4DR7T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr7T00
4K0KT 2VQFT 1XNQT 4JI7T 4LF5T 3OTOT 4DV1T 1N33T 4DR7T 4JI4T 2UXCT 1HNZT 4DV2T 3T1YT 5BR8T 4JI1T 2ZM6T 2UUAT 4JI0T 3T1HT 2UU9T 4NXMT 4DV4T 4JI6T 4LFBT 4DR1T 4DV3T 4DUZT 4X65T 1IBMT 5LMNT 4JV5T 4DR4T 4YHHT 4DV7T 4DUYT 1HR0T 4LF9T 4LFCT 4LF7T 4X64T 5LMUT 1IBLT 4LF6T 4DR5T 1J5ET 4AQYT 4DV5T 1XNRT 4JI8T 4DV0T 1IBKT 4JI3T 2E5LT 1FJGT 4B3RT 5IWAT 1HNXT 1N36T 2UXDT 1N32T 4DV6T 4B3MT 4GKJT 1XMOT 4LF8T 4JYAT 4YY3T 4B3TT 4X66T 2HHHT 2UUCT 4LF4T 1N34T 4DR6T 4DR2T 2UUBT 2UXBT 1I94T 4JI2T 4JI5T 4GKKT 4LFAT 4OX9T 2F4VT 4KHPT 1XMQT 4NXNT 4B3ST 2VQET 1HNWT 4DR3T 4X62T
chains in the Genus database with same CATH superfamily
1ZV4X 3PU8A 4XZCA 2LRLA 1T7SA 3KDSE 3NZQA 1YXRA 1Z8UA 4KMCA 4PFOA 3SS1A 2WBLA 3R84B 4YTPA 4AKGA 1R8IA 4CXWA 4JI7T 4WW0A 5FY0A 5EK3A 2N1GA 4A5XA 3OTOT 3AE6A 2KSRA 1Y64B 4DR7T 4JI4T 2E2AA 3IHRA 4BA9A 3G06A 3T1YT 3OYXA 2X66A 5LXTE 2R6GF 2QVAA 3SRZA 2BVLA 4UVAB 4EZ4A 1MIYA 3RLFF 3ZC1A 4HFHA 2EHOD 2LEHA 4QXBB 2DHRA 3Q2MA 3ZN1B 4QWNB 2DWGA 5KX5E 2XAFB 3ONLC 2LJLA 2W63A 3ETUA 1KNZA 4HN9A 1JNZA 2WU2A 3KVBA 1OEDC 1M7KA 2E9XA 2L3LA 2WB5A 4QH1A 4NUUA 5DABA 3VHLA 2KLQA 4NXMT 3SFDA 4H9RC 3RI5A 4I4TE 2UXNB 3C4XA 3NZPA 1S94A 3RH3A 4DR1T 2DCFA 1HFAA 1LKXA 2V7IA 2XUEA 3AA7B 1BR4A 4HKAA 1JNRA 2WDVA 3P4RA 1HX1B 2LHRA 3WAJA 5L47A 4TNVA 4YXDA 5LGUB 4YJ3E 4X65T 5EZYE 1MNEA 2M6BA 4LMJA 2RPAA 2X0YA 5LMNT 4NIQA 4H9PC 5JDHA 4G63A 1HCIA 5AQNB 2LOSA 3KINB 4JLEA 2XM2A 2ZM2A 1UUSA 2ZLYA 3RRCA 4CN6A 2M67A 2X0HA 2LSIA 2BS2A 4FI5A 4IE4A 4O4LE 4ASKA 1NAFA 3I1AA 5DJQC 2WQYA 3VKGA 2GK9A 4DO0A 1MNDA 2JIWA 4JUYA 5ADXL 1YQ4A 2QRXA 4CXYA 1OEDB 4UVBB 4WBOA 4IL4A 3P50A 3LK2B 2H7VC 2NTYA 4YLHA 3ZYMA 4ZHQE 5L3EB 5L3DB 5LP6E 4A97A 3P4PA 4CXXA 4LF6T 4PFPA 5J2TE 3GMIA 4ISTA 1YQ3A 1VRBA 5LJMA 3CKDA 2A72A 4U7YA 3RKOA 3IA3A 3AE2A 4PK4A 1S35A 3GN5A 5FVLA 2HH7A 3N9NA 3O1HA 4ZI2C 2JPFA 2WS3A 4H63H 4BAYB 4DV0T 3AXJA 4L0RA 2IW5B 4CI1B 1W0AA 1OEDE 3KFWX 2HPLA 4DMWA 4B3RT 4YT0A 2NWBA 2XQYA 3Q5XA 5IWAT 4O4IE 1N36T 4EEBA 1N32T 3IF8B 1L0VA 1FMWA 4TV9E 4CN1A 4AKHA 4ZI3C 1ZEEA 4DV6T 3QUJA 5CA0E 1E2AA 3TKLB 1HG2A 2B76A 2NOXA 3VRAA 3EI0A 3LSVA 5FP3A 2H7OA 4LF8T 2MOZA 5LCYA 4AISA 3OKQA 5ABHA 4ANJA 2XQ8A 4HFBA 2XQAA 3UUMA 4WZXA 4I55E 5JDQA 1MMAA 2LT3A 4TV8E 1N34T 4DR6T 4DIDB 2A3DA 2XAHB 3ONXA 3FZKB 1QSDA 3GN5B 5AQKB 2YU1A 2LHNA 4JI5T 2XSAA 3AECA 3PUQA 3ZT6A 5HXSA 3AXJB 4K0UA 5L3FB 2F4VT 3QK6A 3AE5A 3EAMA 3OVUA 2G0UA 5FL1A 4ZI3D 2XHEB 1LVFA 3PUSA 4TN7B 2JJ9A 1FEWA 1W09A 3MA9A 4ILAA 3N2GE 4NXNT 2BDEA 3RQUA 5LNKA 4LF5T 3PUAA 4IDNA 2Y48B 5EK4A 4Z90A 5LGNB 3OJAA 1J5WA 1HS7A 3UU8A 3RKGA 4OK0A 3L3PA 4H9SE 1HF8A 4H63V 2J4GA 1CHUA 3N9OA 4F6RC 3ZEFB 2CXDA 2IIUA 5A1LA 5LB7B 3AE9A 5HEJA 2FJEA 2BBJA 3PUXF 2FUPA 5L2LA 2XAJB 3PTRB 3ZMVB 3N5LA 2C5IT 4EGWA 1UK5A 1XNQT 4XBFB 3ANWB 5ABEA 3AE7A 2NP9A 3ZJ2A 3AEDA 1LRZA 3CMLA 4U2YA 1QLBA 4IE6A 3UULA 4WYVA 4O8SA 3ZMTB 4EOZB 4YSZA 4DV2T 4MLKA 1HNZT 4ILCA 4ZXLA 4UV9B 4YSYA 