4DRHA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
NNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 30
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drhA00
1A7XA 3B7XA 4JFMA 5HTGA 2ZR5A 3UQBA 4ODRA 3TC5A 5HKGA 1D6OA 4ODOA 1D7JA 4IPXA 2JZVA 2L2SA 5D75A 1FKHA 2RUDA 1JVWA 4MSPA 4DZ3A 2MNTA 3PRDA 4ITZA 1PBKA 3O5GA 4JFLA 1HXVA 4O2TA 3O5EA 1J4RA 2UZ5A 4ODMA 2KGJA 4W9OA 5DIUA 2N87A 3H9RB 4FN2A 4LAXA 3KADA 3UQIA 4DH0A 1JNSA 1F40A 3O5IA 3UI5A 2LPVA 3UI6A 2XPAA 2PPPA 3MDYB 2LKNA 3KAHA 3KZ7A 1YW5A 1FAPA 1BKFA 2PBCA 2RURA 2RQSA 2XP3A 3NRKA 1U79A 4R0XA 3O5OA 4LAYA 1FKLA 2Q5AA 3KACA 1F8AB 4NNRA 2IF4A 3FAPA 2MF9A 3JXVA 1NMWA 2KI3A 1ZCNA 4LAVA 2MLXA 3O5JA 2XP4A 1FKJA 4JFIA 4J4NA 1T11A 1Q6UA 2XP8A 2XP9A 2M08A 4JFJA 4DRJA 4ODLA 3O5LA 2MLZA 5HW6A 2K8IA 2OFNA 4ODQA 2PPNA 2XPBA 1J4HA 1NMVA 2XP7A 3RFWA 4G2PA 2XP5A 4GGQA 4QT2A 1FKIA 1PINA 1D7HA 1QPFA 2PV3A 1D7IA 2RUCA 5HWCA 3NI6A 5HW8A 2FKEA 2LJ4A 2AWGA 1FKGA 2KE0A 2ZQSA 4ODNA 4QIBA 2DG3A 1J4IA 3I6CA 1Q1CA 3GPKA 4FAPA 5HW7A 4J4OA 3JYMA 3O5MA 4IQ2A 1B6CA 3RGCA 5DITA 3KAGA 5I98A 4G50A 5J6EA 1FKTA 1FKKA 1KT1A 1QPLA 2Y78A 2ZR4A 4TW6A 4TNSA 3IKGA 3CGMA 2PV1A 4GIVA 4N19A 4DT4A 5DIVA 1TCOC 1Q6HA 2ZQUA 3O5RA 3TCZA 4C02B 5BXJA 4MGVA 4DRHA 5GPGA 4DRKA 1QZ2A 2ITKA 4U86A 3IK8A 4BF8A 1FKRA 1JNTA 2D9FA 4DIPA 1P5QA 2RUQA 3O5PA 2ZQTA 4QT3A 3LUOA 1Q6IA 2XP6A 1W26A 3IHZA 4U84A 2DG9A 1M5YA 3JYJA 1YATA 1KT0A 4DRQA 3TDBA 1Y0OA 4ODKA 4DRPA 5B8IC 2KFWA 3NTPA 2KO7A 2M2AA 4LAWA 2M1IA 1FJDA 4W9PA 2MPHA 2VN1A 3VAWA 2ZQVA 3PRBA 1R9HA 3UQAA 4TW7A 1NSGA 1ZK6A 1N1AA 1EQ3A 2RSEA 1EYMA 4TYOA 1FKDA 3OOBA 3UI4A 3ODKA 3KAIA 3CGNA 3UF8A 3KCEA 4DRNA 3O5DA 2DG4A 2KR7A 1BL4A 3KABA 5HUAA 4U85A 1FD9A 1J6YA 3IKDA 2PV2A 4ODPA 5HT1A 4TW8A 4DRIA 1C9HA 2LGOA 3PA7A 2F4EA 2F2DA 2MLYA 4JYSA 4DROA 3O5QA 1FKSA 2FAPA 2PPOA 4DRMA 2ZR6A 4IQCA 1L1PA 3O5FA 1FKFA 3WH0A 4TX0A 1ROTA 2F21A 2VCDA 3EY6A 4W9QA 3O5KA 5HWBA 4JFKA 1FKBA 4DZ2A 1ROUA 3KAFA
chains in the Genus database with same CATH superfamily
3B7XA 1VF8A 3UQBA 5HKGA 4ODOA 1EDQA 4MSPA 1LL6A 4DZ3A 4ITZA 1HXVA 1TFVA 3AQUA 4ODMA 1FFQA 1K9TA 4LAXA 2B31A 4DH0A 1JCHB 1NWUA 1NWSA 1F40A 1CTNA 1H0GA 3KZ7A 1H0IA 2Q5AA 2A3AA 2YBTA 1E6ZA 1NMWA 1ZBCA 2KI3A 3ARXA 3RM8A 4L3NA 3WQWA 3ARQA 3G6LA 2XP4A 2DT3A 2XP8A 3ARVA 2G41A 2K8IA 2PPNA 2XPBA 3RFWA 1FKIA 3EIPA 4MNMA 3AROA 5HW8A 3GTYX 1LL4A 1J4IA 2DG3A 4FAPA 3JYMA 3O5MA 4IQ2A 1B6CA 4KQZA 5DITA 3RM9A 1ZBKA 2O9OA 2Y78A 2ZR4A 1KFWA 4W5UA 1RD6A 5DO2A 3CGMA 3WIJA 4GIVA 4ZPTR 1TCOC 3ARSA 4C02B 4MGVA 3IK8A 4BF8A 4ZPWR 1P5QA 3O5PA 2F23A 3LUOA 3ARUA 1NWRA 4W9PA 2VN1A 3VAWA 2DSZA 1R9HA 3UQAA 