4DR7T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr7T00
2F4VT 4LFAT 4LFBT 1HNWT 4NXMT 4JI7T 4JI1T 1HR0T 4LF7T 4DR4T 2UXDT 4K0KT 4B3RT 4JI3T 4JI0T 4LF4T 1N34T 4DUZT 4DV0T 4B3MT 4DR2T 4JI4T 1XNRT 4NXNT 4DR7T 4LFCT 5BR8T 2E5LT 4DV6T 1N32T 4DR5T 2UUCT 1XMOT 4JI2T 4DV3T 4DV1T 1I94T 3T1HT 1HNXT 4DR6T 4X66T 2UXCT 4JI6T 1IBMT 2VQFT 4DR3T 1J5ET 4DUYT 4B3TT 4X62T 4DV5T 2HHHT 2ZM6T 4JV5T 4LF5T 4LF9T 2UUBT 4DR1T 4GKJT 4LF6T 1XMQT 3T1YT 4X64T 5IWAT 4DV2T 4KHPT 1IBKT 4JI8T 4JYAT 2UUAT 4LF8T 1N33T 2UU9T 2UXBT 4GKKT 1FJGT 4DV4T 1XNQT 2VQET 4AQYT 1N36T 5LMUT 4DV7T 4OX9T 3OTOT 1HNZT 4X65T 4B3ST 4JI5T 5LMNT 4YY3T 4YHHT 1IBLT
chains in the Genus database with same CATH superfamily
1KF6A 4YSZA 3AE3A 5JRCB 4JI0T 3FXDB 2CMRA 5ABFA 3ZYLA 1JNZA 3RLFF 4GK5E 4O2AE 4U2YA 3R6NA 3AE7A 4U7YA 1XMOT 3AB3B 5LGUB 4JI6T 3H37A 3SFEA 2IC6A 2YDRA 3AAAB 3PUQA 1H7CA 2CXFA 1VCTA 3HKEE 4EOZB 3P7IA 4LF9T 2UUBT 1YXRA 5FVLA 1OEDE 3RYIE 4IREA 3KV5A 5E0OA 4YSXA 4NUVA 1FMVA 1IBKT 2WDQA 5HEHA 4JI8T 3C64A 4EZ4A 5IHYA 2W62A 2FBWA 2KZ7B 4WZXA 3ETVA 4DV4T 3AVRA 2V7LA 1HNZT 5FL0A 2V7MA 1B7TA 1YKEB 2WMOA 2JMKA 5LCYA 5EZYE 3VKGA 5J2TE 4QKNA 3ONJA 4JEUB 2UXDT 4LF4T 2NW7A 1SHZC 3TLVA 5L3BB 2ODVA 3RRWA 2I59A 2PG8A 1MNEA 3OYXA 1MIYA 4LFCT 4DV6T 4IDQA 1N32T 3BK9A 4DR5T 4IE6A 3IEEA 4MALA 4HFDA 3K8PC 4EXTA 2IIUA 3KINB 1E2AA 2LRLA 2VQFT 2DL1A 1YD8G 5CFBA 4CXYA 3ZYKA 4X1KE 2MTQA 5AQFB 1OEDA 3RRCA 4H9NC 5LNKA 3PU3A 4UV8B 5M4YA 5C3JA 1XDOA 2B1EA 3RHWA 5IWAT 2V6XA 1NENA 3RYHE 3AE4A 4Q25A 3MZKB 2L9QA 3JC6D 2BG9A 2CCQA 3JC6C 4AKHA 2X66A 1XNQT 3KDSE 2CBJA 1XDPA 4MFRA 1ZV4X 2IDOB 3N9NA 2HH7A 1NAFA 3UUXB 4A97A 2G0UA 3HKDE 3AA7B 3AXJA 4ZI2D 1FEWA 2ZM8A 2VKHA 2W00A 3B57A 3VRAA 5HEGA 4ZI2C 5AQVB 3KV4A 2X9XA 4E7SA 1SE7A 2XPKA 3CWZB 3MJXA 5HEUA 4IDZA 3ZCJA 2LSYA 4Z8XA 2CM0A 4U31A 5HWYA 2WWVA 3HI2A 4YFSA 3AE6A 3IF8B 1YQ3A 5HXHA 4HE8A 1D1AA 2H89A 4PFPA 4ILBA 2VL0A 1I94T 1WYCA 4ZS3A 1HNXT 4X66T 4KHZF 5JDHA 3CQCB 1J5ET 4A5XA 3PUGA 5ABGA 2NWBA 3FB2A 2DCFA 2HHHT 2BKNA 4JV5T 5TAOA 3N2OA 4UV9B 5HYAA 3P8CD 5DJQC 4N78D 4B6XA 3KVBA 3UTKA 3N9OA 3N9QA 4KI0F 3RH3A 2UUAT 4DVDA 4ILAA 2XAHB 4CN4A 3CKDA 3N2KE 4PW8A 2MPKA 3QNUA 3Q5EA 3CVRA 3T8OA 1MIWA 2M6BA 4ZS2A 4X65T 5LP6E 2BS4A 3FZFB 2L3LA 2VURA 4ADZA 5FXZA 3AA0B 4CI3B 5HCJA 3IA3A 4JLEA 4KX6A 4TWDA 3RGLA 1NWMX 1W09A 2JJ9A 4X1IE 1UGOA 2W66A 4DR2T 2X9YA 4F6RC 3UT5E 3FXEB 2XQYA 2DWKA 1UUSA 4MBQA 4DV1T 3TKLB 3VR8A 3ZEFB 4DUYT 1HX8A 4IGUA 4IL9A 5JR9A 4QH1A 4YTMA 3EUHA 2L8KA 3OVUA 3CMLA 1WYBA 3PTRB 2HN2A 5BMVE 2V6YB 3SRZA 5L4EA 4OHFA 3VR9A 5LXTE 3IHRA 1W0BA 2ACXA 2WBLA 3C50A 5J2UE 4YHJA 2EHOB 1EZ3A 3O1IA 4TZ4C 1LKXA 3MA9A 2WM9A 1J1JA 4QXCB 2V7KA 4HGAA 2YKSA 4WNKA 3VRBA 4M1PA 1X9BA 4AQGA 3P4QA 4G63A 4AKIA 5JQGE 3P4SA 3IBPA 1LRZA 3N2GE 4EYYR 3ZMTB 3SWHA 4TX5A 2XQAA 1VRBA 3UUMA 2ODUA 5EK4A 2XQ4A 2LSKA 4ILUA 4IE7A 4I4TE 2PFVA 3EDVA 2LT3A 1MIVA 3GMIA 3L8RA 3CIRA 4NIQA 4U74A 5JREA 1D1BA 3GN5A 1MMAA 2JQ9A 4H9PC 4QXHB 5HAXA 2XQ3A 1G73A 2JPFA 2KT9A 