4DRBA

The crystal structure of fancm bound mhf complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
98
structure length
98
Chain Sequence
b'RFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The structure of the FANCM-MHF complex reveals physical features for functional assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
total genus 38
structure length 98
sequence length 98
chains with identical sequence B, D, E, G, H
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4drbA00
2HIOA 4E44A 3AZFD 4UUZA 1KX3B 1P3IC 3KWQA 4Z66D 4Z2MH 3AZGA 5CPIB 3AZHB 1M1AA 3NQUA 1EQZC 5B0ZA 4G92C 5DNMA 1P3PA 3O62B 5AV9B 5B24C 5B32B 3LZ1A 3WA9C 5KDMA 4JJNA 1TAFA 2HIOB 5BS7C 4UUZB 1U35A 1P34A 5B24D 3KWQB 3UTAC 2IO5B 3MVDD 1M1AB 3NQUB 5B1LC 5B0ZB 5DNMB 5CP6C 3X1VC 3B0DB 1P3PB 4ZBJB 5CPKC 3LZ1B 5KDMB 5CP6D 1TAFB 3KXBA 3X1VD 1U35B 1P34B 3W96C 4EO5C 5GXQA 2CWEA 4AWLC 3W98D 4R8PA 3B0CW 5GSUC 1BH9A 3W96D 3WTPA 3AN2C 3RELC 4WU8A 3REJA 4KGCA 1P3AC 3AFAC 3B0CT 3KXBB 3RELD 3AN2D 1KX4C 3AZIA 1P3AD 3WKJC 3AFAD 5GXQB 2HUEB 5JRGA 3WKJD 5BNVA 4ZUXC 2NQBC 3WTPB 3MVDB 2YFVA 5B2IB 5BT1C 4WU8B 3REJB 4ZUXD 4KGCB 2NQBD 3UT9A 3AZEC 5BT1D 3AZIB 5B1MA 5GT3A 5BNXA 3REIB 5BNVB 3VH6W 2YFVB 4H9QB 4H9SA 3AV2A 2JSSA 1ZLAC 3W97C 2BYMA 1F1EA 3UT9B 4J8XA 1P3MA 3VH6T 1ZLAD 3W97D 5B1MB 1R4VA 5GT3B 3W99A 5BNXB 5AV6C 5AVCA 5F99A 3MGQA 3LZ0C 5AV6D 4G91C 1JFIA 5DNNA 3MGPA 3TU4C 2BYMB 3VH5A 2LY8A 3MGSA 4J8XB 1P3MB 3TU4D 4Z5TC 3W99B 5C3IC 3C1BA 3V9RA 3KUYD 5F99B 4Z5TD 4HGAB 3AZNA 3MGQB 5E5AA 1JFIB 1TZYA 5DNNB 3MGPB 5B32G 2FJ7C 3UTBA 1B67A 3MGSB 1P3BC 5G49A 1AOIA 1A7WA 2NZDA 2FJ7D 1P3BD 3V9RB 3REHC 4YM6A 3AZNB 1P3LA 3NQJB 1KX3C 5E5AB 3REHD 1TZYB 3AZHC 1KX3D 3UTBB 5G49B 1AOIB 5CPID 3AZHD 3O62C 1S32A 5AV9C 3X1SA 4YM6B 2HIOC 5B2JC 3O62D 5AV9D 4H9NA 5B32D 2F8NH 2IO5C 2HIOD 3WTPE 3MGRB 1KX5A 3KWQD 5B0ZC 3AZGD 3B0DC 1P3PC 3X1SB 1M1AD 3LJAA 5B0ZD 3LZ1C 4J8UA 3A6NA 5DNMD 1P3PD 1U35C 4H9NB 1P34C 4QLCB 3LZ1D 4JJND 4XZQA 5B31A 1KX5B 1U35D 1P34D 4X23A 3R45A 3LJAB 3A6NB 3KXBC 4NE5A 4WU9A 1P3OA 5GXQC 4XZQB 3KXBD 5B31B 4H9RA 4LD9A 2HUEC 5JA4A 4X23B 3R45B 1M19A 5GXQD 5AV8A 3WTPC 3MVDC 4XUJA 5B2IC 3AZGB 5AVBA 3WTPD 4H9PA 5AV5A 5B2ID 2AROA 3REJD 3AZIC 4WU8D 4WU9B 5GT0A 1P3OB 4KGCD 3KSYA 4JJNB 3AZID 5JA4B 4LD9B 3REIC 3X1UA 4J8VA 5AV8B 3W98C 5B0YA 3AV1A 3REID 5AVBB 4H9PB 5AV5B 3UT9C 2AROB 5GT0B 3LELA 3UT9D 4J8WA 3AZFA 5B40A 3X1UB 5B1MD 5GT3D 4J8VB 5FUGA 4DRBA 5B0YB 3X1TA 4H9SC 1P3KA 3AZJA 1P3IA 4R8PB 1BH9B 4J8XC 1P3MC 1KU5A 3LELB 1EQZA 3W99C 4J8WB 4J8XD 1P3MD 5B40B 3AYWA 5FUGB 1F66A 4HGAC 3W99D 3MGQC 3X1TB 3WA9A 5BS7A 1P3KB 3AZJB 5F99D 3MGPC 1P3IB 3UTAA 5JRGB 3MGQD 3B6GA 4NE6A 3MGSC 5DNND 3MGPD 1EQZB 5B1LA 4WZSB 4G92B 3MGSD 5CPKA 3VH6A 3AYWB 3WA9B 1F66B 3AZNC 1WWIA 5E5AC 3C1BD 1TZYC 3UTAB 3AZND 3B6GB 1ID3A 5E5AD 3UTBC 1TZYD 3AV2B 5GSUA 3UTBD 3AN2A 3RELA 4YM6C 5CPKB 1AOID 3KUYC 4YM6D 1KX4A 3WKJA 1ID3B 5AVCB 5AY8A 3MGRC 5GSUB 3MGRD 5B31G 3X1SC 3B6FA 1S32D 3AZEA 3X1SD 3AZMA 4E45A 4M6BA 2YFWA 4QLCC 4YS3A 3REKA 3C1BB 4KUDA 5AY8B 4QLCD 4KHAA 1KX5D 5CPJA 5CPIC 2PYOA 3LJAC 3B6FB 3A6NC 1ZLAA 5B33A 2NZDB 3AZEB 4Z2MG 3AZMB 3LJAD 2YFWB 4YS3B 3REKB 3A6ND 3WAAA 4KUDB 4XZQC 5B31C 1M18A 5B32C 1B6WA 1HTAA 1P3LB 4CAYA 4KHAB 1BH8A 4XZQD 5B31D 1HQ3A 5CPJB 3KWQC 3AZGC 3LZ0A 2PYOB 4X23D 5B33B 1M1AC 4WU9C 5DNMC 1P3OC 3WAAB 4ZBJC 1S32B 3AZLA 1M18B 1WWSA 3C1CA 4WU9D 4JJNC 4LD9C 1P3OD 1H3OA 4CAYB 1BH8B 5AV8C 1HQ3B 2F8NA 3MNNA 4LD9D 3LZ0B 3AZKA 2CV5A 4G91B 1M19D 5AV8D 4XUJD 5AV5C 2AROC 5AVBD 3AZLB 5AV5D 1ULYA 2AROD 3C1CB 4J8UB 5GT0D 1H3OB 3X1UC 2RVQD 2F8NB 3MNNB 1KX3A 3AZKB 2CV5B 3X1UD 4J8VD 5B0YD 4R8PC 3REJC 4R8PD 4WU8C 4J8WC 4KGCC 5B40C 3LELD 1P3GA 3X1TC 4J8WD 1P3KC 5B2JA 5B40D 1P3FA 3AZJC 4H9RB 5JRGC 3X1TD 1P3KD 1M19B 3AZJD 4XUJB 1P3ID 5JRGD 3AYWC 1EQZD 1P3GB 1F66C 1P3FB 5B2JB 5B1MC 1N1JA 5GT3C 3AYWD 3WA9D 1F66D 3B6GC 4Z66A 3AV2C 3AV1B 3UTAD 3B6GD 3B0BA 3AV2D 5B1LD 1N1JB 5CPKD 3AZFB 1ID3C 5AVCC 5B24A 5F99C 4Z66B 1ID3D 5AVCD 5DNNC 3MVDA 5B2IA 5GSUD 4NFTA 5CP6A 2BYKA 3C1BC 3X1VA 5AY8C 5B24B 1KX4D 3REIA 5AY8D 3W98A 4H9QA 3W96A 3B6FC 2F8NK 1AOIC 2NZDC 3AZMC 5B1LB 4CSRA 4YS3C 4WNNA 3REKC 5CP6B 2BYKB 3X1VB 3B6FD 4KUDC 2NZDD 3AZED 3AZMD 1P3AA 4YS3D 3AFAA 3REKD 1P3LC 4KUDD 3W98B 5CPJC 2PYOC 1P3LD 3W96B 4EO5B 4AWLB 5B33C 5CPJD 2F8NG 4CSRB 4ZUXA 2PYOD 4WNNB 3WAAC 2NQBA 1S32C 3AN2B 5B33D 3RELB 1M18C 1P3AB 3AFAB 3WAAD 1M18D 1KX4B 1HQ3C 2L5AA 3VH5W 3WKJB 1KX5C 1HQ3D 4WV4B 3LZ0D 1Q9CA 4ZUXB 3VH5T 2NQBB 3AZLC 3C1CC 4J8UC 3W97A 3AZLD 3C1CD 3MNNC 4J8UD 3NQJA 3AZKC 2CV5C 2F8ND 4DRAA 3MNND 5AV6A 5CHLB 4X23C 3AZKD 2CV5D 4H9OA 1ZLAB 3W97B 3TU4A 3KUYA 4Z5TA 4NE3A 5AV6B 1M19C 3MGRA 1BFMA 4XUJC 4H9OB 5AVBC 3TU4B 1P3GC 2FJ7A 5GT0C 3KUYB 1P3BA 2RVQC 1P3FC 4Z5TB 4QLCA 1P3GD 5C3IB 5BO0A 3REHA 5B2JD 1P3FD 4J8VC 5B0YC 3AV1C 5CPIA 3AV1D 3AZHA 2FJ7B 1P3BB 3LELC 3AZFC 5BO0B 3O62A 5AV9A 3REHB 5B32A 4Z66C