4TW7A 1NSGA 1ZK6A 1N1AA 1EYMA 3OOBA 3ODKA 2O92A 3RM4A 3WD4A 5HUAA 1J6YA 1HKIA 4Q22A 4ODPA 4S3JA 1C9HA 4JYSA 1W1PA 4DROA 2EULA 1L1PA 2PPOA 4DRMA 3ARYA 3CHEA 2ZR6A 4IQCA 3WL0A 2VCDA 5HWBA 4U84A 1FKBA 3KAFA 1A7XA 4DWSC 1W9PA 1D7JA 2DPEA 4HARA 2L2SA 1GOIA 1FKHA 2MNTA 1ZU8A 1E6RA 3RMEA 1PBKA 3O5EA 1J4RA 4W9OA 1WB0A 3CZ8A 3KADA 4UDMA 3UI5A 4KR0B 3UI6A 2LKNA 2WLZA 4Z2HA 2PBCA 2RURA 1JNEA 3O5OA 1F8AB 2IF4A 3FAPA 3JXVA 4ZPVR 1W1TA 2MLXA 1FKJA 1JNDA 4JFIA 4J4NA 3OA5A 1HKJA 3GU0A 2MLZA 1XRVA 4Z2LA 4G2PA 2XP5A 1PINA 2PV3A 2QF8A 1D7IA 5HWCA 2AWGA 1FKGA 4ODNA 4QIBA 5HW7A 3I6CA 3GPKA 1O6IA 2ETNA 5I98A 1FKTA 1X6NA 3WQVA 2DSVA 3IKGA 2PV1A 3WD3A 2DT2A 2DSWA 2DT1A 3O5RA 1Q6HA 3AS2A 3AS3A 4U86A 4WKAA 1W9UA 2YBUA 4P8UA 4DWSD 1YATA 1WNOA 3FY1A 3TDBA 3ALGA 3BMBA 4MNJA 2KFWA 3NTPA 2KO7A 4P8WA 4WKHA 1EHNA 3ALFA 4ZS6A 1LL7A 1FKDA 3UI4A 3G6MA 3O5DA 1BL4A 2ESCA 1FD9A 4MNKA 4TW8A 2F2DA 1OGBA 1ZB5A 4ML4A 3O5QA 1FKSA 4TX0A 1W1VA 2F21A 3O5KA 4MNLA 5DEZA 3AS0A 1HKMA 3TC5A 1GUVA 4IPXA 2JZVA 5D75A 2WK2A 2RUDA 3PRDA 2DSUA 4O2TA 2UZ5A 3WD2A 2N87A 3H9RB 2A3EA 4FN2A 3CH9A 1W1YA 1E44A 4MPKA 3MDYB 2PPPA 1GPFA 3NRKA 4R0XA 2P4VA 2RQSA 4Z2KA 1U79A 4LAYA 1FKLA 4IT4A 1HJWA 4NNRA 2MF9A 4HBOA 1ZCNA 3B8SA 1HJVA 4LAVA 3O5JA 4MTVA 3WKZA 2OLHA 2M08A 4JFJA 4ODLA 2PN0A 5HW6A 2OFNA 1J4HA 4HBEA 4R5EA 1D7HA 1W9VA 2RUCA 3NI6A 2LJ4A 2KE0A 1OWQA 1Q1CA 3RGCA 3KAGA 3WD0A 5J6EA 1NH6A 1KT1A 2WLYA 4TW6A 1ITXA 1LQ0A 4Z2GA 3ARZA 3TCZA 5BXJA 1WAWA 3FXYA 2ITKA 2D9FA 3PRAA 1ZBWA 3ARPA 4QT3A 2DG9A 3JYJA 1SYTA 4DRQA 4ODKA 2M2AA 1FJDA 2M1IA 2MPHA 1E9LA 4S3KA 2RSEA 3CGNA 4LGXA 4P8VA 3W4RA 4DRNA 2DG4A 3KABA 5HT1A 4DRIA 2G8ZA 2LGOA 3AS1A 2F4EA 2MLYA 5DF0A 2FAPA 3O5FA 1FKFA 2A3BA 1ROTA 3EY6A 4W9QA 1XHGA 1UR9A 4WKFA 3ARWA 4DZ2A 1ROUA 4JFMA 5HTGA 2ZR5A 4ODRA 1LG1A 1D6OA 2FDMA 4WIWA 1ZBVA 1JVWA 4L72B 3O5GA 4JFLA 3WL1A 5GPRA 4NSBA 3B9AA 3WD1A 2KGJA 5DIUA 3UQIA 1JNSA 4URIA 3BXWA 4DWSA 3O5IA 2LPVA 1NWTA 1OGGA 2XPAA 1E6NA 3KAHA 1YW5A 1FAPA 1BKFA 2XP3A 4AY1A 2B5UB 4DWSB 3KACA 1HJXA 3B9EA 1T11A 1Q6UA 4Q7NA 2XP9A 4WK9A 4Z2JA 4DRJA 3PR9A 3O5LA 1EIBA 4ODQA 4PTMA 2XP7A 1NMVA 4QT2A 4GGQA 1HKKA 1QPFA 3ARRA 4QZVB 4IT6A 4P8XA 2FKEA 1LG2A 2A3CA 1GRJA 4XAKA 2ZQSA 1LJYA 3CHCA 2WM0A 4J4OA 2DT0A 2IUZA 4G50A 1UR8A 1FKKA 1QPLA 1SR0A 1X6LA 4TNSA 3B9DA 4N19A 4DT4A 5DIVA 2ZQUA 4DRHA 5GPGA 4DRKA 1QZ2A 1FKRA 1JNTA 2PI6A 4DIPA 2RUQA 5GQBA 3ARTA 2ZQTA 3CHDA 1E15A 1Q6IA 2XP6A 1W26A 3IHZA 4MAVA 1KT0A 1Y0OA 4DRPA 5B8IC 1FFRA 5JH8A 4LAWA 4WJXA 3CHFA 4NZCA 2ZQVA 3PRBA 1E6PA 1EQ3A 5HBFA 4TYOA 3KAIA 3UF8A 3KCEA 2KR7A 2AOSA 4U85A 3QOKA 3IKDA 2PV2A 3PA7A 1D2KA 4Z2IA 1IX5A 1ZL1A 3WH0A 4JFKA 1M5YA