2IAKA 4HFVA 3HKDE 4UIGA 2XSBA 3ZN0B 5FVKA 4ZEYA 5JR9C 3D0TA 4ILUA 4XAXB 4TX5A 2UUAT 1AJ3A 3ETVA 4Q25A 4AKLA 4AQFA 3GA8A 5C2TA 5JDLA 2SPCA 3AEAA 3OYZA 3T1HT 2E9XD 1T8BA 2DL1A 3K3OA 5AQRB 1YW0A 2NTXA 3RF1A 3O9XA 3VR8A 3ZSTA 4CI3B 2CPTA 1D0XA 5AQIB 4L5GA 5HXCA 5C3JA 3LBXA 3I9WA 2I6HA 3PURA 2A2FX 4IREA 1IBMT 2CHNA 4ISSA 2WMOA 2C5JA 1T72A 3FXDB 4PNIA 2AE9A 4HWFA 2RA1A 3C4WA 5JDNA 1DU2A 3LG7A 2HN2A 2WY2A 4LMLA 1ZP0A 2ACXA 3M3ZB 3O1JA 1D0ZA 1HX8A 2WM9A 3LDQB 2FBWA 2KINB 5EK2A 4YHHT 1UGOA 1OXZA 1BR2A 4IDOA 4DUYT 2WDQA 1HR0T 2J62A 1HG5A 2ACZA 3AEEA 3C98B 1YKHB 2MYSA 1M62A 4E7SA 2DLRA 4PJMA 2YDRA 3V5SA 2KXPB 4OYJA 5LHIB 4JEHB 2DWKA 2LSYA 5AQPB 5C8YE 3PE0A 2BKOA 2ZM0A 4DR5T 2LKHA 3HI2A 2LLYA 4KX6A 2V7KA 4KHZF 3JADA 2V26A 4U7IA 3ZMSB 3AEBA 3ONJA 4GK0E 4AQYT 3LBXB 2EHOA 2W66A 5DQVA 3QB5A 3TLUA 2IHR1 3ZYKA 2D2SA 2Q9QC 2NW9A 5JVDE 4HE8A 3C64A 4U31A 1IBKT 2CRBA 4C90A 4L9IA 4EIWA 2YK0A 4PW8A 2BKNA 2H3RA 2CBIA 2E5LT 5AQJB 4TNWA 1UURA 2X9YA 3ZSSA 4EB6E 4HFIA 1HNXT 3FZHB 1B7TA 3A7MA 3E0ZA 3HKCE 3RIUA 4CI2B 5AQVB 4DMVA 2WZHA 5JDMA 5E0OA 5TAOA 2CWYA 4C91A 2XZEA 2V6XA 2ZMAA 2X67A 3CQGB 5LHHB 3ZT7A 3I0QA 3MK7C 3RX6A 3VU7H 2H89A 2W2UA 1OEDA 2E9XC 3HKEE 4YY3T 4JYAT 4GYRA 4B3TT 4IE7A 4EYUA 4X66T 2IC9A 5J1GA 2PBIA 2VKOA 5HEUA 3RC8A 4HTEA 5FKYA 4CQIA 3J7Yq 2WDRA 4OHFA 3CIRA 3ZC0A 3PDYA 5LHGB 1IAPA 2UUBT 3KV6A 2A9UA 2LM9A 2EHOB 4FJOA 4JI2T 3ZJ1A 4TWHA 2K24A 3UU4A 3FZMB 3TLSA 3I0OA 4LFAT 5JQGE 4DVDA 2IUBA 2JMHA 3RC3A 4AI6A 2K3WA 2BG9C 4HFEA 4AXPA 2Q9QB 2WWVA 2K5BB 2VKDA 2XPKA 3C51A 3N9PA 3QOFA 4KBMB 3DJBA 2CLYB 4GK5E 4KI0F 2BVMA 4NUVA 1NENA 3AA6B 1XDPA 1ZOYA 4J2CA 5HCJA 5IYZE 3H37A 1CUNA 2J47A 1H7CA 1GQEA 3E08A 4BJNA 3FXEB 2FJAA 4P0BA 4NPPA 3FZFB 2N9DA 3AE3A 2DNXA 4U33A 2E5VA 3AEGA 3ZKRA 1X9BA 3N2OA 4KUMB 4QXHB 4UV8B 5LBMA 2XQ6A 1WR0A 4DBRA 2V5DA 3N9LA 4DNDA 1MMDA 4EZHA 1US7B 4DBQA 2XQ9A 5LG3A 3R6NA 4ADZA 3FB2A 5CA1E 2L9QA 4DV1T 1N33T 2VVSA 2NW8A 2WP9A 3SWHA 5HWYA 3AEFA 2UXCT 2WMNA 1D1AA 3C50A 4GIWA 4HWDA 2XASB 1KF6A 2I0MA 2Q9QD 2PJQA 3MXZA 4N78D 2OV9A 2V5CA 3ESLA 3PV0F 4WNKA 2ZM6T 2YKSA 3JAEA 3EDVA 4HWCA 4KP3C 5ETWA 5JH7E 4YSXA 3B57A 2XJ7A 4M1PA 3IBPA 2VB6A 3BQLA 5HEGA 5FYMA 2I59A 3A8YC 2BG9B 5F5WA 4PJNA 5ABFB 5J0ZA 3AVSA 5JTGA 3AE8A 2JQHA 2CCQA 2UU9T 3DTOA 3T8OA 4DV4T 5AQOB 3H3AA 3NRXA 3FBZA 3P8CD 3PU3A 5AQMB 4GKKT 2KWIB 2ZM8A 3JC6D 3NRYA 5AQLB 5L3GB 3UUNA 3UQ7A 4A98A 2XQ3A 5HEOA 1UX5A 3BK9A 3RIFA 2YU2A 1ZHCA 3F2EA 3MKDA 1XWMA 3O4XE 2BG9E 4DUZT 5CJ5A 1J1JA 3O1IA 5FXVA 5KXJA 1KNPA 3AAIA 3HL6A 4YTNA 2CXLA 4PK6A 4HEAA 5F8PA 2LSJA 5AQSB 4ZZBA 2CE7A 3VRBA 1D1BA 1U4QA 2E8IA 2X9HA 1NEKA 4I50E 1SE7A 4DV7T 3M65A 1VCTA 5HAXA 2WAUA 2M6IA 2IMLA 3UFEA 1BR1A 4LFCT 4MBQA 1XZYA 3SOLA 1D1CA 4E7ZA 2D0TA 4TWFA 4U3CA 4UELA 5AQHB 2IC6A 5ABGA 4UF0A 2V7LA 4IGUA 4U72A 3RYIE 5L3CB 1WYCA 3PUZF 4YHJA 1EZ3A 5DQWA 3ZCIA 1J5ET 3U78A 3JAFA 5BMVE 2V7MA 2VKJA 4DV5T 1UX4A 2KZ7B 4JI8T 5FNVE 2W4XA 1KK7A 3AAAB 4COFA 4O2AE 3CK6A 3CQCB 2W62A 3AE1A 5LA6E 1FJGT 5HWXA 