4DRBA

The crystal structure of fancm bound mhf complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
98
structure length
98
Chain Sequence
RFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the FANCM-MHF complex reveals physical features for functional assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
molecule keywords Centromere protein S
total genus 38
structure length 98
sequence length 98
chains with identical sequence B, D, E, G, H
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4drbA00
3AZLA 1P3BC 2CV5A 1P3KB 2FJ7D 4M6BA 3WKJB 2RVQD 5GT0D 4X23D 3C1BC 3REIC 3REKB 3MGQC 4Z5TD 5FUGB 5AY8C 4J8XA 4QLCB 3WTPB 1KX3A 4YM6C 3W97A 1Q9CA 4AWLB 5CPJD 3V9RA 3X1UC 3LZ1B 3MGRD 3W99C 3UTBD 3LZ0A 1KX4A 4YM6A 3WTPA 1P3AC 5GSUC 4E44A 4G92B 3REID 2CV5B 1P3KA 5DNMA 1P3OA 3W99A 3AZNA 4J8UD 4YS3A 3AZMC 5CPID 3AV2A 1P3GC 3AZJB 3AZIC 2CV5D 3AZMB 5CPKA 1ID3C 1KX5B 4LD9D 4CSRB 4WU8D 3C1BA 5GT3B 1EQZA 2PYOC 5GSUB 3X1UD 2F8NK 2CV5C 1ULYA 3B6FC 1R4VA 3NQUB 4ZBJC 3W97D 3AFAC 5B0YB 5JRGB 4H9OB 5AVCC 3LZ1C 2HUEC 4KUDB 4EO5C 3AN2B 5CHLB 4KUDA 5B24D 1S32C 5AVCD 2AROB 4J8WC 2IO5C 1HTAA 4Z66D 5JRGD 2BYKB 5B1MA 3AN2D 1P3KC 2NZDD 3NQJB 5E5AD 3AZED 3C1BB 3AZND 3UTAB 1P3FA 2F8NB 2HIOC 3UT9D 2PYOD 5B33C 5AV5B 3UT9C 3REHB 2BYMA 4J8VD 4YS3B 3AZFC 3C1BD 3AZHD 3X1UA 4Z5TB 5CP6A 1P3LB 3AYWA 1ZLAC 5B32C 2LY8A 5BO0A 5AV8D 3W96A 3A6NA 5CPJB 3X1TC 1P3AA 3KXBA 5B32D 1P3MC 1KX4B 3LZ0B 1B6WA 1P3OC 3REHC 3LZ1A 3W98A 5BS7A 3LELC 5DNND 3X1VC 4WU9D 1F66D 4LD9A 3KUYC 3VH5W 3RELC 1P3IC 5JA4A 5B1MD 1KX3C 1H3OB 3W96C 4J8XB 1AOIA 3WAAB 3REKA 5B31A 1N1JA 5AY8D 3AZLB 3AZGB 4J8WB 3VH6T 3AZJD 4R8PB 3UT9A 2NQBC 3AZGC 5B1LC 5B1LB 4KGCB 2FJ7B 3LELD 1U35B 3WKJD 5GT0B 1F1EA 2HUEB 4XUJA 4X23B 4G91C 3KUYD 3RELD 3AZLD 4NE3A 2FJ7A 4R8PD 5CP6D 3AYWD 3WAAC 5AV5D 3AFAD 1P3IB 3O62D 3LELB 4J8WA 4JJNB 4XZQB 3KWQA 3KUYB 3RELB 3LZ0C 5KDMB 1ID3B 3UTBB 1N1JB 4HGAC 5BNVB 3WAAA 4NE5A 1M18B 5AV9B 3AZID 5CPJC 1HQ3A 3MGSD 1P3GD 1M1AB 1EQZC 3MGPD 5B32B 3MGQD 4H9QA 3W98B 1WWSA 4YM6D 3TU4D 4YS3C 5F99B 4WU9B 5CPIB 1P3BA 1P3AB 4ZUXC 3MGRA 5E5AC 5BO0B 5B2JC 4WZSB 1KX5D 4XUJC 1P3LA 3AZKA 3VH5T 5B2ID 1P34A 5GSUD 3X1UB 3LJAA 2BYMB 3R45A 5B31D 5B40B 1TZYA 3REJA 4WU8A 3WA9D 3O62A 3MGRB 3UTAA 5BT1D 5B0ZA 2AROC 3MVDA 1S32A 5CPIA 1P3BB 5AVCB 1KU5A 2AROD 5B1MB 1M19B 5AVBD 4H9QB 5GXQA 5B2JB 4ZBJB 3X1SA 5GT3C 5E5AB 3B0DC 3B0CT 3AV1B 1M18A 4J8WD 2YFVA 5BNXB 5F99C 4Z66A 3AZIB 5JRGA 3W98C 1P3GB 5KDMA 5CPKC 4QLCD 1ID3A 3B6FA 3B6GA 1ZLAD 1U35D 2F8NH 2JSSA 1M18C 5GSUA 1HQ3D 3AZKC 1P34C 5GT3A 1EQZB 3UTBC 4CSRA 1KX5A 5AV6B 1TAFB 2NQBD 5CPKB 3WTPE 5DNMC 5C3IC 4X23A 1BH8B 4H9SC 5GT0A 4JJND 2NZDA 3AZNC 2F8NG 5G49A 4JJNC 4H9NA 3MNNC 5B0ZC 5AV6D 3MVDC 3W99B 3AZGA 3O62C 5B1MC 1U35C 5DNNB 1F66B 4G91B 3WTPC 4H9RA 5GT0C 4X23C 3AZKD 1P34D 3W98D 2FJ7C 1H3OA 3AZLC 4YM6B 5JA4B 4LD9B 4R8PC 5AY8B 3REIA 3REIB 1P3AD 3B6FD 5AVBB 4J8XC 3W97B 3WKJC 3B6GC 5B0ZD 3MVDD 1KX3B 1AOID 5B2JD 4QLCA 4YS3D 4J8UA 5FUGA 4H9RB 5CPJA 3LZ1D 3W96B 3AV2D 5DNNA 1F66A 5GXQD 3WKJA 3MGPC 3AYWB 5CPIC 5CP6B 4H9PB 3AZMD 5GXQC 3X1VA 3X1TB 5G49B 3C1CB 1P3PB 3REHA 5AV5A 2NZDB 2NZDC 1ID3D 3MGSC 1BH8A 1EQZD 3B6GD 5B31C 3C1CC 3AYWC 3KWQC 1P3PC 1ZLAA 3AFAA 5AV6A 1M1AD 1P3LC 3NQJA 3MGPB 4KUDD 4XUJD 3VH5A 2NQBA 5B24B 2BYKA 3B6GB 3TU4B 5AV5C 3WAAD 5F99D 4Z66B 5BNXA 3AZIA 3VH6W 3W97C 3AN2A 3UTAC 5E5AA 4Z2MH 2IO5B 3VH6A 1P3FC 3TU4A 4LD9C 3AZEC 5B24A 3NQUA 2NQBB 4KUDC 3MGPA 4J8VA 3WA9C 1S32B 3MGQA 5JRGC 5DNNC 5B0ZB 3MVDB 3X1VD 1F66C 4EO5B 3AN2C 3AFAB 1P3ID 3AZHB 1HQ3C 1B67A 3O62B 3AZMA 4WU8B 1P3LD 3A6NC 4XZQD 3MNNB 1TZYC 3REJC 3AV2B 5B40A 1P3BD 4ZUXD 3R45B 3A6ND 3AZNB 3X1VB 3KXBC 1TZYD 3REJD 3AZKB 4H9PA 1P34B 3X1TD 4WNNB 2L5AA 5DNMB 3AZJC 1P3OB 5AV8C 2PYOB 5AV6C 3AZFD 5B1LD 4KGCD 4KHAA 4J8UB 3AV1C 4J8XD 5AVBA 5B33D 1KX3D 4UUZA 3V9RB 5AV8A 5AY8A 3W96D 4CAYB 3B0DB 1BH9B 3REKD 3KXBD 1M19C 1M1AA 1HQ3B 3LZ0D 5AV9A 5B33B 5B31G 3WTPD 5BNVA 1A7WA 3UTBA 4AWLC 3KUYA 3RELA 4XZQA 3LELA 1JFIB 4H9NB 4ZUXA 3MGRC 5B40C 2HIOA 3W99D 3REKC 3AZGD 4XUJB 3AZFA 1TAFA 5B32G 4KGCA 3MNND 1BFMA 4ZUXB 2F8ND 5B0YC 3MGSA 1WWIA 4WU9C 3B6FB 1P3GA 5B31B 2YFVB 5B40D 1P3MA 4NFTA 1AOIB 5B33A 3AV1A 1KX5C 3B0BA 3X1SB 1BH9A 5B2JA 3KWQD 4CAYA 5AV9C 4J8UC 2CWEA 5GXQB 5AV8B 4UUZB 5CP6C 1M19A 4HGAB 1M1AC 5AV9D 5B0YD 3C1CD 5AVCA 1P3PD 4Z2MG 4XZQC 3KXBB 3AV2C 4NE6A 3A6NB 2YFWB 4KHAB 5B2IA 4WU8C 4G92C 4WV4B 3AZHC 4DRAA 1TZYB 3REJB 2HIOD 4WNNA 2PYOA 3AZEA 4Z5TA 3WA9B 5BS7C 1P3FD 3LJAB 4KGCC 4J8VC 5B2IC 3WA9A 3AZEB 3UTAD 3MNNA 5B2IB 2F8NA 2YFWA 4QLCC 3AZHA 1P3FB 3LJAD 3REHD 3MGQB 4WU9A 5F99A 4Z66C 4J8VB 3LJAC 3TU4C 1P3MD 3B0CW 5B32A 2AROA 5C3IB 5B24C 1S32D 4E45A 1M19D 1P3MB 1KX4D 4H9OA 4H9SA 3X1SD 5B0YA 5BT1C 3KSYA 3KWQB 1M18D 1KX4C 3X1SC 2RVQC 4JJNA 3MGSB 3AV1D 1P3IA 4Z5TC 5DNMD 1P3OD 4DRBA 3AZFB 1AOIC 1ZLAB 1P3KD 3AZJA 5GT3D 1U35A 5B1LA 3C1CA 2HIOB 1P3PA 3UT9B 3X1TA 5AVBC 4R8PA 5CPKD 1JFIA
