4P2ZA 4GKKB 2OCHA 2P4KA 2F93B 4JV5B 3ABKB 3LUTB 1XHXA 4DO2A 2IJKA 1XNRO 3HKEA 2ZR3A 1G4YB 4DR2O 1V54C 1FFXA 4MVRA 2CGOA 2VQFB 1X59A 1EN5A 4I9WA 3ZHSA 2Q7GA 3T1YB 1KD1W 3J80N 1YJ9V 1YF2A 2WWWA 4KFMA 1K5SA 1Q5OA 1YJNV 5KHGA 3DGEA 3F5WC 1FJGO 4LWSA 3E86A 4GUNA 3C3SA 1KKDA 4X65B 3IGAC 4FM1A 2ITDC 1N36B 4GX2A 2JEXA 4MVOA 3WB2A 5LXTB 1GN4A 4X62O 1SF9A 1BT8A 2RQ6A 4E4EA 4X64B 3G4SV 1OJHA 3ZRXA 2XAQA 3K59A 1PL4A 1WNSA 3JD1A 4O4IA 2HHHO 4KHPO 5H6QA 3SDLA 1URFA 3H1KH 1BSMA 4ZIBA 4JI4B 1Y74A 4X89A 4AQYO 2Q6AA 4PDVA 1IBMO 2Y69C 5LYJB 3A0HZ 1Q81W 5KLVH 3FYIB 3AG7A 3GB7C 2ETNA 3T4DA 3TGUH 1SA0A 5IDJA 4B3TO 1QHTA 3B4SA 2XOKG 1SRYA 3NXSA 4JI1B 5FL7G 1Z5WA 4DV7B 3TXSA 1FYJA 2EULA 1AR5A 2EIKC 4F6RB 1QR8A 4FVMA 1RM1C 4JI3B 1YTFB 2ZIOA 1SQVH 4DR5O 2IU0A 5B1AB 3E89A 3KZIZ 5FNVA 4BIUA 1NVPD 4ICGA 2HLDG 4DV5B 3QO7A 4LFBB 3ETGA 4DR5B 4DK0A 2CUGA 3CRMA 5JH7A 1BHAA 2UUBO 1IXMA 3AG1C 4LNUA 1VF6A 1BMFG 3D3QA 3GWOA 3K0DA 4P30A 2OWOA 3DC5A 4DV7O 3D3IA 4YIOA 4PA7A 1I7FA 2XTAA 3ETQA 5B1NA 4EB6B 1WLEA 3OMNB 1WAZA 4JASA 4JF3A 4JI2O 1SZTA 1NTZH 1SQFA 4J7ZA 1XDCA 1HNXB 3UM7A 2V1DA 1FXKC 1PNLA 2EJ7A 2CTQA 3MDSA 2ZD9A 3BA9A 4CZZA 2EJRA 1QBZA 4DR3B 3SYAA 4WFEA 1WPXA 3HPLC 3A0RA 3H1JH 4TQDA 2W6IG 2F1MA 4JI5O 3PN1A 1VF7A 2QWPB 3WU2Z 1R73A 4PA3A 2YXHA 3BEHA 2BTQB 1BHBA 4LF7B 1VQPV 4NYKA 1HNXO 4BIZA 3CWBH 2H94A 3B09A 1MZEA 3C90A 3HKCA 5K1XA 2P5OA 3KKYA 3OR7C 1YI2V 2RJZA 5H6RA 3JSLA 2CTPA 1NKDA 1VQ4V 2CGNA 3HR0A 4FLXA 2N04A 4J7KA 1JMKC 2LGQA 3RYFA 3JATB 1QVGU 4DR2B 2UUCO 4F6RA 2H3OA 4XDLA 1XNRB 3ZMTA 1YTFD 1F23A 3FB8C 4L87A 2CDYA 1Q3EA 1YCIA 5KUMA 3AG1B 1NQTA 4RWUA 4LF4B 5KAIZ 1M93A 2WA3A 4MVMA 2X6BA 1EN4A 3ZMSA 1Z2GA 1M90W 3CB2A 5J2TA 4JI0O 1PNMA 1KKCA 2BSKA 4LF5B 2HR3A 4U7NA 2QKCA 2YXLA 3F7YC 5ITZA 4LF4O 4O4IB 3CRCA 2YDEA 3MHHC 3FKSG 1R1BA 4AQYB 4JAAA 1XMOO 3OE7G 3RYFB 2UXCO 1DLBA 1GK9A 3JD0A 5CB4B 1NR1A 2R9AA 3K79A 3RFRA 1QNMA 4MTXA 4LR3A 1FAFA 4MSWC 4O2AA 3K06A 1PP9H 4MTOA 4J10A 5IJ9B 2WA4A 1VF6C 1Q6HA 4K35A 3EHBB 1N34B 1RSOB 1FJGB 2Y0PA 1JFFA 3Q4HB 2LFSA 1FKAO 3DSQA 2IW5A 2P7TC 1P7GA 1L1FA 3O65A 4H13B 4RO2A 3N2KB 4FFBA 3SPJA 1VMGA 3CCLV 4JI8B 1VQ5V 4HZ3A 4CS4A 2QTSA 2HKOA 4U7OA 3JAKA 2Y0IA 5AG2A 2WLHA 2HVKC 3CCVV 2NN4A 3SPGA 4WCEV 4IYHA 2UXBB 2PYLA 3FFQA 3G80A 1AI5A 2UXDO 4EB6A 1VIBA 2JEUA 5KMGB 1KYOF 1OCZB 1RSOA 3U11A 4LFAO 2P6JA 3ABTA 1S0VA 4O4JB 4TWKA 4X1IA 2OT5A 2DYSB 4QNHB 1XREA 4NR1A 1UPGA 2EX3A 2DE0X 1H8EG 4O4HA 3OTFA 2OYQA 5IJ9A 4FLTA 2YIAA 3CXCU 1US6A 4JI4O 2Q5ZA 3JARA 4JAUA 3E22B 1AJQA 3K3WA 1VQLV 4O4LA 2ITCC 3A2FA 1SC5B 3RYHB 1SQXH 3EVKA 2P06A 4K0KB 4LF9O 1Y66A 5LMUO 3CP1A 4LF8B 3ZRWA 5B1OA 4LF6B 1WN7A 1MG1A 5JCOC 1GH6A 4WFAV 2CH7A 1Q6IA 2F23A 2Q67A 4TUYA 2YIBA 1VQKV 4FLUA 2X6CA 3ABLC 5LYJA 4GKJB 3W7XA 1JJOA 4EFBA 3CRAA 1KP3A 2IH3C 4J9ZB 4MTGA 3BA8A 4U3FH 4LH6A 3K58A 5E1AC 2LW1A 3K03A 3CJHB 1R6NA 2UU9B 5LXTA 3VBBA 2DJVA 1IBLO 4DV6O 4J41A 1KBHA 2JVDA 3GWKC 1FXHA 4DUYO 4KP4A 4LWSB 4MS2A 5EBWC 4CS3A 4PDLA 2ZCEA 4I4TA 3QVNA 2LJ2A 2QWQB 1O9HA 1CPYA 1HDJA 1FD9A 3I5DA 3K5MA 2CAZC 4PI2A 5BZBA 2FMLA 1TVKA 3UT5B 1DF5A 2Q69A 2ZT9B 1PPJH 1DTOA 2DMXA 1I0HA 3G67A 3LDEA 4FJCC 3E2EA 1S77D 1GTOA 4TOIA 4YJ2A 1JPXA 4JV5O 5DECA 5LHGA 1KMIZ 2N05A 1VQ6V 1TA8A 5L3GA 3JALA 5EBLC 1NI8A 2R70A 2NR5A 3B8MA 3SGIA 2LO1A 5JJEB 4UCOA 5LP6A 