4DRAE

Crystal structure of mhf complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
74
structure length
74
Chain Sequence
b'SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The structure of the FANCM-MHF complex reveals physical features for functional assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 74
sequence length 74
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09415 CENP-X CENP-S associating Centromere protein X
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.100 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4draE02
4NE6B 4DRBJ 4E45B 3B0BC 4NE5B 4DRAE 4NE3B 4E44B
chains in the Genus database with same CATH superfamily
2PN0A 4DU6A 5DMZA 4QPMA 4NE6B 1TFEA 2LNZA 1FB1A 4E45B 1IS8A 1WUQA 1AIPC 1WM9A 2LO0A 2WSEG 1EFUB 1WURA 3LW5K 4JA3A 4DRAE 1N3SA 1N3TA 2KR1A 2WSFK 2O01G 4NE3B 1N3RA 2P11A 1FBXA 2WSCK 1A8RA 3LW5G 1EL6A 4R8QA 4NE5B 4E44B 4Q7JA 1A9CA 2WSFG 3BMBA 3VEJA 4DRBJ 2WSEK 1WPLA 3B0BC 1GTPA 2WSCG 1IS7A
chains in the Genus database with same CATH topology
2PN0A 4DU6A 5DMZA 4QPMA 4NE6B 1TFEA 2LNZA 1FB1A 4E45B 1IS8A 1WUQA 1AIPC 1WM9A 2LO0A 1EFUB 1WURA 4JA3A 4DRAE 1N3SA 1N3TA 2KR1A 4NE3B 1N3RA 2P11A 1FBXA 1A8RA 1EL6A 4NE5B 4E44B 4Q7JA 1A9CA 3BMBA 3VEJA 4DRBJ 1WPLA 3B0BC 1GTPA 4R8QA 1IS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE6 B;  4DRB J;  4E45 B;  3B0B C;  4NE5 B;  4DRA E;  4NE3 B;  4E44 B; 
#chains in the Genus database with same CATH topology
 2PN0 A;  4DU6 A;  5DMZ A;  4QPM A;  4NE6 B;  1TFE A;  2LNZ A;  1FB1 A;  4E45 B;  1IS8 A;  1WUQ A;  1AIP C;  1WM9 A;  2LO0 A;  2WSE G;  1EFU B;  1WUR A;  3LW5 K;  4JA3 A;  4DRA E;  1N3S A;  1N3T A;  2KR1 A;  2WSF K;  2O01 G;  4NE3 B;  1N3R A;  2P11 A;  1FBX A;  2WSC K;  1A8R A;  3LW5 G;  1EL6 A;  4R8Q A;  4NE5 B;  4E44 B;  4Q7J A;  1A9C A;  2WSF G;  3BMB A;  3VEJ A;  4DRB J;  2WSE K;  1WPL A;  3B0B C;  1GTP A;  2WSC G;  1IS7 A; 
#chains in the Genus database with same CATH homology
 2PN0 A;  4DU6 A;  5DMZ A;  4QPM A;  4NE6 B;  1TFE A;  2LNZ A;  1FB1 A;  4E45 B;  1IS8 A;  1WUQ A;  1AIP C;  1WM9 A;  2LO0 A;  1EFU B;  1WUR A;  4JA3 A;  4DRA E;  1N3S A;  1N3T A;  2KR1 A;  4NE3 B;  1N3R A;  2P11 A;  1FBX A;  1A8R A;  1EL6 A;  4NE5 B;  4E44 B;  4Q7J A;  1A9C A;  3BMB A;  3VEJ A;  4DRB J;  1WPL A;  3B0B C;  1GTP A;  4R8Q A;  1IS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...