3EABA 3PUWF 1XMQT 1Z0PA 5FY7A 4DMWA 1WCRA 1YQ4A 2DNXA 1HF8A 5AQSB 5LB7B 4F8HA 2LOSA 1D0ZA 5J1GA 2QVAA 3RPUA 2LHRA 2WAUA 4XAXB 2J4GA 3PUVF 2VK9A 3VU7H 4UVBB 4I0UA 3QB5A 3PDYA 5JDGA 5JVDE 1J5WA 1QLBA 2W67A 4GK0E 3SOLA 2WQYA 4L9IA 2ES0A 2F4VT 2X51A 4AISA 3HA4A 4JI1T 2K3WA 2CA5A 3FBZA 3UU8A 4DIDB 2WZHA 3EHZA 2VVSA 4H9QC 1O3XA 2E5VA 1OEDC 4PJJA 2D0UA 3JAEA 2H7OA 4DR7T 5HXRA 2JIWA 5F5WA 5ABEA 2UUCT 5C8YE 2D2SA 2M6IA 3RKOA 2AE9A 5AQJB 5ABHA 4WYVA 5DABA 1MMGA 4HFHA 3ONXA 4ERRA 2BG9C 2VWAA 3ZN1B 5A1LA 4DR1T 3O1HA 4GKJT 2NW9A 3CQXC 2MAWA 3UFGA 1ZEEA 2C5KT 2HPJA 5FKYA 5LJMA 1KNRA 4IE0A 2WU5A 4ZEYA 4ASKA 4PK4A 2RPAA 1UK5A 4LF8T 2H88A 2CXDA 5J0ZA 4UIGA 3WAJA 3OTOT 3O1JA 3NWIA 2B76A 3RYFE 4YY3T 3U3IA 2PJQA 4HWCA 1OEDB 2VL8A 3AE1A 2QRXA 4JI7T 2D9DA 3ZCIA 2KINB 2NTYA 2X0YA 4UELA 3PV0F 4JI3T 2BG9E 4DUZT 4I50E 4O8SA 2E9XA 4P09A 4H63H 1KEYA 4P0BA 5JRCA 4DR6T 4O4JE 2D5UA 2CWOA 4GIWA 4H9SE 2C5IT 2WMNA 5LG4A 2I6HA 2A3DA 4ISSA 2UXXB 5FL1A 3UUNA 3RX6A 1ZOYA 3AXJB 2JRKA 3RIUA 1IJ5A 1OWAA 3ZPOA 1V9DA 4KP3C 2ZM2A 4CN1A 4EV6A 4YT0A 4TWHA 3RC8A 2XM1A 2RA1A 2J47A 4TNVA 2N2NA 4IL4A 1W9RA 3Q5DA 4EZHA 1MNDA 2IC9A 4OX9T 2KXPB 3G06A 3C51A 4AXPA 2XASB 1D0XA 5L4HA 1WR6A 3HR0A 4LF7T 1T7SA 3FZKB 1WR0A 2XQ5A 4BJNA 4K0KT 5LJNA 2NW8A 5JDLA 2BZBA 5L3GB 3AEBA 2YN6A 3RF1A 3JADA 2ZLYA 4HWFA 4DV3T 3FZLB 3NVOA 2V8SV 4FI5A 4ZOLE 3S4UA 5AQUB 4OYKA 5HXCA 4B3TT 2BVMA 1SA0E 2R6GF 5JTGA 3GWHA 2X9WA 2XJ7A 4QWNB 2KWIB 3RQUA 2Q9QA 5HEOA 1KFYA 4GYSA 1UCUA 3ESLA 3NBXX 3ABVA 5AQNB 4KHPT 2X0HA 2OV9A 4U2ZA 3ETUA 2LJLA 2YU2A 2NP9A 2X67A 3ZMSB 3FZHB 2WB5A 2WSSV 2UXBT 2XQ6A 4CXXA 5ETWA 5C2TA 3J7Yq 5AQRB 2LOPA 4MLKA 4LMKA 5LGTB 4L5GA 2VVNA 4AKGA 1JNRA 3WAKA 2PTFA 4ZZBA 4YJ3E 5F3JA 2JQHA 3FHNA 4U3CA 1YW0A 1IJ6A 1UX4A 2I0MA 1KK7A 4TUYE 3BQLA 4JUYA 2MYSA 3E08A 4JI4T 3C4ZA 3ZMVB 2QA7A 2CEAA 3JCFA 2E5LT 4A56A 5EK3A 1HFAA 5LG3A 2FJEA 4CXWA 2DI4A 4CI2B 4LMLA 2FUPA 4V1Av 2LSGA 2KMFA 3NRXA 4H9RC 2LLYA 4UVAB 3UUBA 5JDFA 2W0GA 3LDQB 3ZT7A 2LSIA 3PJAA 4X62T 3C98B 2D0TA 2VB6A 3DTOA 3SFDA 3Q5WA 4YJ2E 2ACZA 3F57A 2XTLA 2H7VC 3PUXF 1QUUA 3PJAJ 1G8XA 1LVKA 4O2BE 2V5CA 5H6QB 3TLUA 4EEBA 5CB4E 5L3DB 4PJMA 5F8PA 3CX8B 3D0TA 3ZMZB 2MOZA 3KV6A 5CA1E 3I1AA 4X1YE 2BKOA 2IUBA 1D1CA 3ZT5A 4CZZB 3ZJ2A 4HN9A 4IE4A 2YINA 2K48A 4JI5T 2XSBA 1L0VA 5AQKB 1VOMA 2CLYC 4NXMT 5L3EB 4OFZA 4C90A 4UEMA 4I55E 4TV9E 1M7KA 1HTJF 4ZI3D 3ZT6A 4EIWA 2WDVA 4B3RT 3ANWB 4ZI3C 5HEJA 3LG7A 4X5TA 3UU4A 2LM2A 4UVCB 2FJDA 5H6RB 3KBTA 3AE8A 4UXNB 3AECA 4CI1B 5LA6E 3LBXB 3HL6A 3DJBA 2N9DA 3LFMA 4IHJE 1I6ZA 3CX7B 2K9AA 4ZHQE 2FJBA 2LM9A 4OYJA 4YTPA 5GONE 3NZPA 4DR3T 2M67A 4IT4A 4UF0B 2OLTA 4YLHA 2BBHA 2KSRA 2YDSA 5L3CB 4H63V 4EB6E 2NR4A 4PNIA 2VKOA 2CHOA 3KVAA 3OPCA 1T98A 4LF6T 3SS1A 4DBRA 5FY1A 1S35A 4ZZCA 2XQ7A 5KXJA 3ZC1A 4KMCA 3AEDA 4IDNA 1ZHCA 1BR0A 4JBWF 2E9XD 2VQET 2V6YA 1LVFA 2E9XC 5AQQB 1R8IA 2BBJA 4ILCA 3AE2A 5ABFB 4COFA 2NTXA 3W15B 2RP4A 2BKPA 2EHOA 1VCSA 4U72A 3UQ4A 3Q9DA 1HX1B 2AXDS 1IBLT 4BA9A 2SPCA 3TLSA 