chains in the Genus database with same CATH superfamily
3AZLA 1P3BC 2CV5A 1P3KB 2FJ7D 4M6BA 3WKJB 2RVQD 5GT0D 2Y2PA 4X23D 3C1BC 3REIC 3REKB 3MGQC 4Z5TD 2W8SA 5FUGB 5AY8C 4J8XA 4QLCB 3WTPB 2JCHA 1KX3A 4YM6C 3W97A 1Q9CA 4AWLB 5CPJD 3V9RA 3X1UC 3LZ1B 3MGRD 3KFUG 1W2EA 3W99C 3UTBD 3LZ0A 1KX4A 4YM6A 3WTPA 1P3AC 5GSUC 4E44A 4G92B 3REID 2CV5B 1P3KA 5DNMA 1P3OA 3W99A 3AZNA 4J8UD 4YS3A 3AZMC 5CPID 3AV2A 1P3GC 3AZJB 3AZIC 2CV5D 3AZMB 5CPKA 1ID3C 1KX5B 4LD9D 4CSRB 4WU8D 3C1BA 2Y2GA 5GT3B 1EQZA 2PYOC 5GSUB 3X1UD 2F8NK 2CV5C 1ULYA 2J8PA 3F6TA 3B6FC 1R4VA 3NQUB 4ZBJC 3W97D 2Y2KA 3AFAC 5B0YB 5JRGB 4H9OB 5AVCC 3LZ1C 2HUEC 4KUDB 4EO5C 3AN2B 5CHLB 4KUDA 5B24D 1S32C 5AVCD 2AROB 1T3UA 2Y2HA 4J8WC 2IO5C 1HTAA 4Z66D 5JRGD 2BYKB 5B1MA 3AN2D 1P3KC 2NZDD 3NQJB 5E5AD 3AZED 3C1BB 3AZND 3UTAB 4UPKA 1P3FA 2ZY2A 2F8NB 2HIOC 3UT9D 2PYOD 5B33C 5AV5B 3UT9C 3REHB 2BYMA 4J8VD 4YS3B 3AZFC 3C1BD 3AZHD 3X1UA 4Z5TB 5CP6A 1P3LB 3AYWA 1ZLAC 5B32C 3FDDA 2LY8A 5BO0A 5AV8D 3W96A 3A6NA 5CPJB 3X1TC 1P3AA 2DQNC 3KXBA 5B32D 1P3MC 1KX4B 3LZ0B 1B6WA 1P3OC 3REHC 3LZ1A 3W98A 5BS7A 3LELC 5DNND 3X1VC 4WU9D 1F66D 4LD9A 3KUYC 3VH5W 3RELC 1P3IC 5JA4A 5B1MD 1KX3C 1H3OB 3W96C 4J8XB 1AOIA 3WAAB 3REKA 5B31A 1N1JA 5AY8D 3AZLB 3AZGB 4J8WB 3VH6T 2JE5A 3AZJD 4R8PB 3UT9A 2NQBC 3AZGC 5B1LC 5B1LB 4KGCB 2FJ7B 3LELD 1U35B 2FFFB 3WKJD 5GT0B 1F1EA 2HUEB 4XUJA 4X23B 4G91C 3KUYD 3RELD 3AZLD 3H0MC 4NE3A 2FJ7A 1PZRA 4R8PD 5CP6D 3AYWD 3WAAC 5AV5D 3AFAD 1P3IB 3O62D 2XD1A 3LELB 4J8WA 4JJNB 2UWXA 4XZQB 3KWQA 3KUYB 3RELB 3LZ0C 5KDMB 1ID3B 3UTBB 1N1JB 4HGAC 5BNVB 3IP4C 3WAAA 4NE5A 1M18B 5AV9B 2Y2OA 2Y2LA 3AZID 5CPJC 1HQ3A 2RIQA 3MGSD 1P3GD 1M1AB 1EQZC 3MGPD 5B32B 3MGQD 2Y2IA 4H9QA 3W98B 1WWSA 4YM6D 3TU4D 4YS3C 5F99B 4WU9B 5CPIB 1P3BA 1P3AB 4ZUXC 3MGRA 5E5AC 5BO0B 5B2JC 4WZSB 1KX5D 4XUJC 2Y2MA 1P3LA 3AZKA 3VH5T 5B2ID 1P34A 5GSUD 3X1UB 3LJAA 2BYMB 3R45A 5B31D 5B40B 1TZYA 3REJA 3A1IA 4WU8A 3WA9D 3O62A 3MGRB 3UTAA 5BT1D 5B0ZA 2AROC 3MVDA 1S32A 5CPIA 1P3BB 5AVCB 3EPJA 1KU5A 2AROD 3EG5B 5B1MB 1M19B 3EPKA 5AVBD 4H9QB 5GXQA 5B2JB 4ZBJB 3X1SA 5GT3C 5E5AB 3B0DC 3B0CT 3AV1B 1M18A 4J8WD 2YFVA 5BNXB 5F99C 4Z66A 3AZIB 5JRGA 3W98C 1P3GB 5KDMA 5CPKC 4QLCD 1ID3A 3B6FA 3B6GA 1ZLAD 1Z2CB 1U35D 2F8NH 2JSSA 1M18C 5GSUA 1HQ3D 3AZKC 1P34C 5GT3A 1EQZB 3UTBC 4CSRA 1KX5A 5AV6B 1TAFB 2NQBD 5CPKB 3WTPE 5DNMC 3P5JB 5C3IC 5GT0A 1BH8B 4H9SC 4X23A 4JJND 2NZDA 3AZNC 2F8NG 5G49A 4JJNC 4H9NA 3MNNC 5B0ZC 5AV6D 3MVDC 3W99B 3AZGA 3O62C 5B1MC 1U35C 5DNNB 1F66B 4G91B 3WTPC 4H9RA 5GT0C 4X23C 3AZKD 1P34D 3W98D 2FJ7C 1H3OA 3AZLC 4YM6B 5JA4B 4LD9B 4R8PC 5AY8B 3REIA 3REIB 1P3AD 3B6FD 5AVBB 4J8XC 3W97B 3WKJC 3B6GC 5B0ZD 3MVDD 1KX3B 1AOID 5B2JD 4QLCA 4YS3D 4J8UA 5FUGA 4H9RB 5CPJA 3LZ1D 3W96B 3AV2D 5DNNA 1F66A 3AL0C 5GXQD 3WKJA 3MGPC 3AYWB 5CPIC 5CP6B 4H9PB 3AZMD 5GXQC 3X1VA 3X1TB 5G49B 3EPHA 3C1CB 1P3PB 3REHA 5AV5A 2NZDB 2NZDC 1ID3D 3MGSC 1BH8A 1EQZD 3B6GD 5B31C 3C1CC 3AYWC 2ZY3A 3KWQC 1P3PC 1ZLAA 3AFAA 5AV6A 1M1AD 1P3LC 3NQJA 3MGPB 2ZM5A 4KUDD 4XUJD 3VH5A 2NQBA 5B24B 2BYKA 3B6GB 3TU4B 5AV5C 3WAAD 3H0LC 5F99D 5BNXA 4Z66B 3AZIA 3VH6W 2XD5A 3W97C 3AN2A 3UTAC 5E5AA 4Z2MH 2IO5B 3VH6A 1P3FC 3TU4A 4LD9C 3AZEC 5B24A 3NQUA 2NQBB 4KUDC 3MGPA 4J8VA 3WA9C 1S32B 3MGQA 5JRGC 5DNNC 5B0ZB 3MVDB 3X1VD 1F66C 4EO5B 3AN2C 3AFAB 1P3ID 3AZHB 1HQ3C 1B67A 3O62B 3AZMA 4WU8B 1P3LD 3A6NC 4XZQD 3MNNB 1TZYC 3REJC 3AV2B 5B40A 1P3BD 4ZUXD 3R45B 3A6ND 3AZNB 2G5HC 3X1VB 3KXBC 1TZYD 3REJD 3A1KA 4H9PA 3AZKB 3X1TD 4WNNB 2BG1A 2L5AA 5DNMB 3AZJC 5AV8C 1P3OB 2PYOB 5AV6C 3AZFD 5B1LD 2Y2JA 4KGCD 4KHAA 4J8UB 3AV1C 4J8XD 5AVBA 5B33D 1KX3D 4UUZA 3V9RB 5AV8A 5AY8A 3W96D 4CAYB 3B0DB 1BH9B 3REKD 3KXBD 1M19C 1M1AA 1HQ3B 3LZ0D 4DQYB 5AV9A 5B33B 5B31G 3EPLA 3WTPD 5BNVA 1A7WA 3UTBA 4WJ3C 4AWLC 3KUYA 3RELA 4XZQA 3LELA 1JFIB 4H9NB 4ZUXA 3MGRC 5B40C 2VQRA 2HIOA 3W99D 3REKC 3AZGD 4XUJB 3AZFA 1TAFA 5B32G 4KGCA 3MNND 1BFMA 4ZUXB 2F8ND 5B0YC 3MGSA 1WWIA 1P34B 4WU9C 