chains in the Genus database with same CATH topology
3B7XA 1VF8A 3UQBA 5HKGA 4ODOA 1EDQA 4MSPA 1LL6A 4DZ3A 4ITZA 1HXVA 1TFVA 3AQUA 4ODMA 1FFQA 1K9TA 4LAXA 2B31A 4DH0A 1NWUA 1NWSA 1F40A 1CTNA 1H0GA 3KZ7A 1H0IA 2Q5AA 2A3AA 2YBTA 1E6ZA 1NMWA 1ZBCA 2KI3A 3ARXA 3RM8A 4L3NA 3WQWA 3ARQA 3G6LA 2XP4A 2DT3A 2XP8A 3ARVA 2G41A 2K8IA 2PPNA 2XPBA 3RFWA 1FKIA 4MNMA 3AROA 5HW8A 1LL4A 1J4IA 2DG3A 4FAPA 3JYMA 3O5MA 4IQ2A 1B6CA 4KQZA 5DITA 3RM9A 1ZBKA 2O9OA 2Y78A 2ZR4A 1KFWA 4W5UA 1RD6A 5DO2A 3CGMA 3WIJA 4GIVA 4ZPTR 1TCOC 3ARSA 4C02B 4MGVA 3IK8A 4BF8A 4ZPWR 1P5QA 3O5PA 3LUOA 3ARUA 1NWRA 4W9PA 2VN1A 3VAWA 2DSZA 1R9HA 3UQAA 4TW7A 1NSGA 1ZK6A 1N1AA 1EYMA 3OOBA 3ODKA 2O92A 3RM4A 3WD4A 5HUAA 1J6YA 1HKIA 4Q22A 4ODPA 4S3JA 1C9HA 4JYSA 1W1PA 4DROA 1L1PA 2PPOA 4DRMA 3ARYA 3CHEA 2ZR6A 4IQCA 3WL0A 2VCDA 5HWBA 4U84A 1FKBA 3KAFA 1A7XA 4DWSC 1W9PA 1D7JA 2DPEA 4HARA 2L2SA 1GOIA 1FKHA 2MNTA 1ZU8A 1E6RA 3RMEA 1PBKA 3O5EA 1J4RA 4W9OA 1WB0A 3CZ8A 3KADA 3UI5A 4KR0B 3UI6A 2LKNA 2WLZA 4Z2HA 2PBCA 2RURA 1JNEA 3O5OA 1F8AB 2IF4A 3FAPA 3JXVA 4ZPVR 1W1TA 2MLXA 1FKJA 1JNDA 4JFIA 4J4NA 3OA5A 1HKJA 2MLZA 1XRVA 4Z2LA 4G2PA 2XP5A 1PINA 2PV3A 2QF8A 1D7IA 5HWCA 2AWGA 1FKGA 4ODNA 4QIBA 5HW7A 3I6CA 3GPKA 1O6IA 5I98A 1FKTA 1X6NA 3WQVA 2DSVA 3IKGA 2PV1A 3WD3A 2DT2A 2DSWA 2DT1A 3O5RA 1Q6HA 3AS2A 3AS3A 4U86A 4WKAA 1W9UA 2YBUA 4P8UA 4DWSD 1YATA 1WNOA 3FY1A 3TDBA 3ALGA 4MNJA 2KFWA 3NTPA 2KO7A 4P8WA 4WKHA 1EHNA 3ALFA 4ZS6A 1LL7A 1FKDA 3UI4A 3G6MA 3O5DA 1BL4A 2ESCA 1FD9A 4MNKA 4TW8A 2F2DA 1OGBA 1ZB5A 4ML4A 3O5QA 1FKSA 4TX0A 1W1VA 2F21A 3O5KA 4MNLA 5DEZA 3AS0A 1HKMA 3TC5A 1GUVA 4IPXA 2JZVA 5D75A 2WK2A 2RUDA 3PRDA 2DSUA 4O2TA 2UZ5A 3WD2A 2N87A 3H9RB 2A3EA 4FN2A 3CH9A 1W1YA 4MPKA 3MDYB 2PPPA 1GPFA 3NRKA 4R0XA 2RQSA 4Z2KA 1U79A 4LAYA 1FKLA 4IT4A 1HJWA 4NNRA 2MF9A 4HBOA 1ZCNA 3B8SA 1HJVA 4LAVA 3O5JA 4MTVA 3WKZA 2OLHA 2M08A 4JFJA 4ODLA 5HW6A 2OFNA 1J4HA 4HBEA 4R5EA 1D7HA 1W9VA 2RUCA 3NI6A 2LJ4A 2KE0A 1OWQA 1Q1CA 3RGCA 3KAGA 3WD0A 5J6EA 1NH6A 1KT1A 2WLYA 4TW6A 1ITXA 1LQ0A 4Z2GA 3ARZA 3TCZA 5BXJA 1WAWA 3FXYA 2ITKA 2D9FA 3PRAA 1ZBWA 3ARPA 4QT3A 2DG9A 3JYJA 1SYTA 4DRQA 4ODKA 2M2AA 1FJDA 2M1IA 2MPHA 1E9LA 4S3KA 2RSEA 3CGNA 4LGXA 4P8VA 3W4RA 4DRNA 2DG4A 3KABA 5HT1A 4DRIA 2G8ZA 2LGOA 3AS1A 2F4EA 2MLYA 5DF0A 2FAPA 3O5FA 1FKFA 2A3BA 1ROTA 3EY6A 4W9QA 1XHGA 1UR9A 4WKFA 3ARWA 4DZ2A 1ROUA 4JFMA 5HTGA 2ZR5A 4ODRA 1LG1A 1D6OA 2FDMA 4WIWA 1ZBVA 1JVWA 4L72B 3O5GA 4JFLA 3WL1A 5GPRA 4NSBA 3B9AA 3WD1A 2KGJA 5DIUA 3UQIA 1JNSA 4URIA 3BXWA 4DWSA 3O5IA 2LPVA 1NWTA 1OGGA 2XPAA 1E6NA 3KAHA 1YW5A 1FAPA 1BKFA 2XP3A 4AY1A 4DWSB 3KACA 