2DLRA 3N9MA 4DR4T 5FYMA 3L39A 4E7ZA 4DBQA 4DV0T 2C0SA 4HWHA 3A5XA 1XNRT 2W63A 1HCIA 3RIUC 5LGNB 1T72A 1NEKA 3JAFA 3NKZA 3CK6A 4Z90A 1BR4A 4TNWA 4KBMB 4AI6A 4L0RA 3OJAA 2DHRA 2XY8B 3O4XE 4AKRB 2XQ8A 1S94A 2CPTA 5ADXL 3ZJ1A 2YEVC 4EGWA 4LF5T 3QK6A 5LOVE 2XAFB 2LKGA 2XZEA 3UQ7A 3B13A 3F2EA 3O9XA 4WW0A 2XSAA 5FP3A 5LYJE 2V5DA 3N9PA 2YK0A 3ZN0B 3LJCA 2BS3A 2E9XB 4HFBA 5JDNA 5FNVE 5KDMC 2HN1A 4TN7B 4MHCA 2UU9T 3BQKA 2WU2A 4YTNA 2LHNA 2J62A 3LK2B 3UULA 3L09A 2X0LB 2WDRA 4YHHT 2JMHA 3M3ZB 2CE7A 3PURA 4AKLA 2XUEA 3RIFA 3V5UA 4CN6A 3AAIA 4QXBB 3Q5XA 3UU6A 3VHLA 4IE5A 5JDQA 2E2AA 4AQFA 3AA1B 4B3MT 1UX5A 2Q9QD 2DWGA 4NXNT 5FMNA 2Q9QC 2XQ9A 3BQIA 2LKHA 2UXCT 3HKCE 1E7PA 1IBMT 5AQPB 3PUYF 3N9LA 1US7B 4DV5T 1ZKEA 2CXLA 2ZM6T 1CHUA 2BG9B 1BR1A 4O4HE 3QOFA 2XAGB 2V7JA 4X64T 3FZMB 3ZKRA 3VKHA 4PFOA 3H3MA 2Y6XA 4HKAA 4YXDA 3H3AA 4P0AA 2BDEA 3RYCE 5L47A 3AE5A 2C5JA 1HS7A 4GOUA 2A72A 3ZMUB 4GKKT 2JQQA 4XBFB 4HWDA 4AQYT 4X20E 4GYRA 3CPZA 2LRKA 5HXEA 4FJOA 4QHOA 3V5SA 1FMWA 4LFAT 4IDOA 2KNDA 1OXZA 4BJMA 4O4IE 2IAKA 2Q9QB 5JDMA 3ZYMA 1N34T 4TV8E 1XZYA 2N1GA 5FXVA 5HWXA 2VASA 1DU2A 4C91A 3AAEB 4PAGA 5AQMB 4AIUA 4NUUA 2Z6EA 1U4QA 4EEDA 2ZMAA 3OBVE 4U7IA 5JR9C 2W4XA 3CX6B 5EK2A 1IAPA 4HFVA 3MXZA 3CQGB 2X9HA 2BS2A 2XAQB 1T8BA 2E8IA 4BAYB 3I9YA 3FBLA 3Q2MA 3RI5A 2WY2A 5LHHB 4QX7B 3LK42 5FY0A 4DV2T 5AQLB 4QH5A 3RC3A 2LSJA 3AEGA 4EAHA 3UU5A 1ZP0A 3PE0A 1Y01A 3EAMA 2LEHA 4WBNE 5LHIB 4PK5A 4NPPA 4HEAA 4LMJA 3NRYA 3HKBE 2ZM0A 2CHNA 3AE9A 3PU8A 3P4RA 3K3NA 1E1HB 4LFBT 2V7IA 4XZCA 3K1SA 4P1NA 2NOXA 4O4LE 4J2CA 1WRDA 2IMLA 5FXXA 1UURA 2YOEA 5DQVA 1SUMB 3C4XA 3DP7A 4JEHB 1BR2A 1MMDA 5AQIB 3ZSSA 5JR9B 3MACA 4ZI7E 1M62A 3F31A 4U33A 3T1HT 4IIJE 4HFIA 4TWFA 4HTEA 3LSVA 2A2FX 3U78A 5IUXA 2JQKA 1QSDA 2EHOD 3RQWA 5AQOB 2WCAA 2EHOC 2YDQA 4DO0A 1HG5A 3P4PA 5HCMA 5CGMA 3R84B 4QX8B 2YU1A 4G2AA 3QUJA 3EI0A 3TLTA 2CWYA 1Z8UA 3L3PA 4K0UA 1KNZA 5FXWA 1FJGT 4IDPA 2WS3A 3N5LA 3MKDA 5LMUT 4PJNA 2P9BA 3ONLC 5LMNT 3TLWA 2BVLA 2IHR1 3LK3B 1HNWT 3ZLIA 2XM2A 3KBUA 5CJ5A 5AFUL 2VKDA 2A9UA 2Y48B 4ISTA 1XWMA 5AQTB 1GQEA 1FIOA 4DMVA 1X79A 3E22E 4HWIB 2GK9A 3GN5B 1WFDA 5AQGB 2K24A 5IYZE 4HFEA 2QGSA 1W0AA 4I43B 2V26A 3P50A 4QH4A 4PJLA 4Z91A 2XAJB 2PBIA 3AEAA 2W61A 3K3OA 3QB5K 5LHGB 3I0QA 2LE8A 2KLQA 4CQIA 2HPLA 2QYWA 3PUZF 4H9OC 5FVKA 1HG2A 3MK7C 3EVYA 1MMNA 1U5PA 2IW5B 4JYAT 3A8YC 3RIAA 5LBQB 4ZXLA 1N33T 4AQFC 3A7MA 3I9WA 3EDUA 1N36T 4DV7T 3KV9A 3OYZA 1YKHB 4PK6A 2VKJA 2WZIA 1IZNB 4YSYA 3NZQA 2K5BB 4HFCA 2OA5A 1WLXA 3K3QC 1AJ3A 2W2UA 1HR0T 2CBIA 3AA6B 2WP9A 3ZC0A 2CLYB 1KNPA 5AQHB 2J1DG 3AVSA 5L3FB 1D0YA 3E0ZA 3OKQA 3UFEA 5BR8T 4JI2T 2FJAA 3ANWA 3QC9A 3M65A 3WI3A 2CRBA 4EYUA 4DNDA 3LBXA 5LBMA 4KUMB 3X1DA 3P4WA 2V1DB 3GA8A 3UU3A 5DQWA 3T1YT 5KMGP 5KX5E 3B5MA 3ZSTA 4UF0A 2MBGA 1Y64B 3PUSA 4A98A 2KWHA 2WWUA 3PUAA 3AEFA 2X68A 3RKGA 3J9X1 5L2LA 4ANJA 5CA0E 5HXSA 2Y8DA 1CUNA 3KFWX 4B3ST 2UXNB 2H3RA 4WBOA 2XHEB 3I0OA 4OK0A 3C4WA 5JH7E 4UR9A 3AEEA
