4DR7T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr7T00
2VQFT 4LFAT 1XMOT 5LMNT 1FJGT 1HNWT 4DUZT 4LF7T 2UUCT 4KHPT 2UUBT 4DV1T 3T1YT 2UXBT 1HNZT 4JI1T 1IBLT 4DV2T 4X62T 4DR6T 4DV0T 4NXMT 4AQYT 4GKJT 4NXNT 4JI6T 4X65T 4DV4T 1IBMT 4LFCT 2ZM6T 1N32T 2UUAT 4JI7T 1XNRT 4DR7T 4DV3T 5BR8T 2VQET 4DR2T 5LMUT 4OX9T 3T1HT 2UXDT 4X64T 4LF4T 4DUYT 2HHHT 4JI2T 1XMQT 2UU9T 4B3ST 4LF8T 4DV7T 4JI4T 1XNQT 4DR5T 4DR4T 1N34T 4YHHT 2F4VT 4DV6T 4JI0T 1HNXT 1I94T 4X66T 4GKKT 1N33T 4DR3T 4JI3T 4DV5T 4B3TT 4K0KT 4JI5T 4LF6T 4LF5T 2E5LT 4JV5T 4B3RT 1J5ET 1HR0T 1N36T 1IBKT 3OTOT 2UXCT 4YY3T 4JYAT 4LFBT 4B3MT 5IWAT 4JI8T 4LF9T 4DR1T
chains in the Genus database with same CATH superfamily
2D2SA 1EZ3A 3TLSA 1NEKA 3K3OA 1S94A 5KDMC 4DR6T 4AQYT 3UU6A 1BR1A 3P8CD 4QH5A 3PUXF 4EEDA 3P4RA 5F5WA 3PTRB 3RYCE 1S35A 3ZCJA 3AEAA 4HFIA 4HE8A 2JMKA 3CQCB 3GN5B 4OYKA 5LBMA 2HHHT 4DBRA 2IHR1 3V5UA 1HX8A 4KBMB 2LSIA 3AA6B 3FZMB 3ZT6A 4NIQA 2M6IA 2BKOA 4AKIA 2XQ6A 3AAAB 3ZC0A 5GONE 5HEHA 4LF5T 2YDSA 3QB5A 2DLRA 2CCQA 2X66A 3Q5DA 2A72A 5LGTB 1YD8G 2X0LB 5EK4A 3AE6A 5JDGA 2ODVA 4JYAT 2V8SV 4Z8XA 2V7JA 3FXEB 3I1AA 4I55E 3K1SA 5CFBA 1WFDA 4LF7T 5AQNB 4HWFA 4HWCA 5EK3A 4DV1T 4GYRA 1HS7A 2PJQA 5IYZE 4COFA 3P7IA 3E22E 3HKCE 2IMLA 4GKJT 3F2EA 4CN6A 1M62A 4TNVA 5AFUL 3ETVA 4F6RC 1WCRA 4ZI2C 4LMJA 4DMVA 5FY0A 3ZCIA 2WM9A 2WDQA 5LCYA 3PE0A 2CPTA 4O4HE 2WU5A 4DV7T 5LJNA 2FJBA 4OFZA 3JAFA 5L3GB 3ZT7A 3WI3A 2MAWA 1QSDA 5ABFA 2KSRA 2VKJA 3UT5E 3FBZA 2WSSV 1N33T 1UX5A 2N9DA 4DR3T 4EZHA 4H9RC 2JMHA 3OYXA 4B3RT 2LHNA 4HFEA 5FXZA 2VKDA 4ZI2D 4LFBT 5HAXA 1LVFA 4FJOA 3LJCA 2CXLA 4AQFC 1XMOT 2QYWA 4KHPT 5FNVE 3H3AA 2NOXA 4XAXB 3ZYLA 4UEMA 3JC6C 2A9UA 4XZCA 3ZPOA 3CX8B 3LBXA 1IAPA 3X1DA 5J2UE 3NWIA 1U4QA 4HTEA 2Y48B 4UXNB 4Z90A 3AEDA 4GOUA 2LSYA 2V7MA 2WCAA 2WB5A 3BQIA 1XNRT 2K3WA 3O1IA 5JDMA 2YEVC 5FVKA 3PU3A 3PJAA 3J7Yq 3SFDA 4BAYB 3HR0A 4QH1A 5F3JA 2YDRA 5C2TA 2QA7A 4IHJE 5C8YE 3RH3A 2BG9E 2X9YA 5LG3A 2ES0A 5JDFA 1HG5A 3IBPA 1XDOA 4O2BE 1G8XA 5DJQC 1LKXA 3JC6D 4O4JE 1WYBA 5ADXL 1E1HB 2YKSA 5FMNA 1D0XA 2LM9A 4I4TE 3B13A 5ABFB 2E9XD 3CWZB 5AQOB 3KBTA 3AXJA 2X68A 2CWOA 4JUYA 4X1IE 5IWAT 2ACZA 4PJLA 2DL1A 4IL9A 4JI8T 5LXTE 4M1PA 3KFWX 3LK2B 3Q5XA 3AE1A 2ZM0A 4U33A 2K9AA 3LG7A 4TN7B 2VASA 4MHCA 2XQ9A 4ZHQE 3RC3A 4KHZF 2LOPA 4GYSA 5L3DB 3TLWA 4XBFB 2I0MA 3UU3A 1KF6A 2LSKA 1OEDE 3LBXB 4IREA 3IEEA 1XMQT 4PK4A 2XSAA 3JCFA 3N9MA 2X0HA 3UUBA 5F8PA 1XDPA 2LKGA 1MMGA 3RQUA 2WWVA 1D1AA 3AE4A 3QK6A 4IDQA 5AQTB 4K0UA 4U2YA 1UURA 3IHRA 4B6XA 3C98B 4I0UA 3SOLA 4ILCA 4CZZB 3ZMSB 1D1BA 1ZOYA 4AXPA 3UULA 5FP3A 2IAKA 4CI2B 5CA0E 2HPLA 5AQQB 1Y64B 2CEAA 4U72A 4UELA 5LP6E 2WZHA 2W67A 3ETUA 3AXJB 2XM1A 3ZSTA 1SA0E 2XJ7A 3ZT5A 2Q9QC 4MFRA 1HNZT 2WY2A 2E2AA 1JNRA 4CXXA 3K8PC 5DABA 4X1KE 4O8SA 1IBMT 4HWHA 2JIWA 4DR2T 4UVBB 3PDYA 4H9NC 1MMAA 2RP4A 4DUYT 1T8BA 4YHJA 2DNXA 3PUQA 3ZMUB 2IIUA 2VVNA 2SPCA 3L39A 4UVCB 4JLEA 2BS3A 2W4XA 3PUGA 5HXHA 2Q9QD 1VRBA 3FB2A 3Q5EA 2DHRA 2MYSA 2R6GF 