chains in the Genus database with same CATH superfamily
2DQNC 2ZY5A 2HIOA 4E44A 3AZFD 4UUZA 1PZRA 1KX3B 1P3IC 3KWQA 4Z66D 4Z2MH 3AZGA 5CPIB 3AZHB 2ZY2A 1M1AA 3NQUA 1EQZC 5B0ZA 4G92C 5DNMA 1P3PA 3O62B 5AV9B 2Y2MA 5B24C 5B32B 3LZ1A 3WA9C 5KDMA 4JJNA 1TAFA 2HIOB 5BS7C 4UUZB 1U35A 1P34A 5B24D 3KWQB 3UTAC 2IO5B 3MVDD 1M1AB 3NQUB 3P5JB 5B1LC 5B0ZB 5DNMB 5CP6C 3X1VC 3B0DB 1P3PB 4ZBJB 5CPKC 3LZ1B 5KDMB 2Y2PA 5CP6D 1TAFB 3KXBA 3X1VD 1U35B 1P34B 2W8SA 3W96C 4EO5C 5GXQA 2CWEA 4AWLC 3W98D 4R8PA 3B0CW 5GSUC 1BH9A 3W96D 3WTPA 3AN2C 3RELC 4WU8A 3REJA 4KGCA 1P3AC 3AFAC 1T3UA 3B0CT 3KXBB 3RELD 3AN2D 1KX4C 3AZIA 1P3AD 3WKJC 3AFAD 5GXQB 2HUEB 5JRGA 3WKJD 5BNVA 4ZUXC 2NQBC 3WTPB 3MVDB 2YFVA 5B2IB 5BT1C 4WU8B 3REJB 4ZUXD 4KGCB 2NQBD 3UT9A 3AZEC 5BT1D 3AZIB 5B1MA 5GT3A 5BNXA 3REIB 2DF4C 5BNVB 3VH6W 2YFVB 4H9QB 4H9SA 3AV2A 2JSSA 2G5HC 1ZLAC 3W97C 2BYMA 1F1EA 3UT9B 4WJ3C 4J8XA 1P3MA 3VH6T 1ZLAD 3W97D 5B1MB 1R4VA 5GT3B 3W99A 5BNXB 5AV6C 5AVCA 5F99A 3MGQA 3LZ0C 5AV6D 4G91C 1JFIA 5DNNA 3MGPA 3TU4C 2BYMB 3VH5A 2LY8A 3MGSA 4J8XB 1P3MB 3TU4D 4Z5TC 3W99B 5C3IC 3C1BA 3V9RA 3KUYD 5F99B 2J8PA 4Z5TD 4HGAB 3AZNA 3MGQB 5E5AA 1JFIB 1TZYA 5DNNB 3MGPB 5B32G 2FJ7C 3UTBA 1B67A 3MGSB 1P3BC 5G49A 1AOIA 1A7WA 2NZDA 2FJ7D 1P3BD 3V9RB 3REHC 4YM6A 3AZNB 1P3LA 3NQJB 1KX3C 5E5AB 3REHD 1TZYB 3AZHC 1KX3D 3UTBB 5G49B 1AOIB 5CPID 3AZHD 2Y2JA 3O62C 1S32A 5AV9C 3X1SA 4YM6B 2HIOC 5B2JC 3O62D 5AV9D 4H9NA 5B32D 2F8NH 2IO5C 2HIOD 3WTPE 3MGRB 1KX5A 3KWQD 5B0ZC 3AZGD 3B0DC 1P3PC 3X1SB 1M1AD 3LJAA 5B0ZD 3LZ1C 4J8UA 3A6NA 5DNMD 1P3PD 1U35C 4H9NB 1P34C 4QLCB 3LZ1D 4JJND 4XZQA 5B31A 1KX5B 1U35D 1P34D 4X23A 3R45A 3LJAB 3A6NB 3KXBC 4NE5A 4WU9A 1P3OA 5GXQC 4XZQB 3KXBD 5B31B 4H9RA 4LD9A 2HUEC 5JA4A 4X23B 3H0LC 2Y2GA 3R45B 5GXQD 5AV8A 1M19A 3WTPC 3IP4C 3MVDC 2FFFB 4XUJA 5B2IC 4UPKA 4DQYB 3AZGB 5AVBA 3WTPD 4H9PA 5AV5A 5B2ID 2AROA 3REJD 3AZIC 4WU8D 4WU9B 5GT0A 1P3OB 4KGCD 3KSYA 4JJNB 3AZID 5JA4B 4LD9B 3REIC 3X1UA 4J8VA 5AV8B 3W98C 5B0YA 3AV1A 3REID 5AVBB 4H9PB 2XD5A 5AV5B 3UT9C 2AROB 2Y2HA 5GT0B 3LELA 3UT9D 4J8WA 3AZFA 5B40A 3X1UB 5B1MD 5GT3D 4J8VB 5FUGA 4DRBA 5B0YB 3X1TA 4H9SC 1P3KA 3AZJA 1P3IA 4R8PB 1BH9B 4J8XC 1P3MC 2JE5A 1KU5A 3LELB 1EQZA 3W99C 4J8WB 4J8XD 1P3MD 5B40B 3AYWA 5FUGB 1F66A 4HGAC 3W99D 3MGQC 3X1TB 3WA9A 5BS7A 1P3KB 3AZJB 5F99D 3MGPC 2ZY4A 1P3IB 3UTAA 5JRGB 3MGQD 3B6GA 4NE6A 3MGSC 5DNND 3MGPD 1EQZB 5B1LA 4WZSB 4G92B 3MGSD 5CPKA 3VH6A 3AYWB 3WA9B 1F66B 3AZNC 1WWIA 5E5AC 3C1BD 1TZYC 3UTAB 3AZND 3B6GB 1ID3A 5E5AD 3UTBC 1TZYD 2ZY3A 3AV2B 5GSUA 3UTBD 3AN2A 3RELA 4YM6C 5CPKB 1AOID 3KUYC 4YM6D 1KX4A 3WKJA 1ID3B 5AVCB 5AY8A 3MGRC 2RIQA 5GSUB 2VQRA 3MGRD 5B31G 3X1SC 1W2EA 3B6FA 1S32D 3AZEA 3X1SD 3AZMA 4E45A 4M6BA 2YFWA 4QLCC 4YS3A 3REKA 3C1BB 4KUDA 5AY8B 4QLCD 4KHAA 1KX5D 5CPJA 5CPIC 3EPKA 3LJAC 2PYOA 3B6FB 3A6NC 1ZLAA 5B33A 3FDDA 2NZDB 3AZEB 4Z2MG 3AZMB 3LJAD 2YFWB 4YS3B 3REKB 3A6ND 3WAAA 4KUDB 4XZQC 5B31C 1M18A 5B32C 1B6WA 1HTAA 3H0RC 1P3LB 4CAYA 4KHAB 1BH8A 4XZQD 5B31D 1HQ3A 5CPJB 3KWQC 3AZGC 3LZ0A 2PYOB 4X23D 5B33B 1M1AC 3F6TA 4WU9C 5DNMC 1P3OC 3WAAB 4ZBJC 1S32B 2Y2OA 3AZLA 1M18B 1WWSA 3C1CA 2Y2IA 4WU9D 4JJNC 4LD9C 1P3OD 1H3OA 4CAYB 1BH8B 5AV8C 1HQ3B 2F8NA 3MNNA 4LD9D 3LZ0B 3AZKA 2CV5A 4G91B 1M19D 5AV8D 4XUJD 5AV5C 1Z2CB 2AROC 5AVBD 3AZLB 5AV5D 1ULYA 2AROD 3C1CB 4J8UB 2F2AC 5GT0D 1H3OB 3X1UC 2RVQD 3EPHA 2F8NB 3MNNB 1KX3A 3AZKB 2CV5B 3X1UD 4J8VD 3EG5B 4R8PC 5B0YD 2Y2NA 3EPLA 3REJC 4R8PD 4WU8C 4J8WC 4KGCC 5B40C 3LELD 1P3GA 3X1TC 4J8WD 1P3KC 5B2JA 5B40D 1P3FA 3AZJC 3H0MC 4H9RB 5JRGC 3X1TD 1P3KD 1M19B 3AZJD 4XUJB 1P3ID 5JRGD 3A1IA 3AYWC 1EQZD 1P3GB 1F66C 1P3FB 5B2JB 5B1MC 1N1JA 5GT3C 3AYWD 3WA9D 1F66D 3KFUG 3B6GC 4Z66A 3AV2C 3AV1B 3UTAD 3B6GD 3B0BA 3AV2D 5B1LD 1N1JB 5CPKD 3AZFB 1ID3C 5AVCC 5B24A 5F99C 2ZM5A 4Z66B 3AL0C 1ID3D 5AVCD 5DNNC 3MVDA 5B2IA 5GSUD 4NFTA 5CP6A 2BYKA 3C1BC 3X1VA 5AY8C 5B24B 1KX4D 2G5IC 3REIA 2JCHA 5AY8D 3W98A 4H9QA 3W96A 3B6FC 2F8NK 1AOIC 