chains in the Genus database with same CATH topology
2F4VT 4LFAT 4LFBT 1HNWT 4NXMT 4JI7T 4JI1T 1HR0T 4LF7T 4DR4T 2UXDT 4K0KT 4B3RT 4JI3T 4JI0T 4LF4T 1N34T 4DUZT 4DV0T 4B3MT 4DR2T 4JI4T 1XNRT 4NXNT 4DR7T 4LFCT 5BR8T 2E5LT 4DV6T 1N32T 4DR5T 2UUCT 1XMOT 4JI2T 4DV3T 4DV1T 1I94T 3T1HT 1HNXT 4DR6T 4X66T 2UXCT 4JI6T 1IBMT 2VQFT 4DR3T 1J5ET 4DUYT 4B3TT 4X62T 4DV5T 2HHHT 2ZM6T 4JV5T 4LF5T 4LF9T 2UUBT 4DR1T 4GKJT 4LF6T 1XMQT 3T1YT 4X64T 5IWAT 4DV2T 4KHPT 1IBKT 4JI8T 4JYAT 2UUAT 4LF8T 1N33T 2UU9T 2UXBT 4GKKT 1FJGT 4DV4T 1XNQT 2VQET 4AQYT 1N36T 5LMUT 4DV7T 4OX9T 3OTOT 1HNZT 4X65T 4B3ST 4JI5T 5LMNT 4YY3T 4YHHT 1IBLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V T;  4LFA T;  4LFB T;  1HNW T;  4NXM T;  4JI7 T;  4JI1 T;  1HR0 T;  4LF7 T;  4DR4 T;  2UXD T;  4K0K T;  4B3R T;  4JI3 T;  4JI0 T;  4LF4 T;  1N34 T;  4DUZ T;  4DV0 T;  4B3M T;  4DR2 T;  4JI4 T;  1XNR T;  4NXN T;  4DR7 T;  4LFC T;  5BR8 T;  2E5L T;  4DV6 T;  1N32 T;  4DR5 T;  2UUC T;  1XMO T;  4JI2 T;  4DV3 T;  4DV1 T;  1I94 T;  3T1H T;  1HNX T;  4DR6 T;  4X66 T;  2UXC T;  4JI6 T;  1IBM T;  2VQF T;  4DR3 T;  1J5E T;  4DUY T;  4B3T T;  4X62 T;  4DV5 T;  2HHH T;  2ZM6 T;  4JV5 T;  4LF5 T;  4LF9 T;  2UUB T;  4DR1 T;  4GKJ T;  4LF6 T;  1XMQ T;  3T1Y T;  4X64 T;  5IWA T;  4DV2 T;  4KHP T;  1IBK T;  4JI8 T;  4JYA T;  2UUA T;  4LF8 T;  1N33 T;  2UU9 T;  2UXB T;  4GKK T;  1FJG T;  4DV4 T;  1XNQ T;  2VQE T;  4AQY T;  1N36 T;  5LMU T;  4DV7 T;  4OX9 T;  3OTO T;  1HNZ T;  4X65 T;  4B3S T;  4JI5 T;  5LMN T;  4YY3 T;  4YHH T;  1IBL T; 
#chains in the Genus database with same CATH topology
 1KF6 A;  4YSZ A;  3AE3 A;  5JRC B;  4JI0 T;  3FXD B;  2CMR A;  5ABF A;  3ZYL A;  1JNZ A;  3RLF F;  4GK5 E;  4O2A E;  4U2Y A;  3R6N A;  3AE7 A;  4U7Y A;  1XMO T;  3AB3 B;  5LGU B;  4JI6 T;  3H37 A;  3SFE A;  2IC6 A;  2YDR A;  3AAA B;  3PUQ A;  1H7C A;  2CXF A;  1VCT A;  3HKE E;  4EOZ B;  3P7I A;  4LF9 T;  2UUB T;  1YXR A;  5FVL A;  1OED E;  3RYI E;  4IRE A;  3KV5 A;  5E0O A;  4YSX A;  4NUV A;  1FMV A;  1IBK T;  2WDQ A;  5HEH A;  4JI8 T;  3C64 A;  4EZ4 A;  5IHY A;  2W62 A;  2FBW A;  2KZ7 B;  4WZX A;  3ETV A;  4DV4 T;  3AVR A;  2V7L A;  1HNZ T;  5FL0 A;  2V7M A;  1B7T A;  1YKE B;  2WMO A;  2JMK A;  5LCY A;  5EZY E;  3VKG A;  5J2T E;  4QKN A;  3ONJ A;  4JEU B;  2UXD T;  4LF4 T;  2NW7 A;  1SHZ C;  3TLV A;  5L3B B;  2ODV A;  3RRW A;  2I59 A;  2PG8 A;  1MNE A;  3OYX A;  1MIY A;  4LFC T;  4DV6 T;  4IDQ A;  1N32 T;  3BK9 A;  4DR5 T;  4IE6 A;  3IEE A;  4MAL A;  4HFD A;  3K8P C;  4EXT A;  2IIU A;  3KIN B;  1E2A A;  2LRL A;  2VQF T;  2DL1 A;  1YD8 G;  5CFB A;  4CXY A;  3ZYK A;  4X1K E;  2MTQ A;  5AQF B;  1OED A;  3RRC A;  4H9N C;  5LNK A;  3PU3 A;  4UV8 B;  5M4Y A;  5C3J A;  1XDO A;  2B1E A;  3RHW A;  5IWA T;  2V6X A;  1NEN A;  3RYH E;  3AE4 A;  4Q25 A;  3MZK B;  2L9Q A;  3JC6 D;  2BG9 A;  2CCQ A;  3JC6 C;  4AKH A;  2X66 A;  1XNQ T;  3KDS E;  2CBJ A;  1XDP A;  4MFR A;  1ZV4 X;  2IDO B;  3N9N A;  2HH7 A;  1NAF