4ZOLB 1TAEA 2IJIA 4B08A 4OX9B 4OX9O 3RN4A 4JI7O 5IE9A 4G28B 4TV9A 2QR4A 4J80A 2EIKB 3ABUA 5EYPA 3TK1A 1YITV 3FAVB 3H01A 1BL8A 1RM1B 1BS3A 3SYPA 2GHYA 2IJHA 3FD9A 4TV8A 3VQWA 5K1PA 4DV4B 3AG2C 1M1KW 1XL4A 3JCZA 1BQ0A 4FLWA 3MHSC 1MSWD 3LSUA 1P7BA 4RUEA 2B9ZA 2VWJA 4I9QA 2WAMA 3SJCC 5FNVB 4I55A 4GYCB 1ZSPA 2E5LO 4HAMA 4YY3O 1HWYA 4DV0B 3CSXA 3BFRA 3CCJV 3OR6C 4UV8A 3P3NA 2O57A 4HNAB 1XMQO 5CA0B 1MA1A 2WSSG 2FKXA 3JCUZ 1OCRB 2UXNA 1NH2B 4UV9A 4JPRA 4CC6A 1OCCB 1SA0B 1Q86W 5IYBO 5A2QN 2EIMC 2ZM6O 5GONB 5B3SC 5LP6C 1SKVA 4PA9A 1HNWB 4H37A 4ASUG 3FYEB 2XT9A 5KHHA 2L6LA 5HFMA 4X62B 1S72V 4BW5A 1N36O 3OD4A 4G27B 4X65O 4DV3O 3LDDA 3KCYA 5LGUA 3K9AA 1EZVH 4NVPA 4JZGA 2ZDIC 3RYIB 2E75B 1H2GA 5GTHZ 1AVMA 3G6EV 2C2AA 1W0KG 2IH1C 5LOVA 3H1HH 4I0XA 1ORQC 4OXSA 4YJ3B 3G71V 5EIBC 4JAVA 4NKGB 3ZN0A 3BVOA 4Q20A 2AXTZ 4X1YA 1XMOB 4QGPA 1V55C 4GZRB 5BMVB 5L3CA 1M56B 5KHKA 4GKKO 1LNQA 3W7SA 2NNUA 1Q6UA 5JQGA 2HP8A 1Q43A 1ENVA 1O9GA 1KECA 2ATKC 4X88A 1V9PA 4JI7B 1R3IC 2XASA 1K97A 2CTRA 4BAYA 1OCOC 1SZXA 3F5TA 3K57A 5L3FA 3RYCB 4X9QA 4DR7O 3RWRD 3AK3A 4JI0B 3IFXA 2JJ1G 1EN6A 1CEZA 4G2KA 1BCCH 2IBZH 2HJFC 4IHJB 1FXKA 3ZN1A 1KQSU 1AILA 1ZTEA 4WBNB 3N2GB 2ZR2A 3WFVA 3ASOB 1KC8W 1YZBA 3ETEA 3N27A 4I5SA 3I56V 2IM9A 2HEPA 4UVCA 1EBOA 3OUFA 3LSSA 1W59A 3TXQA 4PV1B 1RPOA 5IWAO 4FK5C 2FL4A 1VARA 4D7TA 2YEVB 3ASNC 4LF7O 3SJAC 5B66Z 1YIJV 2EBOA 3CD6V 1Z5VA 5J2UB 4X66B 1J5EB 3JAWA 4DR1O 2ZIMA 3G6BA 2QM4A 2YUAA 1Y67A 3IJ4A 5IY5B 1RP3B 2UXCB 1M56C 1XHZA 2FYUH 4UVBA 5A9GA 4H44B 3RYCA 1SS3A 3WG7B 1QLEB 1EFRG 2XUMA 5BXZA 2DN9A 3J81N 2NLJC 2R9RB 1UFIA 3AEIA 1SQQH 1JX9A 2QM7A 3RW0A 4EEQA 1QQCA 4DRXB 2OIEA 3E83A 2QKAA 4NTYA 1HP8A 3VQXA 2ZKOA 4FM0A 2A9HA 1KP2A 3CS5A 2P67A 3R66A 3BHPA 2Y48A 2PGGA 4CH3A 2Z3YA 1TUBB 4GX5A 1AI6A 1Y6XA 3OAAG 4JI6O 2X7RB 4O2BA 3RYIA 2GUZB 3CXHF 2WLNA 5H5NA 4J7JA 2ZXWB 3HKBB 3CC4V 4CH4A 1TUEB 4LFAB 5JJNB 4LCUC 3AG3C 3IC7A 4U3JA 3ASNB 1BQZA 4D6TH 3ZHTA
chains in the Genus database with same CATH topology
4DV5O 4LFBO 2F4VO 4JI2O 1N36O 1FJGO 2UUAO 4B3MO 4DV2O 4X65O 4DV3O 4JI4O 4LF6O 4JV5O 4LF4O 4LF8O 4LF7O 4YHHO 5FLXN 4JI8O 4DR6O 4X62O 4NXMO 4JYAO 1R1BA 2Z0AA 1XNQO 1XMOO 4X64O 4DV0O 4DR1O 4JI1O 4X66O 1XEQA 2UXCO 1D2DA 2VQFO 1DK1A 1F7YA 4OX9O 2HHHO 4LF9O 4JI7O 5LMUO 4KHPO 4K0KO 3SDLA 1I94O 4NXNO 2JRIA 4JI5O 4AQYO 2LW7A 4GKKO 2VQEO 5BXZA 1IBMO 3J81N 1HNXO 4DUZO 3J7AU 2UU9O 3T1HO 1AB3A 1A32A 4A5UB 1FKAO 4B3TO 1R6TA 5BR8O 1HNWO 1G1XB 3O65A 3F5TA 1J5EO 2ZKOA 4DR7O 1FYJA 2E5LO 4B3SO 4DR4O 2DOSA 2AGAA 4OPAA 3JAMN 5LL6Y 2N74A 2UUCO 3R66A 1IBKO 4JI3O 4LFCO 4YY3O 4OPHA 1N34O 2UXBO 1HNZO 4GKJO 2DJVA 3OTOO 4DR5O 4JI6O 1IBLO 4DV6O 4LF5O 1XMQO 4DUYO 2FKXA 1AILA 5H5NA 1XNRO 2UUBO 3RT3C 4B3RO 1N32O 2UXDO 1HR0O 1YZBA 3T1YO 5IT9N 4DR2O 4LFAO 5LMNO 3M8AA 1X59A 4JI0O 1N33O 5A2QN 4DV1O 4DR3O 4DV7O 2ZM6O 1KUQA 5IWAO 3J80N 4DV4O 5BY1A 1NS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 O;  4LFB O;  2F4V O;  4JI2 O;  1N36 O;  1FJG O;  2UUA O;  4B3M O;  4DV2 O;  4X65 O;  4DV3 O;  4JI4 O;  4LF6 O;  4JV5 O;  4LF4 O;  4LF8 O;  4LF7 O;  4YHH O;  5FLX N;  4JI8 O;  4DR6 O;  4X62 O;  4NXM O;  4JYA O;  1R1B A;  2Z0A A;  1XNQ O;  1XMO O;  4X64 O;  4DV0 O;  4DR1 O;  4JI1 O;  4X66 O;  1XEQ A;  2UXC O;  1D2D A;  2VQF O;  1DK1 A;  1F7Y