2NZDC 3AZMC 5B1LB 4CSRA 4YS3C 4WNNA 3REKC 5CP6B 2BYKB 3X1VB 3B6FD 4KUDC 2NZDD 3AZED 3AZMD 1P3AA 4YS3D 3AFAA 3REKD 1P3LC 4KUDD 3W98B 5CPJC 2PYOC 1P3LD 3W96B 4EO5B 4AWLB 5B33C 5CPJD 2F8NG 4CSRB 4ZUXA 2PYOD 4WNNB 3WAAC 2NQBA 1S32C 3AN2B 5B33D 3RELB 1M18C 1P3AB 3AFAB 3WAAD 1M18D 1KX4B 1HQ3C 2L5AA 3VH5W 3WKJB 1KX5C 1HQ3D 4WV4B 3LZ0D 1Q9CA 4ZUXB 3VH5T 2NQBB 3AZLC 3C1CC 4J8UC 3W97A 2BG1A 3AZLD 3C1CD 3MNNC 4J8UD 3NQJA 3AZKC 2CV5C 2F8ND 4DRAA 3MNND 5AV6A 5CHLB 4X23C 3AZKD 2CV5D 2Y2LA 4H9OA 1ZLAB 3W97B 3TU4A 3KUYA 4Z5TA 4NE3A 5AV6B 1M19C 3MGRA 1BFMA 4XUJC 4H9OB 5AVBC 3TU4B 1P3GC 2FJ7A 5GT0C 3KUYB 1P3BA 2RVQC 2UWXA 1P3FC 3A1KA 4Z5TB 4QLCA 1P3GD 5C3IB 5BO0A 3EPJA 3REHA 5B2JD 1P3FD 4J8VC 5B0YC 3AV1C 2XD1A 2Y2KA 5CPIA 3AV1D 3AZHA 2FJ7B 1P3BB 3LELC 2Y2QA 3AZFC 5BO0B 3O62A 5AV9A 3REHB 5B32A 4Z66C
chains in the Genus database with same CATH topology
2DQNC 2ZY5A 2HIOA 4E44A 3AZFD 4UUZA 1PZRA 1KX3B 1P3IC 3KWQA 4Z66D 4Z2MH 3AZGA 5CPIB 3AZHB 2ZY2A 1M1AA 3NQUA 1EQZC 5B0ZA 4G92C 5DNMA 1P3PA 3O62B 5AV9B 2Y2MA 5B24C 5B32B 3LZ1A 3WA9C 5KDMA 4JJNA 1TAFA 2HIOB 5BS7C 4UUZB 1U35A 1P34A 5B24D 3KWQB 3UTAC 2IO5B 3MVDD 1M1AB 3NQUB 3P5JB 5B1LC 5B0ZB 5DNMB 5CP6C 3X1VC 3B0DB 1P3PB 4ZBJB 5CPKC 3LZ1B 5KDMB 2Y2PA 5CP6D 1TAFB 3KXBA 3X1VD 1U35B 1P34B 2W8SA 3W96C 4EO5C 5GXQA 2CWEA 4AWLC 3W98D 4R8PA 3B0CW 5GSUC 1BH9A 3W96D 3WTPA 3AN2C 3RELC 4WU8A 3REJA 4KGCA 1P3AC 3AFAC 1T3UA 3B0CT 3KXBB 3RELD 3AN2D 1KX4C 3AZIA 1P3AD 3WKJC 3AFAD 5GXQB 2HUEB 5JRGA 3WKJD 5BNVA 4ZUXC 2NQBC 3WTPB 3MVDB 2YFVA 5B2IB 5BT1C 4WU8B 3REJB 4ZUXD 4KGCB 2NQBD 3UT9A 3AZEC 5BT1D 3AZIB 5B1MA 5GT3A 5BNXA 3REIB 2DF4C 5BNVB 3VH6W 2YFVB 4H9QB 4H9SA 3AV2A 2JSSA 2G5HC 1ZLAC 3W97C 2BYMA 1F1EA 3UT9B 4WJ3C 4J8XA 1P3MA 3VH6T 1ZLAD 3W97D 5B1MB 1R4VA 5GT3B 3W99A 5BNXB 5AV6C 5AVCA 5F99A 3MGQA 3LZ0C 5AV6D 4G91C 1JFIA 5DNNA 3MGPA 3TU4C 2BYMB 3VH5A 2LY8A 3MGSA 4J8XB 1P3MB 3TU4D 4Z5TC 3W99B 5C3IC 3C1BA 3V9RA 3KUYD 5F99B 2J8PA 4Z5TD 4HGAB 3AZNA 3MGQB 5E5AA 1JFIB 1TZYA 5DNNB 3MGPB 5B32G 2FJ7C 3UTBA 1B67A 3MGSB 1P3BC 5G49A 1AOIA 1A7WA 2NZDA 2FJ7D 1P3BD 3V9RB 3REHC 4YM6A 3AZNB 1P3LA 3NQJB 1KX3C 5E5AB 3REHD 1TZYB 3AZHC 1KX3D 3UTBB 5G49B 1AOIB 5CPID 3AZHD 2Y2JA 3O62C 1S32A 5AV9C 3X1SA 4YM6B 2HIOC 5B2JC 3O62D 5AV9D 4H9NA 5B32D 2F8NH 2IO5C 2HIOD 3WTPE 3MGRB 1KX5A 3KWQD 5B0ZC 3AZGD 3B0DC 1P3PC 3X1SB 1M1AD 3LJAA 5B0ZD 3LZ1C 4J8UA 3A6NA 5DNMD 1P3PD 1U35C 4H9NB 1P34C 4QLCB 3LZ1D 4JJND 4XZQA 5B31A 1KX5B 1U35D 1P34D 4X23A 3R45A 3LJAB 3A6NB 3KXBC 4NE5A 4WU9A 1P3OA 5GXQC 4XZQB 3KXBD 5B31B 4H9RA 4LD9A 2HUEC 5JA4A 4X23B 3H0LC 2Y2GA 3R45B 5GXQD 5AV8A 1M19A 3WTPC 3IP4C 3MVDC 2FFFB 4XUJA 5B2IC 4UPKA 4DQYB 3AZGB 5AVBA 3WTPD 4H9PA 5AV5A 5B2ID 2AROA 3REJD 3AZIC 4WU8D 4WU9B 5GT0A 1P3OB 4KGCD 3KSYA 4JJNB 3AZID 5JA4B 4LD9B 3REIC 3X1UA 4J8VA 5AV8B 3W98C 5B0YA 3AV1A 3REID 5AVBB 4H9PB 2XD5A 5AV5B 3UT9C 2AROB 2Y2HA 5GT0B 3LELA 3UT9D 4J8WA 3AZFA 5B40A 3X1UB 5B1MD 5GT3D 4J8VB 5FUGA 4DRBA 5B0YB 3X1TA 4H9SC 1P3KA 3AZJA 1P3IA 4R8PB 1BH9B 4J8XC 1P3MC 2JE5A 1KU5A 3LELB 1EQZA 3W99C 4J8WB 4J8XD 1P3MD 5B40B 3AYWA 5FUGB 1F66A 4HGAC 3W99D 3MGQC 3X1TB 3WA9A 5BS7A 1P3KB 3AZJB 5F99D 3MGPC 2ZY4A 1P3IB 3UTAA 5JRGB 3MGQD 3B6GA 4NE6A 3MGSC 5DNND 3MGPD 1EQZB 5B1LA 4WZSB 4G92B 3MGSD 5CPKA 3VH6A 3AYWB 3WA9B 1F66B 3AZNC 1WWIA 5E5AC 3C1BD 1TZYC 3UTAB 3AZND 3B6GB 1ID3A 5E5AD 3UTBC 1TZYD 2ZY3A 3AV2B 5GSUA 3UTBD 3AN2A 3RELA 4YM6C 5CPKB 1AOID 3KUYC 4YM6D 1KX4A 3WKJA 1ID3B 5AVCB 5AY8A 3MGRC 2RIQA 5GSUB 2VQRA 3MGRD 5B31G 3X1SC 1W2EA 3B6FA 1S32D 3AZEA 3X1SD 3AZMA 4E45A 4M6BA 2YFWA 4QLCC 4YS3A 3REKA 3C1BB 4KUDA 5AY8B 4QLCD 4KHAA 1KX5D 5CPJA 5CPIC 3EPKA 3LJAC 2PYOA 3B6FB 3A6NC 1ZLAA 5B33A 3FDDA 2NZDB 3AZEB 4Z2MG 3AZMB 3LJAD 2YFWB 4YS3B 3REKB 3A6ND 3WAAA 4KUDB 4XZQC 5B31C 1M18A 5B32C 1B6WA 1HTAA 3H0RC 1P3LB 4CAYA 4KHAB 1BH8A 4XZQD 5B31D 1HQ3A 5CPJB 3KWQC 3AZGC 3LZ0A 2PYOB 4X23D 5B33B 1M1AC 3F6TA 4WU9C 5DNMC 1P3OC 3WAAB 4ZBJC 1S32B 2Y2OA 3AZLA 1M18B 1WWSA 3C1CA 2Y2IA 4WU9D 4JJNC 4LD9C 1P3OD 1H3OA 4CAYB 1BH8B 5AV8C 1HQ3B 2F8NA 3MNNA 4LD9D 3LZ0B 3AZKA 2CV5A 4G91B 1M19D 5AV8D 4XUJD 5AV5C 1Z2CB 2AROC 5AVBD 3AZLB 5AV5D 1ULYA 2AROD 3C1CB 4J8UB 2F2AC 5GT0D 1H3OB 3X1UC 2RVQD 3EPHA 2F8NB 3MNNB 1KX3A 3AZKB 2CV5B 3X1UD 4J8VD 3EG5B 4R8PC 5B0YD 2Y2NA 3EPLA 3REJC 4R8PD 4WU8C 4J8WC 4KGCC 5B40C 3LELD 1P3GA 3X1TC 4J8WD 1P3KC 5B2JA 5B40D 1P3FA 3AZJC 3H0MC 4H9RB 5JRGC 3X1TD 1P3KD 1M19B 3AZJD 4XUJB 1P3ID 5JRGD 3A1IA 3AYWC 