4DRHA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
NNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 30
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drhA00
3B7XA 4LAXA 4U84A 5DITA 4ITZA 1D6OA 2OFNA 5HUAA 4JYSA 5HWBA 3O5RA 4LAYA 1JVWA 4JFLA 1FKFA 1ZCNA 2PV3A 2XP6A 2Q5AA 1FKLA 2KO7A 2XP7A 4JFKA 2KR7A 3JYJA 1BL4A 4LAWA 4DIPA 3KAFA 1W26A 4DT4A 3PRDA 4IPXA 2MLZA 2ZQVA 3VAWA 1FKRA 4ODLA 3RFWA 5HKGA 4TW7A 1F8AB 1R9HA 2F4EA 2M2AA 2VCDA 2RSEA 1U79A 2M08A 2UZ5A 2RURA 4IQCA 2MNTA 1FKDA 4GIVA 3O5DA 2PPOA 1NSGA 4DZ3A 5HTGA 2MLXA 3UI6A 4FN2A 1ZK6A 3O5IA 4FAPA 2IF4A 1J4RA 3TDBA 1BKFA 3O5QA 5HW6A 1ROTA 3KZ7A 1Q6UA 2PV1A 2RUDA 2XP3A 1FKTA 1P5QA 3IK8A 4ODOA 4U85A 2XPAA 3IKGA 4QT2A 2MLYA 1JNTA 1YW5A 3UI5A 1JNSA 5GPGA 1HXVA 4JFIA 2ZQTA 2L2SA 2DG3A 2XPBA 3EY6A 4NNRA 4W9QA 4W9PA 4QIBA 4DZ2A 2RUCA 2FKEA 2N87A 1FKGA 3JXVA 2ZR6A 4ODNA 1YATA 1D7IA 4ODPA 2F2DA 4DRHA 1PBKA 1A7XA 2D9FA 1TCOC 3UF8A 1L1PA 3KAHA 1FKHA 3LUOA 3TCZA 2KE0A 4JFJA 5HWCA 4C02B 1FKBA 1PINA 2AWGA 2XP8A 1B6CA 1FAPA 2RQSA 1FKIA 4DRMA 1M5YA 2DG9A 4QT3A 3KADA 5HW8A 1D7JA 1Y0OA 3UQBA 3KABA 3PA7A 2ITKA 1ROUA 3WH0A 3UQIA 5J6EA 2F21A 3NI6A 3O5PA 3OOBA 4ODQA 4TX0A 2FAPA 1QZ2A 2KFWA 4DRNA 2ZQSA 5HT1A 2PBCA 4DRIA 4R0XA 2KI3A 2LJ4A 4O2TA 1KT1A 4W9OA 4G2PA 4MSPA 3UQAA 1FD9A 3NRKA 3O5FA 3CGNA 3GPKA 4MGVA 4DH0A 1FKSA 5HW7A 4N19A 2LGOA 3KAGA 3KAIA 3RGCA 4DRKA 2XP4A 2XP5A 2KGJA 4BF8A 4JFMA 1T11A 4GGQA 4U86A 3KCEA 3KACA 1QPLA 1FJDA 2ZR5A 4LAVA 3TC5A 1N1AA 2VN1A 2ZR4A 3O5LA 4IQ2A 3O5OA 1EQ3A 2LPVA 2DG4A 2XP9A 3ODKA 4DRQA 3FAPA 1J4HA 4ODRA 1NMWA 1Q6IA 3I6CA 5B8IC 1FKJA 1FKKA 3IKDA 3NTPA 4ODKA 2PPPA 4J4OA 1KT0A 2JZVA 2Y78A 2RUQA 1F40A 3O5KA 2ZQUA 3JYMA 3MDYB 5DIUA 4G50A 1D7HA 2MPHA 4DROA 2LKNA 5DIVA 3PRBA 3O5GA 2M1IA 3O5MA 1NMVA 3IHZA 4TNSA 5BXJA 1J4IA 1J6YA 1Q6HA 1C9HA 3CGMA 4DRJA 2K8IA 1EYMA 4J4NA 2PV2A 1QPFA 5I98A 3O5EA 2PPNA 4TW8A 4TW6A 4TYOA 2MF9A 3UI4A 1Q1CA 3H9RB 4DRPA 3O5JA 4ODMA 5D75A