1MIWA 3AVRA 4H9OC 5AQTB 4JI0T 4IE5A 3RQWA 2LSKA 3CX6B 4EYYR 2CA5A 5J2UE 2H88A 4ZI2D 2D5UA 2W0GA 5JR9A 3ZMZB 5FXZA 1MIVA 3TLVA 4GKJT 1XMOT 5LJNA 2PG8A 2CXFA 1FMVA 2KWHA 2X68A 3PJAA 3H3MA 4PJLA 2CMRA 1QUUA 1X79A 2VKHA 3F57A 1Z0PA 4TWDA 4UF0B 3UQ4A 2XQ4A 3F31A 2QGSA 2UUCT 5FXWA 3KV5A 2WU5A 3N9MA 3NWIA 3UT5E 2MAWA 3LK42 2LSGA 3QB5K 4ZI7E 4DR2T 2UXBT 2CHOA 3P4SA 4LMKA 4UEMA 3RPUA 4HWHA 5CGMA 2Y8DA 2YEVC 3CPZA 1ZKEA 1WYBA 4TUYE 4V1Av 3Q5EA 2BKPA 4O4HE 5HCMA 1SA0E 4OX9T 4KHPT 1YKEB 3W15B 5JRCA 2D9DA 5KMGP 1MMGA 1T98A 4H9QC 2XTLA 3PUVF 2Y6XA 1SHZC 4ZS2A 2PTFA 3SFEA 3ZYLA 2C0SA 1Y01A 2E9XB 2K9AA 3IEEA 4IDPA 3V5UA 2JMKA 4X1IE 5JREA 1MMNA 3A5XA 5AQFB 2W67A 4U74A 3HA4A 2VQET 1HNWT 4UR9A 4DR3T 3PUWF 4PK5A 4K0KT 5CFBA 1D0YA 1E7PA 1KNRA 2V7JA 1WRDA 1G73A 5LBQB 3RYFE 3UU3A 3WAKA 4B6XA 3UFGA 3CQXC 4UVCB 2VQFT 2D0UA 3HKBE 4JEUB 2L8KA 4QH4A 4QKNA 5JDFA 2X51A 4HFCA 2V8SV 3KBTA 4HWIB 4O4JE 4QX8B 4I0UA 5AQUB 5KDMC 2V1DB 4EXTA 5H6RB 3P7IA 5BR8T 4JI1T 2EHOC 2MBGA 3UU5A 2JQKA 5JRCB 2Q9QA 5FMNA 3EABA 3K1SA 5LG4A 3RIAA 4TZ4C 2RP4A 2CEAA 4IT4A 2LM2A 3PJAJ 4YJ2E 2LOPA 4PAGA 3ZPOA 1W9RA 2BZBA 5JDGA 1OWAA 4O2BE 3GWHA 2CLYC 5FL0A 3RIUC 3MJXA 4JI6T 1KFYA 2FJDA 4LFBT 3MZKB 5F3JA 2VL0A 1I6ZA 3VKHA 2LRKA 4MFRA 3J9X1 5FY1A 3LFMA 4BJMA 2VL8A 5HXHA 2CWOA 2AXDS 1YD8G 3QNUA 5H6QB 4AQGA 4DV3T 4AKIA 4ZS3A 3ZLIA 3AA1B 2HN1A 5LGTB 2HPJA 1IZNB 2Z6EA 2BS4A 3OPCA 3NVOA 2FJBA 3I9YA 3RRWA 4JV5T 4ILBA 2JQQA 5AQQB 1SUMB 3TLTA 4WBNE 1VCSA 4MHCA 3K8PC 4OYKA 3PUYF 2MPKA 3ZT5A 5LYJE 4DR4T 2LE8A 2YN6A 4QH5A 1WCRA 3EUHA 5FXXA 3ZCJA 3WI3A 2P9BA 3VR9A 3AAEB 2NW7A 2BG9A 3X1DA 3CVRA 5ABFA 1O3XA 3CX8B 3BQKA 3Q5WA 4ZZCA 4LF9T 5M4YA 2ODVA 5HEHA 3FBLA 4LF7T 4X64T 5L3BB 4P0AA 5LMUT 4GOUA 4HFDA 4ERRA 2KT9A 2XAQB 4G2AA 2VVNA 1HTJF 3OBVE 2WCAA 4PJJA 5L4HA 3ABVA 3S4UA 3CWZB 3QC9A 1IJ6A 2XM1A 1IBLT 1BR0A 2K48A 2LKGA 2YINA 3BQIA 3EDUA 4IIJE 5FY7A 3RGLA 3N2KE 1E1HB 3RYCE 3NKZA 1WLXA 5L4EA 4X20E 5GONE 2BBHA 1W0BA 3Q9DA 2DI4A 2CM0A 3L09A 3Q5DA 4IDZA 2IDOB 2W61A 1XNRT 3MACA 2VWAA 2OA5A 2WZIA 2YOEA 2UXXB 3KBUA 4YFSA 4ZOLE 2V6YB 4I43B 5LOVE 3RHWA 2X0LB 4JI3T 3UU6A 2N2NA 2VASA 4IHJE 4AQFC 5HXEA 5CB4E 2X9XA 2XQ5A 4CZZB 3NBXX 4QXCB 4UXNB 4IL9A 2B1EA 2C5KT 2PFVA 2XY8B 3B5MA 2ES0A 2YDSA 3AA0B 3RYHE 3UUBA 3ZMUB 2UXDT 3JC6C 2W00A 2MTQA 4U2ZA 4X1YE 1XDOA 4CN4A 2J1DG 4OFZA 4B3MT 3PUGA 3UTKA 1NWMX 4X5TA 4A56A 1FIOA 1VOMA 3E22E 3AB3B 5IUXA 3FHNA 5HYAA 3TLWA 1U5PA 2HHHT 4H9NC 3P4WA 2WSSV 4LF4T 4IE0A 2ODUA 1WR6A 5HXRA 5IHYA 3K3QC 4X1KE 2QA7A 2JRKA 3AE4A 1UCUA 2KNDA 4HGAA 2XAGB 4QHOA 4YTMA 3ANWA 3L39A 3U3IA 1I94T 2NR4A 3P4QA 3LK3B 4AIUA 5AFUL 3UUXB 4JBWF 2QYWA 2WWUA 3HR0A 3N9QA 3DP7A 3JCFA 2VK9A 4P09A 2V6YA 4QX7B 4EV6A 2KMFA 1LVKA 4AKRB 4Z91A 1XMQT 3FZLB 4IDQA 1WFDA 4MALA 2X9WA 3EHZA 4EEDA 2VURA 3L8RA 4Z8XA 4EAHA 1KEYA 2CBJA 3CX7B 3EVYA 3KV4A 3LJCA 5AQGB 4F8HA 3B13A 2BS3A 5JR9B 2YDQA 4B3ST 3K3NA 2JQ9A 4P1NA 3KV9A 2XQ7A 4GYSA 1V9DA 3C4ZA 3KVAA 1IJ5A 1G8XA 2OLTA 4X62T