A;  4OX9 O;  2HHH O;  4LF9 O;  4JI7 O;  5LMU O;  4KHP O;  4K0K O;  3SDL A;  1I94 O;  4NXN O;  2JRI A;  4JI5 O;  4AQY O;  2LW7 A;  4GKK O;  2VQE O;  5BXZ A;  1IBM O;  3J81 N;  1HNX O;  4DUZ O;  3J7A U;  2UU9 O;  3T1H O;  1AB3 A;  1A32 A;  4A5U B;  1FKA O;  4B3T O;  1R6T A;  5BR8 O;  1HNW O;  1G1X B;  3O65 A;  3F5T A;  1J5E O;  2ZKO A;  4DR7 O;  1FYJ A;  2E5L O;  4B3S O;  4DR4 O;  2DOS A;  2AGA A;  4OPA A;  3JAM N;  5LL6 Y;  2N74 A;  2UUC O;  3R66 A;  1IBK O;  4JI3 O;  4LFC O;  4YY3 O;  4OPH A;  1N34 O;  2UXB O;  1HNZ O;  4GKJ O;  2DJV A;  3OTO O;  4DR5 O;  4JI6 O;  1IBL O;  4DV6 O;  4LF5 O;  1XMQ O;  4DUY O;  2FKX A;  1AIL A;  5H5N A;  1XNR O;  2UUB O;  3RT3 C;  4B3R O;  1N32 O;  2UXD O;  1HR0 O;  1YZB A;  3T1Y O;  5IT9 N;  4DR2 O;  4LFA O;  5LMN O;  3M8A A;  1X59 A;  4JI0 O;  1N33 O;  5A2Q N;  4DV1 O;  4DR3 O;  4DV7 O;  2ZM6 O;  1KUQ A;  5IWA O;  3J80 N;  4DV4 O;  5BY1 A;  1NS1 A; 
#chains in the Genus database with same CATH topology
 1FXV A;  5LA6 A;  4B3T B;  3AK1 A;  2E76 B;  4ZBM A;  2JS3 A;  2QJ1 A;  1Q90 D;  4B3M O;  4DV2 O;  3X2Q C;  2GSM B;  4Q6G A;  4J42 A;  4K3A A;  4IYI A;  3UO2 A;  2K9P A;  1JQ0 A;  3JAS A;  1SER A;  4X20 A;  1IBM B;  3ABL B;  4PD4 F;  4FLV A;  2WLM A;  5LHH A;  3L70 H;  4NTW A;  2P22 C;  2WLI B;  1XNQ O;  2HG5 C;  3SYO A;  3BAB A;  4XDK A;  1ROP A;  1G8M A;  1D5A A;  3DXR A;  4FZ0 A;  4TSF G;  2Y4U A;  5F2V O;  4WF9 V;  2HHH B;  4WFG A;  4IL6 Z;  2DWE C;  1GM8 A;  3ML0 A;  4NXN O;  5KX5 B;  2VQE O;  5IYZ A;  2LP7 A;  2A3Q A;  2YEV A;  4QIW F;  1M57 B;  4X1K A;  5CA1 A;  3CEI A;  4YY3 B;  3R65 A;  2UU9 O;  1UJW B;  2UXX A;  4ZHQ B;  5CA1 B;  3OM3 B;  1Q82 W;  2ZE8 A;  3ZMZ A;  5B1B C;  2DYR C;  2PI4 A;  3L73 H;  1Y76 B;  4JYB A;  4OPA A;  3VQV A;  3STL C;  2N74 A;  5JVD B;  2JDI G;  4TV9 B;  1L8D A;  4JYC A;  1HNZ B;  2JIZ G;  2CK3 G;  4GKJ O;  3E8B A;  2QKS A;  4B3M B;  2H8P C;  3JYC A;  2GTA A;  1NU1 H;  3K9S A;  1NJI W;  3AK2 A;  5IJ0 B;  1N32 O;  5GW7 A;  5C8Y B;  1HR0 O;  1LR1 A;  4PA6 A;  3E8G A;  4YJ2 B;  5LHI A;  2JK5 C;  1R3J C;  1VQ8 V;  1OCR C;  1QCE A;  4JTA B;  4B3S B;  4K8Z A;  2YC0 A;  1N33 O;  3P3P A;  1GN6 A;  3BCC H;  5LA6 B;  1RPR A;  3W7T A;  5BY1 A;  3C3T A;  1N0N A;  3X2Q B;  4U3J B;  4F4L A;  2EIM B;  4DR6 B;  4JI6 B;  2OIG A;  4LP8 A;  1VQO V;  2UUC B;  2PTM A;  1VQM V;  5EK0 A;  3AG2 B;  5FPO A;  1S3J A;  1XQ8 A;  1K8A W;  4JI1 O;  1SET A;  2RN9 A;  1QVF U;  3CJH A;  5EZY A;  3KG2 A;  2DWD C;  2UXD B;  1XL6 A;  4DUY B;  4DV6 B;  4Z2W A;  4JYA B;  1IBL B;  4E2L A;  4JTD B;  1WA8 A;  2D3O W;  3APO A;  3CCR V;  1WJZ A;  5H9C A;  4DUZ O;  3D36 C;  2ZDI A;  2QTO A;  4KHP B;  3B2E E;  1A32 A;  3CE2 A;  5B1B B;  2DYR B;  1AP5 A;  4HBN A;  2XND G;  4UVA A;  5EZY B;  1I94 B;  2W0X A;  3ZIA G;  2KG7 A;  1IDS A;  5C8Y A;  2QWO B;  1J5E O;  2F95 B;  1DF4 A;  4DR4 O;  3CCM V;  3SJB C;  2VS0 A;  3CCS V;  3SPC A;  1N34 O;  1AJN A;  1K92 A;  1MMM A;  1HW7 A;  1YJW V;  3OTO O;  4JI2 B;  3JAW B;  1S76 D;  5KUK A;  1R3K C;  4AHC A;  5JVD A;  1AR1 B;  3OTO B;  3ZRV A;  1JJ2 U;  2R9I A;  4PDR A;  2PUS A;  4CH6 A;  3JAR B;  5LMU B;  3T1Y O;  1ZL8 A;  4TT3 G;  3M8A A;  3STZ C;  3KCX A;  1E1Q G;  4YXW G;  4UCS A;  2Q7E A;  4FLZ A;  4O4H B;  4K8X A;  2WLL