3B6FB 1P3GA 5B31B 2YFVB 5B40D 2Y2NA 1P3MA 4NFTA 1AOIB 5B33A 3AV1A 1KX5C 3B0BA 3X1SB 1BH9A 5B2JA 3KWQD 4CAYA 5AV9C 4J8UC 2CWEA 5GXQB 5AV8B 4UUZB 5CP6C 1M19A 4HGAB 1M1AC 5AV9D 5B0YD 3C1CD 2G5IC 5AVCA 1P3PD 4Z2MG 4XZQC 3KXBB 3AV2C 4NE6A 2ZY4A 2YFWB 3A6NB 4KHAB 5B2IA 4WU8C 2ZY5A 4WV4B 4G92C 3AZHC 4DRAA 1TZYB 3REJB 2DF4C 2HIOD 4WNNA 2PYOA 3AZEA 4Z5TA 3WA9B 5BS7C 1P3FD 3LJAB 4KGCC 4J8VC 2Y2QA 5B2IC 3WA9A 3AZEB 3UTAD 3MNNA 5B2IB 2F8NA 2YFWA 4QLCC 3AZHA 1P3FB 3LJAD 3REHD 3MGQB 4WU9A 5F99A 4Z66C 4J8VB 3LJAC 3TU4C 1P3MD 3B0CW 5B32A 2AROA 3H0RC 5C3IB 5B24C 1S32D 4E45A 1M19D 1P3MB 1KX4D 4H9OA 4H9SA 3X1SD 5B0YA 5BT1C 3KSYA 3KWQB 1M18D 1KX4C 3X1SC 2RVQC 4JJNA 3MGSB 3AV1D 1P3IA 2F2AC 4Z5TC 5DNMD 1P3OD 4DRBA 3AZFB 1AOIC 1ZLAB 1P3KD 3AZJA 5GT3D 1U35A 5B1LA 3C1CA 2HIOB 1P3PA 3UT9B 3X1TA 5AVBC 4R8PA 5CPKD 1JFIA
chains in the Genus database with same CATH topology
3AZLA 1P3BC 2CV5A 1P3KB 2FJ7D 4M6BA 3WKJB 2RVQD 5GT0D 2Y2PA 4X23D 3C1BC 3REIC 3REKB 3MGQC 4Z5TD 2W8SA 5FUGB 5AY8C 4J8XA 4QLCB 3WTPB 2JCHA 1KX3A 4YM6C 3W97A 1Q9CA 4AWLB 5CPJD 3V9RA 3X1UC 3LZ1B 3MGRD 3KFUG 1W2EA 3W99C 3UTBD 3LZ0A 1KX4A 4YM6A 3WTPA 1P3AC 5GSUC 4E44A 4G92B 3REID 2CV5B 1P3KA 5DNMA 1P3OA 3W99A 3AZNA 4J8UD 4YS3A 3AZMC 5CPID 3AV2A 1P3GC 3AZJB 3AZIC 2CV5D 3AZMB 5CPKA 1ID3C 1KX5B 4LD9D 4CSRB 4WU8D 3C1BA 2Y2GA 5GT3B 1EQZA 2PYOC 5GSUB 3X1UD 2F8NK 2CV5C 1ULYA 2J8PA 3F6TA 3B6FC 1R4VA 3NQUB 4ZBJC 3W97D 2Y2KA 3AFAC 5B0YB 5JRGB 4H9OB 5AVCC 3LZ1C 2HUEC 4KUDB 4EO5C 3AN2B 5CHLB 4KUDA 5B24D 1S32C 5AVCD 2AROB 1T3UA 2Y2HA 4J8WC 2IO5C 1HTAA 4Z66D 5JRGD 2BYKB 5B1MA 3AN2D 1P3KC 2NZDD 3NQJB 5E5AD 3AZED 3C1BB 3AZND 3UTAB 4UPKA 1P3FA 2ZY2A 2F8NB 2HIOC 3UT9D 2PYOD 5B33C 5AV5B 3UT9C 3REHB 2BYMA 4J8VD 4YS3B 3AZFC 3C1BD 3AZHD 3X1UA 4Z5TB 5CP6A 1P3LB 3AYWA 1ZLAC 5B32C 3FDDA 2LY8A 5BO0A 5AV8D 3W96A 3A6NA 5CPJB 3X1TC 1P3AA 2DQNC 3KXBA 5B32D 1P3MC 1KX4B 3LZ0B 1B6WA 1P3OC 3REHC 3LZ1A 3W98A 5BS7A 3LELC 5DNND 3X1VC 4WU9D 1F66D 4LD9A 3KUYC 3VH5W 3RELC 1P3IC 5JA4A 5B1MD 1KX3C 1H3OB 3W96C 4J8XB 1AOIA 3WAAB 3REKA 5B31A 1N1JA 5AY8D 3AZLB 3AZGB 4J8WB 3VH6T 2JE5A 3AZJD 4R8PB 3UT9A 2NQBC 3AZGC 5B1LC 5B1LB 4KGCB 2FJ7B 3LELD 1U35B 2FFFB 3WKJD 5GT0B 1F1EA 2HUEB 4XUJA 4X23B 4G91C 3KUYD 3RELD 3AZLD 3H0MC 4NE3A 2FJ7A 1PZRA 4R8PD 5CP6D 3AYWD 3WAAC 5AV5D 3AFAD 1P3IB 3O62D 2XD1A 3LELB 4J8WA 4JJNB 2UWXA 4XZQB 3KWQA 3KUYB 3RELB 3LZ0C 5KDMB 1ID3B 3UTBB 1N1JB 4HGAC 5BNVB 3IP4C 3WAAA 4NE5A 1M18B 5AV9B 2Y2OA 2Y2LA 3AZID 5CPJC 1HQ3A 2RIQA 3MGSD 1P3GD 1M1AB 1EQZC 3MGPD 5B32B 3MGQD 2Y2IA 4H9QA 3W98B 1WWSA 4YM6D 3TU4D 4YS3C 5F99B 4WU9B 5CPIB 1P3BA 1P3AB 4ZUXC 3MGRA 5E5AC 5BO0B 5B2JC 4WZSB 1KX5D 4XUJC 2Y2MA 1P3LA 3AZKA 3VH5T 5B2ID 1P34A 5GSUD 3X1UB 3LJAA 2BYMB 3R45A 5B31D 5B40B 1TZYA 3REJA 3A1IA 4WU8A 3WA9D 3O62A 3MGRB 3UTAA 5BT1D 5B0ZA 2AROC 3MVDA 1S32A 5CPIA 1P3BB 5AVCB 3EPJA 1KU5A 2AROD 3EG5B 5B1MB 1M19B 3EPKA 5AVBD 4H9QB 5GXQA 5B2JB 4ZBJB 3X1SA 5GT3C 5E5AB 3B0DC 3B0CT 3AV1B 1M18A 4J8WD 2YFVA 5BNXB 5F99C 4Z66A 3AZIB 5JRGA 3W98C 1P3GB 5KDMA 5CPKC 4QLCD 1ID3A 3B6FA 3B6GA 1ZLAD 1Z2CB 1U35D 2F8NH 2JSSA 1M18C 5GSUA 1HQ3D 3AZKC 1P34C 5GT3A 1EQZB 3UTBC 4CSRA 1KX5A 5AV6B 1TAFB 2NQBD 5CPKB 3WTPE 5DNMC 3P5JB 5C3IC 5GT0A 1BH8B 4H9SC 4X23A 4JJND 2NZDA 3AZNC 2F8NG 5G49A 4JJNC 4H9NA 3MNNC 5B0ZC 5AV6D 3MVDC 3W99B 3AZGA 3O62C 5B1MC 1U35C 5DNNB 1F66B 4G91B 3WTPC 4H9RA 5GT0C 4X23C 3AZKD 1P34D 3W98D 2FJ7C 1H3OA 3AZLC 4YM6B 5JA4B 4LD9B 4R8PC 5AY8B 3REIA 3REIB 1P3AD 3B6FD 5AVBB 4J8XC 3W97B 3WKJC 3B6GC 5B0ZD 3MVDD 1KX3B 1AOID 5B2JD 4QLCA 4YS3D 4J8UA 5FUGA 4H9RB 5CPJA 3LZ1D 3W96B 3AV2D 5DNNA 1F66A 3AL0C 5GXQD 3WKJA 3MGPC 3AYWB 5CPIC 5CP6B 4H9PB 3AZMD 5GXQC 3X1VA 3X1TB 5G49B 3EPHA 3C1CB 1P3PB 3REHA 5AV5A 2NZDB 2NZDC 1ID3D 3MGSC 1BH8A 1EQZD 3B6GD 5B31C 3C1CC 3AYWC 2ZY3A 3KWQC 1P3PC 1ZLAA 3AFAA 5AV6A 1M1AD 1P3LC 3NQJA 3MGPB 2ZM5A 4KUDD 4XUJD 3VH5A 2NQBA 5B24B 2BYKA 3B6GB 3TU4B 5AV5C 3WAAD 3H0LC 5F99D 5BNXA 4Z66B 3AZIA 3VH6W 2XD5A 3W97C 3AN2A 3UTAC 5E5AA 4Z2MH 2IO5B 3VH6A 1P3FC 3TU4A 4LD9C 3AZEC 5B24A 3NQUA 2NQBB 4KUDC 3MGPA 4J8VA 3WA9C 1S32B 3MGQA 5JRGC 5DNNC 5B0ZB 3MVDB 3X1VD 1F66C 4EO5B 3AN2C 3AFAB 1P3ID 3AZHB 1HQ3C 1B67A 3O62B 3AZMA 4WU8B 1P3LD 3A6NC 4XZQD 3MNNB 1TZYC 3REJC 3AV2B 5B40A 1P3BD 4ZUXD 3R45B 3A6ND 3AZNB 2G5HC 3X1VB 3KXBC 1TZYD 3REJD 3A1KA 4H9PA 3AZKB 3X1TD 4WNNB 2BG1A 2L5AA 5DNMB 3AZJC 5AV8C 1P3OB 2PYOB 5AV6C 3AZFD 5B1LD 2Y2JA 4KGCD 4KHAA 4J8UB 3AV1C 4J8XD 