chains in the Genus database with same CATH topology
4K0KT 2VQFT 1XNQT 4JI7T 4LF5T 3OTOT 4DV1T 1N33T 4DR7T 4JI4T 2UXCT 1HNZT 4DV2T 3T1YT 5BR8T 4JI1T 2ZM6T 2UUAT 4JI0T 3T1HT 2UU9T 4NXMT 4DV4T 4JI6T 4LFBT 4DR1T 4DV3T 4DUZT 4X65T 1IBMT 5LMNT 4JV5T 4DR4T 4YHHT 4DV7T 4DUYT 1HR0T 4LF9T 4LFCT 4LF7T 4X64T 5LMUT 1IBLT 4LF6T 4DR5T 1J5ET 4AQYT 4DV5T 1XNRT 4JI8T 4DV0T 1IBKT 4JI3T 2E5LT 1FJGT 4B3RT 5IWAT 1HNXT 1N36T 2UXDT 1N32T 4DV6T 4B3MT 4GKJT 1XMOT 4LF8T 4JYAT 4YY3T 4B3TT 4X66T 2HHHT 2UUCT 4LF4T 1N34T 4DR6T 4DR2T 2UUBT 2UXBT 1I94T 4JI2T 4JI5T 4GKKT 4LFAT 4OX9T 2F4VT 4KHPT 1XMQT 4NXNT 4B3ST 2VQET 1HNWT 4DR3T 4X62T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K T;  2VQF T;  1XNQ T;  4JI7 T;  4LF5 T;  3OTO T;  4DV1 T;  1N33 T;  4DR7 T;  4JI4 T;  2UXC T;  1HNZ T;  4DV2 T;  3T1Y T;  5BR8 T;  4JI1 T;  2ZM6 T;  2UUA T;  4JI0 T;  3T1H T;  2UU9 T;  4NXM T;  4DV4 T;  4JI6 T;  4LFB T;  4DR1 T;  4DV3 T;  4DUZ T;  4X65 T;  1IBM T;  5LMN T;  4JV5 T;  4DR4 T;  4YHH T;  4DV7 T;  4DUY T;  1HR0 T;  4LF9 T;  4LFC T;  4LF7 T;  4X64 T;  5LMU T;  1IBL T;  4LF6 T;  4DR5 T;  1J5E T;  4AQY T;  4DV5 T;  1XNR T;  4JI8 T;  4DV0 T;  1IBK T;  4JI3 T;  2E5L T;  1FJG T;  4B3R T;  5IWA T;  1HNX T;  1N36 T;  2UXD T;  1N32 T;  4DV6 T;  4B3M T;  4GKJ T;  1XMO T;  4LF8 T;  4JYA T;  4YY3 T;  4B3T T;  4X66 T;  2HHH T;  2UUC T;  4LF4 T;  1N34 T;  4DR6 T;  4DR2 T;  2UUB T;  2UXB T;  1I94 T;  4JI2 T;  4JI5 T;  4GKK T;  4LFA T;  4OX9 T;  2F4V T;  4KHP T;  1XMQ T;  4NXN T;  4B3S T;  2VQE T;  1HNW T;  4DR3 T;  4X62 T; 
#chains in the Genus database with same CATH topology
 1ZV4 X;  3PU8 A;  4XZC A;  2LRL A;  1T7S A;  3KDS E;  3NZQ A;  1YXR A;  1Z8U A;  4KMC A;  4PFO A;  3SS1 A;  2WBL A;  3R84 B;  4YTP A;  4AKG A;  1R8I A;  4CXW A;  4JI7 T;  4WW0 A;  5FY0 A;  5EK3 A;  2N1G A;  4A5X A;  3OTO T;  3AE6 A;  2KSR A;  1Y64 B;  4DR7 T;  4JI4 T;  2E2A A;  3IHR A;  4BA9 A;  3G06 A;  3T1Y T;  3OYX A;  2X66 A;  5LXT E;  2R6G F;  2QVA A;  3SRZ A;  2BVL A;  4UVA B;  4EZ4 A;  1MIY A;  3RLF F;  3ZC1 A;  4HFH A;  2EHO D;  2LEH A;  4QXB B;  2DHR A;  3Q2M A;  3ZN1 B;  4QWN B;  2DWG A;  5KX5 E;  2XAF B;  3ONL C;  2LJL A;  2W63 A;  3ETU A;  1KNZ A;  4HN9 A;  1JNZ A;  2WU2 A;  3KVB A;  1OED C;  1M7K A;  2E9X A;  2L3L A;  2WB5 A;  4QH1 A;  4NUU A;  5DAB A;  3VHL A;  2KLQ A;  4NXM T;  3SFD A;  4H9R C;  3RI5 A;  4I4T E;  2UXN B;  3C4X A;  3NZP A;  1S94 A;  3RH3 A;  4DR1 T;  2DCF A;  1HFA A;  1LKX A;  2V7I A;  2XUE A;  3AA7 B;  1BR4 A;  4HKA A;  1JNR A;  2WDV A;  3P4R A;  1HX1 B;  2LHR A;  3WAJ A;  5L47 A;  4TNV A;  4YXD A;  5LGU B;  4YJ3 E;  4X65 T;  5EZY E;  1MNE A;  2M6B A;  4LMJ A;  2RPA A;  2X0Y A;  5LMN T;  4NIQ A;  4H9P C;  5JDH A;  4G63 A;  1HCI A;  5AQN B;  2LOS A;  3KIN B;  4JLE A;  2XM2 A;  2ZM2 A;  1UUS A;  2ZLY A;  3RRC A;  4CN6 A;  2M67 A;  2X0H A;  2LSI A;  2BS2 A;  4FI5 A;  4IE4 A;  4O4L E;  4ASK A;  1NAF A;  3I1A A;  5DJQ C;  2WQY A;  3VKG A;  2GK9 A;  4DO0 A;  1MND A;  2JIW