4AQFA 3ZLIA 3GWHA 2NW7A 5JREA 3RKGA 2WMNA 4ILUA 4ZXLA 3BQLA 4HWDA 1HX1B 2Z6EA 5AQKB 3AVRA 4HFHA 5L2LA 4L9IA 1E2AA 2PG8A 2FJAA 2N2NA 3PV0F 4DBQA 3DTOA 1FEWA 3C4WA 5L4EA 4PJMA 3GMIA 3N2GE 2QGSA 4LMKA 4A56A 4YJ2E 2WU2A 5LOVE 3AEFA 4DV0T 4NXMT 1W09A 3NRYA 2C5JA 4G2AA 1Y01A 3O4XE 4ZI3C 5H6RB 3AAEB 3E0ZA 4DV3T 5KX5E 2BS4A 3RRWA 3EDUA 1MMNA 3EVYA 2JQQA 3T8OA 5HWXA 2XPKA 3OVUA 3N9PA 1DU2A 3UUNA 1HF8A 3N9QA 1N34T 4YHHT 2J62A 1W0BA 3LDQB 2W62A 4H9OC 4WZXA 3ONXA 4B3TT 5HEGA 1R8IA 3C50A 2M6BA 4TWDA 2XQ4A 2CMRA 4ZI3D 4ZI7E 1KNPA 4QHOA 5AQGB 5L47A 5LGNB 3OJAA 3N5LA 3MJXA 4U31A 4NUVA 2DWGA 2VL8A 1ZP0A 3HKDE 5L3EB 2I6HA 1OWAA 4HFCA 3UFGA 5IUXA 3EI0A 2CXFA 1ZHCA 4WBNE 4UIGA 3N2OA 2L8KA 3O1HA 2LM2A 3VU7H 2DWKA 4DVDA 3ZYKA 1MIVA 3F31A 1HFAA 2E9XB 4YTPA 2BBJA 4YXDA 2LRKA 1N32T 2JQHA 2V5CA 1UUSA 5J1GA 4OYJA 1LRZA 3ZJ1A 5JH7E 1VOMA 1NWMX 2XAQB 4IDPA 2MOZA 5CJ5A 5HXSA 3ZSSA 2V7LA 2B76A 2H88A 4WBOA 4LF8T 4HFVA 4JI4T 3ZKRA 2M67A 1I6ZA 2JRKA 3SWHA 2FBWA 3FHNA 1D1CA 3I9WA 3UUXB 4DNDA 2KWHA 2DI4A 4PAGA 3QUJA 1UX4A 2V6YA 2LJLA 3L3PA 1XWMA 3UQ4A 5AQSB 3PURA 2CRBA 2UXNB 2W0GA 2Q9QA 4AKGA 2EHOC 2CLYB 4NPPA 5EK2A 2LE8A 1MNEA 3N9LA 4JEHB 4ASKA 3A8YC 3HL6A 3KV6A 2X9XA 5JRCB 1HCIA 4QXBB 4H9QC 1WR6A 3H3MA 3RYFE 5AQVB 4E7SA 2BG9B 4QXHB 2H7OA 2V26A 3FZFB 4ILAA 1NENA 3RHWA 2H3RA 4ADZA 4LFCT 5IHYA 2CHNA 2P9BA 3SS1A 4DR7T 5BR8T 2VQET 1HTJF 3TLUA 4CXYA 4U2ZA 4OX9T 5LA6E 5JVDE 4X64T 4LF4T 2EHOD 4B3ST 3B57A 1XNQT 4O2AE 2KZ7B 1V9DA 2E9XC 4OK0A 4ZS2A 2D0TA 4L5GA 5LHHB 5HEUA 1I94T 3SFEA 5AQJB 1VCSA 3HA4A 2WP9A 3RIUC 4H63H 2WZIA 2A2FX 2V7KA 3S4UA 3MXZA 2X9HA 3NZQA 2YN6A 3B5MA 3NBXX 4AKHA 2MPKA 1YKEB 1FMWA 4HGAA 4TWHA 2V7IA 2V6YB 3FBLA 3PUZF 3UU4A 4LF9T 2J4GA 2W61A 4DR1T 2CXDA 1OEDB 2WDRA 2LRLA 3AAIA 3M3ZB 2CBIA 4Z91A 5HEOA 1KNZA 4A5XA 4X1YE 2Q9QB 4E7ZA 4N78D 4HFBA 3ZC1A 3A5XA 4YTNA 2ZLYA 4A98A 1T72A 4EXTA 2XM2A 4NUUA 2LLYA 2YU2A 3V5SA 3PUVF 3PUAA 3CQXC 2CLYC 3AA1B 3N9NA 3AA0B 2YU1A 1UK5A 4IGUA 5JDQA 3CX6B 1M7KA 1X79A 3AEBA 2V5DA 3C4ZA 3W15B 2BG9C 5HYAA 3RPUA 3AECA 5J2TE 1LVKA 2C5IT 5FL0A 5AQMB 1Z0PA 4DR4T 1W9RA 5FXVA 4EOZB 4TNWA 1HNXT 4IE0A 1H7CA 4GK0E 3FZHB 4U7IA 5H6QB 4JI3T 2XAFB 3D0TA 5CA1E 2MBGA 3ABVA 1KK7A 2QVAA 3ONJA 2KWIB 4TZ4C 4ZZCA 3SRZA 5JQGE 4HEAA 3C51A 4EB6E 4U74A 5LYJE 1T7SA 1T98A 3ZN0B 2BDEA 2WBLA 1ZV4X 1FJGT 2ZMAA 2WDVA 3ZEFB 1G73A 1IZNB 2UUBT 3RGLA 1MNDA 4JI1T 3UUMA 1IBLT 3LK3B 1YQ4A 4DV2T 3K3QC 2X51A 1J1JA 2FJEA 2LSGA 4ZEYA 3QOFA 3HKEE 3Q9DA 1OEDC 1JNZA 2NP9A 3VKGA 4YTMA 2JQ9A 3TLVA 1ZEEA 1KEYA 3OBVE 3ZYMA 2ZM8A 1GQEA 3VR9A 3NZPA 3AB3B 2E8IA 2ODUA 4C90A 4P0BA 2VVSA 4X66T 4IIJE 3WAJA 2C5KT 2EHOA 1SE7A 4I43B 5BMVE 5JDLA 4EIWA 5CB4E 1E7PA 1NAFA 2KLQA 4AIUA 2PTFA 2K24A 5DQWA 3CX7B 4MLKA 1B7TA 3EUHA 5J0ZA 5AQLB 3JADA 2NW9A 3KVAA 5LMNT 2D5UA 1HNWT 3ZMZB 2VB6A 2ACXA 2XY8B 4TX5A 3ZMTB 2XTLA 2H89A 2LEHA 2VWAA 4GIWA 2VKHA 3EABA 4UVAB 4JI6T 2VK9A 4TV9E 3CQGB 4JI7T 5LBQB 3PJAJ 2E9XA 2XQAA 2CA5A 4PJJA 2BBHA 3N9OA 2IC9A 3TKLB 4AQGA 3KV9A 4UR9A 