A;  4X1K B;  2F4V O;  5LMN B;  2Q0O C;  2RMK B;  2EIJ C;  1MOF A;  5B1A C;  5IYZ B;  2ZE7 A;  1S5J A;  1K4C C;  3N2G A;  1VQ7 V;  4C7U A;  2YI8 A;  1XOU A;  1YDX A;  4JGS A;  3K04 A;  2K1E A;  1RFY A;  4N21 A;  1OHH G;  4XDJ A;  3T2M A;  2E3C A;  1D5N A;  1LUV A;  4B7K A;  4FFK A;  4IGG A;  4X20 B;  1YSC A;  1F4M A;  2EIN C;  2WLL B;  1IUR A;  4ZHQ A;  1U96 A;  2MK3 A;  3S3X A;  2QWN B;  3LSQ A;  1MAB G;  3EXA A;  1NTM H;  1F4N A;  3J7A U;  1NR7 A;  1Y4M A;  1ZL8 B;  3OT7 A;  2UUA B;  2CE4 A;  2X0L A;  2EZP A;  1ZUQ A;  4IIJ A;  1KB9 F;  4DR1 B;  1PV0 A;  3W7W A;  1DGS A;  1OV9 A;  3OEE G;  4IT5 A;  1N8R W;  2B5U A;  1HR0 B;  4LFC O;  2HJD A;  2AZ0 A;  5CB4 A;  1GO3 F;  1K3E A;  4LFC B;  3FX7 A;  3JAS B;  2P90 A;  5JJJ B;  4CBC A;  3ZHV A;  1AI7 A;  1AJP A;  2IJJ A;  4LC1 A;  1FS0 G;  5DM6 V;  3OGC C;  4B3R O;  3IAY A;  1SES A;  3SJQ C;  2PZS A;  3RVZ A;  1PM9 A;  1P4R A;  3ETD A;  4WFH A;  4DR3 O;  3HKD B;  3HKD A;  2ZXW C;  3U0Z A;  4J11 A;  1L0L H;  5DN6 G;  1NBM G;  1ZAU A;  5TIS Z;  1N4C A;  4UXN A;  4DW1 A;  3OFN G;  3WG7 C;  1WP7 A;  1QLE C;  1NTK H;  4LF6 O;  2ZNJ A;  4LF8 O;  4JZ2 A;  4WFF A;  2QDO A;  4H0L B;  2VQE B;  4DR7 B;  2JGU A;  1YEW A;  4ZKI A;  2JS5 A;  3HB3 B;  2D2C B;  2EIL B;  3UQ8 A;  1YVW A;  3B40 A;  4CC5 A;  2X6A A;  3QO8 A;  5H2F Z;  4O4L B;  4PHZ A;  2A0L A;  1QLN A;  3ZHR A;  4FPP A;  4I7Z B;  4IIJ B;  3E8H A;  3BRC A;  3E22 A;  5KA6 A;  3JD4 A;  4I55 B;  1LUW A;  4NXM B;  2LW7 A;  1B04 A;  4RQE A;  5EC1 C;  1NH2 D;  5L3B A;  1X4T A;  4Z1V A;  3HKC B;  4FM2 A;  3K5O A;  1AB3 A;  3SR2 C;  2FB5 A;  1GMG A;  5L3D A;  1H2L A;  5BR8 O;  2BOC C;  2GBO A;  3RGB A;  3ZJZ A;  2DYS C;  3JSN A;  2AW9 A;  3A0B Z;  2DOS A;  2AGA A;  3JAM N;  3AG3 B;  3QTC A;  4NB5 A;  1IVS A;  2ZIN A;  1PL0 A;  1WB7 A;  3ZRS A;  2ZQM A;  3SPH A;  1M5I A;  5CBF A;  4DR4 B;  2E74 B;  3CCU V;  3ABM C;  4JI5 B;  3ZS8 C;  2RCV A;  3N2K A;  4FFB B;  1JA8 A;  3L74 H;  1XUQ A;  3W7U A;  1NVP B;  3CCQ V;  1ZX3 A;  4NTX A;  5IT9 N;  5LMN O;  2QSA A;  4DV1 O;  3DC6 A;  3UT5 A;  1TVK B;  1NS1 A;  2XAF A;  5EC2 C;  2W6J G;  1H8H G;  2F43 G;  5JQG B;  4MVS A;  1BGY H;  4QE7 A;  3D36 A;  4EFE A;  4I4T B;  1U97 A;  2XAH A;  4O2A B;  4BWA A;  4X1Y B;  2KQX A;  4JYY A;  2WLI A;  1OCZ C;  5LOV B;  2FTK A;  2MW2 B;  1ZLZ A;  2VQF O;  3BAA A;  2QA4 V;  2R72 A;  3P30 A;  3RBZ A;  1I94 O;  1FFT B;  4MTF A;  2BE3 A;  3L9D A;  1GN2 A;  1F51 A;  4P9O A;  4N23 A;  3T1H O;  1XI1 A;  2VWK A;  3H1L H;  5GON A;  4A5U B;  2YIC A;  5J2T B;  2WLK A;  2GUZ A;  2DW4 A;  1R3L C;  4YJ3 A;  3K08 A;  1Y74 B;  4I0X B;  3SYC A;  4B7E A;  1K34 A;  1CP9 A;  2G38 A;  1S5H C;  1TUB A;  2M7W A;  4YHH B;  2DQ3 A;  4HNA A;  3THO A;  1IBK O;  4MT8 A;  1HNZ O;  3ABM B;  1K4D C;  1P49 A;  2V7Q G;  1SQB H;  1GAX A;  4R7C A;  3IC9 A;  2IU3 A;  2A79 B;  2L35 A;  5GTI Z;  3OMA B;  2ZNI A;  3FB5 C;  4AI8 A;  5KHI A;  1MZF A;  3CHX A;  2Q8V A;  2Q9L A;  4J9Y B;  4UB6 Z;  3E8F A;  2BCC H;  1YXB A;  3ZHU A;  5HFL A;  3QNE A;  4LBE C;  3T1H B;  3FAV A;  1K9M W;  3HKE B;  1KU9 A;  3F7V C;  3NR7 A;  4JI8 O;  2GDS A;  3ABK C;  1H2S B;  2ILM A;  4FLY A;  5J2U A;  4RUF A;  1PKX A;  5JCO A;  3LDC A;  2Y4T A;  1GKF A;  2OCC B;  3JD3 A;  1Y76 A;  