A;  4JUY A;  5ADX L;  1YQ4 A;  2QRX A;  4CXY A;  1OED B;  4UVB B;  4WBO A;  4IL4 A;  3P50 A;  3LK2 B;  2H7V C;  2NTY A;  4YLH A;  3ZYM A;  4ZHQ E;  5L3E B;  5L3D B;  5LP6 E;  4A97 A;  3P4P A;  4CXX A;  4LF6 T;  4PFP A;  5J2T E;  3GMI A;  4IST A;  1YQ3 A;  1VRB A;  5LJM A;  3CKD A;  2A72 A;  4U7Y A;  3RKO A;  3IA3 A;  3AE2 A;  4PK4 A;  1S35 A;  3GN5 A;  5FVL A;  2HH7 A;  3N9N A;  3O1H A;  4ZI2 C;  2JPF A;  2WS3 A;  4H63 H;  4BAY B;  4DV0 T;  3AXJ A;  4L0R A;  2IW5 B;  4CI1 B;  1W0A A;  1OED E;  3KFW X;  2HPL A;  4DMW A;  4B3R T;  4YT0 A;  2NWB A;  2XQY A;  3Q5X A;  5IWA T;  4O4I E;  1N36 T;  4EEB A;  1N32 T;  3IF8 B;  1L0V A;  1FMW A;  4TV9 E;  4CN1 A;  4AKH A;  4ZI3 C;  1ZEE A;  4DV6 T;  3QUJ A;  5CA0 E;  1E2A A;  3TKL B;  1HG2 A;  2B76 A;  2NOX A;  3VRA A;  3EI0 A;  3LSV A;  5FP3 A;  2H7O A;  4LF8 T;  2MOZ A;  5LCY A;  4AIS A;  3OKQ A;  5ABH A;  4ANJ A;  2XQ8 A;  4HFB A;  2XQA A;  3UUM A;  4WZX A;  4I55 E;  5JDQ A;  1MMA A;  2LT3 A;  4TV8 E;  1N34 T;  4DR6 T;  4DID B;  2A3D A;  2XAH B;  3ONX A;  3FZK B;  1QSD A;  3GN5 B;  5AQK B;  2YU1 A;  2LHN A;  4JI5 T;  2XSA A;  3AEC A;  3PUQ A;  3ZT6 A;  5HXS A;  3AXJ B;  4K0U A;  5L3F B;  2F4V T;  3QK6 A;  3AE5 A;  3EAM A;  3OVU A;  2G0U A;  5FL1 A;  4ZI3 D;  2XHE B;  1LVF A;  3PUS A;  4TN7 B;  2JJ9 A;  1FEW A;  1W09 A;  3MA9 A;  4ILA A;  3N2G E;  4NXN T;  2BDE A;  3RQU A;  5LNK A;  4LF5 T;  3PUA A;  4IDN A;  2Y48 B;  5EK4 A;  4Z90 A;  5LGN B;  3OJA A;  1J5W A;  1HS7 A;  3UU8 A;  3RKG A;  4OK0 A;  3L3P A;  4H9S E;  1HF8 A;  4H63 V;  2J4G A;  1CHU A;  3N9O A;  4F6R C;  3ZEF B;  2CXD A;  2IIU A;  5A1L A;  5LB7 B;  3AE9 A;  5HEJ A;  2FJE A;  2BBJ A;  3PUX F;  2FUP A;  5L2L A;  2XAJ B;  3PTR B;  3ZMV B;  3N5L A;  2C5I T;  4EGW A;  1UK5 A;  1XNQ T;  4XBF B;  3ANW B;  5ABE A;  3AE7 A;  2NP9 A;  3ZJ2 A;  3AED A;  1LRZ A;  3CML A;  4U2Y A;  1QLB A;  4IE6 A;  3UUL A;  4WYV A;  4O8S A;  3ZMT B;  4EOZ B;  4YSZ A;  4DV2 T;  4MLK A;  1HNZ T;  4ILC A;  4ZXL A;  4UV9 B;  4YSY A;  2IAK A;  4HFV A;  3HKD E;  4UIG A;  2XSB A;  3ZN0 B;  5FVK A;  4ZEY A;  5JR9 C;  3D0T A;  4ILU A;  4XAX B;  4TX5 A;  2UUA T;  1AJ3 A;  3ETV A;  4Q25 A;  4AKL A;  4AQF A;  3GA8 A;  5C2T A;  5JDL A;  2SPC A;  3AEA A;  3OYZ A;  3T1H T;  2E9X D;  1T8B A;  2DL1 A;  3K3O A;  5AQR B;  1YW0 A;  2NTX A;  3RF1 A;  3O9X A;  3VR8 A;  3ZST A;  4CI3 B;  2CPT A;  1D0X A;  5AQI B;  4L5G A;  5HXC A;  5C3J A;  3LBX A;  3I9W A;  2I6H A;  3PUR A;  2A2F X;  4IRE A;  1IBM T;  2CHN A;  4ISS A;  2WMO A;  2C5J A;  1T72 A;  3FXD B;  4PNI A;  2AE9 A;  4HWF A;  2RA1 A;  3C4W A;  5JDN A;  1DU2 A;  3LG7 A;  2HN2 A;  2WY2 A;  4LML A;  1ZP0 A;  2ACX A;  3M3Z B;  3O1J A;  1D0Z A;  1HX8 A;  2WM9 A;  3LDQ B;  2FBW A;  2KIN B;  5EK2 A;  4YHH T;  1UGO A;  1OXZ A;  1BR2 A;  4IDO A;  4DUY T;  2WDQ A;  1HR0 T;  2J62 A;  1HG5 A;  2ACZ A;  3AEE A;  3C98 B;  1YKH B;  2MYS A;  1M62 A;  4E7S A;  2DLR A;  4PJM A;  2YDR A;  3V5S A;  2KXP B;  