A;  3UUX B;  4A97 A;  2G0U A;  3HKD E;  3AA7 B;  3AXJ A;  4ZI2 D;  1FEW A;  2ZM8 A;  2VKH A;  2W00 A;  3B57 A;  3VRA A;  5HEG A;  4ZI2 C;  5AQV B;  3KV4 A;  2X9X A;  4E7S A;  1SE7 A;  2XPK A;  3CWZ B;  3MJX A;  5HEU A;  4IDZ A;  3ZCJ A;  2LSY A;  4Z8X A;  2CM0 A;  4U31 A;  5HWY A;  2WWV A;  3HI2 A;  4YFS A;  3AE6 A;  3IF8 B;  1YQ3 A;  5HXH A;  4HE8 A;  1D1A A;  2H89 A;  4PFP A;  4ILB A;  2VL0 A;  1I94 T;  1WYC A;  4ZS3 A;  1HNX T;  4X66 T;  4KHZ F;  5JDH A;  3CQC B;  1J5E T;  4A5X A;  3PUG A;  5ABG A;  2NWB A;  3FB2 A;  2DCF A;  2HHH T;  2BKN A;  4JV5 T;  5TAO A;  3N2O A;  4UV9 B;  5HYA A;  3P8C D;  5DJQ C;  4N78 D;  4B6X A;  3KVB A;  3UTK A;  3N9O A;  3N9Q A;  4KI0 F;  3RH3 A;  2UUA T;  4DVD A;  4ILA A;  2XAH B;  4CN4 A;  3CKD A;  3N2K E;  4PW8 A;  2MPK A;  3QNU A;  3Q5E A;  3CVR A;  3T8O A;  1MIW A;  2M6B A;  4ZS2 A;  4X65 T;  5LP6 E;  2BS4 A;  3FZF B;  2L3L A;  2VUR A;  4ADZ A;  5FXZ A;  3AA0 B;  4CI3 B;  5HCJ A;  3IA3 A;  4JLE A;  4KX6 A;  4TWD A;  3RGL A;  1NWM X;  1W09 A;  2JJ9 A;  4X1I E;  1UGO A;  2W66 A;  4DR2 T;  2X9Y A;  4F6R C;  3UT5 E;  3FXE B;  2XQY A;  2DWK A;  1UUS A;  4MBQ A;  4DV1 T;  3TKL B;  3VR8 A;  3ZEF B;  4DUY T;  1HX8 A;  4IGU A;  4IL9 A;  5JR9 A;  4QH1 A;  4YTM A;  3EUH A;  2L8K A;  3OVU A;  3CML A;  1WYB A;  3PTR B;  2HN2 A;  5BMV E;  2V6Y B;  3SRZ A;  5L4E A;  4OHF A;  3VR9 A;  5LXT E;  3IHR A;  1W0B A;  2ACX A;  2WBL A;  3C50 A;  5J2U E;  4YHJ A;  2EHO B;  1EZ3 A;  3O1I A;  4TZ4 C;  1LKX A;  3MA9 A;  2WM9 A;  1J1J A;  4QXC B;  2V7K A;  4HGA A;  2YKS A;  4WNK A;  3VRB A;  4M1P A;  1X9B A;  4AQG A;  3P4Q A;  4G63 A;  4AKI A;  5JQG E;  3P4S A;  3IBP A;  1LRZ A;  3N2G E;  4EYY R;  3ZMT B;  3SWH A;  4TX5 A;  2XQA A;  1VRB A;  3UUM A;  2ODU A;  5EK4 A;  2XQ4 A;  2LSK A;  4ILU A;  4IE7 A;  4I4T E;  2PFV A;  3EDV A;  2LT3 A;  1MIV A;  3GMI A;  3L8R A;  3CIR A;  4NIQ A;  4U74 A;  5JRE A;  1D1B A;  3GN5 A;  1MMA A;  2JQ9 A;  4H9P C;  4QXH B;  5HAX A;  2XQ3 A;  1G73 A;  2JPF A;  2KT9 A;  3EAB A;  3PUW F;  1XMQ T;  1Z0P A;  5FY7 A;  4DMW A;  1WCR A;  1YQ4 A;  2DNX A;  1HF8 A;  5AQS B;  5LB7 B;  4F8H A;  2LOS A;  1D0Z A;  5J1G A;  2QVA A;  3RPU A;  2LHR A;  2WAU A;  4XAX B;  2J4G A;  3PUV F;  2VK9 A;  3VU7 H;  4UVB B;  4I0U A;  3QB5 A;  3PDY A;  5JDG A;  5JVD E;  1J5W A;  1QLB A;  2W67 A;  4GK0 E;  3SOL A;  2WQY A;  4L9I A;  2ES0 A;  2F4V T;  2X51 A;  4AIS A;  3HA4 A;  4JI1 T;  2K3W A;  2CA5 A;  3FBZ A;  3UU8 A;  4DID B;  2WZH A;  3EHZ A;  2VVS A;  4H9Q C;  1O3X A;  2E5V A;  1OED C;  4PJJ A;  2D0U A;  3JAE A;  2H7O A;  4DR7 T;  5HXR A;  2JIW A;  5F5W A;  5ABE A;  2UUC T;  5C8Y E;  2D2S A;  2M6I A;  3RKO A;  2AE9 A;  5AQJ B;  5ABH A;  4WYV A;  5DAB A;  1MMG A;  4HFH A;  3ONX A;  4ERR A;  2BG9 C;  2VWA A;  3ZN1 B;  5A1L A;  4DR1 T;  3O1H A;  4GKJ T;  2NW9 A;  3CQX C;  2MAW A;  3UFG A;  1ZEE A;  2C5K T;  2HPJ A;  5FKY A;  5LJM A;  1KNR A;  4IE0 A;  2WU5 A;  4ZEY A;  4ASK A;  4PK4 A;  