1HJXA 3B9EA 1T11A 1Q6UA 4Q7NA 2XP9A 4WK9A 4Z2JA 4DRJA 3PR9A 3O5LA 1EIBA 4ODQA 4PTMA 2XP7A 1NMVA 4QT2A 4GGQA 1HKKA 1QPFA 3ARRA 4QZVB 4IT6A 4P8XA 2FKEA 1LG2A 2A3CA 4XAKA 2ZQSA 1LJYA 3CHCA 2WM0A 4J4OA 2DT0A 2IUZA 4G50A 1UR8A 1FKKA 1QPLA 1SR0A 1X6LA 4TNSA 3B9DA 4N19A 4DT4A 5DIVA 2ZQUA 4DRHA 5GPGA 4DRKA 1QZ2A 1FKRA 1JNTA 2PI6A 4DIPA 2RUQA 5GQBA 3ARTA 2ZQTA 3CHDA 1E15A 1Q6IA 2XP6A 1W26A 3IHZA 4MAVA 1KT0A 1Y0OA 4DRPA 5B8IC 1FFRA 5JH8A 4LAWA 4WJXA 3CHFA 4NZCA 2ZQVA 3PRBA 1E6PA 1EQ3A 5HBFA 4TYOA 3KAIA 3UF8A 3KCEA 2KR7A 2AOSA 4U85A 3QOKA 3IKDA 2PV2A 3PA7A 1D2KA 4Z2IA 1IX5A 1ZL1A 3WH0A 4JFKA 1M5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  3B7X A;  4JFM A;  5HTG A;  2ZR5 A;  3UQB A;  4ODR A;  3TC5 A;  5HKG A;  1D6O A;  4ODO A;  1D7J A;  4IPX A;  2JZV A;  2L2S A;  5D75 A;  1FKH A;  2RUD A;  1JVW A;  4MSP A;  4DZ3 A;  2MNT A;  3PRD A;  4ITZ A;  1PBK A;  3O5G A;  4JFL A;  1HXV A;  4O2T A;  3O5E A;  1J4R A;  2UZ5 A;  4ODM A;  2KGJ A;  4W9O A;  5DIU A;  2N87 A;  3H9R B;  4FN2 A;  4LAX A;  3KAD A;  3UQI A;  4DH0 A;  1JNS A;  1F40 A;  3O5I A;  3UI5 A;  2LPV A;  3UI6 A;  2XPA A;  2PPP A;  3MDY B;  2LKN A;  3KAH A;  3KZ7 A;  1YW5 A;  1FAP A;  1BKF A;  2PBC A;  2RUR A;  2RQS A;  2XP3 A;  3NRK A;  1U79 A;  4R0X A;  3O5O A;  4LAY A;  1FKL A;  2Q5A A;  3KAC A;  1F8A B;  4NNR A;  2IF4 A;  3FAP A;  2MF9 A;  3JXV A;  1NMW A;  2KI3 A;  1ZCN A;  4LAV A;  2MLX A;  3O5J A;  2XP4 A;  1FKJ A;  4JFI A;  4J4N A;  1T11 A;  1Q6U A;  2XP8 A;  2XP9 A;  2M08 A;  4JFJ A;  4DRJ A;  4ODL A;  3O5L A;  2MLZ A;  5HW6 A;  2K8I A;  2OFN A;  4ODQ A;  2PPN A;  2XPB A;  1J4H A;  1NMV A;  2XP7 A;  3RFW A;  4G2P A;  2XP5 A;  4GGQ A;  4QT2 A;  1FKI A;  1PIN A;  1D7H A;  1QPF A;  2PV3 A;  1D7I A;  2RUC A;  5HWC A;  3NI6 A;  5HW8 A;  2FKE A;  2LJ4 A;  2AWG A;  1FKG A;  2KE0 A;  2ZQS A;  4ODN A;  4QIB A;  2DG3 A;  1J4I A;  3I6C A;  1Q1C A;  3GPK A;  4FAP A;  5HW7 A;  4J4O A;  3JYM A;  3O5M A;  4IQ2 A;  1B6C A;  3RGC A;  5DIT A;  3KAG A;  5I98 A;  4G50 A;  5J6E A;  1FKT A;  1FKK A;  1KT1 A;  1QPL A;  2Y78 A;  2ZR4 A;  4TW6 A;  4TNS A;  3IKG A;  3CGM A;  2PV1 A;  4GIV A;  4N19 A;  4DT4 A;  5DIV A;  1TCO C;  1Q6H A;  2ZQU A;  3O5R A;  3TCZ A;  4C02 B;  5BXJ A;  4MGV A;  4DRH A;  5GPG A;  4DRK A;  1QZ2 A;  2ITK A;  4U86 A;  3IK8 A;  4BF8 A;  1FKR A;  1JNT A;  2D9F A;  4DIP A;  1P5Q A;  2RUQ A;  3O5P A;  2ZQT A;  4QT3 A;  3LUO A;  1Q6I A;  2XP6 A;  1W26 A;  3IHZ A;  4U84 A;  2DG9 A;  1M5Y A;  3JYJ A;  1YAT A;  1KT0 A;  4DRQ A;  3TDB A;  1Y0O A;  4ODK A;  4DRP A;  5B8I C;  2KFW A;  3NTP A;  2KO7 A;  2M2A A;  4LAW A;  