4OYJ A;  5LHI B;  4JEH B;  2DWK A;  2LSY A;  5AQP B;  5C8Y E;  3PE0 A;  2BKO A;  2ZM0 A;  4DR5 T;  2LKH A;  3HI2 A;  2LLY A;  4KX6 A;  2V7K A;  4KHZ F;  3JAD A;  2V26 A;  4U7I A;  3ZMS B;  3AEB A;  3ONJ A;  4GK0 E;  4AQY T;  3LBX B;  2EHO A;  2W66 A;  5DQV A;  3QB5 A;  3TLU A;  2IHR 1;  3ZYK A;  2D2S A;  2Q9Q C;  2NW9 A;  5JVD E;  4HE8 A;  3C64 A;  4U31 A;  1IBK T;  2CRB A;  4C90 A;  4L9I A;  4EIW A;  2YK0 A;  4PW8 A;  2BKN A;  2H3R A;  2CBI A;  2E5L T;  5AQJ B;  4TNW A;  1UUR A;  2X9Y A;  3ZSS A;  4EB6 E;  4HFI A;  1HNX T;  3FZH B;  1B7T A;  3A7M A;  3E0Z A;  3HKC E;  3RIU A;  4CI2 B;  5AQV B;  4DMV A;  2WZH A;  5JDM A;  5E0O A;  5TAO A;  2CWY A;  4C91 A;  2XZE A;  2V6X A;  2ZMA A;  2X67 A;  3CQG B;  5LHH B;  3ZT7 A;  3I0Q A;  3MK7 C;  3RX6 A;  3VU7 H;  2H89 A;  2W2U A;  1OED A;  2E9X C;  3HKE E;  4YY3 T;  4JYA T;  4GYR A;  4B3T T;  4IE7 A;  4EYU A;  4X66 T;  2IC9 A;  5J1G A;  2PBI A;  2VKO A;  5HEU A;  3RC8 A;  4HTE A;  5FKY A;  4CQI A;  3J7Y q;  2WDR A;  4OHF A;  3CIR A;  3ZC0 A;  3PDY A;  5LHG B;  1IAP A;  2UUB T;  3KV6 A;  2A9U A;  2LM9 A;  2EHO B;  4FJO A;  4JI2 T;  3ZJ1 A;  4TWH A;  2K24 A;  3UU4 A;  3FZM B;  3TLS A;  3I0O A;  4LFA T;  5JQG E;  4DVD A;  2IUB A;  2JMH A;  3RC3 A;  4AI6 A;  2K3W A;  2BG9 C;  4HFE A;  4AXP A;  2Q9Q B;  2WWV A;  2K5B B;  2VKD A;  2XPK A;  3C51 A;  3N9P A;  3QOF A;  4KBM B;  3DJB A;  2CLY B;  4GK5 E;  4KI0 F;  2BVM A;  4NUV A;  1NEN A;  3AA6 B;  1XDP A;  1ZOY A;  4J2C A;  5HCJ A;  5IYZ E;  3H37 A;  1CUN A;  2J47 A;  1H7C A;  1GQE A;  3E08 A;  4BJN A;  3FXE B;  2FJA A;  4P0B A;  4NPP A;  3FZF B;  2N9D A;  3AE3 A;  2DNX A;  4U33 A;  2E5V A;  3AEG A;  3ZKR A;  1X9B A;  3N2O A;  4KUM B;  4QXH B;  4UV8 B;  5LBM A;  2XQ6 A;  1WR0 A;  4DBR A;  2V5D A;  3N9L A;  4DND A;  1MMD A;  4EZH A;  1US7 B;  4DBQ A;  2XQ9 A;  5LG3 A;  3R6N A;  4ADZ A;  3FB2 A;  5CA1 E;  2L9Q A;  4DV1 T;  1N33 T;  2VVS A;  2NW8 A;  2WP9 A;  3SWH A;  5HWY A;  3AEF A;  2UXC T;  2WMN A;  1D1A A;  3C50 A;  4GIW A;  4HWD A;  2XAS B;  1KF6 A;  2I0M A;  2Q9Q D;  2PJQ A;  3MXZ A;  4N78 D;  2OV9 A;  2V5C A;  3ESL A;  3PV0 F;  4WNK A;  2ZM6 T;  2YKS A;  3JAE A;  3EDV A;  4HWC A;  4KP3 C;  5ETW A;  5JH7 E;  4YSX A;  3B57 A;  2XJ7 A;  4M1P A;  3IBP A;  2VB6 A;  3BQL A;  5HEG A;  5FYM A;  2I59 A;  3A8Y C;  2BG9 B;  5F5W A;  4PJN A;  5ABF B;  5J0Z A;  3AVS A;  5JTG A;  3AE8 A;  2JQH A;  2CCQ A;  2UU9 T;  3DTO A;  3T8O A;  4DV4 T;  5AQO B;  3H3A A;  3NRX A;  3FBZ A;  3P8C D;  3PU3 A;  5AQM B;  4GKK T;  2KWI B;  2ZM8 A;  3JC6 D;  3NRY A;  5AQL B;  5L3G B;  3UUN A;  3UQ7 A;  4A98 A;  2XQ3 A;  5HEO A;  1UX5 A;  3BK9 A;  3RIF A;  2YU2 A;  1ZHC A;  3F2E A;  3MKD A;  1XWM A;  3O4X E;  2BG9 E;  4DUZ T;  5CJ5 A;  1J1J A;  3O1I A;  5FXV A;  5KXJ A;  1KNP A;  3AAI A;  3HL6 A;  4YTN A;  2CXL A;  4PK6 A;  4HEA A;  5F8P A;  2LSJ A;  5AQS B;  4ZZB A;  2CE7 A;  3VRB A;  1D1B A;  1U4Q A;  2E8I A;  2X9H A;  1NEK A;  4I50 E;  1SE7 