2RPA A;  1UK5 A;  4LF8 T;  2H88 A;  2CXD A;  5J0Z A;  4UIG A;  3WAJ A;  3OTO T;  3O1J A;  3NWI A;  2B76 A;  3RYF E;  4YY3 T;  3U3I A;  2PJQ A;  4HWC A;  1OED B;  2VL8 A;  3AE1 A;  2QRX A;  4JI7 T;  2D9D A;  3ZCI A;  2KIN B;  2NTY A;  2X0Y A;  4UEL A;  3PV0 F;  4JI3 T;  2BG9 E;  4DUZ T;  4I50 E;  4O8S A;  2E9X A;  4P09 A;  4H63 H;  1KEY A;  4P0B A;  5JRC A;  4DR6 T;  4O4J E;  2D5U A;  2CWO A;  4GIW A;  4H9S E;  2C5I T;  2WMN A;  5LG4 A;  2I6H A;  2A3D A;  4ISS A;  2UXX B;  5FL1 A;  3UUN A;  3RX6 A;  1ZOY A;  3AXJ B;  2JRK A;  3RIU A;  1IJ5 A;  1OWA A;  3ZPO A;  1V9D A;  4KP3 C;  2ZM2 A;  4CN1 A;  4EV6 A;  4YT0 A;  4TWH A;  3RC8 A;  2XM1 A;  2RA1 A;  2J47 A;  4TNV A;  2N2N A;  4IL4 A;  1W9R A;  3Q5D A;  4EZH A;  1MND A;  2IC9 A;  4OX9 T;  2KXP B;  3G06 A;  3C51 A;  4AXP A;  2XAS B;  1D0X A;  5L4H A;  1WR6 A;  3HR0 A;  4LF7 T;  1T7S A;  3FZK B;  1WR0 A;  2XQ5 A;  4BJN A;  4K0K T;  5LJN A;  2NW8 A;  5JDL A;  2BZB A;  5L3G B;  3AEB A;  2YN6 A;  3RF1 A;  3JAD A;  2ZLY A;  4HWF A;  4DV3 T;  3FZL B;  3NVO A;  2V8S V;  4FI5 A;  4ZOL E;  3S4U A;  5AQU B;  4OYK A;  5HXC A;  4B3T T;  2BVM A;  1SA0 E;  2R6G F;  5JTG A;  3GWH A;  2X9W A;  2XJ7 A;  4QWN B;  2KWI B;  3RQU A;  2Q9Q A;  5HEO A;  1KFY A;  4GYS A;  1UCU A;  3ESL A;  3NBX X;  3ABV A;  5AQN B;  4KHP T;  2X0H A;  2OV9 A;  4U2Z A;  3ETU A;  2LJL A;  2YU2 A;  2NP9 A;  2X67 A;  3ZMS B;  3FZH B;  2WB5 A;  2WSS V;  2UXB T;  2XQ6 A;  4CXX A;  5ETW A;  5C2T A;  3J7Y q;  5AQR B;  2LOP A;  4MLK A;  4LMK A;  5LGT B;  4L5G A;  2VVN A;  4AKG A;  1JNR A;  3WAK A;  2PTF A;  4ZZB A;  4YJ3 E;  5F3J A;  2JQH A;  3FHN A;  4U3C A;  1YW0 A;  1IJ6 A;  1UX4 A;  2I0M A;  1KK7 A;  4TUY E;  3BQL A;  4JUY A;  2MYS A;  3E08 A;  4JI4 T;  3C4Z A;  3ZMV B;  2QA7 A;  2CEA A;  3JCF A;  2E5L T;  4A56 A;  5EK3 A;  1HFA A;  5LG3 A;  2FJE A;  4CXW A;  2DI4 A;  4CI2 B;  4LML A;  2FUP A;  4V1A v;  2LSG A;  2KMF A;  3NRX A;  4H9R C;  2LLY A;  4UVA B;  3UUB A;  5JDF A;  2W0G A;  3LDQ B;  3ZT7 A;  2LSI A;  3PJA A;  4X62 T;  3C98 B;  2D0T A;  2VB6 A;  3DTO A;  3SFD A;  3Q5W A;  4YJ2 E;  2ACZ A;  3F57 A;  2XTL A;  2H7V C;  3PUX F;  1QUU A;  3PJA J;  1G8X A;  1LVK A;  4O2B E;  2V5C A;  5H6Q B;  3TLU A;  4EEB A;  5CB4 E;  5L3D B;  4PJM A;  5F8P A;  3CX8 B;  3D0T A;  3ZMZ B;  2MOZ A;  3KV6 A;  5CA1 E;  3I1A A;  4X1Y E;  2BKO A;  2IUB A;  1D1C A;  3ZT5 A;  4CZZ B;  3ZJ2 A;  4HN9 A;  4IE4 A;  2YIN A;  2K48 A;  4JI5 T;  2XSB A;  1L0V A;  5AQK B;  1VOM A;  2CLY C;  4NXM T;  5L3E B;  4OFZ A;  4C90 A;  4UEM A;  4I55 E;  4TV9 E;  1M7K A;  1HTJ F;  4ZI3 D;  3ZT6 A;  4EIW A;  2WDV A;  4B3R T;  3ANW B;  4ZI3 C;  5HEJ A;  3LG7 A;  4X5T A;  3UU4 A;  2LM2 A;  4UVC B;  2FJD A;  5H6R B;  3KBT A;  3AE8 A;  4UXN B;  3AEC A;  4CI1 B;  5LA6 E;  3LBX B;  3HL6 A;  3DJB A;  2N9D A;  3LFM A;  4IHJ E;  1I6Z A;  3CX7 B;  2K9A A;  4ZHQ E;  2FJB A;  2LM9 A;  4OYJ A;  4YTP A;  5GON E;  3NZP A;  4DR3 T;  2M67 A;  4IT4 A;  4UF0 