2M1I A;  1FJD A;  4W9P A;  2MPH A;  2VN1 A;  3VAW A;  2ZQV A;  3PRB A;  1R9H A;  3UQA A;  4TW7 A;  1NSG A;  1ZK6 A;  1N1A A;  1EQ3 A;  2RSE A;  1EYM A;  4TYO A;  1FKD A;  3OOB A;  3UI4 A;  3ODK A;  3KAI A;  3CGN A;  3UF8 A;  3KCE A;  4DRN A;  3O5D A;  2DG4 A;  2KR7 A;  1BL4 A;  3KAB A;  5HUA A;  4U85 A;  1FD9 A;  1J6Y A;  3IKD A;  2PV2 A;  4ODP A;  5HT1 A;  4TW8 A;  4DRI A;  1C9H A;  2LGO A;  3PA7 A;  2F4E A;  2F2D A;  2MLY A;  4JYS A;  4DRO A;  3O5Q A;  1FKS A;  2FAP A;  2PPO A;  4DRM A;  2ZR6 A;  4IQC A;  1L1P A;  3O5F A;  1FKF A;  3WH0 A;  4TX0 A;  1ROT A;  2F21 A;  2VCD A;  3EY6 A;  4W9Q A;  3O5K A;  5HWB A;  4JFK A;  1FKB A;  4DZ2 A;  1ROU A;  3KAF A; 
#chains in the Genus database with same CATH topology
 3B7X A;  1VF8 A;  3UQB A;  5HKG A;  4ODO A;  1EDQ A;  4MSP A;  1LL6 A;  4DZ3 A;  4ITZ A;  1HXV A;  1TFV A;  3AQU A;  4ODM A;  1FFQ A;  1K9T A;  4LAX A;  2B31 A;  4DH0 A;  1JCH B;  1NWU A;  1NWS A;  1F40 A;  1CTN A;  1H0G A;  3KZ7 A;  1H0I A;  2Q5A A;  2A3A A;  2YBT A;  1E6Z A;  1NMW A;  1ZBC A;  2KI3 A;  3ARX A;  3RM8 A;  4L3N A;  3WQW A;  3ARQ A;  3G6L A;  2XP4 A;  2DT3 A;  2XP8 A;  3ARV A;  2G41 A;  2K8I A;  2PPN A;  2XPB A;  3RFW A;  1FKI A;  3EIP A;  4MNM A;  3ARO A;  5HW8 A;  3GTY X;  1LL4 A;  1J4I A;  2DG3 A;  4FAP A;  3JYM A;  3O5M A;  4IQ2 A;  1B6C A;  4KQZ A;  5DIT A;  3RM9 A;  1ZBK A;  2O9O A;  2Y78 A;  2ZR4 A;  1KFW A;  4W5U A;  1RD6 A;  5DO2 A;  3CGM A;  3WIJ A;  4GIV A;  4ZPT R;  1TCO C;  3ARS A;  4C02 B;  4MGV A;  3IK8 A;  4BF8 A;  4ZPW R;  1P5Q A;  3O5P A;  2F23 A;  3LUO A;  3ARU A;  1NWR A;  4W9P A;  2VN1 A;  3VAW A;  2DSZ A;  1R9H A;  3UQA A;  4TW7 A;  1NSG A;  1ZK6 A;  1N1A A;  1EYM A;  3OOB A;  3ODK A;  2O92 A;  3RM4 A;  3WD4 A;  5HUA A;  1J6Y A;  1HKI A;  4Q22 A;  4ODP A;  4S3J A;  1C9H A;  4JYS A;  1W1P A;  4DRO A;  2EUL A;  1L1P A;  2PPO A;  4DRM A;  3ARY A;  3CHE A;  2ZR6 A;  4IQC A;  3WL0 A;  2VCD A;  5HWB A;  4U84 A;  1FKB A;  3KAF A;  1A7X A;  4DWS C;  1W9P A;  1D7J A;  2DPE A;  4HAR A;  2L2S A;  1GOI A;  1FKH A;  2MNT A;  1ZU8 A;  1E6R A;  3RME A;  1PBK A;  3O5E A;  1J4R A;  4W9O A;  1WB0 A;  3CZ8 A;  3KAD A;  4UDM A;  3UI5 A;  4KR0 B;  3UI6 A;  2LKN A;  2WLZ A;  4Z2H A;  2PBC A;  2RUR A;  1JNE A;  3O5O A;  1F8A B;  2IF4 A;  3FAP A;  3JXV A;  4ZPV R;  1W1T A;  2MLX A;  1FKJ A;  1JND A;  4JFI A;  4J4N A;  3OA5 A;  1HKJ A;  3GU0 A;  2MLZ A;  1XRV A;  4Z2L A;  4G2P A;  2XP5 A;  1PIN A;  2PV3 A;  2QF8 A;  1D7I A;  5HWC A;  2AWG A;  1FKG A;  4ODN A;  4QIB A;  5HW7 A;  3I6C A;  3GPK A;  1O6I A;  2ETN A;  5I98 A;  1FKT A;  1X6N A;  