3WB0 A;  1YHQ V;  1GRJ A;  5IYC O;  4OGQ B;  1TGO A;  4B3R B;  1BE3 H;  3JAL B;  4UCU A;  2JRI A;  5CBH A;  2OTJ V;  4UFZ A;  5DED A;  3ICX A;  4EKW A;  1ZWI C;  3SPI A;  4GT1 A;  3T1C A;  4R6Z A;  3S3W A;  2WLJ A;  1JFF B;  1NZ6 A;  2XAG A;  2XAJ A;  1K73 W;  5JWP A;  5KX5 A;  1T5E A;  4WFB V;  4PDM A;  2RNB A;  1JCH A;  4D7S A;  1R6T A;  1G6U A;  3GVM A;  1OCC C;  4NXN B;  1H38 A;  5EBM C;  1ARO P;  3DXR B;  5JH7 B;  5B3S B;  3TJT A;  2EZO A;  5LP6 B;  2B1I A;  4TQF A;  1E1R G;  4UCR A;  4JI3 O;  1GM9 A;  2PI5 A;  2EIJ B;  3CME V;  4ABM A;  2Q4P A;  1MNG A;  3QG5 A;  2KG7 B;  1NT2 B;  3CRQ A;  1B6Q A;  4LF5 O;  2QM8 A;  2JJ2 G;  2ADP A;  2A06 H;  1XIL A;  1AI4 A;  2ARH A;  1E79 G;  3OGI B;  3O9O A;  1WA8 B;  2QGN A;  1GN3 A;  3CYO A;  1MSD A;  2ADQ B;  4I50 A;  3B77 A;  3ZMU A;  2LGW A;  3ZED A;  2EIN B;  4XBF A;  2CH7 B;  2Q7H A;  2OTL V;  4BW9 A;  5FPR A;  4BIO A;  1PD3 A;  4FZ1 A;  1IBK B;  5L3E A;  2OCC C;  2AHZ A;  4X64 O;  2VRZ A;  3I55 V;  3QO5 A;  3D8C A;  3CC7 V;  4X66 O;  3RYH A;  1W2B U;  1OCO B;  1QU7 A;  5LGT A;  2YXY A;  1F7Y A;  2GV9 A;  4QPJ A;  2AHY A;  4CS2 A;  3UKM A;  1P84 F;  2EIL C;  2QEX V;  3L75 H;  4DRX A;  3PJS K;  4GX0 A;  3LNN A;  1L0N H;  1OZ0 A;  3DTU B;  4TUY B;  1XBL A;  3VOU A;  1SQP H;  4MVZ A;  2BTO A;  1I5X A;  4X8A A;  5IJ0 A;  4AIL C;  2F66 C;  3FB6 C;  4O4J A;  3ASO C;  1I08 A;  2BOB C;  1HNW O;  1FFX B;  5CA0 A;  4BR6 A;  3WB1 A;  4HYO A;  2Q0A A;  4PJ0 Z;  3ZCC A;  2ZE6 A;  4GCZ A;  5KHJ A;  3OW2 U;  1V55 B;  4P9P A;  1FPO A;  1IZ3 A;  3OUS A;  4DUZ B;  4RAI A;  3CRR A;  1XMQ B;  3AG4 B;  3P32 A;  2YI9 A;  4QE9 A;  2GTS A;  4W4K A;  4DYL A;  3EFF K;  4QPK A;  2A7W A;  3A8T A;  2P4V A;  3BPZ A;  1Q7Y W;  3RT3 C;  2YS8 A;  1EZJ A;  5KA5 A;  2E5L B;  3H1I H;  4PEL A;  1H2M A;  4TV8 B;  4X1I B;  1KUQ A;  1B3Q A;  2QWR B;  3Q4H A;  4JTC B;  1JVM A;  4PI0 A;  5BR8 B;  5IY5 C;  1VQ9 V;  4DV5 O;  4LFB O;  4WBN A;  3ZX6 A;  1K33 A;  5E79 Z;  4MW3 A;  2UUA O;  1FXK B;  5CA3 A;  4UB8 Z;  4LNU B;  3CC2 V;  1VP7 A;  4YHH O;  5FLX N;  3K5N A;  2DQ0 A;  3JAK B;  2XHB A;  4DR6 O;  1THZ A;  4W4L A;  1IXB A;  4NXM O;  1B06 A;  3TCU A;  4DW0 A;  4DXW A;  4R50 A;  5LGN A;  4GLX A;  2Z0A A;  3RVY A;  3APQ A;  1K5Q A;  1W0J G;  1H2K A;  2M6Y A;  4ZI7 A;  4UUJ C;  4DK1 A;  2YIB D;  1Q8I A;  1XEQ A;  1D2D A;  4QJF B;  1DK1 A;  4LF9 B;  2B1G A;  4K0K O;  2HFE C;  2WPD G;  1N32 B;  3L72 H;  3M7M X;  2W0F C;  4H33 A;  4DV3 B;  3BY6 A;  4PA4 A;  1JOY A;  3K5L A;  2JGD A;  5ITZ B;  4L8J A;  5CMU A;  3UO3 A;  1BZK A;  2ZM6 B;  4YIP A;  3CX5 F;  5BMV A;  4GX1 A;  4UCT A;  3HKB A;  3OMI B;  2F4V B;  3CCE V;  1N0J A;  1COW G;  1G1X B;  5CBG A;  4O2B B;  3B8N A;  4KL1 A;  5LBQ A;  5LL6 Y;  2Z5U A;  3SYQ A;  3AG4 C;  2LQT A;  2YSU B;  4OPH A;  3L71 H;  1M4U A;  1IX9 A;  3QF7 A;  1M9N A;  4MVU A;  2AZ2 A;  3VQY A;  4CH5 A;  2RDC A;  3LNM B;  1CXZ B;  1GM7 A;  4KUM A;  5D5P A;  1I5Y A;  3K0G A;  3JAT A;  2CTW A;  2LFR A;  4R8C A;  2KKW A;  3U10 A;  3ZHQ A;  4DV1 B;  2PYJ A;  2BSK B;  5EIB D;  3TET A;  2UUB B;  4DV4 O;  1J95 A;  3CMA V;  4I50 B;  1V54 B;  4MVQ A;  1XNQ B;  4KXR A;  1K7D A;  1QR9 A;  1AP6 A;  3CPW U;  2QE7 G;  2JGD B;  4RQF A;  3ZMV A;  3ZRW B;  2Q68 A;  2HVJ C;  