B;  2OLT A;  4YLH A;  2BBH A;  2KSR A;  2YDS A;  5L3C B;  4H63 V;  4EB6 E;  2NR4 A;  4PNI A;  2VKO A;  2CHO A;  3KVA A;  3OPC A;  1T98 A;  4LF6 T;  3SS1 A;  4DBR A;  5FY1 A;  1S35 A;  4ZZC A;  2XQ7 A;  5KXJ A;  3ZC1 A;  4KMC A;  3AED A;  4IDN A;  1ZHC A;  1BR0 A;  4JBW F;  2E9X D;  2VQE T;  2V6Y A;  1LVF A;  2E9X C;  5AQQ B;  1R8I A;  2BBJ A;  4ILC A;  3AE2 A;  5ABF B;  4COF A;  2NTX A;  3W15 B;  2RP4 A;  2BKP A;  2EHO A;  1VCS A;  4U72 A;  3UQ4 A;  3Q9D A;  1HX1 B;  2AXD S;  1IBL T;  4BA9 A;  2SPC A;  3TLS A;  2DLR A;  3N9M A;  4DR4 T;  5FYM A;  3L39 A;  4E7Z A;  4DBQ A;  4DV0 T;  2C0S A;  4HWH A;  3A5X A;  1XNR T;  2W63 A;  1HCI A;  3RIU C;  5LGN B;  1T72 A;  1NEK A;  3JAF A;  3NKZ A;  3CK6 A;  4Z90 A;  1BR4 A;  4TNW A;  4KBM B;  4AI6 A;  4L0R A;  3OJA A;  2DHR A;  2XY8 B;  3O4X E;  4AKR B;  2XQ8 A;  1S94 A;  2CPT A;  5ADX L;  3ZJ1 A;  2YEV C;  4EGW A;  4LF5 T;  3QK6 A;  5LOV E;  2XAF B;  2LKG A;  2XZE A;  3UQ7 A;  3B13 A;  3F2E A;  3O9X A;  4WW0 A;  2XSA A;  5FP3 A;  5LYJ E;  2V5D A;  3N9P A;  2YK0 A;  3ZN0 B;  3LJC A;  2BS3 A;  2E9X B;  4HFB A;  5JDN A;  5FNV E;  5KDM C;  2HN1 A;  4TN7 B;  4MHC A;  2UU9 T;  3BQK A;  2WU2 A;  4YTN A;  2LHN A;  2J62 A;  3LK2 B;  3UUL A;  3L09 A;  2X0L B;  2WDR A;  4YHH T;  2JMH A;  3M3Z B;  2CE7 A;  3PUR A;  4AKL A;  2XUE A;  3RIF A;  3V5U A;  4CN6 A;  3AAI A;  4QXB B;  3Q5X A;  3UU6 A;  3VHL A;  4IE5 A;  5JDQ A;  2E2A A;  4AQF A;  3AA1 B;  4B3M T;  1UX5 A;  2Q9Q D;  2DWG A;  4NXN T;  5FMN A;  2Q9Q C;  2XQ9 A;  3BQI A;  2LKH A;  2UXC T;  3HKC E;  1E7P A;  1IBM T;  5AQP B;  3PUY F;  3N9L A;  1US7 B;  4DV5 T;  1ZKE A;  2CXL A;  2ZM6 T;  1CHU A;  2BG9 B;  1BR1 A;  4O4H E;  3QOF A;  2XAG B;  2V7J A;  4X64 T;  3FZM B;  3ZKR A;  3VKH A;  4PFO A;  3H3M A;  2Y6X A;  4HKA A;  4YXD A;  3H3A A;  4P0A A;  2BDE A;  3RYC E;  5L47 A;  3AE5 A;  2C5J A;  1HS7 A;  4GOU A;  2A72 A;  3ZMU B;  4GKK T;  2JQQ A;  4XBF B;  4HWD A;  4AQY T;  4X20 E;  4GYR A;  3CPZ A;  2LRK A;  5HXE A;  4FJO A;  4QHO A;  3V5S A;  1FMW A;  4LFA T;  4IDO A;  2KND A;  1OXZ A;  4BJM A;  4O4I E;  2IAK A;  2Q9Q B;  5JDM A;  3ZYM A;  1N34 T;  4TV8 E;  1XZY A;  2N1G A;  5FXV A;  5HWX A;  2VAS A;  1DU2 A;  4C91 A;  3AAE B;  4PAG A;  5AQM B;  4AIU A;  4NUU A;  2Z6E A;  1U4Q A;  4EED A;  2ZMA A;  3OBV E;  4U7I A;  5JR9 C;  2W4X A;  3CX6 B;  5EK2 A;  1IAP A;  4HFV A;  3MXZ A;  3CQG B;  2X9H A;  2BS2 A;  2XAQ B;  1T8B A;  2E8I A;  4BAY B;  3I9Y A;  3FBL A;  3Q2M A;  3RI5 A;  2WY2 A;  5LHH B;  4QX7 B;  3LK4 2;  5FY0 A;  4DV2 T;  5AQL B;  4QH5 A;  3RC3 A;  2LSJ A;  3AEG A;  4EAH A;  3UU5 A;  1ZP0 A;  3PE0 A;  1Y01 A;  3EAM A;  2LEH A;  4WBN E;  5LHI B;  4PK5 A;  4NPP A;  4HEA A;  4LMJ A;  3NRY A;  3HKB E;  2ZM0 A;  2CHN A;  3AE9 A;  3PU8 A;  3P4R A;  3K3N A;  1E1H B;  4LFB T;  2V7I A;  4XZC A;  3K1S A;  4P1N A;  2NOX A;  4O4L E;  4J2C A;  1WRD A;  2IML A;  5FXX A;  1UUR A;  2YOE A;  5DQV A;  1SUM B;  3C4X A;  3DP7 A;  