3RIUA 4UV8B 1CUNA 5LNKA 2XAHB 2N1GA 4DMWA 2J1DG 2CBJA 3DJBA 3RIAA 3PUYF 5C3JA 1SUMB 5JDHA 3P4WA 4CN1A 2Y8DA 3RIFA 2XASB 4BA9A 4LF6T 2BS2A 4UF0A 5JR9B 3MA9A 3RC8A 4AISA 3MACA 1HR0T 5AQHB 2B1EA 4PK6A 5HXEA 2EHOB 5ABGA 2OA5A 2LSJA 4ISSA 3UFEA 1HG2A 3RF1A 1YKHB 1IJ5A 5JTGA 4CN4A 3ANWA 1QUUA 3AA7B 3A7MA 2VQFT 3RYHE 3ESLA 2V6XA 2DCFA 4DUZT 3U78A 3EHZA 2UUCT 4H9SE 1KNRA 3FZLB 3AEGA 2XUEA 4MBQA 4IDOA 2ZM2A 4OHFA 2X67A 5JRCA 3FZKB 3R6NA 4G63A 2FJDA 5DQVA 4ZOLE 3M65A 2BG9A 1X9BA 3P4SA 3BK9A 3DP7A 2KXPB 3VRAA 3MZKB 2XQ7A 5FYMA 2HPJA 2A3DA 5FXWA 3RYIE 2JPFA 4QKNA 1BR0A 4TV8E 4I50E 4CI1B 3F57A 4H9PC 1FMVA 5LG4A 4QWNB 4JEUB 5FY1A 5M4YA 5E0OA 4IE5A 2LHRA 4F8HA 4PFPA 1AJ3A 4DV5T 1UCUA 3HKBE 3OPCA 3KVBA 2HH7A 3UQ7A 2NW8A 3CMLA 3VKHA 1WLXA 2GK9A 5TAOA 4ZS3A 2OLTA 3BQKA 5LB7B 4UF0B 1W0AA 2JJ9A 3AE2A 4ERRA 3LK42 4QH4A 4DIDB 4YSZA 5LGUB 3H37A 3C64A 2NTYA 4CXWA 5JR9C 3L09A 3I0QA 3IF8B 4YSXA 4GK5E 4QX7B 5L3CB 2E5VA 1OEDA 3T1YT 2XQ3A 2UXBT 3ZN1B 3G06A 2C0SA 1QLBA 3Q2MA 3WAKA 3ANWB 4Q25A 2V1DB 2K48A 2KMFA 3AVSA 5EZYE 1D0ZA 1MIWA 1CHUA 5FXXA 2H7VC 3ZMVB 3P4PA 2I59A 3T1HT 4KP3C 2FUPA 2YK0A 2JQKA 3PU8A 4JI2T 5HEJA 3K3NA 4AKLA 2CHOA 4DV6T 4EYUA 4PFOA 3RLFF 5HWYA 4CQIA 4KUMB 4HN9A 2NR4A 2WS3A 3C4XA 3NRXA 1BR2A 3GA8A 3PUSA 3VRBA 5HCMA 3QNUA 2PFVA 4O4IE 3RX6A 4HKAA 4KI0F 2HN1A 2J47A 3E08A 4ANJA 2XSBA 5ABHA 1IBKT 5ABEA 2W00A 5LJMA 4KX6A 3JAEA 3TLTA 2X0YA 4V1Av 4L0RA 4LFAT 2WAUA 2K5BB 5AQUB 2W66A 4ILBA 2L3LA 1FIOA 4YFSA 2Y6XA 5CGMA 4X62T 3RRCA 2D0UA 3QB5K 2YINA 3O1JA 4NXNT 4EYYR 4HFDA 1XZYA 4P0AA 4C91A 2IC6A 3AEEA 2ZM6T 5HXRA 4IDNA 4WYVA 4UV9B 4J2CA 4MALA 1YW0A 5LMUT 4QX8B 3MK7C 5AQRB 4QXCB 2NWBA 1J5WA 1OXZA 4PK5A 3RI5A 3OKQA 2F4VT 2X9WA 3R84B 2BZBA 1U5PA 2CWYA 3CPZA 4YJ3E 4PW8A 3O9XA 4O4LE 2IDOB 2KNDA 4EV6A 3ONLC 4JI5T 2QRXA 4YSYA 4H63V 5L3BB 2XHEB 3KV4A 4AKRB 5L3FB 2XQ5A 1YQ3A 1O3XA 3OYZA 1WRDA 4X20E 5FVLA 3AE3A 2RPAA 1WR0A 4KMCA 3RKOA 1MIYA 2AXDS 2KT9A 2LT3A 3KV5A 5FL1A 2BVLA 2YDQA 3KBUA 3MKDA 2WMOA 1SHZC 3AE7A 1IJ6A 3U3IA 3Q5WA 3LFMA 3UTKA 3UU8A 2VL0A 4X65T 4DV4T 2G0UA 3J9X1 2D9DA 4PNIA 4EAHA 4IDZA 4IE6A 2LOSA 2PBIA 4HWIB 1YXRA 3KINB 1ZKEA 2WWUA 5HCJA 2IUBA 3HI2A 1KFYA 3CKDA 5L4HA 4EEBA 2KINB 2UU9T 5LHIB 2HN2A 3I0OA 3VR8A 4IL4A 2NTXA 1VCTA 3I9YA 3N2KE 2XQ8A 2OV9A 2VKOA 4TUYE 5KMGP 4TWFA 3UU5A 4U7YA 4PJNA 4YLHA 2WQYA 4IT4A 2E5LT 3AE9A 3CIRA 3P4QA 4JV5T 5JR9A 1L0VA 1J5ET 3OTOT 2UXCT 4YY3T 4ISTA 4B3MT 2XAGB 4BJMA 3FXDB 3CK6A 5FKYA 2W63A 4IE7A 3L8RA 2CE7A 3EAMA 2LKHA 2BVMA 4DO0A 4WNKA 2BKNA 1US7B 2VURA 4IE4A 5AQIB 4EGWA 4X5TA 2CM0A 3GN5A 4CI3B 5JDNA 2UUAT 2AE9A 2MTQA 3KDSE 5KXJA 5FY7A 4AI6A 4ZZBA 3VHLA 3CVRA 1MMDA 2UXDT 5AQFB 3EDVA 3PUWF 4JBWF 4EZ4A 3QC9A 2XAJB 1D0YA 3P50A 4DR5T 4JI0T 5HXCA 5ETWA 3ZJ2A 4WW0A 4P1NA 3NVOA 2XQYA 4LMLA 3IA3A 4A97A 4GKKT 5AQPB 4YT0A 1Z8UA 1UGOA 2IW5B 4K0KT 3RQWA 3NKZA 4BJNA 4U3CA 5LHGB 1BR4A 3AE5A 4FI5A 5A1LA 2BKPA 2W2UA 1N36T 3AE8A 4P09A 2YOEA 2UXXB 2L9QA 3LSVA 2XZEA 2RA1A 1WYCA