3WQV A;  2DSV A;  3IKG A;  2PV1 A;  3WD3 A;  2DT2 A;  2DSW A;  2DT1 A;  3O5R A;  1Q6H A;  3AS2 A;  3AS3 A;  4U86 A;  4WKA A;  1W9U A;  2YBU A;  4P8U A;  4DWS D;  1YAT A;  1WNO A;  3FY1 A;  3TDB A;  3ALG A;  3BMB A;  4MNJ A;  2KFW A;  3NTP A;  2KO7 A;  4P8W A;  4WKH A;  1EHN A;  3ALF A;  4ZS6 A;  1LL7 A;  1FKD A;  3UI4 A;  3G6M A;  3O5D A;  1BL4 A;  2ESC A;  1FD9 A;  4MNK A;  4TW8 A;  2F2D A;  1OGB A;  1ZB5 A;  4ML4 A;  3O5Q A;  1FKS A;  4TX0 A;  1W1V A;  2F21 A;  3O5K A;  4MNL A;  5DEZ A;  3AS0 A;  1HKM A;  3TC5 A;  1GUV A;  4IPX A;  2JZV A;  5D75 A;  2WK2 A;  2RUD A;  3PRD A;  2DSU A;  4O2T A;  2UZ5 A;  3WD2 A;  2N87 A;  3H9R B;  2A3E A;  4FN2 A;  3CH9 A;  1W1Y A;  1E44 A;  4MPK A;  3MDY B;  2PPP A;  1GPF A;  3NRK A;  4R0X A;  2P4V A;  2RQS A;  4Z2K A;  1U79 A;  4LAY A;  1FKL A;  4IT4 A;  1HJW A;  4NNR A;  2MF9 A;  4HBO A;  1ZCN A;  3B8S A;  1HJV A;  4LAV A;  3O5J A;  4MTV A;  3WKZ A;  2OLH A;  2M08 A;  4JFJ A;  4ODL A;  2PN0 A;  5HW6 A;  2OFN A;  1J4H A;  4HBE A;  4R5E A;  1D7H A;  1W9V A;  2RUC A;  3NI6 A;  2LJ4 A;  2KE0 A;  1OWQ A;  1Q1C A;  3RGC A;  3KAG A;  3WD0 A;  5J6E A;  1NH6 A;  1KT1 A;  2WLY A;  4TW6 A;  1ITX A;  1LQ0 A;  4Z2G A;  3ARZ A;  3TCZ A;  5BXJ A;  1WAW A;  3FXY A;  2ITK A;  2D9F A;  3PRA A;  1ZBW A;  3ARP A;  4QT3 A;  2DG9 A;  3JYJ A;  1SYT A;  4DRQ A;  4ODK A;  2M2A A;  1FJD A;  2M1I A;  2MPH A;  1E9L A;  4S3K A;  2RSE A;  3CGN A;  4LGX A;  4P8V A;  3W4R A;  4DRN A;  2DG4 A;  3KAB A;  5HT1 A;  4DRI A;  2G8Z A;  2LGO A;  3AS1 A;  2F4E A;  2MLY A;  5DF0 A;  2FAP A;  3O5F A;  1FKF A;  2A3B A;  1ROT A;  3EY6 A;  4W9Q A;  1XHG A;  1UR9 A;  4WKF A;  3ARW A;  4DZ2 A;  1ROU A;  4JFM A;  5HTG A;  2ZR5 A;  4ODR A;  1LG1 A;  1D6O A;  2FDM A;  4WIW A;  1ZBV A;  1JVW A;  4L72 B;  3O5G A;  4JFL A;  3WL1 A;  5GPR A;  4NSB A;  3B9A A;  3WD1 A;  2KGJ A;  5DIU A;  3UQI A;  1JNS A;  4URI A;  3BXW A;  4DWS A;  3O5I A;  2LPV A;  1NWT A;  1OGG A;  2XPA A;  1E6N A;  3KAH A;  1YW5 A;  1FAP A;  1BKF A;  2XP3 A;  4AY1 A;  2B5U B;  4DWS B;  3KAC A;  1HJX A;  3B9E A;  1T11 A;  1Q6U A;  4Q7N A;  2XP9 A;  4WK9 A;  4Z2J A;  4DRJ A;  3PR9 A;  3O5L A;  1EIB A;  4ODQ A;  4PTM A;  2XP7 A;  1NMV A;  4QT2 A;  4GGQ A;  1HKK A;  1QPF A;  3ARR A;  4QZV B;  4IT6 A;  4P8X A;  2FKE A;  1LG2 A;  2A3C A;  1GRJ A;  4XAK A;  2ZQS A;  1LJY A;  3CHC A;  2WM0 A;  4J4O A;  2DT0 A;  2IUZ A;  4G50 A;  1UR8 A;  1FKK A;  1QPL A;  1SR0 A;  1X6L A;  4TNS A;  3B9D A;  4N19 A;  4DT4 A;  5DIV A;  2ZQU A;  4DRH A;  5GPG A;  4DRK A;  1QZ2 A;  1FKR A;  1JNT A;  2PI6 A;  4DIP A;  2RUQ A;  5GQB A;  3ART A;  2ZQT A;  3CHD A;  1E15 A;  1Q6I A;  2XP6 A;  1W26 A;  3IHZ A;  4MAV A;  1KT0 A;  1Y0O A;  4DRP A;  5B8I C;  1FFR A;  5JH8 A;  4LAW A;  4WJX A;  3CHF A;  4NZC A;  2ZQV A;  3PRB A;  1E6P A;  1EQ3 A;  5HBF A;  4TYO A;  3KAI A;  3UF8 A;  3KCE A;  2KR7 A;  2AOS A;  4U85 A;  3QOK A;  3IKD A;  2PV2 A;  3PA7 A;  1D2K A;  4Z2I A;  1IX5 A;  1ZL1 A;  3WH0 A;  4JFK A;  1M5Y A; 