4JEH B;  1BR2 A;  1MMD A;  5AQI B;  3ZSS A;  5JR9 B;  3MAC A;  4ZI7 E;  1M62 A;  3F31 A;  4U33 A;  3T1H T;  4IIJ E;  4HFI A;  4TWF A;  4HTE A;  3LSV A;  2A2F X;  3U78 A;  5IUX A;  2JQK A;  1QSD A;  2EHO D;  3RQW A;  5AQO B;  2WCA A;  2EHO C;  2YDQ A;  4DO0 A;  1HG5 A;  3P4P A;  5HCM A;  5CGM A;  3R84 B;  4QX8 B;  2YU1 A;  4G2A A;  3QUJ A;  3EI0 A;  3TLT A;  2CWY A;  1Z8U A;  3L3P A;  4K0U A;  1KNZ A;  5FXW A;  1FJG T;  4IDP A;  2WS3 A;  3N5L A;  3MKD A;  5LMU T;  4PJN A;  2P9B A;  3ONL C;  5LMN T;  3TLW A;  2BVL A;  2IHR 1;  3LK3 B;  1HNW T;  3ZLI A;  2XM2 A;  3KBU A;  5CJ5 A;  5AFU L;  2VKD A;  2A9U A;  2Y48 B;  4IST A;  1XWM A;  5AQT B;  1GQE A;  1FIO A;  4DMV A;  1X79 A;  3E22 E;  4HWI B;  2GK9 A;  3GN5 B;  1WFD A;  5AQG B;  2K24 A;  5IYZ E;  4HFE A;  2QGS A;  1W0A A;  4I43 B;  2V26 A;  3P50 A;  4QH4 A;  4PJL A;  4Z91 A;  2XAJ B;  2PBI A;  3AEA A;  2W61 A;  3K3O A;  3QB5 K;  5LHG B;  3I0Q A;  2LE8 A;  2KLQ A;  4CQI A;  2HPL A;  2QYW A;  3PUZ F;  4H9O C;  5FVK A;  1HG2 A;  3MK7 C;  3EVY A;  1MMN A;  1U5P A;  2IW5 B;  4JYA T;  3A8Y C;  3RIA A;  5LBQ B;  4ZXL A;  1N33 T;  4AQF C;  3A7M A;  3I9W A;  3EDU A;  1N36 T;  4DV7 T;  3KV9 A;  3OYZ A;  1YKH B;  4PK6 A;  2VKJ A;  2WZI A;  1IZN B;  4YSY A;  3NZQ A;  2K5B B;  4HFC A;  2OA5 A;  1WLX A;  3K3Q C;  1AJ3 A;  2W2U A;  1HR0 T;  2CBI A;  3AA6 B;  2WP9 A;  3ZC0 A;  2CLY B;  1KNP A;  5AQH B;  2J1D G;  3AVS A;  5L3F B;  1D0Y A;  3E0Z A;  3OKQ A;  3UFE A;  5BR8 T;  4JI2 T;  2FJA A;  3ANW A;  3QC9 A;  3M65 A;  3WI3 A;  2CRB A;  4EYU A;  4DND A;  3LBX A;  5LBM A;  4KUM B;  3X1D A;  3P4W A;  2V1D B;  3GA8 A;  3UU3 A;  5DQW A;  3T1Y T;  5KMG P;  5KX5 E;  3B5M A;  3ZST A;  4UF0 A;  2MBG A;  1Y64 B;  3PUS A;  4A98 A;  2KWH A;  2WWU A;  3PUA A;  3AEF A;  2X68 A;  3RKG A;  3J9X 1;  5L2L A;  4ANJ A;  5CA0 E;  5HXS A;  2Y8D A;  1CUN A;  3KFW X;  4B3S T;  2UXN B;  2H3R A;  4WBO A;  2XHE B;  3I0O A;  4OK0 A;  3C4W A;  5JH7 E;  4UR9 A;  3AEE A; 
#chains in the Genus database with same CATH homology
 2F4V T;  4LFA T;  4LFB T;  1HNW T;  4NXM T;  4JI7 T;  4JI1 T;  1HR0 T;  4LF7 T;  4DR4 T;  2UXD T;  4K0K T;  4B3R T;  4JI3 T;  4JI0 T;  4LF4 T;  1N34 T;  4DUZ T;  4DV0 T;  4B3M T;  4DR2 T;  4JI4 T;  1XNR T;  4NXN T;  4DR7 T;  4LFC T;  5BR8 T;  2E5L T;  4DV6 T;  1N32 T;  4DR5 T;  2UUC T;  1XMO T;  4JI2 T;  4DV3 T;  4DV1 T;  1I94 T;  3T1H T;  1HNX T;  4DR6 T;  4X66 T;  2UXC T;  4JI6 T;  1IBM T;  2VQF T;  4DR3 T;  1J5E T;  4DUY T;  4B3T T;  4X62 T;  4DV5 T;  2HHH T;  2ZM6 T;  4JV5 T;  4LF5 T;  4LF9 T;  2UUB T;  4DR1 T;  4GKJ T;  4LF6 T;  1XMQ T;  3T1Y T;  4X64 T;  5IWA T;  4DV2 T;  4KHP T;  1IBK T;  4JI8 T;  4JYA T;  2UUA T;  4LF8 T;  1N33 T;  2UU9 T;  2UXB T;  4GKK T;  1FJG T;  4DV4 T;  1XNQ T;  2VQE T;  4AQY T;  1N36 T;  5LMU T;  4DV7 T;  4OX9 T;  3OTO T;  1HNZ T;  4X65 T;  4B3S T;  4JI5 T;  5LMN T;  4YY3 T;  4YHH T;  1IBL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...