A;  4DV7 T;  3M65 A;  1VCT A;  5HAX A;  2WAU A;  2M6I A;  2IML A;  3UFE A;  1BR1 A;  4LFC T;  4MBQ A;  1XZY A;  3SOL A;  1D1C A;  4E7Z A;  2D0T A;  4TWF A;  4U3C A;  4UEL A;  5AQH B;  2IC6 A;  5ABG A;  4UF0 A;  2V7L A;  4IGU A;  4U72 A;  3RYI E;  5L3C B;  1WYC A;  3PUZ F;  4YHJ A;  1EZ3 A;  5DQW A;  3ZCI A;  1J5E T;  3U78 A;  3JAF A;  5BMV E;  2V7M A;  2VKJ A;  4DV5 T;  1UX4 A;  2KZ7 B;  4JI8 T;  5FNV E;  2W4X A;  1KK7 A;  3AAA B;  4COF A;  4O2A E;  3CK6 A;  3CQC B;  2W62 A;  3AE1 A;  5LA6 E;  1FJG T;  5HWX A;  1MIW A;  3AVR A;  4H9O C;  5AQT B;  4JI0 T;  4IE5 A;  3RQW A;  2LSK A;  3CX6 B;  4EYY R;  2CA5 A;  5J2U E;  2H88 A;  4ZI2 D;  2D5U A;  2W0G A;  5JR9 A;  3ZMZ B;  5FXZ A;  1MIV A;  3TLV A;  4GKJ T;  1XMO T;  5LJN A;  2PG8 A;  2CXF A;  1FMV A;  2KWH A;  2X68 A;  3PJA A;  3H3M A;  4PJL A;  2CMR A;  1QUU A;  1X79 A;  2VKH A;  3F57 A;  1Z0P A;  4TWD A;  4UF0 B;  3UQ4 A;  2XQ4 A;  3F31 A;  2QGS A;  2UUC T;  5FXW A;  3KV5 A;  2WU5 A;  3N9M A;  3NWI A;  3UT5 E;  2MAW A;  3LK4 2;  2LSG A;  3QB5 K;  4ZI7 E;  4DR2 T;  2UXB T;  2CHO A;  3P4S A;  4LMK A;  4UEM A;  3RPU A;  4HWH A;  5CGM A;  2Y8D A;  2YEV C;  3CPZ A;  1ZKE A;  1WYB A;  4TUY E;  4V1A v;  3Q5E A;  2BKP A;  4O4H E;  5HCM A;  1SA0 E;  4OX9 T;  4KHP T;  1YKE B;  3W15 B;  5JRC A;  2D9D A;  5KMG P;  1MMG A;  1T98 A;  4H9Q C;  2XTL A;  3PUV F;  2Y6X A;  1SHZ C;  4ZS2 A;  2PTF A;  3SFE A;  3ZYL A;  2C0S A;  1Y01 A;  2E9X B;  2K9A A;  3IEE A;  4IDP A;  3V5U A;  2JMK A;  4X1I E;  5JRE A;  1MMN A;  3A5X A;  5AQF B;  2W67 A;  4U74 A;  3HA4 A;  2VQE T;  1HNW T;  4UR9 A;  4DR3 T;  3PUW F;  4PK5 A;  4K0K T;  5CFB A;  1D0Y A;  1E7P A;  1KNR A;  2V7J A;  1WRD A;  1G73 A;  5LBQ B;  3RYF E;  3UU3 A;  3WAK A;  4B6X A;  3UFG A;  3CQX C;  4UVC B;  2VQF T;  2D0U A;  3HKB E;  4JEU B;  2L8K A;  4QH4 A;  4QKN A;  5JDF A;  2X51 A;  4HFC A;  2V8S V;  3KBT A;  4HWI B;  4O4J E;  4QX8 B;  4I0U A;  5AQU B;  5KDM C;  2V1D B;  4EXT A;  5H6R B;  3P7I A;  5BR8 T;  4JI1 T;  2EHO C;  2MBG A;  3UU5 A;  2JQK A;  5JRC B;  2Q9Q A;  5FMN A;  3EAB A;  3K1S A;  5LG4 A;  3RIA A;  4TZ4 C;  2RP4 A;  2CEA A;  4IT4 A;  2LM2 A;  3PJA J;  4YJ2 E;  2LOP A;  4PAG A;  3ZPO A;  1W9R A;  2BZB A;  5JDG A;  1OWA A;  4O2B E;  3GWH A;  2CLY C;  5FL0 A;  3RIU C;  3MJX A;  4JI6 T;  1KFY A;  2FJD A;  4LFB T;  3MZK B;  5F3J A;  2VL0 A;  1I6Z A;  3VKH A;  2LRK A;  4MFR A;  3J9X 1;  5FY1 A;  3LFM A;  4BJM A;  2VL8 A;  5HXH A;  2CWO A;  2AXD S;  1YD8 G;  3QNU A;  5H6Q B;  4AQG A;  4DV3 T;  4AKI A;  4ZS3 A;  3ZLI A;  3AA1 B;  2HN1 A;  5LGT B;  2HPJ A;  1IZN B;  2Z6E A;  2BS4 A;  3OPC A;  3NVO A;  2FJB A;  3I9Y A;  3RRW A;  4JV5 T;  4ILB A;  2JQQ A;  5AQQ B;  1SUM B;  3TLT A;  4WBN E;  1VCS A;  4MHC A;  3K8P C;  4OYK A;  3PUY F;  2MPK A;  3ZT5 A;  5LYJ E;  4DR4 T;  2LE8 A;  2YN6 A;  4QH5 A;  1WCR A;  3EUH A;  5FXX A;  3ZCJ A;  3WI3 A;  2P9B A;  3VR9 A;  3AAE B;  2NW7 A;  2BG9 A;  3X1D A;  3CVR A;  5ABF A;  1O3X