chains in the Genus database with same CATH topology
2VQFT 4LFAT 1XMOT 5LMNT 1FJGT 1HNWT 4DUZT 4LF7T 2UUCT 4KHPT 2UUBT 4DV1T 3T1YT 2UXBT 1HNZT 4JI1T 1IBLT 4DV2T 4X62T 4DR6T 4DV0T 4NXMT 4AQYT 4GKJT 4NXNT 4JI6T 4X65T 4DV4T 1IBMT 4LFCT 2ZM6T 1N32T 2UUAT 4JI7T 1XNRT 4DR7T 4DV3T 5BR8T 2VQET 4DR2T 5LMUT 4OX9T 3T1HT 2UXDT 4X64T 4LF4T 4DUYT 2HHHT 4JI2T 1XMQT 2UU9T 4B3ST 4LF8T 4DV7T 4JI4T 1XNQT 4DR5T 4DR4T 1N34T 4YHHT 2F4VT 4DV6T 4JI0T 1HNXT 1I94T 4X66T 4GKKT 1N33T 4DR3T 4JI3T 4DV5T 4B3TT 4K0KT 4JI5T 4LF6T 4LF5T 2E5LT 4JV5T 4B3RT 1J5ET 1HR0T 1N36T 1IBKT 3OTOT 2UXCT 4YY3T 4JYAT 4LFBT 4B3MT 5IWAT 4JI8T 4LF9T 4DR1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF T;  4LFA T;  1XMO T;  5LMN T;  1FJG T;  1HNW T;  4DUZ T;  4LF7 T;  2UUC T;  4KHP T;  2UUB T;  4DV1 T;  3T1Y T;  2UXB T;  1HNZ T;  4JI1 T;  1IBL T;  4DV2 T;  4X62 T;  4DR6 T;  4DV0 T;  4NXM T;  4AQY T;  4GKJ T;  4NXN T;  4JI6 T;  4X65 T;  4DV4 T;  1IBM T;  4LFC T;  2ZM6 T;  1N32 T;  2UUA T;  4JI7 T;  1XNR T;  4DR7 T;  4DV3 T;  5BR8 T;  2VQE T;  4DR2 T;  5LMU T;  4OX9 T;  3T1H T;  2UXD T;  4X64 T;  4LF4 T;  4DUY T;  2HHH T;  4JI2 T;  1XMQ T;  2UU9 T;  4B3S T;  4LF8 T;  4DV7 T;  4JI4 T;  1XNQ T;  4DR5 T;  4DR4 T;  1N34 T;  4YHH T;  2F4V T;  4DV6 T;  4JI0 T;  1HNX T;  1I94 T;  4X66 T;  4GKK T;  1N33 T;  4DR3 T;  4JI3 T;  4DV5 T;  4B3T T;  4K0K T;  4JI5 T;  4LF6 T;  4LF5 T;  2E5L T;  4JV5 T;  4B3R T;  1J5E T;  1HR0 T;  1N36 T;  1IBK T;  3OTO T;  2UXC T;  4YY3 T;  4JYA T;  4LFB T;  4B3M T;  5IWA T;  4JI8 T;  4LF9 T;  4DR1 T; 
#chains in the Genus database with same CATH topology
 2D2S A;  1EZ3 A;  3TLS A;  1NEK A;  3K3O A;  1S94 A;  5KDM C;  4DR6 T;  4AQY T;  3UU6 A;  1BR1 A;  3P8C D;  4QH5 A;  3PUX F;  4EED A;  3P4R A;  5F5W A;  3PTR B;  3RYC E;  1S35 A;  3ZCJ A;  3AEA A;  4HFI A;  4HE8 A;  2JMK A;  3CQC B;  3GN5 B;  4OYK A;  5LBM A;  2HHH T;  4DBR A;  2IHR 1;  3V5U A;  1HX8 A;  4KBM B;  2LSI A;  3AA6 B;  3FZM B;  3ZT6 A;  4NIQ A;  2M6I A;  2BKO A;  4AKI A;  2XQ6 A;  3AAA B;  3ZC0 A;  5GON E;  5HEH A;  4LF5 T;  2YDS A;  3QB5 A;  2DLR A;  2CCQ A;  2X66 A;  3Q5D A;  2A72 A;  5LGT B;  1YD8 G;  2X0L B;  5EK4 A;  3AE6 A;  5JDG A;  2ODV A;  4JYA T;  2V8S V;  4Z8X A;  2V7J A;  3FXE B;  3I1A A;  4I55 E;  3K1S A;  5CFB A;  1WFD A;  4LF7 T;  5AQN B;  4HWF A;  4HWC A;  5EK3 A;  4DV1 T;  4GYR A;  1HS7 A;  2PJQ A;  5IYZ E;  4COF A;  3P7I A;  3E22 E;  3HKC E;  2IML A;  4GKJ T;  3F2E A;  4CN6 A;  1M62 A;  4TNV A;  5AFU L;  3ETV A;  4F6R C;  1WCR A;  4ZI2 C;  4LMJ A;  4DMV A;  5FY0 A;  3ZCI A;  2WM9 A;  2WDQ A;  5LCY A;  3PE0 A;  2CPT A;  4O4H E;  2WU5 A;  4DV7 T;  5LJN A;  2FJB A;  4OFZ A;  3JAF A;  5L3G B;  3ZT7 A;  3WI3 A;  2MAW A;  1QSD A;  5ABF A;  2KSR A;  2VKJ A;  3UT5 E;  3FBZ A;  2WSS V;  1N33 T;  1UX5 A;  2N9D A;  4DR3 T;  4EZH A;  4H9R C;  2JMH A;  3OYX A;  4B3R T;  2LHN A;  4HFE A;  5FXZ A;  2VKD A;  4ZI2 D;  4LFB T;  5HAX A;  1LVF A;  4FJO A;  3LJC A;  2CXL A;  4AQF C;  1XMO