1EQZD 1P3GB 1F66C 1P3FB 5B2JB 5B1MC 1N1JA 5GT3C 3AYWD 3WA9D 1F66D 3KFUG 3B6GC 4Z66A 3AV2C 3AV1B 3UTAD 3B6GD 3B0BA 3AV2D 5B1LD 1N1JB 5CPKD 3AZFB 1ID3C 5AVCC 5B24A 5F99C 2ZM5A 4Z66B 3AL0C 1ID3D 5AVCD 5DNNC 3MVDA 5B2IA 5GSUD 4NFTA 5CP6A 2BYKA 3C1BC 3X1VA 5AY8C 5B24B 1KX4D 2G5IC 3REIA 2JCHA 5AY8D 3W98A 4H9QA 3W96A 3B6FC 2F8NK 1AOIC 2NZDC 3AZMC 5B1LB 4CSRA 4YS3C 4WNNA 3REKC 5CP6B 2BYKB 3X1VB 3B6FD 4KUDC 2NZDD 3AZED 3AZMD 1P3AA 4YS3D 3AFAA 3REKD 1P3LC 4KUDD 3W98B 5CPJC 2PYOC 1P3LD 3W96B 4EO5B 4AWLB 5B33C 5CPJD 2F8NG 4CSRB 4ZUXA 2PYOD 4WNNB 3WAAC 2NQBA 1S32C 3AN2B 5B33D 3RELB 1M18C 1P3AB 3AFAB 3WAAD 1M18D 1KX4B 1HQ3C 2L5AA 3VH5W 3WKJB 1KX5C 1HQ3D 4WV4B 3LZ0D 1Q9CA 4ZUXB 3VH5T 2NQBB 3AZLC 3C1CC 4J8UC 3W97A 2BG1A 3AZLD 3C1CD 3MNNC 4J8UD 3NQJA 3AZKC 2CV5C 2F8ND 4DRAA 3MNND 5AV6A 5CHLB 4X23C 3AZKD 2CV5D 2Y2LA 4H9OA 1ZLAB 3W97B 3TU4A 3KUYA 4Z5TA 4NE3A 5AV6B 1M19C 3MGRA 1BFMA 4XUJC 4H9OB 5AVBC 3TU4B 1P3GC 2FJ7A 5GT0C 3KUYB 1P3BA 2RVQC 2UWXA 1P3FC 3A1KA 4Z5TB 4QLCA 1P3GD 5C3IB 5BO0A 3EPJA 3REHA 5B2JD 1P3FD 4J8VC 5B0YC 3AV1C 2XD1A 2Y2KA 5CPIA 3AV1D 3AZHA 2FJ7B 1P3BB 3LELC 2Y2QA 3AZFC 5BO0B 3O62A 5AV9A 3REHB 5B32A 4Z66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO A;  4E44 A;  3AZF D;  4UUZ A;  1KX3 B;  1P3I C;  3KWQ A;  4Z66 D;  4Z2M H;  3AZG A;  5CPI B;  3AZH B;  1M1A A;  3NQU A;  1EQZ C;  5B0Z A;  4G92 C;  5DNM A;  1P3P A;  3O62 B;  5AV9 B;  5B24 C;  5B32 B;  3LZ1 A;  3WA9 C;  5KDM A;  4JJN A;  1TAF A;  2HIO B;  5BS7 C;  4UUZ B;  1U35 A;  1P34 A;  5B24 D;  3KWQ B;  3UTA C;  2IO5 B;  3MVD D;  1M1A B;  3NQU B;  5B1L C;  5B0Z B;  5DNM B;  5CP6 C;  3X1V C;  3B0D B;  1P3P B;  4ZBJ B;  5CPK C;  3LZ1 B;  5KDM B;  5CP6 D;  1TAF B;  3KXB A;  3X1V D;  1U35 B;  1P34 B;  3W96 C;  4EO5 C;  5GXQ A;  2CWE A;  4AWL C;  3W98 D;  4R8P A;  3B0C W;  5GSU C;  1BH9 A;  3W96 D;  3WTP A;  3AN2 C;  3REL C;  4WU8 A;  3REJ A;  4KGC A;  1P3A C;  3AFA C;  3B0C T;  3KXB B;  3REL D;  3AN2 D;  1KX4 C;  3AZI A;  1P3A D;  3WKJ C;  3AFA D;  5GXQ B;  2HUE B;  5JRG A;  3WKJ D;  5BNV A;  4ZUX C;  2NQB C;  3WTP B;  3MVD B;  2YFV A;  5B2I B;  5BT1 C;  4WU8 B;  3REJ B;  4ZUX D;  4KGC B;  2NQB D;  3UT9 A;  3AZE C;  5BT1 D;  3AZI B;  5B1M A;  5GT3 A;  5BNX A;  3REI B;  5BNV B;  3VH6 W;  2YFV B;  4H9Q B;  4H9S A;  3AV2 A;  2JSS A;  1ZLA C;  3W97 C;  2BYM A;  1F1E A;  3UT9 B;  4J8X A;  1P3M A;  3VH6 T;  1ZLA D;  3W97 D;  5B1M B;  1R4V A;  5GT3 B;  3W99 A;  5BNX B;  5AV6 C;  5AVC A;  5F99 A;  3MGQ A;  3LZ0 C;  5AV6 D;  4G91 C;  1JFI A;  5DNN A;  3MGP A;  3TU4 C;  2BYM B;  3VH5 A;  2LY8 A;  3MGS A;  4J8X B;  1P3M B;  3TU4 D;  4Z5T C;  3W99 B;  5C3I C;  3C1B A;  3V9R A;  3KUY D;  5F99 B;  4Z5T D;  4HGA B;  3AZN A;  3MGQ B;  5E5A A;  1JFI B;  1TZY A;  5DNN B;  3MGP B;  5B32 G;  2FJ7 C;  3UTB A;  1B67 A;  3MGS B;  1P3B C;  5G49 A;  1AOI A;  1A7W A;  2NZD A;  2FJ7 D;  1P3B D;  3V9R B;  3REH C;  4YM6 A;  3AZN B;  1P3L A;  3NQJ B;  1KX3 C;  5E5A B;  3REH D;  1TZY B;  3AZH C;  1KX3 D;  3UTB B;  5G49 B;  1AOI B;  5CPI D;  3AZH D;  3O62 C;  1S32 A;  5AV9 C;  3X1S A;  4YM6 B;  2HIO C;  5B2J C;  3O62 D;  5AV9 D;  4H9N A;  5B32 D;  2F8N H;  2IO5 C;  2HIO D;  3WTP E;  3MGR B;  1KX5 A;  3KWQ D;  5B0Z C;  3AZG D;  3B0D C;  1P3P C;  3X1S B;  1M1A D;  3LJA A;  5B0Z D;  3LZ1 C;  4J8U A;  3A6N A;  5DNM D;  1P3P D;  1U35 C;  4H9N B;  1P34 C;  4QLC B;  3LZ1 D;  4JJN D;  4XZQ A;  5B31 A;  1KX5 B;  1U35 D;  1P34 D;  4X23 A;  3R45 A;  3LJA B;  3A6N B;  3KXB C;  4NE5 A;  4WU9 A;  1P3O A;  5GXQ C;  4XZQ B;  3KXB D;  5B31 B;  4H9R A;  4LD9 A;  2HUE C;  5JA4 A;  4X23 B;  3R45 B;  1M19 A;  5GXQ D;  5AV8 A;  3WTP C;  3MVD C;  4XUJ A;  5B2I C;  3AZG B;  5AVB A;  3WTP D;  4H9P A;  5AV5 A;  5B2I D;  2ARO A;  3REJ D;  3AZI C;  4WU8 D;  4WU9 B;  5GT0 A;  1P3O B;  4KGC D;  3KSY A;  4JJN B;  3AZI D;  5JA4 B;  4LD9 B;  3REI C;  3X1U A;  4J8V A;  5AV8 B;  3W98 C;  5B0Y A;  3AV1 A;  3REI D;  5AVB B;  4H9P B;  5AV5 B;  3UT9 C;  2ARO B;  5GT0 B;  3LEL A;  3UT9 D;  4J8W A;  3AZF A;  5B40 A;  3X1U B;  5B1M D;  5GT3 D;  4J8V B;  5FUG A;  4DRB A;  5B0Y B;  3X1T A;  4H9S C;  1P3K A;  3AZJ A;  1P3I A;  4R8P B;  1BH9 B;  4J8X C;  1P3M C;  1KU5 A;  3LEL B;  1EQZ A;  3W99 C;  4J8W B;  4J8X D;  1P3M D;  5B40 B;  3AYW A;  5FUG B;  1F66 A;  4HGA C;  3W99 D;  3MGQ C;  3X1T B;  3WA9 A;  5BS7 A;  1P3K B;  3AZJ B;  5F99 D;  3MGP C;  1P3I B;  3UTA