5AVBA 5B33D 1KX3D 4UUZA 3V9RB 5AV8A 5AY8A 3W96D 4CAYB 3B0DB 1BH9B 3REKD 3KXBD 1M19C 1M1AA 1HQ3B 3LZ0D 4DQYB 5AV9A 5B33B 5B31G 3EPLA 3WTPD 5BNVA 1A7WA 3UTBA 4WJ3C 4AWLC 3KUYA 3RELA 4XZQA 3LELA 1JFIB 4H9NB 4ZUXA 3MGRC 5B40C 2VQRA 2HIOA 3W99D 3REKC 3AZGD 4XUJB 3AZFA 1TAFA 5B32G 4KGCA 3MNND 1BFMA 4ZUXB 2F8ND 5B0YC 3MGSA 1WWIA 1P34B 4WU9C 3B6FB 1P3GA 5B31B 2YFVB 5B40D 2Y2NA 1P3MA 4NFTA 1AOIB 5B33A 3AV1A 1KX5C 3B0BA 3X1SB 1BH9A 5B2JA 3KWQD 4CAYA 5AV9C 4J8UC 2CWEA 5GXQB 5AV8B 4UUZB 5CP6C 1M19A 4HGAB 1M1AC 5AV9D 5B0YD 3C1CD 2G5IC 5AVCA 1P3PD 4Z2MG 4XZQC 3KXBB 3AV2C 4NE6A 2ZY4A 2YFWB 3A6NB 4KHAB 5B2IA 4WU8C 2ZY5A 4WV4B 4G92C 3AZHC 4DRAA 1TZYB 3REJB 2DF4C 2HIOD 4WNNA 2PYOA 3AZEA 4Z5TA 3WA9B 5BS7C 1P3FD 3LJAB 4KGCC 4J8VC 2Y2QA 5B2IC 3WA9A 3AZEB 3UTAD 3MNNA 5B2IB 2F8NA 2YFWA 4QLCC 3AZHA 1P3FB 3LJAD 3REHD 3MGQB 4WU9A 5F99A 4Z66C 4J8VB 3LJAC 3TU4C 1P3MD 3B0CW 5B32A 2AROA 3H0RC 5C3IB 5B24C 1S32D 4E45A 1M19D 1P3MB 1KX4D 4H9OA 4H9SA 3X1SD 5B0YA 5BT1C 3KSYA 3KWQB 1M18D 1KX4C 3X1SC 2RVQC 4JJNA 3MGSB 3AV1D 1P3IA 2F2AC 4Z5TC 5DNMD 1P3OD 4DRBA 3AZFB 1AOIC 1ZLAB 1P3KD 3AZJA 5GT3D 1U35A 5B1LA 3C1CA 2HIOB 1P3PA 3UT9B 3X1TA 5AVBC 4R8PA 5CPKD 1JFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL A;  1P3B C;  2CV5 A;  1P3K B;  2FJ7 D;  4M6B A;  3WKJ B;  2RVQ D;  5GT0 D;  4X23 D;  3C1B C;  3REI C;  3REK B;  3MGQ C;  4Z5T D;  5FUG B;  5AY8 C;  4J8X A;  4QLC B;  3WTP B;  1KX3 A;  4YM6 C;  3W97 A;  1Q9C A;  4AWL B;  5CPJ D;  3V9R A;  3X1U C;  3LZ1 B;  3MGR D;  3W99 C;  3UTB D;  3LZ0 A;  1KX4 A;  4YM6 A;  3WTP A;  1P3A C;  5GSU C;  4E44 A;  4G92 B;  3REI D;  2CV5 B;  1P3K A;  5DNM A;  1P3O A;  3W99 A;  3AZN A;  4J8U D;  4YS3 A;  3AZM C;  5CPI D;  3AV2 A;  1P3G C;  3AZJ B;  3AZI C;  2CV5 D;  3AZM B;  5CPK A;  1ID3 C;  1KX5 B;  4LD9 D;  4CSR B;  4WU8 D;  3C1B A;  5GT3 B;  1EQZ A;  2PYO C;  5GSU B;  3X1U D;  2F8N K;  2CV5 C;  1ULY A;  3B6F C;  1R4V A;  3NQU B;  4ZBJ C;  3W97 D;  3AFA C;  5B0Y B;  5JRG B;  4H9O B;  5AVC C;  3LZ1 C;  2HUE C;  4KUD B;  4EO5 C;  3AN2 B;  5CHL B;  4KUD A;  5B24 D;  1S32 C;  5AVC D;  2ARO B;  4J8W C;  2IO5 C;  1HTA A;  4Z66 D;  5JRG D;  2BYK B;  5B1M A;  3AN2 D;  1P3K C;  2NZD D;  3NQJ B;  5E5A D;  3AZE D;  3C1B B;  3AZN D;  3UTA B;  1P3F A;  2F8N B;  2HIO C;  3UT9 D;  2PYO D;  5B33 C;  5AV5 B;  3UT9 C;  3REH B;  2BYM A;  4J8V D;  4YS3 B;  3AZF C;  3C1B D;  3AZH D;  3X1U A;  4Z5T B;  5CP6 A;  1P3L B;  3AYW A;  1ZLA C;  5B32 C;  2LY8 A;  5BO0 A;  5AV8 D;  3W96 A;  3A6N A;  5CPJ B;  3X1T C;  1P3A A;  3KXB A;  5B32 D;  1P3M C;  1KX4 B;  3LZ0 B;  1B6W A;  1P3O C;  3REH C;  3LZ1 A;  3W98 A;  5BS7 A;  3LEL C;  5DNN D;  3X1V C;  4WU9 D;  1F66 D;  4LD9 A;  3KUY C;  3VH5 W;  3REL C;  1P3I C;  5JA4 A;  5B1M D;  1KX3 C;  1H3O B;  3W96 C;  4J8X B;  1AOI A;  3WAA B;  3REK A;  5B31 A;  1N1J A;  5AY8 D;  3AZL B;  3AZG B;  4J8W B;  3VH6 T;  3AZJ D;  4R8P B;  3UT9 A;  2NQB C;  3AZG C;  5B1L C;  5B1L B;  4KGC B;  2FJ7 B;  3LEL D;  1U35 B;  3WKJ D;  5GT0 B;  1F1E A;  2HUE B;  4XUJ A;  4X23 B;  4G91 C;  3KUY D;  3REL D;  3AZL D;  4NE3 A;  2FJ7 A;  4R8P D;  5CP6 D;  3AYW D;  3WAA C;  5AV5 D;  3AFA D;  1P3I B;  3O62 D;  3LEL B;  4J8W A;  4JJN B;  4XZQ B;  3KWQ A;  3KUY B;  3REL B;  3LZ0 C;  5KDM B;  1ID3 B;  3UTB B;  1N1J B;  4HGA C;  5BNV B;  3WAA A;  4NE5 A;  1M18 B;  5AV9 B;  3AZI D;  5CPJ C;  1HQ3 A;  3MGS D;  1P3G D;  1M1A B;  1EQZ C;  3MGP D;  5B32 B;  3MGQ D;  4H9Q A;  3W98 B;  1WWS A;  4YM6 D;  3TU4 D;  4YS3 C;  5F99 B;  4WU9 B;  5CPI B;  1P3B A;  1P3A B;  4ZUX C;  3MGR A;  5E5A C;  5BO0 B;  5B2J C;  4WZS B;  1KX5 D;  4XUJ C;  1P3L A;  3AZK A;  3VH5 T;  5B2I D;  1P34 A;  5GSU D;  3X1U B;  3LJA A;  2BYM B;  3R45 A;  5B31 D;  5B40 B;  1TZY A;  3REJ A;  4WU8 A;  3WA9 D;  3O62 A;  3MGR B;  3UTA A;  5BT1 D;  5B0Z A;  2ARO C;  3MVD A;  1S32 A;  5CPI A;  1P3B B;  5AVC B;  1KU5 A;  2ARO D;  5B1M B;  1M19 B;  5AVB D;  4H9Q B;  5GXQ A;  5B2J B;  4ZBJ B;  3X1S A;  5GT3 C;  5E5A B;  3B0D C;  3B0C T;  3AV1 B;  1M18 A;  4J8W D;  2YFV A;  5BNX B;  5F99 C;  4Z66 A;  3AZI B;  5JRG A;  3W98 C;  1P3G B;  5KDM A;  5CPK C;  4QLC D;  1ID3 A;  3B6F A;  3B6G A;  1ZLA D;  1U35 D;  2F8N H;  2JSS A;  1M18 C;  5GSU A;  1HQ3 D;  3AZK C;  1P34 C;  5GT3 A;  1EQZ B;  3UTB C;  4CSR A;  1KX5 A;  5AV6 B;  1TAF B;  2NQB D;  5CPK B;  3WTP E;  5DNM C;  5C3I C;  4X23 A;  1BH8 B;  4H9S C;  5GT0 A;  