#chains in the Genus database with same CATH homology
 3B7X A;  1VF8 A;  3UQB A;  5HKG A;  4ODO A;  1EDQ A;  4MSP A;  1LL6 A;  4DZ3 A;  4ITZ A;  1HXV A;  1TFV A;  3AQU A;  4ODM A;  1FFQ A;  1K9T A;  4LAX A;  2B31 A;  4DH0 A;  1NWU A;  1NWS A;  1F40 A;  1CTN A;  1H0G A;  3KZ7 A;  1H0I A;  2Q5A A;  2A3A A;  2YBT A;  1E6Z A;  1NMW A;  1ZBC A;  2KI3 A;  3ARX A;  3RM8 A;  4L3N A;  3WQW A;  3ARQ A;  3G6L A;  2XP4 A;  2DT3 A;  2XP8 A;  3ARV A;  2G41 A;  2K8I A;  2PPN A;  2XPB A;  3RFW A;  1FKI A;  4MNM A;  3ARO A;  5HW8 A;  1LL4 A;  1J4I A;  2DG3 A;  4FAP A;  3JYM A;  3O5M A;  4IQ2 A;  1B6C A;  4KQZ A;  5DIT A;  3RM9 A;  1ZBK A;  2O9O A;  2Y78 A;  2ZR4 A;  1KFW A;  4W5U A;  1RD6 A;  5DO2 A;  3CGM A;  3WIJ A;  4GIV A;  4ZPT R;  1TCO C;  3ARS A;  4C02 B;  4MGV A;  3IK8 A;  4BF8 A;  4ZPW R;  1P5Q A;  3O5P A;  3LUO A;  3ARU A;  1NWR A;  4W9P A;  2VN1 A;  3VAW A;  2DSZ A;  1R9H A;  3UQA A;  4TW7 A;  1NSG A;  1ZK6 A;  1N1A A;  1EYM A;  3OOB A;  3ODK A;  2O92 A;  3RM4 A;  3WD4 A;  5HUA A;  1J6Y A;  1HKI A;  4Q22 A;  4ODP A;  4S3J A;  1C9H A;  4JYS A;  1W1P A;  4DRO A;  1L1P A;  2PPO A;  4DRM A;  3ARY A;  3CHE A;  2ZR6 A;  4IQC A;  3WL0 A;  2VCD A;  5HWB A;  4U84 A;  1FKB A;  3KAF A;  1A7X A;  4DWS C;  1W9P A;  1D7J A;  2DPE A;  4HAR A;  2L2S A;  1GOI A;  1FKH A;  2MNT A;  1ZU8 A;  1E6R A;  3RME A;  1PBK A;  3O5E A;  1J4R A;  4W9O A;  1WB0 A;  3CZ8 A;  3KAD A;  3UI5 A;  4KR0 B;  3UI6 A;  2LKN A;  2WLZ A;  4Z2H A;  2PBC A;  2RUR A;  1JNE A;  3O5O A;  1F8A B;  2IF4 A;  3FAP A;  3JXV A;  4ZPV R;  1W1T A;  2MLX A;  1FKJ A;  1JND A;  4JFI A;  4J4N A;  3OA5 A;  1HKJ A;  2MLZ A;  1XRV A;  4Z2L A;  4G2P A;  2XP5 A;  1PIN A;  2PV3 A;  2QF8 A;  1D7I A;  5HWC A;  2AWG A;  1FKG A;  4ODN A;  4QIB A;  5HW7 A;  3I6C A;  3GPK A;  1O6I A;  5I98 A;  1FKT A;  1X6N A;  3WQV A;  2DSV A;  3IKG A;  2PV1 A;  3WD3 A;  2DT2 A;  2DSW A;  2DT1 A;  3O5R A;  1Q6H A;  3AS2 A;  3AS3 A;  4U86 A;  4WKA A;  1W9U A;  2YBU A;  4P8U A;  4DWS D;  1YAT A;  1WNO A;  3FY1 A;  3TDB A;  3ALG A;  4MNJ A;  2KFW A;  3NTP A;  2KO7 A;  4P8W A;  4WKH A;  1EHN A;  3ALF A;  4ZS6 A;  1LL7 A;  1FKD A;  3UI4 A;  3G6M A;  3O5D A;  1BL4 A;  2ESC A;  1FD9 A;  4MNK A;  