A;  5JRG B;  3MGQ D;  3B6G A;  4NE6 A;  3MGS C;  5DNN D;  3MGP D;  1EQZ B;  5B1L A;  4WZS B;  4G92 B;  3MGS D;  5CPK A;  3VH6 A;  3AYW B;  3WA9 B;  1F66 B;  3AZN C;  1WWI A;  5E5A C;  3C1B D;  1TZY C;  3UTA B;  3AZN D;  3B6G B;  1ID3 A;  5E5A D;  3UTB C;  1TZY D;  3AV2 B;  5GSU A;  3UTB D;  3AN2 A;  3REL A;  4YM6 C;  5CPK B;  1AOI D;  3KUY C;  4YM6 D;  1KX4 A;  3WKJ A;  1ID3 B;  5AVC B;  5AY8 A;  3MGR C;  5GSU B;  3MGR D;  5B31 G;  3X1S C;  3B6F A;  1S32 D;  3AZE A;  3X1S D;  3AZM A;  4E45 A;  4M6B A;  2YFW A;  4QLC C;  4YS3 A;  3REK A;  3C1B B;  4KUD A;  5AY8 B;  4QLC D;  4KHA A;  1KX5 D;  5CPJ A;  5CPI C;  2PYO A;  3LJA C;  3B6F B;  3A6N C;  1ZLA A;  5B33 A;  2NZD B;  3AZE B;  4Z2M G;  3AZM B;  3LJA D;  2YFW B;  4YS3 B;  3REK B;  3A6N D;  3WAA A;  4KUD B;  4XZQ C;  5B31 C;  1M18 A;  5B32 C;  1B6W A;  1HTA A;  1P3L B;  4CAY A;  4KHA B;  1BH8 A;  4XZQ D;  5B31 D;  1HQ3 A;  5CPJ B;  3KWQ C;  3AZG C;  3LZ0 A;  2PYO B;  4X23 D;  5B33 B;  1M1A C;  4WU9 C;  5DNM C;  1P3O C;  3WAA B;  4ZBJ C;  1S32 B;  3AZL A;  1M18 B;  1WWS A;  3C1C A;  4WU9 D;  4JJN C;  4LD9 C;  1P3O D;  1H3O A;  4CAY B;  1BH8 B;  5AV8 C;  1HQ3 B;  2F8N A;  3MNN A;  4LD9 D;  3LZ0 B;  3AZK A;  2CV5 A;  4G91 B;  1M19 D;  5AV8 D;  4XUJ D;  5AV5 C;  2ARO C;  5AVB D;  3AZL B;  5AV5 D;  1ULY A;  2ARO D;  3C1C B;  4J8U B;  5GT0 D;  1H3O B;  3X1U C;  2RVQ D;  2F8N B;  3MNN B;  1KX3 A;  3AZK B;  2CV5 B;  3X1U D;  4J8V D;  5B0Y D;  4R8P C;  3REJ C;  4R8P D;  4WU8 C;  4J8W C;  4KGC C;  5B40 C;  3LEL D;  1P3G A;  3X1T C;  4J8W D;  1P3K C;  5B2J A;  5B40 D;  1P3F A;  3AZJ C;  4H9R B;  5JRG C;  3X1T D;  1P3K D;  1M19 B;  3AZJ D;  4XUJ B;  1P3I D;  5JRG D;  3AYW C;  1EQZ D;  1P3G B;  1F66 C;  1P3F B;  5B2J B;  5B1M C;  1N1J A;  5GT3 C;  3AYW D;  3WA9 D;  1F66 D;  3B6G C;  4Z66 A;  3AV2 C;  3AV1 B;  3UTA D;  3B6G D;  3B0B A;  3AV2 D;  5B1L D;  1N1J B;  5CPK D;  3AZF B;  1ID3 C;  5AVC C;  5B24 A;  5F99 C;  4Z66 B;  1ID3 D;  5AVC D;  5DNN C;  3MVD A;  5B2I A;  5GSU D;  4NFT A;  5CP6 A;  2BYK A;  3C1B C;  3X1V A;  5AY8 C;  5B24 B;  1KX4 D;  3REI A;  5AY8 D;  3W98 A;  4H9Q A;  3W96 A;  3B6F C;  2F8N K;  1AOI C;  2NZD C;  3AZM C;  5B1L B;  4CSR A;  4YS3 C;  4WNN A;  3REK C;  5CP6 B;  2BYK B;  3X1V B;  3B6F D;  4KUD C;  2NZD D;  3AZE D;  3AZM D;  1P3A A;  4YS3 D;  3AFA A;  3REK D;  1P3L C;  4KUD D;  3W98 B;  5CPJ C;  2PYO C;  1P3L D;  3W96 B;  4EO5 B;  4AWL B;  5B33 C;  5CPJ D;  2F8N G;  4CSR B;  4ZUX A;  2PYO D;  4WNN B;  3WAA C;  2NQB A;  1S32 C;  3AN2 B;  5B33 D;  3REL B;  1M18 C;  1P3A B;  3AFA B;  3WAA D;  1M18 D;  1KX4 B;  1HQ3 C;  2L5A A;  3VH5 W;  3WKJ B;  1KX5 C;  1HQ3 D;  4WV4 B;  3LZ0 D;  1Q9C A;  4ZUX B;  3VH5 T;  2NQB B;  3AZL C;  3C1C C;  4J8U C;  3W97 A;  3AZL D;  3C1C D;  3MNN C;  4J8U D;  3NQJ A;  3AZK C;  2CV5 C;  2F8N D;  4DRA A;  3MNN D;  5AV6 A;  5CHL B;  4X23 C;  3AZK D;  2CV5 D;  4H9O A;  1ZLA B;  3W97 B;  3TU4 A;  3KUY A;  4Z5T A;  4NE3 A;  5AV6 B;  1M19 C;  3MGR A;  1BFM A;  4XUJ C;  4H9O B;  5AVB C;  3TU4 B;  1P3G C;  2FJ7 A;  5GT0 C;  3KUY B;  1P3B A;  2RVQ C;  1P3F C;  4Z5T B;  4QLC A;  1P3G D;  5C3I B;  5BO0 A;  3REH A;  5B2J D;  1P3F D;  4J8V C;  5B0Y C;  3AV1 C;  5CPI A;  3AV1 D;  3AZH A;  2FJ7 B;  1P3B B;  3LEL C;  3AZF C;  5BO0 B;  3O62 A;  5AV9 A;  3REH B;  5B32 A;  4Z66 C; 
#chains in the Genus database with same CATH topology
 2DQN C;  2ZY5 A;  2HIO A;  4E44 A;  3AZF D;  4UUZ A;  1PZR A;  1KX3 B;  1P3I C;  3KWQ A;  4Z66 D;  4Z2M H;  3AZG A;  5CPI B;  3AZH B;  2ZY2 A;  1M1A A;  3NQU A;  1EQZ C;  5B0Z A;  4G92 C;  5DNM A;  1P3P A;  3O62 B;  5AV9 B;  2Y2M A;  5B24 C;  5B32 B;  3LZ1 A;  3WA9 C;  5KDM A;  4JJN A;  1TAF A;  2HIO B;  5BS7 C;  4UUZ B;  1U35 A;  1P34 A;  5B24 D;  3KWQ B;  3UTA C;  2IO5 B;  3MVD D;  1M1A B;  3NQU B;  3P5J B;  5B1L C;  5B0Z B;  5DNM B;  5CP6 C;  3X1V C;  3B0D B;  1P3P B;  4ZBJ B;  5CPK C;  3LZ1 B;  5KDM B;  2Y2P A;  5CP6 D;  1TAF B;  3KXB A;  3X1V D;  1U35 B;  1P34 B;  2W8S A;  3W96 C;  4EO5 C;  5GXQ A;  2CWE A;  4AWL C;  3W98 D;  4R8P A;  3B0C W;  5GSU C;  1BH9 A;  3W96 D;  3WTP A;  3AN2 C;  3REL C;  4WU8 A;  3REJ A;  4KGC A;  1P3A C;  3AFA C;  1T3U A;  3B0C T;  3KXB B;  3REL D;  3AN2 D;  1KX4 C;  3AZI A;  1P3A D;  3WKJ C;  3AFA D;  5GXQ B;  2HUE B;  5JRG A;  3WKJ D;  5BNV A;  4ZUX C;  2NQB C;  3WTP B;  3MVD B;  2YFV A;  5B2I B;  5BT1 C;  