4DV2 B;  5KAF Z;  3T4Z A;  2Q73 A;  4JYA O;  5B5E Z;  2KSD A;  4Z1M G;  4DV0 O;  2V4D A;  5IWA B;  4MW8 A;  4ZI7 B;  1EM1 A;  2PF4 E;  3MAQ A;  1VQN V;  3H9V A;  3M99 B;  1JR9 A;  4FIP C;  5IYD O;  1SQG A;  1VEW A;  2YID A;  4LH7 A;  4UCV A;  1WP8 A;  3ZBH A;  3JD2 A;  1S5L Z;  5D5Q A;  2BTQ A;  1PNK A;  3MD0 A;  5KMG A;  2Y69 B;  5EYP B;  3UCS C;  1WPB A;  1WB8 A;  4IHJ A;  3FB7 C;  4F6E A;  2PY5 A;  1AR4 A;  5J9P C;  4B3S O;  1N33 B;  1R6K A;  4ZOL A;  5CN0 A;  1VF5 B;  3E35 A;  3OEH G;  2UXB O;  2KB1 A;  1M57 C;  2ODM A;  5C93 A;  2ZE5 A;  1H2N A;  4FMT A;  4P2Z A;  4GKK B;  2OCH A;  2P4K A;  2F93 B;  4JV5 B;  3ABK B;  3LUT B;  1XHX A;  4DO2 A;  2IJK A;  1XNR O;  3HKE A;  2ZR3 A;  1G4Y B;  4DR2 O;  1V54 C;  1FFX A;  4MVR A;  2CGO A;  2VQF B;  1X59 A;  1EN5 A;  4I9W A;  3ZHS A;  2Q7G A;  3T1Y B;  1KD1 W;  3J80 N;  1YJ9 V;  1YF2 A;  2WWW A;  4KFM A;  1K5S A;  1Q5O A;  1YJN V;  5KHG A;  3DGE A;  3F5W C;  1FJG O;  4LWS A;  3E86 A;  4GUN A;  3C3S A;  1KKD A;  4X65 B;  3IGA C;  4FM1 A;  2ITD C;  1N36 B;  4GX2 A;  2JEX A;  4MVO A;  3WB2 A;  5LXT B;  1GN4 A;  4X62 O;  1SF9 A;  1BT8 A;  2RQ6 A;  4E4E A;  4X64 B;  3G4S V;  1OJH A;  3ZRX A;  2XAQ A;  3K59 A;  1PL4 A;  1WNS A;  3JD1 A;  4O4I A;  2HHH O;  4KHP O;  5H6Q A;  3SDL A;  1URF A;  3H1K H;  1BSM A;  4ZIB A;  4JI4 B;  1Y74 A;  4X89 A;  4AQY O;  2Q6A A;  4PDV A;  1IBM O;  2Y69 C;  5LYJ B;  3A0H Z;  1Q81 W;  5KLV H;  3FYI B;  3AG7 A;  3GB7 C;  2ETN A;  3T4D A;  3TGU H;  1SA0 A;  5IDJ A;  4B3T O;  1QHT A;  3B4S A;  2XOK G;  1SRY A;  3NXS A;  4JI1 B;  5FL7 G;  1Z5W A;  4DV7 B;  3TXS A;  1FYJ A;  2EUL A;  1AR5 A;  2EIK C;  4F6R B;  1QR8 A;  4FVM A;  1RM1 C;  4JI3 B;  1YTF B;  2ZIO A;  1SQV H;  4DR5 O;  2IU0 A;  5B1A B;  3E89 A;  3KZI Z;  5FNV A;  4BIU A;  1NVP D;  4ICG A;  2HLD G;  4DV5 B;  3QO7 A;  4LFB B;  3ETG A;  4DR5 B;  4DK0 A;  2CUG A;  3CRM A;  5JH7 A;  1BHA A;  2UUB O;  1IXM A;  3AG1 C;  4LNU A;  1VF6 A;  1BMF G;  3D3Q A;  3GWO A;  3K0D A;  4P30 A;  2OWO A;  3DC5 A;  4DV7 O;  3D3I A;  4YIO A;  4PA7 A;  1I7F A;  2XTA A;  3ETQ A;  5B1N A;  4EB6 B;  1WLE A;  3OMN B;  1WAZ A;  4JAS A;  4JF3 A;  4JI2 O;  1SZT A;  1NTZ H;  1SQF A;  4J7Z A;  1XDC A;  1HNX B;  3UM7 A;  2V1D A;  1FXK C;  1PNL A;  2EJ7 A;  2CTQ A;  3MDS A;  2ZD9 A;  3BA9 A;  4CZZ A;  2EJR A;  1QBZ A;  4DR3 B;  3SYA A;  4WFE A;  1WPX A;  3HPL C;  3A0R A;  3H1J H;  4TQD A;  2W6I G;  2F1M A;  4JI5 O;  3PN1 A;  1VF7 A;  2QWP B;  3WU2 Z;  1R73 A;  4PA3 A;  2YXH A;  3BEH A;  2BTQ B;  1BHB A;  4LF7 B;  1VQP V;  4NYK A;  1HNX O;  4BIZ A;  3CWB H;  2H94 A;  3B09 A;  1MZE A;  3C90 A;  3HKC A;  5K1X A;  2P5O A;  3KKY A;  3OR7 C;  1YI2 V;  2RJZ A;  5H6R A;  3JSL A;  2CTP A;  1NKD A;  1VQ4 V;  2CGN A;  3HR0 A;  4FLX A;  2N04 A;  4J7K A;  1JMK C;  2LGQ A;  3RYF A;  3JAT B;  1QVG U;  4DR2 B;  2UUC O;  4F6R A;  2H3O A;  4XDL A;  1XNR B;  3ZMT A;  1YTF D;  1F23 A;  3FB8 C;  4L87 A;  2CDY A;  1Q3E A;  1YCI A;  5KUM A;  3AG1 B;  1NQT A;  4RWU A;  4LF4 B;  5KAI Z;  1M93 A;  2WA3 A;  4MVM A;  2X6B A;  1EN4 A;  3ZMS A;  1Z2G A;  1M90 W;  3CB2 A;  5J2T A;  4JI0 O;  1PNM A;  1KKC A;  2BSK A;  4LF5 B;  2HR3 A;  4U7N A;  2QKC A;  2YXL A;  3F7Y C;  5ITZ A;  4LF4 O;  4O4I B;  3CRC A;  2YDE A;  3MHH C;  