4JJN D;  2NZD A;  3AZN C;  2F8N G;  5G49 A;  4JJN C;  4H9N A;  3MNN C;  5B0Z C;  5AV6 D;  3MVD C;  3W99 B;  3AZG A;  3O62 C;  5B1M C;  1U35 C;  5DNN B;  1F66 B;  4G91 B;  3WTP C;  4H9R A;  5GT0 C;  4X23 C;  3AZK D;  1P34 D;  3W98 D;  2FJ7 C;  1H3O A;  3AZL C;  4YM6 B;  5JA4 B;  4LD9 B;  4R8P C;  5AY8 B;  3REI A;  3REI B;  1P3A D;  3B6F D;  5AVB B;  4J8X C;  3W97 B;  3WKJ C;  3B6G C;  5B0Z D;  3MVD D;  1KX3 B;  1AOI D;  5B2J D;  4QLC A;  4YS3 D;  4J8U A;  5FUG A;  4H9R B;  5CPJ A;  3LZ1 D;  3W96 B;  3AV2 D;  5DNN A;  1F66 A;  5GXQ D;  3WKJ A;  3MGP C;  3AYW B;  5CPI C;  5CP6 B;  4H9P B;  3AZM D;  5GXQ C;  3X1V A;  3X1T B;  5G49 B;  3C1C B;  1P3P B;  3REH A;  5AV5 A;  2NZD B;  2NZD C;  1ID3 D;  3MGS C;  1BH8 A;  1EQZ D;  3B6G D;  5B31 C;  3C1C C;  3AYW C;  3KWQ C;  1P3P C;  1ZLA A;  3AFA A;  5AV6 A;  1M1A D;  1P3L C;  3NQJ A;  3MGP B;  4KUD D;  4XUJ D;  3VH5 A;  2NQB A;  5B24 B;  2BYK A;  3B6G B;  3TU4 B;  5AV5 C;  3WAA D;  5F99 D;  4Z66 B;  5BNX A;  3AZI A;  3VH6 W;  3W97 C;  3AN2 A;  3UTA C;  5E5A A;  4Z2M H;  2IO5 B;  3VH6 A;  1P3F C;  3TU4 A;  4LD9 C;  3AZE C;  5B24 A;  3NQU A;  2NQB B;  4KUD C;  3MGP A;  4J8V A;  3WA9 C;  1S32 B;  3MGQ A;  5JRG C;  5DNN C;  5B0Z B;  3MVD B;  3X1V D;  1F66 C;  4EO5 B;  3AN2 C;  3AFA B;  1P3I D;  3AZH B;  1HQ3 C;  1B67 A;  3O62 B;  3AZM A;  4WU8 B;  1P3L D;  3A6N C;  4XZQ D;  3MNN B;  1TZY C;  3REJ C;  3AV2 B;  5B40 A;  1P3B D;  4ZUX D;  3R45 B;  3A6N D;  3AZN B;  3X1V B;  3KXB C;  1TZY D;  3REJ D;  3AZK B;  4H9P A;  1P34 B;  3X1T D;  4WNN B;  2L5A A;  5DNM B;  3AZJ C;  1P3O B;  5AV8 C;  2PYO B;  5AV6 C;  3AZF D;  5B1L D;  4KGC D;  4KHA A;  4J8U B;  3AV1 C;  4J8X D;  5AVB A;  5B33 D;  1KX3 D;  4UUZ A;  3V9R B;  5AV8 A;  5AY8 A;  3W96 D;  4CAY B;  3B0D B;  1BH9 B;  3REK D;  3KXB D;  1M19 C;  1M1A A;  1HQ3 B;  3LZ0 D;  5AV9 A;  5B33 B;  5B31 G;  3WTP D;  5BNV A;  1A7W A;  3UTB A;  4AWL C;  3KUY A;  3REL A;  4XZQ A;  3LEL A;  1JFI B;  4H9N B;  4ZUX A;  3MGR C;  5B40 C;  2HIO A;  3W99 D;  3REK C;  3AZG D;  4XUJ B;  3AZF A;  1TAF A;  5B32 G;  4KGC A;  3MNN D;  1BFM A;  4ZUX B;  2F8N D;  5B0Y C;  3MGS A;  1WWI A;  4WU9 C;  3B6F B;  1P3G A;  5B31 B;  2YFV B;  5B40 D;  1P3M A;  4NFT A;  1AOI B;  5B33 A;  3AV1 A;  1KX5 C;  3B0B A;  3X1S B;  1BH9 A;  5B2J A;  3KWQ D;  4CAY A;  5AV9 C;  4J8U C;  2CWE A;  5GXQ B;  5AV8 B;  4UUZ B;  5CP6 C;  1M19 A;  4HGA B;  1M1A C;  5AV9 D;  5B0Y D;  3C1C D;  5AVC A;  1P3P D;  4Z2M G;  4XZQ C;  3KXB B;  3AV2 C;  4NE6 A;  3A6N B;  2YFW B;  4KHA B;  5B2I A;  4WU8 C;  4G92 C;  4WV4 B;  3AZH C;  4DRA A;  1TZY B;  3REJ B;  2HIO D;  4WNN A;  2PYO A;  3AZE A;  4Z5T A;  3WA9 B;  5BS7 C;  1P3F D;  3LJA B;  4KGC C;  4J8V C;  5B2I C;  3WA9 A;  3AZE B;  3UTA D;  3MNN A;  5B2I B;  2F8N A;  2YFW A;  4QLC C;  3AZH A;  1P3F B;  3LJA D;  3REH D;  3MGQ B;  4WU9 A;  5F99 A;  4Z66 C;  4J8V B;  3LJA C;  3TU4 C;  1P3M D;  3B0C W;  5B32 A;  2ARO A;  5C3I B;  5B24 C;  1S32 D;  4E45 A;  1M19 D;  1P3M B;  1KX4 D;  4H9O A;  4H9S A;  3X1S D;  5B0Y A;  5BT1 C;  3KSY A;  3KWQ B;  1M18 D;  1KX4 C;  3X1S C;  2RVQ C;  4JJN A;  3MGS B;  3AV1 D;  1P3I A;  4Z5T C;  5DNM D;  1P3O D;  4DRB A;  3AZF B;  1AOI C;  1ZLA B;  1P3K D;  3AZJ A;  5GT3 D;  1U35 A;  5B1L A;  3C1C A;  2HIO B;  1P3P A;  3UT9 B;  3X1T A;  5AVB C;  4R8P A;  5CPK D;  1JFI A; 
#chains in the Genus database with same CATH topology
 3AZL A;  1P3B C;  2CV5 A;  1P3K B;  2FJ7 D;  4M6B A;  3WKJ B;  2RVQ D;  5GT0 D;  2Y2P A;  4X23 D;  3C1B C;  3REI C;  3REK B;  3MGQ C;  4Z5T D;  2W8S A;  5FUG B;  5AY8 C;  4J8X A;  4QLC B;  3WTP B;  2JCH A;  1KX3 A;  4YM6 C;  3W97 A;  1Q9C A;  4AWL B;  5CPJ D;  3V9R A;  3X1U C;  3LZ1 B;  3MGR D;  3KFU G;  1W2E A;  3W99 C;  3UTB D;  3LZ0 A;  1KX4 A;  4YM6 A;  3WTP A;  1P3A C;  5GSU C;  4E44 A;  4G92 B;  3REI D;  2CV5 B;  1P3K A;  5DNM A;  1P3O A;  3W99 A;  3AZN A;  4J8U D;  4YS3 A;  3AZM C;  5CPI D;  3AV2 A;  1P3G C;  3AZJ B;  3AZI C;  2CV5 D;  3AZM B;  5CPK A;  1ID3 C;  1KX5 B;  4LD9 D;  4CSR B;  4WU8 D;  3C1B A;  2Y2G A;  5GT3 B;  1EQZ A;  2PYO C;  5GSU B;  3X1U D;  2F8N K;  2CV5 C;  1ULY A;  2J8P A;  3F6T A;  3B6F C;  1R4V A;  3NQU B;  4ZBJ C;  3W97 D;  2Y2K A;  3AFA C;  5B0Y B;  5JRG B;  4H9O B;  5AVC C;  3LZ1 C;  2HUE C;  4KUD B;  4EO5 C;  3AN2 B;  5CHL B;  4KUD A;  5B24 D;  1S32 C;  5AVC D;  2ARO B;  1T3U A;  2Y2H A;  4J8W C;  