4WU8 B;  3REJ B;  4ZUX D;  4KGC B;  2NQB D;  3UT9 A;  3AZE C;  5BT1 D;  3AZI B;  5B1M A;  5GT3 A;  5BNX A;  3REI B;  2DF4 C;  5BNV B;  3VH6 W;  2YFV B;  4H9Q B;  4H9S A;  3AV2 A;  2JSS A;  2G5H C;  1ZLA C;  3W97 C;  2BYM A;  1F1E A;  3UT9 B;  4WJ3 C;  4J8X A;  1P3M A;  3VH6 T;  1ZLA D;  3W97 D;  5B1M B;  1R4V A;  5GT3 B;  3W99 A;  5BNX B;  5AV6 C;  5AVC A;  5F99 A;  3MGQ A;  3LZ0 C;  5AV6 D;  4G91 C;  1JFI A;  5DNN A;  3MGP A;  3TU4 C;  2BYM B;  3VH5 A;  2LY8 A;  3MGS A;  4J8X B;  1P3M B;  3TU4 D;  4Z5T C;  3W99 B;  5C3I C;  3C1B A;  3V9R A;  3KUY D;  5F99 B;  2J8P A;  4Z5T D;  4HGA B;  3AZN A;  3MGQ B;  5E5A A;  1JFI B;  1TZY A;  5DNN B;  3MGP B;  5B32 G;  2FJ7 C;  3UTB A;  1B67 A;  3MGS B;  1P3B C;  5G49 A;  1AOI A;  1A7W A;  2NZD A;  2FJ7 D;  1P3B D;  3V9R B;  3REH C;  4YM6 A;  3AZN B;  1P3L A;  3NQJ B;  1KX3 C;  5E5A B;  3REH D;  1TZY B;  3AZH C;  1KX3 D;  3UTB B;  5G49 B;  1AOI B;  5CPI D;  3AZH D;  2Y2J A;  3O62 C;  1S32 A;  5AV9 C;  3X1S A;  4YM6 B;  2HIO C;  5B2J C;  3O62 D;  5AV9 D;  4H9N A;  5B32 D;  2F8N H;  2IO5 C;  2HIO D;  3WTP E;  3MGR B;  1KX5 A;  3KWQ D;  5B0Z C;  3AZG D;  3B0D C;  1P3P C;  3X1S B;  1M1A D;  3LJA A;  5B0Z D;  3LZ1 C;  4J8U A;  3A6N A;  5DNM D;  1P3P D;  1U35 C;  4H9N B;  1P34 C;  4QLC B;  3LZ1 D;  4JJN D;  4XZQ A;  5B31 A;  1KX5 B;  1U35 D;  1P34 D;  4X23 A;  3R45 A;  3LJA B;  3A6N B;  3KXB C;  4NE5 A;  4WU9 A;  1P3O A;  5GXQ C;  4XZQ B;  3KXB D;  5B31 B;  4H9R A;  4LD9 A;  2HUE C;  5JA4 A;  4X23 B;  3H0L C;  2Y2G A;  3R45 B;  5GXQ D;  5AV8 A;  1M19 A;  3WTP C;  3IP4 C;  3MVD C;  2FFF B;  4XUJ A;  5B2I C;  4UPK A;  4DQY B;  3AZG B;  5AVB A;  3WTP D;  4H9P A;  5AV5 A;  5B2I D;  2ARO A;  3REJ D;  3AZI C;  4WU8 D;  4WU9 B;  5GT0 A;  1P3O B;  4KGC D;  3KSY A;  4JJN B;  3AZI D;  5JA4 B;  4LD9 B;  3REI C;  3X1U A;  4J8V A;  5AV8 B;  3W98 C;  5B0Y A;  3AV1 A;  3REI D;  5AVB B;  4H9P B;  2XD5 A;  5AV5 B;  3UT9 C;  2ARO B;  2Y2H A;  5GT0 B;  3LEL A;  3UT9 D;  4J8W A;  3AZF A;  5B40 A;  3X1U B;  5B1M D;  5GT3 D;  4J8V B;  5FUG A;  4DRB A;  5B0Y B;  3X1T A;  4H9S C;  1P3K A;  3AZJ A;  1P3I A;  4R8P B;  1BH9 B;  4J8X C;  1P3M C;  2JE5 A;  1KU5 A;  3LEL B;  1EQZ A;  3W99 C;  4J8W B;  4J8X D;  1P3M D;  5B40 B;  3AYW A;  5FUG B;  1F66 A;  4HGA C;  3W99 D;  3MGQ C;  3X1T B;  3WA9 A;  5BS7 A;  1P3K B;  3AZJ B;  5F99 D;  3MGP C;  2ZY4 A;  1P3I B;  3UTA A;  5JRG B;  3MGQ D;  3B6G A;  4NE6 A;  3MGS C;  5DNN D;  3MGP D;  1EQZ B;  5B1L A;  4WZS B;  4G92 B;  3MGS D;  5CPK A;  3VH6 A;  3AYW B;  3WA9 B;  1F66 B;  3AZN C;  1WWI A;  5E5A C;  3C1B D;  1TZY C;  3UTA B;  3AZN D;  3B6G B;  1ID3 A;  5E5A D;  3UTB C;  1TZY D;  2ZY3 A;  3AV2 B;  5GSU A;  3UTB D;  3AN2 A;  3REL A;  4YM6 C;  5CPK B;  1AOI D;  3KUY C;  4YM6 D;  1KX4 A;  3WKJ A;  1ID3 B;  5AVC B;  5AY8 A;  3MGR C;  2RIQ A;  5GSU B;  2VQR A;  3MGR D;  5B31 G;  3X1S C;  1W2E A;  3B6F A;  1S32 D;  3AZE A;  3X1S D;  3AZM A;  4E45 A;  4M6B A;  2YFW A;  4QLC C;  4YS3 A;  3REK A;  3C1B B;  4KUD A;  5AY8 B;  4QLC D;  4KHA A;  1KX5 D;  5CPJ A;  5CPI C;  3EPK A;  3LJA C;  2PYO A;  3B6F B;  3A6N C;  1ZLA A;  5B33 A;  3FDD A;  2NZD B;  3AZE B;  4Z2M G;  3AZM B;  3LJA D;  2YFW B;  4YS3 B;  3REK B;  3A6N D;  3WAA A;  4KUD B;  4XZQ C;  5B31 C;  1M18 A;  5B32 C;  1B6W A;  1HTA A;  3H0R C;  1P3L B;  4CAY A;  4KHA B;  1BH8 A;  4XZQ D;  5B31 D;  1HQ3 A;  5CPJ B;  3KWQ C;  3AZG C;  3LZ0 A;  2PYO B;  4X23 D;  5B33 B;  1M1A C;  3F6T A;  4WU9 C;  5DNM C;  1P3O C;  3WAA B;  4ZBJ C;  1S32 B;  2Y2O A;  3AZL A;  1M18 B;  1WWS A;  3C1C A;  2Y2I A;  4WU9 D;  4JJN C;  4LD9 C;  1P3O D;  1H3O A;  4CAY B;  1BH8 B;  5AV8 C;  1HQ3 B;  2F8N A;  3MNN A;  4LD9 D;  3LZ0 B;  3AZK A;  2CV5 A;  4G91 B;  1M19 D;  5AV8 D;  4XUJ D;  5AV5 C;  1Z2C B;  2ARO C;  5AVB D;  3AZL B;  5AV5 D;  1ULY A;  2ARO D;  3C1C B;  4J8U B;  2F2A C;  5GT0 D;  1H3O B;  3X1U C;  2RVQ D;  3EPH A;  2F8N B;  3MNN B;  1KX3 A;  3AZK B;  2CV5 B;  3X1U D;  4J8V D;  3EG5 B;  4R8P C;  5B0Y D;  2Y2N A;  3EPL A;  3REJ C;  4R8P D;  4WU8 C;  4J8W C;  4KGC C;  5B40 C;  3LEL D;  1P3G A;  3X1T C;  4J8W D;  1P3K C;  5B2J A;  5B40 D;  1P3F A;  3AZJ C;  3H0M C;  4H9R B;  5JRG C;  3X1T D;  1P3K D;  1M19 B;  3AZJ D;  4XUJ B;  1P3I D;  5JRG D;  3A1I A;  3AYW C;  1EQZ D;  1P3G B;  1F66 C;  1P3F B;  5B2J B;  5B1M C;  1N1J A;  5GT3 C;  3AYW D;  3WA9 D;  1F66 D;  3KFU