T;  2QYW A;  4KHP T;  5FNV E;  3H3A A;  2NOX A;  4XAX B;  3ZYL A;  4UEM A;  3JC6 C;  2A9U A;  4XZC A;  3ZPO A;  3CX8 B;  3LBX A;  1IAP A;  3X1D A;  5J2U E;  3NWI A;  1U4Q A;  4HTE A;  2Y48 B;  4UXN B;  4Z90 A;  3AED A;  4GOU A;  2LSY A;  2V7M A;  2WCA A;  2WB5 A;  3BQI A;  1XNR T;  2K3W A;  3O1I A;  5JDM A;  2YEV C;  5FVK A;  3PU3 A;  3PJA A;  3J7Y q;  3SFD A;  4BAY B;  3HR0 A;  4QH1 A;  5F3J A;  2YDR A;  5C2T A;  2QA7 A;  4IHJ E;  5C8Y E;  3RH3 A;  2BG9 E;  2X9Y A;  5LG3 A;  2ES0 A;  5JDF A;  1HG5 A;  3IBP A;  1XDO A;  4O2B E;  1G8X A;  5DJQ C;  1LKX A;  3JC6 D;  4O4J E;  1WYB A;  5ADX L;  1E1H B;  2YKS A;  5FMN A;  1D0X A;  2LM9 A;  4I4T E;  3B13 A;  5ABF B;  2E9X D;  3CWZ B;  5AQO B;  3KBT A;  3AXJ A;  2X68 A;  2CWO A;  4JUY A;  4X1I E;  5IWA T;  2ACZ A;  4PJL A;  2DL1 A;  4IL9 A;  4JI8 T;  5LXT E;  4M1P A;  3KFW X;  3LK2 B;  3Q5X A;  3AE1 A;  2ZM0 A;  4U33 A;  2K9A A;  3LG7 A;  4TN7 B;  2VAS A;  4MHC A;  2XQ9 A;  4ZHQ E;  3RC3 A;  4KHZ F;  2LOP A;  4GYS A;  5L3D B;  3TLW A;  4XBF B;  2I0M A;  3UU3 A;  1KF6 A;  2LSK A;  1OED E;  3LBX B;  4IRE A;  3IEE A;  1XMQ T;  4PK4 A;  2XSA A;  3JCF A;  3N9M A;  2X0H A;  3UUB A;  5F8P A;  1XDP A;  2LKG A;  1MMG A;  3RQU A;  2WWV A;  1D1A A;  3AE4 A;  3QK6 A;  4IDQ A;  5AQT B;  4K0U A;  4U2Y A;  1UUR A;  3IHR A;  4B6X A;  3C98 B;  4I0U A;  3SOL A;  4ILC A;  4CZZ B;  3ZMS B;  1D1B A;  1ZOY A;  4AXP A;  3UUL A;  5FP3 A;  2IAK A;  4CI2 B;  5CA0 E;  2HPL A;  5AQQ B;  1Y64 B;  2CEA A;  4U72 A;  4UEL A;  5LP6 E;  2WZH A;  2W67 A;  3ETU A;  3AXJ B;  2XM1 A;  3ZST A;  1SA0 E;  2XJ7 A;  3ZT5 A;  2Q9Q C;  4MFR A;  1HNZ T;  2WY2 A;  2E2A A;  1JNR A;  4CXX A;  3K8P C;  5DAB A;  4X1K E;  4O8S A;  1IBM T;  4HWH A;  2JIW A;  4DR2 T;  4UVB B;  3PDY A;  4H9N C;  1MMA A;  2RP4 A;  4DUY T;  1T8B A;  4YHJ A;  2DNX A;  3PUQ A;  3ZMU B;  2IIU A;  2VVN A;  2SPC A;  3L39 A;  4UVC B;  4JLE A;  2BS3 A;  2W4X A;  3PUG A;  5HXH A;  2Q9Q D;  1VRB A;  3FB2 A;  3Q5E A;  2DHR A;  2MYS A;  2R6G F;  4AQF A;  3ZLI A;  3GWH A;  2NW7 A;  5JRE A;  3RKG A;  2WMN A;  4ILU A;  4ZXL A;  3BQL A;  4HWD A;  1HX1 B;  2Z6E A;  5AQK B;  3AVR A;  4HFH A;  5L2L A;  4L9I A;  1E2A A;  2PG8 A;  2FJA A;  2N2N A;  3PV0 F;  4DBQ A;  3DTO A;  1FEW A;  3C4W A;  5L4E A;  4PJM A;  3GMI A;  3N2G E;  2QGS A;  4LMK A;  4A56 A;  4YJ2 E;  2WU2 A;  5LOV E;  3AEF A;  4DV0 T;  4NXM T;  1W09 A;  3NRY A;  2C5J A;  4G2A A;  1Y01 A;  3O4X E;  4ZI3 C;  5H6R B;  3AAE B;  3E0Z A;  4DV3 T;  5KX5 E;  2BS4 A;  3RRW A;  3EDU A;  1MMN A;  3EVY A;  2JQQ A;  3T8O A;  5HWX A;  2XPK A;  3OVU A;  3N9P A;  1DU2 A;  3UUN A;  1HF8 A;  3N9Q A;  1N34 T;  4YHH T;  2J62 A;  1W0B A;  3LDQ B;  2W62 A;  4H9O C;  4WZX A;  3ONX A;  4B3T T;  5HEG A;  1R8I A;  3C50 A;  2M6B A;  4TWD A;  2XQ4 A;  2CMR A;  4ZI3 D;  4ZI7 E;  1KNP A;  4QHO A;  5AQG B;  5L47 A;  5LGN B;  3OJA A;  3N5L A;  3MJX A;  4U31 A;  4NUV A;  2DWG A;  2VL8 A;  1ZP0 A;  3HKD E;  5L3E B;  