2IO5 C;  1HTA A;  4Z66 D;  5JRG D;  2BYK B;  5B1M A;  3AN2 D;  1P3K C;  2NZD D;  3NQJ B;  5E5A D;  3AZE D;  3C1B B;  3AZN D;  3UTA B;  4UPK A;  1P3F A;  2ZY2 A;  2F8N B;  2HIO C;  3UT9 D;  2PYO D;  5B33 C;  5AV5 B;  3UT9 C;  3REH B;  2BYM A;  4J8V D;  4YS3 B;  3AZF C;  3C1B D;  3AZH D;  3X1U A;  4Z5T B;  5CP6 A;  1P3L B;  3AYW A;  1ZLA C;  5B32 C;  3FDD A;  2LY8 A;  5BO0 A;  5AV8 D;  3W96 A;  3A6N A;  5CPJ B;  3X1T C;  1P3A A;  2DQN C;  3KXB A;  5B32 D;  1P3M C;  1KX4 B;  3LZ0 B;  1B6W A;  1P3O C;  3REH C;  3LZ1 A;  3W98 A;  5BS7 A;  3LEL C;  5DNN D;  3X1V C;  4WU9 D;  1F66 D;  4LD9 A;  3KUY C;  3VH5 W;  3REL C;  1P3I C;  5JA4 A;  5B1M D;  1KX3 C;  1H3O B;  3W96 C;  4J8X B;  1AOI A;  3WAA B;  3REK A;  5B31 A;  1N1J A;  5AY8 D;  3AZL B;  3AZG B;  4J8W B;  3VH6 T;  2JE5 A;  3AZJ D;  4R8P B;  3UT9 A;  2NQB C;  3AZG C;  5B1L C;  5B1L B;  4KGC B;  2FJ7 B;  3LEL D;  1U35 B;  2FFF B;  3WKJ D;  5GT0 B;  1F1E A;  2HUE B;  4XUJ A;  4X23 B;  4G91 C;  3KUY D;  3REL D;  3AZL D;  3H0M C;  4NE3 A;  2FJ7 A;  1PZR A;  4R8P D;  5CP6 D;  3AYW D;  3WAA C;  5AV5 D;  3AFA D;  1P3I B;  3O62 D;  2XD1 A;  3LEL B;  4J8W A;  4JJN B;  2UWX A;  4XZQ B;  3KWQ A;  3KUY B;  3REL B;  3LZ0 C;  5KDM B;  1ID3 B;  3UTB B;  1N1J B;  4HGA C;  5BNV B;  3IP4 C;  3WAA A;  4NE5 A;  1M18 B;  5AV9 B;  2Y2O A;  2Y2L A;  3AZI D;  5CPJ C;  1HQ3 A;  2RIQ A;  3MGS D;  1P3G D;  1M1A B;  1EQZ C;  3MGP D;  5B32 B;  3MGQ D;  2Y2I A;  4H9Q A;  3W98 B;  1WWS A;  4YM6 D;  3TU4 D;  4YS3 C;  5F99 B;  4WU9 B;  5CPI B;  1P3B A;  1P3A B;  4ZUX C;  3MGR A;  5E5A C;  5BO0 B;  5B2J C;  4WZS B;  1KX5 D;  4XUJ C;  2Y2M A;  1P3L A;  3AZK A;  3VH5 T;  5B2I D;  1P34 A;  5GSU D;  3X1U B;  3LJA A;  2BYM B;  3R45 A;  5B31 D;  5B40 B;  1TZY A;  3REJ A;  3A1I A;  4WU8 A;  3WA9 D;  3O62 A;  3MGR B;  3UTA A;  5BT1 D;  5B0Z A;  2ARO C;  3MVD A;  1S32 A;  5CPI A;  1P3B B;  5AVC B;  3EPJ A;  1KU5 A;  2ARO D;  3EG5 B;  5B1M B;  1M19 B;  3EPK A;  5AVB D;  4H9Q B;  5GXQ A;  5B2J B;  4ZBJ B;  3X1S A;  5GT3 C;  5E5A B;  3B0D C;  3B0C T;  3AV1 B;  1M18 A;  4J8W D;  2YFV A;  5BNX B;  5F99 C;  4Z66 A;  3AZI B;  5JRG A;  3W98 C;  1P3G B;  5KDM A;  5CPK C;  4QLC D;  1ID3 A;  3B6F A;  3B6G A;  1ZLA D;  1Z2C B;  1U35 D;  2F8N H;  2JSS A;  1M18 C;  5GSU A;  1HQ3 D;  3AZK C;  1P34 C;  5GT3 A;  1EQZ B;  3UTB C;  4CSR A;  1KX5 A;  5AV6 B;  1TAF B;  2NQB D;  5CPK B;  3WTP E;  5DNM C;  3P5J B;  5C3I C;  5GT0 A;  1BH8 B;  4H9S C;  4X23 A;  4JJN D;  2NZD A;  3AZN C;  2F8N G;  5G49 A;  4JJN C;  4H9N A;  3MNN C;  5B0Z C;  5AV6 D;  3MVD C;  3W99 B;  3AZG A;  3O62 C;  5B1M C;  1U35 C;  5DNN B;  1F66 B;  4G91 B;  3WTP C;  4H9R A;  5GT0 C;  4X23 C;  3AZK D;  1P34 D;  3W98 D;  2FJ7 C;  1H3O A;  3AZL C;  4YM6 B;  5JA4 B;  4LD9 B;  4R8P C;  5AY8 B;  3REI A;  3REI B;  1P3A D;  3B6F D;  5AVB B;  4J8X C;  3W97 B;  3WKJ C;  3B6G C;  5B0Z D;  3MVD D;  1KX3 B;  1AOI D;  5B2J D;  4QLC A;  4YS3 D;  4J8U A;  5FUG A;  4H9R B;  5CPJ A;  3LZ1 D;  3W96 B;  3AV2 D;  5DNN A;  1F66 A;  3AL0 C;  5GXQ D;  3WKJ A;  3MGP C;  3AYW B;  5CPI C;  5CP6 B;  4H9P B;  3AZM D;  5GXQ C;  3X1V A;  3X1T B;  5G49 B;  3EPH A;  3C1C B;  1P3P B;  3REH A;  5AV5 A;  2NZD B;  2NZD C;  1ID3 D;  3MGS C;  1BH8 A;  1EQZ D;  3B6G D;  5B31 C;  3C1C C;  3AYW C;  2ZY3 A;  3KWQ C;  1P3P C;  1ZLA A;  3AFA A;  5AV6 A;  1M1A D;  1P3L C;  3NQJ A;  3MGP B;  2ZM5 A;  4KUD D;  4XUJ D;  3VH5 A;  2NQB A;  5B24 B;  2BYK A;  3B6G B;  3TU4 B;  5AV5 C;  3WAA D;  3H0L C;  5F99 D;  5BNX A;  4Z66 B;  3AZI A;  3VH6 W;  2XD5 A;  3W97 C;  3AN2 A;  3UTA C;  5E5A A;  4Z2M H;  2IO5 B;  3VH6 A;  1P3F C;  3TU4 A;  4LD9 C;  3AZE C;  5B24 A;  3NQU A;  2NQB B;  4KUD C;  3MGP A;  4J8V A;  3WA9 C;  1S32 B;  3MGQ A;  5JRG C;  5DNN C;  5B0Z B;  3MVD B;  3X1V D;  1F66 C;  4EO5 B;  3AN2 C;  3AFA B;  1P3I D;  3AZH B;  1HQ3 C;  1B67 A;  3O62 B;  3AZM A;  4WU8 B;  1P3L D;  3A6N C;  4XZQ D;  3MNN B;  1TZY C;  3REJ C;  3AV2 B;  5B40 A;  1P3B D;  4ZUX D;  3R45 B;  3A6N D;  3AZN B;  2G5H C;  3X1V B;  3KXB C;  1TZY D;  3REJ D;  3A1K A;  4H9P A;  3AZK B;  3X1T D;  4WNN B;  2BG1 A;  2L5A A;  5DNM B;  3AZJ C;  5AV8 C;  1P3O B;  2PYO B;  5AV6 C;  3AZF D;  5B1L D;  2Y2J A;  4KGC D;  4KHA A;  4J8U B;  3AV1 C;  4J8X D;  5AVB A;  5B33 D;  1KX3 D;  4UUZ A;  3V9R B;  5AV8 A;  5AY8 A;  3W96 D;  4CAY B;  3B0D B;  1BH9 B;  3REK D;  3KXB D;  1M19 C;  