G;  3B6G C;  4Z66 A;  3AV2 C;  3AV1 B;  3UTA D;  3B6G D;  3B0B A;  3AV2 D;  5B1L D;  1N1J B;  5CPK D;  3AZF B;  1ID3 C;  5AVC C;  5B24 A;  5F99 C;  2ZM5 A;  4Z66 B;  3AL0 C;  1ID3 D;  5AVC D;  5DNN C;  3MVD A;  5B2I A;  5GSU D;  4NFT A;  5CP6 A;  2BYK A;  3C1B C;  3X1V A;  5AY8 C;  5B24 B;  1KX4 D;  2G5I C;  3REI A;  2JCH A;  5AY8 D;  3W98 A;  4H9Q A;  3W96 A;  3B6F C;  2F8N K;  1AOI C;  2NZD C;  3AZM C;  5B1L B;  4CSR A;  4YS3 C;  4WNN A;  3REK C;  5CP6 B;  2BYK B;  3X1V B;  3B6F D;  4KUD C;  2NZD D;  3AZE D;  3AZM D;  1P3A A;  4YS3 D;  3AFA A;  3REK D;  1P3L C;  4KUD D;  3W98 B;  5CPJ C;  2PYO C;  1P3L D;  3W96 B;  4EO5 B;  4AWL B;  5B33 C;  5CPJ D;  2F8N G;  4CSR B;  4ZUX A;  2PYO D;  4WNN B;  3WAA C;  2NQB A;  1S32 C;  3AN2 B;  5B33 D;  3REL B;  1M18 C;  1P3A B;  3AFA B;  3WAA D;  1M18 D;  1KX4 B;  1HQ3 C;  2L5A A;  3VH5 W;  3WKJ B;  1KX5 C;  1HQ3 D;  4WV4 B;  3LZ0 D;  1Q9C A;  4ZUX B;  3VH5 T;  2NQB B;  3AZL C;  3C1C C;  4J8U C;  3W97 A;  2BG1 A;  3AZL D;  3C1C D;  3MNN C;  4J8U D;  3NQJ A;  3AZK C;  2CV5 C;  2F8N D;  4DRA A;  3MNN D;  5AV6 A;  5CHL B;  4X23 C;  3AZK D;  2CV5 D;  2Y2L A;  4H9O A;  1ZLA B;  3W97 B;  3TU4 A;  3KUY A;  4Z5T A;  4NE3 A;  5AV6 B;  1M19 C;  3MGR A;  1BFM A;  4XUJ C;  4H9O B;  5AVB C;  3TU4 B;  1P3G C;  2FJ7 A;  5GT0 C;  3KUY B;  1P3B A;  2RVQ C;  2UWX A;  1P3F C;  3A1K A;  4Z5T B;  4QLC A;  1P3G D;  5C3I B;  5BO0 A;  3EPJ A;  3REH A;  5B2J D;  1P3F D;  4J8V C;  5B0Y C;  3AV1 C;  2XD1 A;  2Y2K A;  5CPI A;  3AV1 D;  3AZH A;  2FJ7 B;  1P3B B;  3LEL C;  2Y2Q A;  3AZF C;  5BO0 B;  3O62 A;  5AV9 A;  3REH B;  5B32 A;  4Z66 C; 
#chains in the Genus database with same CATH homology
 2DQN C;  2ZY5 A;  2HIO A;  4E44 A;  3AZF D;  4UUZ A;  1PZR A;  1KX3 B;  1P3I C;  3KWQ A;  4Z66 D;  4Z2M H;  3AZG A;  5CPI B;  3AZH B;  2ZY2 A;  1M1A A;  3NQU A;  1EQZ C;  5B0Z A;  4G92 C;  5DNM A;  1P3P A;  3O62 B;  5AV9 B;  2Y2M A;  5B24 C;  5B32 B;  3LZ1 A;  3WA9 C;  5KDM A;  4JJN A;  1TAF A;  2HIO B;  5BS7 C;  4UUZ B;  1U35 A;  1P34 A;  5B24 D;  3KWQ B;  3UTA C;  2IO5 B;  3MVD D;  1M1A B;  3NQU B;  3P5J B;  5B1L C;  5B0Z B;  5DNM B;  5CP6 C;  3X1V C;  3B0D B;  1P3P B;  4ZBJ B;  5CPK C;  3LZ1 B;  5KDM B;  2Y2P A;  5CP6 D;  1TAF B;  3KXB A;  3X1V D;  1U35 B;  1P34 B;  2W8S A;  3W96 C;  4EO5 C;  5GXQ A;  2CWE A;  4AWL C;  3W98 D;  4R8P A;  3B0C W;  5GSU C;  1BH9 A;  3W96 D;  3WTP A;  3AN2 C;  3REL C;  4WU8 A;  3REJ A;  4KGC A;  1P3A C;  3AFA C;  1T3U A;  3B0C T;  3KXB B;  3REL D;  3AN2 D;  1KX4 C;  3AZI A;  1P3A D;  3WKJ C;  3AFA D;  5GXQ B;  2HUE B;  5JRG A;  3WKJ D;  5BNV A;  4ZUX C;  2NQB C;  3WTP B;  3MVD B;  2YFV A;  5B2I B;  5BT1 C;  4WU8 B;  3REJ B;  4ZUX D;  4KGC B;  2NQB D;  3UT9 A;  3AZE C;  5BT1 D;  3AZI B;  5B1M A;  5GT3 A;  5BNX A;  3REI B;  2DF4 C;  5BNV B;  3VH6 W;  2YFV B;  4H9Q B;  4H9S A;  3AV2 A;  2JSS A;  2G5H C;  1ZLA C;  3W97 C;  2BYM A;  1F1E A;  3UT9 B;  4WJ3 C;  4J8X A;  1P3M A;  3VH6 T;  1ZLA D;  3W97 D;  5B1M B;  1R4V A;  5GT3 B;  3W99 A;  5BNX B;  5AV6 C;  5AVC A;  5F99 A;  3MGQ A;  3LZ0 C;  5AV6 D;  4G91 C;  1JFI A;  5DNN A;  3MGP A;  3TU4 C;  2BYM B;  3VH5 A;  2LY8 A;  3MGS A;  4J8X B;  1P3M B;  3TU4 D;  4Z5T C;  3W99 B;  5C3I C;  3C1B A;  3V9R A;  3KUY D;  5F99 B;  2J8P A;  4Z5T D;  4HGA B;  3AZN A;  3MGQ B;  5E5A A;  1JFI B;  1TZY A;  5DNN B;  3MGP B;  5B32 G;  2FJ7 C;  3UTB A;  1B67 A;  3MGS B;  1P3B C;  5G49 A;  1AOI A;  1A7W A;  2NZD A;  2FJ7 D;  1P3B D;  3V9R B;  3REH C;  4YM6 A;  3AZN B;  1P3L A;  3NQJ B;  1KX3 C;  5E5A B;  3REH D;  1TZY B;  3AZH C;  1KX3 D;  3UTB B;  5G49 B;  1AOI B;  5CPI D;  3AZH D;  2Y2J A;  3O62 C;  1S32 A;  5AV9 C;  3X1S A;  4YM6 B;  2HIO C;  5B2J C;  3O62 D;  5AV9 D;  4H9N A;  5B32 D;  2F8N H;  2IO5 C;  2HIO D;  3WTP E;  3MGR B;  1KX5 A;  3KWQ D;  5B0Z C;  3AZG D;  3B0D C;  1P3P C;  3X1S B;  1M1A D;  3LJA A;  5B0Z D;  3LZ1 C;  4J8U A;  3A6N A;  5DNM D;  1P3P D;  1U35 C;  4H9N B;  1P34 C;  4QLC B;  3LZ1 D;  4JJN D;  4XZQ A;  5B31 A;  1KX5 B;  1U35 D;  1P34 D;  4X23 A;  3R45 A;  3LJA B;  3A6N B;  3KXB C;  4NE5 A;  4WU9 A;  1P3O A;  5GXQ C;  4XZQ B;  3KXB D;  5B31 B;  4H9R A;  4LD9 A;  2HUE C;  5JA4 A;  4X23 B;  3H0L C;  2Y2G A;  3R45 B;  5GXQ D;  5AV8 A;  1M19 A;  3WTP C;  3IP4 C;  3MVD C;  2FFF B;  4XUJ A;  5B2I C;  4UPK A;  4DQY B;  3AZG B;  5AVB A;  3WTP D;  4H9P A;  5AV5 A;  