3FKS G;  1R1B A;  4AQY B;  4JAA A;  1XMO O;  3OE7 G;  3RYF B;  2UXC O;  1DLB A;  1GK9 A;  3JD0 A;  5CB4 B;  1NR1 A;  2R9A A;  3K79 A;  3RFR A;  1QNM A;  4MTX A;  4LR3 A;  1FAF A;  4MSW C;  4O2A A;  3K06 A;  1PP9 H;  4MTO A;  4J10 A;  5IJ9 B;  2WA4 A;  1VF6 C;  1Q6H A;  4K35 A;  3EHB B;  1N34 B;  1RSO B;  1FJG B;  2Y0P A;  1JFF A;  3Q4H B;  2LFS A;  1FKA O;  3DSQ A;  2IW5 A;  2P7T C;  1P7G A;  1L1F A;  3O65 A;  4H13 B;  4RO2 A;  3N2K B;  4FFB A;  3SPJ A;  1VMG A;  3CCL V;  4JI8 B;  1VQ5 V;  4HZ3 A;  4CS4 A;  2QTS A;  2HKO A;  4U7O A;  3JAK A;  2Y0I A;  5AG2 A;  2WLH A;  2HVK C;  3CCV V;  2NN4 A;  3SPG A;  4WCE V;  4IYH A;  2UXB B;  2PYL A;  3FFQ A;  3G80 A;  1AI5 A;  2UXD O;  4EB6 A;  1VIB A;  2JEU A;  5KMG B;  1KYO F;  1OCZ B;  1RSO A;  3U11 A;  4LFA O;  2P6J A;  3ABT A;  1S0V A;  4O4J B;  4TWK A;  4X1I A;  2OT5 A;  2DYS B;  4QNH B;  1XRE A;  4NR1 A;  1UPG A;  2EX3 A;  2DE0 X;  1H8E G;  4O4H A;  3OTF A;  2OYQ A;  5IJ9 A;  4FLT A;  2YIA A;  3CXC U;  1US6 A;  4JI4 O;  2Q5Z A;  3JAR A;  4JAU A;  3E22 B;  1AJQ A;  3K3W A;  1VQL V;  4O4L A;  2ITC C;  3A2F A;  1SC5 B;  3RYH B;  1SQX H;  3EVK A;  2P06 A;  4K0K B;  4LF9 O;  1Y66 A;  5LMU O;  3CP1 A;  4LF8 B;  3ZRW A;  5B1O A;  4LF6 B;  1WN7 A;  1MG1 A;  5JCO C;  1GH6 A;  4WFA V;  2CH7 A;  1Q6I A;  2F23 A;  2Q67 A;  4TUY A;  2YIB A;  1VQK V;  4FLU A;  2X6C A;  3ABL C;  5LYJ A;  4GKJ B;  3W7X A;  1JJO A;  4EFB A;  3CRA A;  1KP3 A;  2IH3 C;  4J9Z B;  4MTG A;  3BA8 A;  4U3F H;  4LH6 A;  3K58 A;  5E1A C;  2LW1 A;  3K03 A;  3CJH B;  1R6N A;  2UU9 B;  5LXT A;  3VBB A;  2DJV A;  1IBL O;  4DV6 O;  4J41 A;  1KBH A;  2JVD A;  3GWK C;  1FXH A;  4DUY O;  4KP4 A;  4LWS B;  4MS2 A;  5EBW C;  4CS3 A;  4PDL A;  2ZCE A;  4I4T A;  3QVN A;  2LJ2 A;  2QWQ B;  1O9H A;  1CPY A;  1HDJ A;  1FD9 A;  3I5D A;  3K5M A;  2CAZ C;  4PI2 A;  5BZB A;  2FML A;  1TVK A;  3UT5 B;  1DF5 A;  2Q69 A;  2ZT9 B;  1PPJ H;  1DTO A;  2DMX A;  1I0H A;  3G67 A;  3LDE A;  4FJC C;  3E2E A;  1S77 D;  1GTO A;  4TOI A;  4YJ2 A;  1JPX A;  4JV5 O;  5DEC A;  5LHG A;  1KMI Z;  2N05 A;  1VQ6 V;  1TA8 A;  5L3G A;  3JAL A;  5EBL C;  1NI8 A;  2R70 A;  2NR5 A;  3B8M A;  3SGI A;  2LO1 A;  5JJE B;  4UCO A;  5LP6 A;  4ZOL B;  1TAE A;  2IJI A;  4B08 A;  4OX9 B;  4OX9 O;  3RN4 A;  4JI7 O;  5IE9 A;  4G28 B;  4TV9 A;  2QR4 A;  4J80 A;  2EIK B;  3ABU A;  5EYP A;  3TK1 A;  1YIT V;  3FAV B;  3H01 A;  1BL8 A;  1RM1 B;  1BS3 A;  3SYP A;  2GHY A;  2IJH A;  3FD9 A;  4TV8 A;  3VQW A;  5K1P A;  4DV4 B;  3AG2 C;  1M1K W;  1XL4 A;  3JCZ A;  1BQ0 A;  4FLW A;  3MHS C;  1MSW D;  3LSU A;  1P7B A;  4RUE A;  2B9Z A;  2VWJ A;  4I9Q A;  2WAM A;  3SJC C;  5FNV B;  4I55 A;  4GYC B;  1ZSP A;  2E5L O;  4HAM A;  4YY3 O;  1HWY A;  4DV0 B;  3CSX A;  3BFR A;  3CCJ V;  3OR6 C;  4UV8 A;  3P3N A;  2O57 A;  4HNA B;  1XMQ O;  5CA0 B;  1MA1 A;  2WSS G;  2FKX A;  3JCU Z;  1OCR B;  2UXN A;  1NH2 B;  4UV9 A;  4JPR A;  4CC6 A;  1OCC B;  1SA0 B;  1Q86 W;  5IYB O;  5A2Q N;  2EIM C;  2ZM6 O;  5GON B;  5B3S C;  5LP6 C;  1SKV A;  4PA9 A;  1HNW B;  4H37 A;  4ASU G;  3FYE B;  2XT9 A;  5KHH A;  2L6L A;  5HFM A;  4X62 B;  1S72 V;  4BW5 A;  1N36 O;  3OD4 A;  4G27 B;  4X65 O;  4DV3 O;  3LDD A;  3KCY A;  5LGU A;  3K9A A;  1EZV H;  4NVP A;  4JZG A;  2ZDI C;  