2I6H A;  1OWA A;  4HFC A;  3UFG A;  5IUX A;  3EI0 A;  2CXF A;  1ZHC A;  4WBN E;  4UIG A;  3N2O A;  2L8K A;  3O1H A;  2LM2 A;  3VU7 H;  2DWK A;  4DVD A;  3ZYK A;  1MIV A;  3F31 A;  1HFA A;  2E9X B;  4YTP A;  2BBJ A;  4YXD A;  2LRK A;  1N32 T;  2JQH A;  2V5C A;  1UUS A;  5J1G A;  4OYJ A;  1LRZ A;  3ZJ1 A;  5JH7 E;  1VOM A;  1NWM X;  2XAQ B;  4IDP A;  2MOZ A;  5CJ5 A;  5HXS A;  3ZSS A;  2V7L A;  2B76 A;  2H88 A;  4WBO A;  4LF8 T;  4HFV A;  4JI4 T;  3ZKR A;  2M67 A;  1I6Z A;  2JRK A;  3SWH A;  2FBW A;  3FHN A;  1D1C A;  3I9W A;  3UUX B;  4DND A;  2KWH A;  2DI4 A;  4PAG A;  3QUJ A;  1UX4 A;  2V6Y A;  2LJL A;  3L3P A;  1XWM A;  3UQ4 A;  5AQS B;  3PUR A;  2CRB A;  2UXN B;  2W0G A;  2Q9Q A;  4AKG A;  2EHO C;  2CLY B;  4NPP A;  5EK2 A;  2LE8 A;  1MNE A;  3N9L A;  4JEH B;  4ASK A;  3A8Y C;  3HL6 A;  3KV6 A;  2X9X A;  5JRC B;  1HCI A;  4QXB B;  4H9Q C;  1WR6 A;  3H3M A;  3RYF E;  5AQV B;  4E7S A;  2BG9 B;  4QXH B;  2H7O A;  2V26 A;  3FZF B;  4ILA A;  1NEN A;  3RHW A;  2H3R A;  4ADZ A;  4LFC T;  5IHY A;  2CHN A;  2P9B A;  3SS1 A;  4DR7 T;  5BR8 T;  2VQE T;  1HTJ F;  3TLU A;  4CXY A;  4U2Z A;  4OX9 T;  5LA6 E;  5JVD E;  4X64 T;  4LF4 T;  2EHO D;  4B3S T;  3B57 A;  1XNQ T;  4O2A E;  2KZ7 B;  1V9D A;  2E9X C;  4OK0 A;  4ZS2 A;  2D0T A;  4L5G A;  5LHH B;  5HEU A;  1I94 T;  3SFE A;  5AQJ B;  1VCS A;  3HA4 A;  2WP9 A;  3RIU C;  4H63 H;  2WZI A;  2A2F X;  2V7K A;  3S4U A;  3MXZ A;  2X9H A;  3NZQ A;  2YN6 A;  3B5M A;  3NBX X;  4AKH A;  2MPK A;  1YKE B;  1FMW A;  4HGA A;  4TWH A;  2V7I A;  2V6Y B;  3FBL A;  3PUZ F;  3UU4 A;  4LF9 T;  2J4G A;  2W61 A;  4DR1 T;  2CXD A;  1OED B;  2WDR A;  2LRL A;  3AAI A;  3M3Z B;  2CBI A;  4Z91 A;  5HEO A;  1KNZ A;  4A5X A;  4X1Y E;  2Q9Q B;  4E7Z A;  4N78 D;  4HFB A;  3ZC1 A;  3A5X A;  4YTN A;  2ZLY A;  4A98 A;  1T72 A;  4EXT A;  2XM2 A;  4NUU A;  2LLY A;  2YU2 A;  3V5S A;  3PUV F;  3PUA A;  3CQX C;  2CLY C;  3AA1 B;  3N9N A;  3AA0 B;  2YU1 A;  1UK5 A;  4IGU A;  5JDQ A;  3CX6 B;  1M7K A;  1X79 A;  3AEB A;  2V5D A;  3C4Z A;  3W15 B;  2BG9 C;  5HYA A;  3RPU A;  3AEC A;  5J2T E;  1LVK A;  2C5I T;  5FL0 A;  5AQM B;  1Z0P A;  4DR4 T;  1W9R A;  5FXV A;  4EOZ B;  4TNW A;  1HNX T;  4IE0 A;  1H7C A;  4GK0 E;  3FZH B;  4U7I A;  5H6Q B;  4JI3 T;  2XAF B;  3D0T A;  5CA1 E;  2MBG A;  3ABV A;  1KK7 A;  2QVA A;  3ONJ A;  2KWI B;  4TZ4 C;  4ZZC A;  3SRZ A;  5JQG E;  4HEA A;  3C51 A;  4EB6 E;  4U74 A;  5LYJ E;  1T7S A;  1T98 A;  3ZN0 B;  2BDE A;  2WBL A;  1ZV4 X;  1FJG T;  2ZMA A;  2WDV A;  3ZEF B;  1G73 A;  1IZN B;  2UUB T;  3RGL A;  1MND A;  4JI1 T;  3UUM A;  1IBL T;  3LK3 B;  1YQ4 A;  4DV2 T;  3K3Q C;  2X51 A;  1J1J A;  2FJE A;  2LSG A;  4ZEY A;  3QOF A;  3HKE E;  3Q9D A;  1OED C;  1JNZ A;  2NP9 A;  3VKG A;  4YTM A;  2JQ9 A;  3TLV A;  1ZEE A;  1KEY A;  3OBV E;  3ZYM A;  2ZM8 A;  1GQE A;  3VR9 A;  3NZP A;  3AB3 B;  2E8I A;  2ODU A;  4C90 A;  4P0B A;  2VVS A;  4X66 T;  4IIJ E;  3WAJ A;  2C5K T;  2EHO