4TW8 A;  2F2D A;  1OGB A;  1ZB5 A;  4ML4 A;  3O5Q A;  1FKS A;  4TX0 A;  1W1V A;  2F21 A;  3O5K A;  4MNL A;  5DEZ A;  3AS0 A;  1HKM A;  3TC5 A;  1GUV A;  4IPX A;  2JZV A;  5D75 A;  2WK2 A;  2RUD A;  3PRD A;  2DSU A;  4O2T A;  2UZ5 A;  3WD2 A;  2N87 A;  3H9R B;  2A3E A;  4FN2 A;  3CH9 A;  1W1Y A;  4MPK A;  3MDY B;  2PPP A;  1GPF A;  3NRK A;  4R0X A;  2RQS A;  4Z2K A;  1U79 A;  4LAY A;  1FKL A;  4IT4 A;  1HJW A;  4NNR A;  2MF9 A;  4HBO A;  1ZCN A;  3B8S A;  1HJV A;  4LAV A;  3O5J A;  4MTV A;  3WKZ A;  2OLH A;  2M08 A;  4JFJ A;  4ODL A;  5HW6 A;  2OFN A;  1J4H A;  4HBE A;  4R5E A;  1D7H A;  1W9V A;  2RUC A;  3NI6 A;  2LJ4 A;  2KE0 A;  1OWQ A;  1Q1C A;  3RGC A;  3KAG A;  3WD0 A;  5J6E A;  1NH6 A;  1KT1 A;  2WLY A;  4TW6 A;  1ITX A;  1LQ0 A;  4Z2G A;  3ARZ A;  3TCZ A;  5BXJ A;  1WAW A;  3FXY A;  2ITK A;  2D9F A;  3PRA A;  1ZBW A;  3ARP A;  4QT3 A;  2DG9 A;  3JYJ A;  1SYT A;  4DRQ A;  4ODK A;  2M2A A;  1FJD A;  2M1I A;  2MPH A;  1E9L A;  4S3K A;  2RSE A;  3CGN A;  4LGX A;  4P8V A;  3W4R A;  4DRN A;  2DG4 A;  3KAB A;  5HT1 A;  4DRI A;  2G8Z A;  2LGO A;  3AS1 A;  2F4E A;  2MLY A;  5DF0 A;  2FAP A;  3O5F A;  1FKF A;  2A3B A;  1ROT A;  3EY6 A;  4W9Q A;  1XHG A;  1UR9 A;  4WKF A;  3ARW A;  4DZ2 A;  1ROU A;  4JFM A;  5HTG A;  2ZR5 A;  4ODR A;  1LG1 A;  1D6O A;  2FDM A;  4WIW A;  1ZBV A;  1JVW A;  4L72 B;  3O5G A;  4JFL A;  3WL1 A;  5GPR A;  4NSB A;  3B9A A;  3WD1 A;  2KGJ A;  5DIU A;  3UQI A;  1JNS A;  4URI A;  3BXW A;  4DWS A;  3O5I A;  2LPV A;  1NWT A;  1OGG A;  2XPA A;  1E6N A;  3KAH A;  1YW5 A;  1FAP A;  1BKF A;  2XP3 A;  4AY1 A;  4DWS B;  3KAC A;  1HJX A;  3B9E A;  1T11 A;  1Q6U A;  4Q7N A;  2XP9 A;  4WK9 A;  4Z2J A;  4DRJ A;  3PR9 A;  3O5L A;  1EIB A;  4ODQ A;  4PTM A;  2XP7 A;  1NMV A;  4QT2 A;  4GGQ A;  1HKK A;  1QPF A;  3ARR A;  4QZV B;  4IT6 A;  4P8X A;  2FKE A;  1LG2 A;  2A3C A;  4XAK A;  2ZQS A;  1LJY A;  3CHC A;  2WM0 A;  4J4O A;  2DT0 A;  2IUZ A;  4G50 A;  1UR8 A;  1FKK A;  1QPL A;  1SR0 A;  1X6L A;  4TNS A;  3B9D A;  4N19 A;  4DT4 A;  5DIV A;  2ZQU A;  4DRH A;  5GPG A;  4DRK A;  1QZ2 A;  1FKR A;  1JNT A;  2PI6 A;  4DIP A;  2RUQ A;  5GQB A;  3ART A;  2ZQT A;  3CHD A;  1E15 A;  1Q6I A;  2XP6 A;  1W26 A;  3IHZ A;  4MAV A;  1KT0 A;  1Y0O A;  4DRP A;  5B8I C;  1FFR A;  5JH8 A;  4LAW A;  4WJX A;  3CHF A;  4NZC A;  2ZQV A;  3PRB A;  1E6P A;  1EQ3 A;  5HBF A;  4TYO A;  3KAI A;  3UF8 A;  3KCE A;  2KR7 A;  2AOS A;  4U85 A;  3QOK A;  3IKD A;  2PV2 A;  3PA7 A;  1D2K A;  4Z2I A;  1IX5 A;  1ZL1 A;  3WH0 A;  4JFK A;  1M5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...