5B2I D;  2ARO A;  3REJ D;  3AZI C;  4WU8 D;  4WU9 B;  5GT0 A;  1P3O B;  4KGC D;  3KSY A;  4JJN B;  3AZI D;  5JA4 B;  4LD9 B;  3REI C;  3X1U A;  4J8V A;  5AV8 B;  3W98 C;  5B0Y A;  3AV1 A;  3REI D;  5AVB B;  4H9P B;  2XD5 A;  5AV5 B;  3UT9 C;  2ARO B;  2Y2H A;  5GT0 B;  3LEL A;  3UT9 D;  4J8W A;  3AZF A;  5B40 A;  3X1U B;  5B1M D;  5GT3 D;  4J8V B;  5FUG A;  4DRB A;  5B0Y B;  3X1T A;  4H9S C;  1P3K A;  3AZJ A;  1P3I A;  4R8P B;  1BH9 B;  4J8X C;  1P3M C;  2JE5 A;  1KU5 A;  3LEL B;  1EQZ A;  3W99 C;  4J8W B;  4J8X D;  1P3M D;  5B40 B;  3AYW A;  5FUG B;  1F66 A;  4HGA C;  3W99 D;  3MGQ C;  3X1T B;  3WA9 A;  5BS7 A;  1P3K B;  3AZJ B;  5F99 D;  3MGP C;  2ZY4 A;  1P3I B;  3UTA A;  5JRG B;  3MGQ D;  3B6G A;  4NE6 A;  3MGS C;  5DNN D;  3MGP D;  1EQZ B;  5B1L A;  4WZS B;  4G92 B;  3MGS D;  5CPK A;  3VH6 A;  3AYW B;  3WA9 B;  1F66 B;  3AZN C;  1WWI A;  5E5A C;  3C1B D;  1TZY C;  3UTA B;  3AZN D;  3B6G B;  1ID3 A;  5E5A D;  3UTB C;  1TZY D;  2ZY3 A;  3AV2 B;  5GSU A;  3UTB D;  3AN2 A;  3REL A;  4YM6 C;  5CPK B;  1AOI D;  3KUY C;  4YM6 D;  1KX4 A;  3WKJ A;  1ID3 B;  5AVC B;  5AY8 A;  3MGR C;  2RIQ A;  5GSU B;  2VQR A;  3MGR D;  5B31 G;  3X1S C;  1W2E A;  3B6F A;  1S32 D;  3AZE A;  3X1S D;  3AZM A;  4E45 A;  4M6B A;  2YFW A;  4QLC C;  4YS3 A;  3REK A;  3C1B B;  4KUD A;  5AY8 B;  4QLC D;  4KHA A;  1KX5 D;  5CPJ A;  5CPI C;  3EPK A;  3LJA C;  2PYO A;  3B6F B;  3A6N C;  1ZLA A;  5B33 A;  3FDD A;  2NZD B;  3AZE B;  4Z2M G;  3AZM B;  3LJA D;  2YFW B;  4YS3 B;  3REK B;  3A6N D;  3WAA A;  4KUD B;  4XZQ C;  5B31 C;  1M18 A;  5B32 C;  1B6W A;  1HTA A;  3H0R C;  1P3L B;  4CAY A;  4KHA B;  1BH8 A;  4XZQ D;  5B31 D;  1HQ3 A;  5CPJ B;  3KWQ C;  3AZG C;  3LZ0 A;  2PYO B;  4X23 D;  5B33 B;  1M1A C;  3F6T A;  4WU9 C;  5DNM C;  1P3O C;  3WAA B;  4ZBJ C;  1S32 B;  2Y2O A;  3AZL A;  1M18 B;  1WWS A;  3C1C A;  2Y2I A;  4WU9 D;  4JJN C;  4LD9 C;  1P3O D;  1H3O A;  4CAY B;  1BH8 B;  5AV8 C;  1HQ3 B;  2F8N A;  3MNN A;  4LD9 D;  3LZ0 B;  3AZK A;  2CV5 A;  4G91 B;  1M19 D;  5AV8 D;  4XUJ D;  5AV5 C;  1Z2C B;  2ARO C;  5AVB D;  3AZL B;  5AV5 D;  1ULY A;  2ARO D;  3C1C B;  4J8U B;  2F2A C;  5GT0 D;  1H3O B;  3X1U C;  2RVQ D;  3EPH A;  2F8N B;  3MNN B;  1KX3 A;  3AZK B;  2CV5 B;  3X1U D;  4J8V D;  3EG5 B;  4R8P C;  5B0Y D;  2Y2N A;  3EPL A;  3REJ C;  4R8P D;  4WU8 C;  4J8W C;  4KGC C;  5B40 C;  3LEL D;  1P3G A;  3X1T C;  4J8W D;  1P3K C;  5B2J A;  5B40 D;  1P3F A;  3AZJ C;  3H0M C;  4H9R B;  5JRG C;  3X1T D;  1P3K D;  1M19 B;  3AZJ D;  4XUJ B;  1P3I D;  5JRG D;  3A1I A;  3AYW C;  1EQZ D;  1P3G B;  1F66 C;  1P3F B;  5B2J B;  5B1M C;  1N1J A;  5GT3 C;  3AYW D;  3WA9 D;  1F66 D;  3KFU G;  3B6G C;  4Z66 A;  3AV2 C;  3AV1 B;  3UTA D;  3B6G D;  3B0B A;  3AV2 D;  5B1L D;  1N1J B;  5CPK D;  3AZF B;  1ID3 C;  5AVC C;  5B24 A;  5F99 C;  2ZM5 A;  4Z66 B;  3AL0 C;  1ID3 D;  5AVC D;  5DNN C;  3MVD A;  5B2I A;  5GSU D;  4NFT A;  5CP6 A;  2BYK A;  3C1B C;  3X1V A;  5AY8 C;  5B24 B;  1KX4 D;  2G5I C;  3REI A;  2JCH A;  5AY8 D;  3W98 A;  4H9Q A;  3W96 A;  3B6F C;  2F8N K;  1AOI C;  2NZD C;  3AZM C;  5B1L B;  4CSR A;  4YS3 C;  4WNN A;  3REK C;  5CP6 B;  2BYK B;  3X1V B;  3B6F D;  4KUD C;  2NZD D;  3AZE D;  3AZM D;  1P3A A;  4YS3 D;  3AFA A;  3REK D;  1P3L C;  4KUD D;  3W98 B;  5CPJ C;  2PYO C;  1P3L D;  3W96 B;  4EO5 B;  4AWL B;  5B33 C;  5CPJ D;  2F8N G;  4CSR B;  4ZUX A;  2PYO D;  4WNN B;  3WAA C;  2NQB A;  1S32 C;  3AN2 B;  5B33 D;  3REL B;  1M18 C;  1P3A B;  3AFA B;  3WAA D;  1M18 D;  1KX4 B;  1HQ3 C;  2L5A A;  3VH5 W;  3WKJ B;  1KX5 C;  1HQ3 D;  4WV4 B;  3LZ0 D;  1Q9C A;  4ZUX B;  3VH5 T;  2NQB B;  3AZL C;  3C1C C;  4J8U C;  3W97 A;  2BG1 A;  3AZL D;  3C1C D;  3MNN C;  4J8U D;  3NQJ A;  3AZK C;  2CV5 C;  2F8N D;  4DRA A;  3MNN D;  5AV6 A;  5CHL B;  4X23 C;  3AZK D;  2CV5 D;  2Y2L A;  4H9O A;  1ZLA B;  3W97 B;  3TU4 A;  3KUY A;  4Z5T A;  4NE3 A;  5AV6 B;  1M19 C;  3MGR A;  1BFM A;  4XUJ C;  4H9O B;  5AVB C;  3TU4 B;  1P3G C;  2FJ7 A;  5GT0 C;  3KUY B;  1P3B A;  2RVQ C;  2UWX A;  1P3F C;  3A1K A;  4Z5T B;  4QLC A;  1P3G D;  5C3I B;  5BO0 A;  3EPJ A;  3REH A;  5B2J D;  1P3F D;  4J8V C;  5B0Y C;  3AV1 C;  2XD1 A;  2Y2K A;  5CPI A;  3AV1 D;  3AZH A;  2FJ7 B;  1P3B B;  3LEL C;  2Y2Q A;  3AZF C;  5BO0 B;  3O62 A;  5AV9 A;  3REH B;  5B32 A;  4Z66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...