A;  1SE7 A;  4I43 B;  5BMV E;  5JDL A;  4EIW A;  5CB4 E;  1E7P A;  1NAF A;  2KLQ A;  4AIU A;  2PTF A;  2K24 A;  5DQW A;  3CX7 B;  4MLK A;  1B7T A;  3EUH A;  5J0Z A;  5AQL B;  3JAD A;  2NW9 A;  3KVA A;  5LMN T;  2D5U A;  1HNW T;  3ZMZ B;  2VB6 A;  2ACX A;  2XY8 B;  4TX5 A;  3ZMT B;  2XTL A;  2H89 A;  2LEH A;  2VWA A;  4GIW A;  2VKH A;  3EAB A;  4UVA B;  4JI6 T;  2VK9 A;  4TV9 E;  3CQG B;  4JI7 T;  5LBQ B;  3PJA J;  2E9X A;  2XQA A;  2CA5 A;  4PJJ A;  2BBH A;  3N9O A;  2IC9 A;  3TKL B;  4AQG A;  3KV9 A;  4UR9 A;  3RIU A;  4UV8 B;  1CUN A;  5LNK A;  2XAH B;  2N1G A;  4DMW A;  2J1D G;  2CBJ A;  3DJB A;  3RIA A;  3PUY F;  5C3J A;  1SUM B;  5JDH A;  3P4W A;  4CN1 A;  2Y8D A;  3RIF A;  2XAS B;  4BA9 A;  4LF6 T;  2BS2 A;  4UF0 A;  5JR9 B;  3MA9 A;  3RC8 A;  4AIS A;  3MAC A;  1HR0 T;  5AQH B;  2B1E A;  4PK6 A;  5HXE A;  2EHO B;  5ABG A;  2OA5 A;  2LSJ A;  4ISS A;  3UFE A;  1HG2 A;  3RF1 A;  1YKH B;  1IJ5 A;  5JTG A;  4CN4 A;  3ANW A;  1QUU A;  3AA7 B;  3A7M A;  2VQF T;  3RYH E;  3ESL A;  2V6X A;  2DCF A;  4DUZ T;  3U78 A;  3EHZ A;  2UUC T;  4H9S E;  1KNR A;  3FZL B;  3AEG A;  2XUE A;  4MBQ A;  4IDO A;  2ZM2 A;  4OHF A;  2X67 A;  5JRC A;  3FZK B;  3R6N A;  4G63 A;  2FJD A;  5DQV A;  4ZOL E;  3M65 A;  2BG9 A;  1X9B A;  3P4S A;  3BK9 A;  3DP7 A;  2KXP B;  3VRA A;  3MZK B;  2XQ7 A;  5FYM A;  2HPJ A;  2A3D A;  5FXW A;  3RYI E;  2JPF A;  4QKN A;  1BR0 A;  4TV8 E;  4I50 E;  4CI1 B;  3F57 A;  4H9P C;  1FMV A;  5LG4 A;  4QWN B;  4JEU B;  5FY1 A;  5M4Y A;  5E0O A;  4IE5 A;  2LHR A;  4F8H A;  4PFP A;  1AJ3 A;  4DV5 T;  1UCU A;  3HKB E;  3OPC A;  3KVB A;  2HH7 A;  3UQ7 A;  2NW8 A;  3CML A;  3VKH A;  1WLX A;  2GK9 A;  5TAO A;  4ZS3 A;  2OLT A;  3BQK A;  5LB7 B;  4UF0 B;  1W0A A;  2JJ9 A;  3AE2 A;  4ERR A;  3LK4 2;  4QH4 A;  4DID B;  4YSZ A;  5LGU B;  3H37 A;  3C64 A;  2NTY A;  4CXW A;  5JR9 C;  3L09 A;  3I0Q A;  3IF8 B;  4YSX A;  4GK5 E;  4QX7 B;  5L3C B;  2E5V A;  1OED A;  3T1Y T;  2XQ3 A;  2UXB T;  3ZN1 B;  3G06 A;  2C0S A;  1QLB A;  3Q2M A;  3WAK A;  3ANW B;  4Q25 A;  2V1D B;  2K48 A;  2KMF A;  3AVS A;  5EZY E;  1D0Z A;  1MIW A;  1CHU A;  5FXX A;  2H7V C;  3ZMV B;  3P4P A;  2I59 A;  3T1H T;  4KP3 C;  2FUP A;  2YK0 A;  2JQK A;  3PU8 A;  4JI2 T;  5HEJ A;  3K3N A;  4AKL A;  2CHO A;  4DV6 T;  4EYU A;  4PFO A;  3RLF F;  5HWY A;  4CQI A;  4KUM B;  4HN9 A;  2NR4 A;  2WS3 A;  3C4X A;  3NRX A;  1BR2 A;  3GA8 A;  3PUS A;  3VRB A;  5HCM A;  3QNU A;  2PFV A;  4O4I E;  3RX6 A;  4HKA A;  4KI0 F;  2HN1 A;  2J47 A;  3E08 A;  4ANJ A;  2XSB A;  5ABH A;  1IBK T;  5ABE A;  2W00 A;  5LJM A;  4KX6 A;  3JAE A;  3TLT A;  2X0Y A;  4V1A v;  4L0R A;  4LFA T;  2WAU A;  2K5B B;  5AQU B;  2W66 A;  4ILB A;  2L3L A;  1FIO A;  4YFS A;  2Y6X A;  5CGM A;  4X62 T;  3RRC A;  2D0U A;  3QB5 K;  2YIN A;  3O1J A;  4NXN T;  4EYY R;  4HFD A;  1XZY A;  4P0A A;  4C91 A;  2IC6 A;  3AEE A;  2ZM6 T;  5HXR A;  4IDN A;  4WYV A;  4UV9 B;  4J2C A;  4MAL A;  1YW0 A;  