1M1A A;  1HQ3 B;  3LZ0 D;  4DQY B;  5AV9 A;  5B33 B;  5B31 G;  3EPL A;  3WTP D;  5BNV A;  1A7W A;  3UTB A;  4WJ3 C;  4AWL C;  3KUY A;  3REL A;  4XZQ A;  3LEL A;  1JFI B;  4H9N B;  4ZUX A;  3MGR C;  5B40 C;  2VQR A;  2HIO A;  3W99 D;  3REK C;  3AZG D;  4XUJ B;  3AZF A;  1TAF A;  5B32 G;  4KGC A;  3MNN D;  1BFM A;  4ZUX B;  2F8N D;  5B0Y C;  3MGS A;  1WWI A;  1P34 B;  4WU9 C;  3B6F B;  1P3G A;  5B31 B;  2YFV B;  5B40 D;  2Y2N A;  1P3M A;  4NFT A;  1AOI B;  5B33 A;  3AV1 A;  1KX5 C;  3B0B A;  3X1S B;  1BH9 A;  5B2J A;  3KWQ D;  4CAY A;  5AV9 C;  4J8U C;  2CWE A;  5GXQ B;  5AV8 B;  4UUZ B;  5CP6 C;  1M19 A;  4HGA B;  1M1A C;  5AV9 D;  5B0Y D;  3C1C D;  2G5I C;  5AVC A;  1P3P D;  4Z2M G;  4XZQ C;  3KXB B;  3AV2 C;  4NE6 A;  2ZY4 A;  2YFW B;  3A6N B;  4KHA B;  5B2I A;  4WU8 C;  2ZY5 A;  4WV4 B;  4G92 C;  3AZH C;  4DRA A;  1TZY B;  3REJ B;  2DF4 C;  2HIO D;  4WNN A;  2PYO A;  3AZE A;  4Z5T A;  3WA9 B;  5BS7 C;  1P3F D;  3LJA B;  4KGC C;  4J8V C;  2Y2Q A;  5B2I C;  3WA9 A;  3AZE B;  3UTA D;  3MNN A;  5B2I B;  2F8N A;  2YFW A;  4QLC C;  3AZH A;  1P3F B;  3LJA D;  3REH D;  3MGQ B;  4WU9 A;  5F99 A;  4Z66 C;  4J8V B;  3LJA C;  3TU4 C;  1P3M D;  3B0C W;  5B32 A;  2ARO A;  3H0R C;  5C3I B;  5B24 C;  1S32 D;  4E45 A;  1M19 D;  1P3M B;  1KX4 D;  4H9O A;  4H9S A;  3X1S D;  5B0Y A;  5BT1 C;  3KSY A;  3KWQ B;  1M18 D;  1KX4 C;  3X1S C;  2RVQ C;  4JJN A;  3MGS B;  3AV1 D;  1P3I A;  2F2A C;  4Z5T C;  5DNM D;  1P3O D;  4DRB A;  3AZF B;  1AOI C;  1ZLA B;  1P3K D;  3AZJ A;  5GT3 D;  1U35 A;  5B1L A;  3C1C A;  2HIO B;  1P3P A;  3UT9 B;  3X1T A;  5AVB C;  4R8P A;  5CPK D;  1JFI A; 
#chains in the Genus database with same CATH homology
 3AZL A;  1P3B C;  2CV5 A;  1P3K B;  2FJ7 D;  4M6B A;  3WKJ B;  2RVQ D;  5GT0 D;  2Y2P A;  4X23 D;  3C1B C;  3REI C;  3REK B;  3MGQ C;  4Z5T D;  2W8S A;  5FUG B;  5AY8 C;  4J8X A;  4QLC B;  3WTP B;  2JCH A;  1KX3 A;  4YM6 C;  3W97 A;  1Q9C A;  4AWL B;  5CPJ D;  3V9R A;  3X1U C;  3LZ1 B;  3MGR D;  3KFU G;  1W2E A;  3W99 C;  3UTB D;  3LZ0 A;  1KX4 A;  4YM6 A;  3WTP A;  1P3A C;  5GSU C;  4E44 A;  4G92 B;  3REI D;  2CV5 B;  1P3K A;  5DNM A;  1P3O A;  3W99 A;  3AZN A;  4J8U D;  4YS3 A;  3AZM C;  5CPI D;  3AV2 A;  1P3G C;  3AZJ B;  3AZI C;  2CV5 D;  3AZM B;  5CPK A;  1ID3 C;  1KX5 B;  4LD9 D;  4CSR B;  4WU8 D;  3C1B A;  2Y2G A;  5GT3 B;  1EQZ A;  2PYO C;  5GSU B;  3X1U D;  2F8N K;  2CV5 C;  1ULY A;  2J8P A;  3F6T A;  3B6F C;  1R4V A;  3NQU B;  4ZBJ C;  3W97 D;  2Y2K A;  3AFA C;  5B0Y B;  5JRG B;  4H9O B;  5AVC C;  3LZ1 C;  2HUE C;  4KUD B;  4EO5 C;  3AN2 B;  5CHL B;  4KUD A;  5B24 D;  1S32 C;  5AVC D;  2ARO B;  1T3U A;  2Y2H A;  4J8W C;  2IO5 C;  1HTA A;  4Z66 D;  5JRG D;  2BYK B;  5B1M A;  3AN2 D;  1P3K C;  2NZD D;  3NQJ B;  5E5A D;  3AZE D;  3C1B B;  3AZN D;  3UTA B;  4UPK A;  1P3F A;  2ZY2 A;  2F8N B;  2HIO C;  3UT9 D;  2PYO D;  5B33 C;  5AV5 B;  3UT9 C;  3REH B;  2BYM A;  4J8V D;  4YS3 B;  3AZF C;  3C1B D;  3AZH D;  3X1U A;  4Z5T B;  5CP6 A;  1P3L B;  3AYW A;  1ZLA C;  5B32 C;  3FDD A;  2LY8 A;  5BO0 A;  5AV8 D;  3W96 A;  3A6N A;  5CPJ B;  3X1T C;  1P3A A;  2DQN C;  3KXB A;  5B32 D;  1P3M C;  1KX4 B;  3LZ0 B;  1B6W A;  1P3O C;  3REH C;  3LZ1 A;  3W98 A;  5BS7 A;  3LEL C;  5DNN D;  3X1V C;  4WU9 D;  1F66 D;  4LD9 A;  3KUY C;  3VH5 W;  3REL C;  1P3I C;  5JA4 A;  5B1M D;  1KX3 C;  1H3O B;  3W96 C;  4J8X B;  1AOI A;  3WAA B;  3REK A;  5B31 A;  1N1J A;  5AY8 D;  3AZL B;  3AZG B;  4J8W B;  3VH6 T;  2JE5 A;  3AZJ D;  4R8P B;  3UT9 A;  2NQB C;  3AZG C;  5B1L C;  5B1L B;  4KGC B;  2FJ7 B;  3LEL D;  1U35 B;  2FFF B;  3WKJ D;  5GT0 B;  1F1E A;  2HUE B;  4XUJ A;  4X23 B;  4G91 C;  3KUY D;  3REL D;  3AZL D;  3H0M C;  4NE3 A;  2FJ7 A;  1PZR A;  4R8P D;  5CP6 D;  3AYW D;  3WAA C;  5AV5 D;  3AFA D;  1P3I B;  3O62 D;  2XD1 A;  3LEL B;  4J8W A;  4JJN B;  2UWX A;  4XZQ B;  3KWQ A;  3KUY B;  3REL B;  3LZ0 C;  5KDM B;  1ID3 B;  3UTB B;  1N1J B;  4HGA C;  5BNV B;  3IP4 C;  3WAA A;  4NE5 A;  1M18 B;  5AV9 B;  2Y2O A;  2Y2L A;  3AZI D;  5CPJ C;  1HQ3 A;  2RIQ A;  3MGS D;  1P3G D;  1M1A B;  1EQZ C;  3MGP D;  5B32 B;  3MGQ D;  2Y2I A;  4H9Q A;  3W98 B;  1WWS A;  4YM6 D;  3TU4 D;  4YS3 C;  5F99 B;  4WU9 B;  5CPI B;  1P3B A;  1P3A B;  4ZUX C;  3MGR A;  5E5A C;  5BO0 B;  5B2J C;  4WZS B;  1KX5 D;  4XUJ C;  2Y2M A;  1P3L A;  3AZK A;  3VH5 T;  5B2I D;  1P34 A;  5GSU