3RYI B;  2E75 B;  1H2G A;  5GTH Z;  1AVM A;  3G6E V;  2C2A A;  1W0K G;  2IH1 C;  5LOV A;  3H1H H;  4I0X A;  1ORQ C;  4OXS A;  4YJ3 B;  3G71 V;  5EIB C;  4JAV A;  4NKG B;  3ZN0 A;  3BVO A;  4Q20 A;  2AXT Z;  4X1Y A;  1XMO B;  4QGP A;  1V55 C;  4GZR B;  5BMV B;  5L3C A;  1M56 B;  5KHK A;  4GKK O;  1LNQ A;  3W7S A;  2NNU A;  1Q6U A;  5JQG A;  2HP8 A;  1Q43 A;  1ENV A;  1O9G A;  1KEC A;  2ATK C;  4X88 A;  1V9P A;  4JI7 B;  1R3I C;  2XAS A;  1K97 A;  2CTR A;  4BAY A;  1OCO C;  1SZX A;  3F5T A;  3K57 A;  5L3F A;  3RYC B;  4X9Q A;  4DR7 O;  3RWR D;  3AK3 A;  4JI0 B;  3IFX A;  2JJ1 G;  1EN6 A;  1CEZ A;  4G2K A;  1BCC H;  2IBZ H;  2HJF C;  4IHJ B;  1FXK A;  3ZN1 A;  1KQS U;  1AIL A;  1ZTE A;  4WBN B;  3N2G B;  2ZR2 A;  3WFV A;  3ASO B;  1KC8 W;  1YZB A;  3ETE A;  3N27 A;  4I5S A;  3I56 V;  2IM9 A;  2HEP A;  4UVC A;  1EBO A;  3OUF A;  3LSS A;  1W59 A;  3TXQ A;  4PV1 B;  1RPO A;  5IWA O;  4FK5 C;  2FL4 A;  1VAR A;  4D7T A;  2YEV B;  3ASN C;  4LF7 O;  3SJA C;  5B66 Z;  1YIJ V;  2EBO A;  3CD6 V;  1Z5V A;  5J2U B;  4X66 B;  1J5E B;  3JAW A;  4DR1 O;  2ZIM A;  3G6B A;  2QM4 A;  2YUA A;  1Y67 A;  3IJ4 A;  5IY5 B;  1RP3 B;  2UXC B;  1M56 C;  1XHZ A;  2FYU H;  4UVB A;  5A9G A;  4H44 B;  3RYC A;  1SS3 A;  3WG7 B;  1QLE B;  1EFR G;  2XUM A;  5BXZ A;  2DN9 A;  3J81 N;  2NLJ C;  2R9R B;  1UFI A;  3AEI A;  1SQQ H;  1JX9 A;  2QM7 A;  3RW0 A;  4EEQ A;  1QQC A;  4DRX B;  2OIE A;  3E83 A;  2QKA A;  4NTY A;  1HP8 A;  3VQX A;  2ZKO A;  4FM0 A;  2A9H A;  1KP2 A;  3CS5 A;  2P67 A;  3R66 A;  3BHP A;  2Y48 A;  2PGG A;  4CH3 A;  2Z3Y A;  1TUB B;  4GX5 A;  1AI6 A;  1Y6X A;  3OAA G;  4JI6 O;  2X7R B;  4O2B A;  3RYI A;  2GUZ B;  3CXH F;  2WLN A;  5H5N A;  4J7J A;  2ZXW B;  3HKB B;  3CC4 V;  4CH4 A;  1TUE B;  4LFA B;  5JJN B;  4LCU C;  3AG3 C;  3IC7 A;  4U3J A;  3ASN B;  1BQZ A;  4D6T H;  3ZHT A; 
#chains in the Genus database with same CATH homology
 4DV5 O;  4LFB O;  2F4V O;  4JI2 O;  1N36 O;  1FJG O;  2UUA O;  4B3M O;  4DV2 O;  4X65 O;  4DV3 O;  4JI4 O;  4LF6 O;  4JV5 O;  4LF4 O;  4LF8 O;  4LF7 O;  4YHH O;  5FLX N;  4JI8 O;  4DR6 O;  4X62 O;  4NXM O;  4JYA O;  1R1B A;  2Z0A A;  1XNQ O;  1XMO O;  4X64 O;  4DV0 O;  4DR1 O;  4JI1 O;  4X66 O;  1XEQ A;  2UXC O;  1D2D A;  2VQF O;  1DK1 A;  1F7Y A;  4OX9 O;  2HHH O;  4LF9 O;  4JI7 O;  5LMU O;  4KHP O;  4K0K O;  3SDL A;  1I94 O;  4NXN O;  2JRI A;  4JI5 O;  4AQY O;  2LW7 A;  4GKK O;  2VQE O;  5BXZ A;  1IBM O;  3J81 N;  1HNX O;  4DUZ O;  3J7A U;  2UU9 O;  3T1H O;  1AB3 A;  1A32 A;  4A5U B;  1FKA O;  4B3T O;  1R6T A;  5BR8 O;  1HNW O;  1G1X B;  3O65 A;  3F5T A;  1J5E O;  2ZKO A;  4DR7 O;  1FYJ A;  2E5L O;  4B3S O;  4DR4 O;  2DOS A;  2AGA A;  4OPA A;  3JAM N;  5LL6 Y;  2N74 A;  2UUC O;  3R66 A;  1IBK O;  4JI3 O;  4LFC O;  4YY3 O;  4OPH A;  1N34 O;  2UXB O;  1HNZ O;  4GKJ O;  2DJV A;  3OTO O;  4DR5 O;  4JI6 O;  1IBL O;  4DV6 O;  4LF5 O;  1XMQ O;  4DUY O;  2FKX A;  1AIL A;  5H5N A;  1XNR O;  2UUB O;  3RT3 C;  4B3R O;  1N32 O;  2UXD O;  1HR0 O;  1YZB A;  3T1Y O;  5IT9 N;  4DR2 O;  4LFA O;  5LMN O;  3M8A A;  1X59 A;  4JI0 O;  1N33 O;  5A2Q N;  4DV1 O;  4DR3 O;  4DV7 O;  2ZM6 O;  1KUQ A;  5IWA O;  3J80 N;  4DV4 O;  5BY1 A;  1NS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...