5LMU T;  4QX8 B;  3MK7 C;  5AQR B;  4QXC B;  2NWB A;  1J5W A;  1OXZ A;  4PK5 A;  3RI5 A;  3OKQ A;  2F4V T;  2X9W A;  3R84 B;  2BZB A;  1U5P A;  2CWY A;  3CPZ A;  4YJ3 E;  4PW8 A;  3O9X A;  4O4L E;  2IDO B;  2KND A;  4EV6 A;  3ONL C;  4JI5 T;  2QRX A;  4YSY A;  4H63 V;  5L3B B;  2XHE B;  3KV4 A;  4AKR B;  5L3F B;  2XQ5 A;  1YQ3 A;  1O3X A;  3OYZ A;  1WRD A;  4X20 E;  5FVL A;  3AE3 A;  2RPA A;  1WR0 A;  4KMC A;  3RKO A;  1MIY A;  2AXD S;  2KT9 A;  2LT3 A;  3KV5 A;  5FL1 A;  2BVL A;  2YDQ A;  3KBU A;  3MKD A;  2WMO A;  1SHZ C;  3AE7 A;  1IJ6 A;  3U3I A;  3Q5W A;  3LFM A;  3UTK A;  3UU8 A;  2VL0 A;  4X65 T;  4DV4 T;  2G0U A;  3J9X 1;  2D9D A;  4PNI A;  4EAH A;  4IDZ A;  4IE6 A;  2LOS A;  2PBI A;  4HWI B;  1YXR A;  3KIN B;  1ZKE A;  2WWU A;  5HCJ A;  2IUB A;  3HI2 A;  1KFY A;  3CKD A;  5L4H A;  4EEB A;  2KIN B;  2UU9 T;  5LHI B;  2HN2 A;  3I0O A;  3VR8 A;  4IL4 A;  2NTX A;  1VCT A;  3I9Y A;  3N2K E;  2XQ8 A;  2OV9 A;  2VKO A;  4TUY E;  5KMG P;  4TWF A;  3UU5 A;  4U7Y A;  4PJN A;  4YLH A;  2WQY A;  4IT4 A;  2E5L T;  3AE9 A;  3CIR A;  3P4Q A;  4JV5 T;  5JR9 A;  1L0V A;  1J5E T;  3OTO T;  2UXC T;  4YY3 T;  4IST A;  4B3M T;  2XAG B;  4BJM A;  3FXD B;  3CK6 A;  5FKY A;  2W63 A;  4IE7 A;  3L8R A;  2CE7 A;  3EAM A;  2LKH A;  2BVM A;  4DO0 A;  4WNK A;  2BKN A;  1US7 B;  2VUR A;  4IE4 A;  5AQI B;  4EGW A;  4X5T A;  2CM0 A;  3GN5 A;  4CI3 B;  5JDN A;  2UUA T;  2AE9 A;  2MTQ A;  3KDS E;  5KXJ A;  5FY7 A;  4AI6 A;  4ZZB A;  3VHL A;  3CVR A;  1MMD A;  2UXD T;  5AQF B;  3EDV A;  3PUW F;  4JBW F;  4EZ4 A;  3QC9 A;  2XAJ B;  1D0Y A;  3P50 A;  4DR5 T;  4JI0 T;  5HXC A;  5ETW A;  3ZJ2 A;  4WW0 A;  4P1N A;  3NVO A;  2XQY A;  4LML A;  3IA3 A;  4A97 A;  4GKK T;  5AQP B;  4YT0 A;  1Z8U A;  1UGO A;  2IW5 B;  4K0K T;  3RQW A;  3NKZ A;  4BJN A;  4U3C A;  5LHG B;  1BR4 A;  3AE5 A;  4FI5 A;  5A1L A;  2BKP A;  2W2U A;  1N36 T;  3AE8 A;  4P09 A;  2YOE A;  2UXX B;  2L9Q A;  3LSV A;  2XZE A;  2RA1 A;  1WYC A; 
#chains in the Genus database with same CATH homology
 2VQF T;  4LFA T;  1XMO T;  5LMN T;  1FJG T;  1HNW T;  4DUZ T;  4LF7 T;  2UUC T;  4KHP T;  2UUB T;  4DV1 T;  3T1Y T;  2UXB T;  1HNZ T;  4JI1 T;  1IBL T;  4DV2 T;  4X62 T;  4DR6 T;  4DV0 T;  4NXM T;  4AQY T;  4GKJ T;  4NXN T;  4JI6 T;  4X65 T;  4DV4 T;  1IBM T;  4LFC T;  2ZM6 T;  1N32 T;  2UUA T;  4JI7 T;  1XNR T;  4DR7 T;  4DV3 T;  5BR8 T;  2VQE T;  4DR2 T;  5LMU T;  4OX9 T;  3T1H T;  2UXD T;  4X64 T;  4LF4 T;  4DUY T;  2HHH T;  4JI2 T;  1XMQ T;  2UU9 T;  4B3S T;  4LF8 T;  4DV7 T;  4JI4 T;  1XNQ T;  4DR5 T;  4DR4 T;  1N34 T;  4YHH T;  2F4V T;  4DV6 T;  4JI0 T;  1HNX T;  1I94 T;  4X66 T;  4GKK T;  1N33 T;  4DR3 T;  4JI3 T;  4DV5 T;  4B3T T;  4K0K T;  4JI5 T;  4LF6 T;  4LF5 T;  2E5L T;  4JV5 T;  4B3R T;  1J5E T;  1HR0 T;  1N36 T;  1IBK T;  3OTO T;  2UXC T;  4YY3 T;  4JYA T;  4LFB T;  4B3M T;  5IWA T;  4JI8 T;  4LF9 T;  4DR1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...