D;  3X1U B;  3LJA A;  2BYM B;  3R45 A;  5B31 D;  5B40 B;  1TZY A;  3REJ A;  3A1I A;  4WU8 A;  3WA9 D;  3O62 A;  3MGR B;  3UTA A;  5BT1 D;  5B0Z A;  2ARO C;  3MVD A;  1S32 A;  5CPI A;  1P3B B;  5AVC B;  3EPJ A;  1KU5 A;  2ARO D;  3EG5 B;  5B1M B;  1M19 B;  3EPK A;  5AVB D;  4H9Q B;  5GXQ A;  5B2J B;  4ZBJ B;  3X1S A;  5GT3 C;  5E5A B;  3B0D C;  3B0C T;  3AV1 B;  1M18 A;  4J8W D;  2YFV A;  5BNX B;  5F99 C;  4Z66 A;  3AZI B;  5JRG A;  3W98 C;  1P3G B;  5KDM A;  5CPK C;  4QLC D;  1ID3 A;  3B6F A;  3B6G A;  1ZLA D;  1Z2C B;  1U35 D;  2F8N H;  2JSS A;  1M18 C;  5GSU A;  1HQ3 D;  3AZK C;  1P34 C;  5GT3 A;  1EQZ B;  3UTB C;  4CSR A;  1KX5 A;  5AV6 B;  1TAF B;  2NQB D;  5CPK B;  3WTP E;  5DNM C;  3P5J B;  5C3I C;  5GT0 A;  1BH8 B;  4H9S C;  4X23 A;  4JJN D;  2NZD A;  3AZN C;  2F8N G;  5G49 A;  4JJN C;  4H9N A;  3MNN C;  5B0Z C;  5AV6 D;  3MVD C;  3W99 B;  3AZG A;  3O62 C;  5B1M C;  1U35 C;  5DNN B;  1F66 B;  4G91 B;  3WTP C;  4H9R A;  5GT0 C;  4X23 C;  3AZK D;  1P34 D;  3W98 D;  2FJ7 C;  1H3O A;  3AZL C;  4YM6 B;  5JA4 B;  4LD9 B;  4R8P C;  5AY8 B;  3REI A;  3REI B;  1P3A D;  3B6F D;  5AVB B;  4J8X C;  3W97 B;  3WKJ C;  3B6G C;  5B0Z D;  3MVD D;  1KX3 B;  1AOI D;  5B2J D;  4QLC A;  4YS3 D;  4J8U A;  5FUG A;  4H9R B;  5CPJ A;  3LZ1 D;  3W96 B;  3AV2 D;  5DNN A;  1F66 A;  3AL0 C;  5GXQ D;  3WKJ A;  3MGP C;  3AYW B;  5CPI C;  5CP6 B;  4H9P B;  3AZM D;  5GXQ C;  3X1V A;  3X1T B;  5G49 B;  3EPH A;  3C1C B;  1P3P B;  3REH A;  5AV5 A;  2NZD B;  2NZD C;  1ID3 D;  3MGS C;  1BH8 A;  1EQZ D;  3B6G D;  5B31 C;  3C1C C;  3AYW C;  2ZY3 A;  3KWQ C;  1P3P C;  1ZLA A;  3AFA A;  5AV6 A;  1M1A D;  1P3L C;  3NQJ A;  3MGP B;  2ZM5 A;  4KUD D;  4XUJ D;  3VH5 A;  2NQB A;  5B24 B;  2BYK A;  3B6G B;  3TU4 B;  5AV5 C;  3WAA D;  3H0L C;  5F99 D;  5BNX A;  4Z66 B;  3AZI A;  3VH6 W;  2XD5 A;  3W97 C;  3AN2 A;  3UTA C;  5E5A A;  4Z2M H;  2IO5 B;  3VH6 A;  1P3F C;  3TU4 A;  4LD9 C;  3AZE C;  5B24 A;  3NQU A;  2NQB B;  4KUD C;  3MGP A;  4J8V A;  3WA9 C;  1S32 B;  3MGQ A;  5JRG C;  5DNN C;  5B0Z B;  3MVD B;  3X1V D;  1F66 C;  4EO5 B;  3AN2 C;  3AFA B;  1P3I D;  3AZH B;  1HQ3 C;  1B67 A;  3O62 B;  3AZM A;  4WU8 B;  1P3L D;  3A6N C;  4XZQ D;  3MNN B;  1TZY C;  3REJ C;  3AV2 B;  5B40 A;  1P3B D;  4ZUX D;  3R45 B;  3A6N D;  3AZN B;  2G5H C;  3X1V B;  3KXB C;  1TZY D;  3REJ D;  3A1K A;  4H9P A;  3AZK B;  3X1T D;  4WNN B;  2BG1 A;  2L5A A;  5DNM B;  3AZJ C;  5AV8 C;  1P3O B;  2PYO B;  5AV6 C;  3AZF D;  5B1L D;  2Y2J A;  4KGC D;  4KHA A;  4J8U B;  3AV1 C;  4J8X D;  5AVB A;  5B33 D;  1KX3 D;  4UUZ A;  3V9R B;  5AV8 A;  5AY8 A;  3W96 D;  4CAY B;  3B0D B;  1BH9 B;  3REK D;  3KXB D;  1M19 C;  1M1A A;  1HQ3 B;  3LZ0 D;  4DQY B;  5AV9 A;  5B33 B;  5B31 G;  3EPL A;  3WTP D;  5BNV A;  1A7W A;  3UTB A;  4WJ3 C;  4AWL C;  3KUY A;  3REL A;  4XZQ A;  3LEL A;  1JFI B;  4H9N B;  4ZUX A;  3MGR C;  5B40 C;  2VQR A;  2HIO A;  3W99 D;  3REK C;  3AZG D;  4XUJ B;  3AZF A;  1TAF A;  5B32 G;  4KGC A;  3MNN D;  1BFM A;  4ZUX B;  2F8N D;  5B0Y C;  3MGS A;  1WWI A;  1P34 B;  4WU9 C;  3B6F B;  1P3G A;  5B31 B;  2YFV B;  5B40 D;  2Y2N A;  1P3M A;  4NFT A;  1AOI B;  5B33 A;  3AV1 A;  1KX5 C;  3B0B A;  3X1S B;  1BH9 A;  5B2J A;  3KWQ D;  4CAY A;  5AV9 C;  4J8U C;  2CWE A;  5GXQ B;  5AV8 B;  4UUZ B;  5CP6 C;  1M19 A;  4HGA B;  1M1A C;  5AV9 D;  5B0Y D;  3C1C D;  2G5I C;  5AVC A;  1P3P D;  4Z2M G;  4XZQ C;  3KXB B;  3AV2 C;  4NE6 A;  2ZY4 A;  2YFW B;  3A6N B;  4KHA B;  5B2I A;  4WU8 C;  2ZY5 A;  4WV4 B;  4G92 C;  3AZH C;  4DRA A;  1TZY B;  3REJ B;  2DF4 C;  2HIO D;  4WNN A;  2PYO A;  3AZE A;  4Z5T A;  3WA9 B;  5BS7 C;  1P3F D;  3LJA B;  4KGC C;  4J8V C;  2Y2Q A;  5B2I C;  3WA9 A;  3AZE B;  3UTA D;  3MNN A;  5B2I B;  2F8N A;  2YFW A;  4QLC C;  3AZH A;  1P3F B;  3LJA D;  3REH D;  3MGQ B;  4WU9 A;  5F99 A;  4Z66 C;  4J8V B;  3LJA C;  3TU4 C;  1P3M D;  3B0C W;  5B32 A;  2ARO A;  3H0R C;  5C3I B;  5B24 C;  1S32 D;  4E45 A;  1M19 D;  1P3M B;  1KX4 D;  4H9O A;  4H9S A;  3X1S D;  5B0Y A;  5BT1 C;  3KSY A;  3KWQ B;  1M18 D;  1KX4 C;  3X1S C;  2RVQ C;  4JJN A;  3MGS B;  3AV1 D;  1P3I A;  2F2A C;  4Z5T C;  5DNM D;  1P3O D;  4DRB A;  3AZF B;  1AOI C;  1ZLA B;  1P3K D;  3AZJ A;  5GT3 D;  1U35 A;  5B1L A;  3C1C A;  2HIO B;  1P3P A;  3UT9 B;  3X1T A;  5AVB C;  4R8P A;  5CPK D;  1JFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...