A;  3CX8 B;  3BQK A;  3Q5W A;  4ZZC A;  4LF9 T;  5M4Y A;  2ODV A;  5HEH A;  3FBL A;  4LF7 T;  4X64 T;  5L3B B;  4P0A A;  5LMU T;  4GOU A;  4HFD A;  4ERR A;  2KT9 A;  2XAQ B;  4G2A A;  2VVN A;  1HTJ F;  3OBV E;  2WCA A;  4PJJ A;  5L4H A;  3ABV A;  3S4U A;  3CWZ B;  3QC9 A;  1IJ6 A;  2XM1 A;  1IBL T;  1BR0 A;  2K48 A;  2LKG A;  2YIN A;  3BQI A;  3EDU A;  4IIJ E;  5FY7 A;  3RGL A;  3N2K E;  1E1H B;  3RYC E;  3NKZ A;  1WLX A;  5L4E A;  4X20 E;  5GON E;  2BBH A;  1W0B A;  3Q9D A;  2DI4 A;  2CM0 A;  3L09 A;  3Q5D A;  4IDZ A;  2IDO B;  2W61 A;  1XNR T;  3MAC A;  2VWA A;  2OA5 A;  2WZI A;  2YOE A;  2UXX B;  3KBU A;  4YFS A;  4ZOL E;  2V6Y B;  4I43 B;  5LOV E;  3RHW A;  2X0L B;  4JI3 T;  3UU6 A;  2N2N A;  2VAS A;  4IHJ E;  4AQF C;  5HXE A;  5CB4 E;  2X9X A;  2XQ5 A;  4CZZ B;  3NBX X;  4QXC B;  4UXN B;  4IL9 A;  2B1E A;  2C5K T;  2PFV A;  2XY8 B;  3B5M A;  2ES0 A;  2YDS A;  3AA0 B;  3RYH E;  3UUB A;  3ZMU B;  2UXD T;  3JC6 C;  2W00 A;  2MTQ A;  4U2Z A;  4X1Y E;  1XDO A;  4CN4 A;  2J1D G;  4OFZ A;  4B3M T;  3PUG A;  3UTK A;  1NWM X;  4X5T A;  4A56 A;  1FIO A;  1VOM A;  3E22 E;  3AB3 B;  5IUX A;  3FHN A;  5HYA A;  3TLW A;  1U5P A;  2HHH T;  4H9N C;  3P4W A;  2WSS V;  4LF4 T;  4IE0 A;  2ODU A;  1WR6 A;  5HXR A;  5IHY A;  3K3Q C;  4X1K E;  2QA7 A;  2JRK A;  3AE4 A;  1UCU A;  2KND A;  4HGA A;  2XAG B;  4QHO A;  4YTM A;  3ANW A;  3L39 A;  3U3I A;  1I94 T;  2NR4 A;  3P4Q A;  3LK3 B;  4AIU A;  5AFU L;  3UUX B;  4JBW F;  2QYW A;  2WWU A;  3HR0 A;  3N9Q A;  3DP7 A;  3JCF A;  2VK9 A;  4P09 A;  2V6Y A;  4QX7 B;  4EV6 A;  2KMF A;  1LVK A;  4AKR B;  4Z91 A;  1XMQ T;  3FZL B;  4IDQ A;  1WFD A;  4MAL A;  2X9W A;  3EHZ A;  4EED A;  2VUR A;  3L8R A;  4Z8X A;  4EAH A;  1KEY A;  2CBJ A;  3CX7 B;  3EVY A;  3KV4 A;  3LJC A;  5AQG B;  4F8H A;  3B13 A;  2BS3 A;  5JR9 B;  2YDQ A;  4B3S T;  3K3N A;  2JQ9 A;  4P1N A;  3KV9 A;  2XQ7 A;  4GYS A;  1V9D A;  3C4Z A;  3KVA A;  1IJ5 A;  1G8X A;  2OLT A;  4X62 T; 
#chains in the Genus database with same CATH homology
 4K0K T;  2VQF T;  1XNQ T;  4JI7 T;  4LF5 T;  3OTO T;  4DV1 T;  1N33 T;  4DR7 T;  4JI4 T;  2UXC T;  1HNZ T;  4DV2 T;  3T1Y T;  5BR8 T;  4JI1 T;  2ZM6 T;  2UUA T;  4JI0 T;  3T1H T;  2UU9 T;  4NXM T;  4DV4 T;  4JI6 T;  4LFB T;  4DR1 T;  4DV3 T;  4DUZ T;  4X65 T;  1IBM T;  5LMN T;  4JV5 T;  4DR4 T;  4YHH T;  4DV7 T;  4DUY T;  1HR0 T;  4LF9 T;  4LFC T;  4LF7 T;  4X64 T;  5LMU T;  1IBL T;  4LF6 T;  4DR5 T;  1J5E T;  4AQY T;  4DV5 T;  1XNR T;  4JI8 T;  4DV0 T;  1IBK T;  4JI3 T;  2E5L T;  1FJG T;  4B3R T;  5IWA T;  1HNX T;  1N36 T;  2UXD T;  1N32 T;  4DV6 T;  4B3M T;  4GKJ T;  1XMO T;  4LF8 T;  4JYA T;  4YY3 T;  4B3T T;  4X66 T;  2HHH T;  2UUC T;  4LF4 T;  1N34 T;  4DR6 T;  4DR2 T;  2UUB T;  2UXB T;  1I94 T;  4JI2 T;  4JI5 T;  4GKK T;  4LFA T;  4OX9 T;  2F4V T;  4KHP T;  1XMQ T;  4NXN T;  4B3S T;  2VQE T;  1HNW T;  4DR3 T;  4X62 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...