chains in the Genus database with same CATH superfamily
2A3EA 3ARVA 1D6OA 1UR9A 3O5RA 4L72B 1ZCNA 3PR9A 2Q5AA 3JYJA 1BL4A 3KAFA 3PRDA 4IPXA 1NWRA 3ARYA 3VAWA 4ODLA 1WNOA 5HKGA 2MNTA 2MLXA 4KR0B 2IF4A 2P4VA 1ROTA 2OLHA 3KZ7A 2PV1A 1FKTA 1P5QA 2XPAA 1TFVA 1XRVA 2QF8A 4Q22A 3EY6A 4W9QA 4WK9A 1SR0A 1CTNA 2RUCA 1FKGA 3JXVA 4S3KA 2DT0A 4Z2IA 3AS0A 2D9FA 1TCOC 1LL4A 3WD2A 1OGGA 3ARTA 3LUOA 1GOIA 2KE0A 4C02B 1PINA 2AWGA 3RM4A 2DG9A 4ML4A 3CHFA 3B9AA 1D7JA 2ESCA 5J6EA 3OOBA 4TX0A 4ODQA 2KFWA 3B9DA 4O2TA 4G2PA 4MSPA 4LGXA 1FKSA 2LGOA 2XP4A 3ARUA 2KGJA 2WLZA 3OA5A 3ALFA 2A3AA 3AROA 2DPEA 2ZR5A 3TC5A 3O5LA 4IQ2A 1ZBVA 3WD4A 2LPVA 2ETNA 2XP9A 4Z2JA 3CHCA 1FKJA 2WLYA 1KT0A 2Y78A 2YBTA 5DIUA 1W1YA 4G50A 1HJWA 4NSBA 5DIVA 3O5MA 1J4IA 2DSVA 1W1VA 1EYMA 4WKFA 2PPNA 4TW6A 3UI4A 1FFQA 5D75A 3B7XA 4DWSD 4LAXA 4ITZA 4Q7NA 1W1TA 4S3JA 1GRJA 2KO7A 1HKMA 2ZQVA 1ZBKA 1FKRA 3RFWA 1F8AB 2F4EA 2M2AA 2RSEA 2DSUA 4IQCA 4DZ3A 5HTGA 3UI6A 3AQUA 4FN2A 1ZK6A 3CZ8A 4FAPA 4DWSA 4MNKA 4KQZA 5GPRA 5HW6A 1WAWA 1Q6UA 2XP3A 4HBEA 1XHGA 3B9EA 3IK8A 1EHNA 3IKGA 4QT2A 2AOSA 1JNSA 2XPBA 4QIBA 2N87A 4Z2KA 1GPFA 1YATA 3GTYX 3CHEA 1E9LA 1LG2A 1EIBA 2B5UB 5HWCA 1W1PA 2XP8A 1FAPA 4DRMA 1M5YA 1E44A 1UR8A 3KADA 4W5UA 3AS3A 3KABA 5JH8A 2DT1A 3O5PA 4NZCA 2FAPA 4ZS6A 2ZQSA 5DEZA 5HT1A 2KI3A 4W9OA 1KT1A 3WD1A 3UQAA 3NRKA 3CGNA 5HW7A 3KAGA 4Z2HA 1LG1A 3WKZA 4Z2GA 2IUZA 1T11A 4GGQA 1JNEA 2EULA 1QPLA 3G6MA 1FJDA 2ZR4A 2DG4A 4WKHA 4DWSC 3ARZA 3ODKA 3RMEA 1J4HA 1H0IA 3I6CA 4ZPWR 2PN0A 3NTPA 3IKDA 4P8VA 1JCHB 4J4OA 2RUQA 1F40A 3JYMA 4MAVA 1D7HA 2MPHA 3O5GA 1NMVA 4TNSA 1J6YA 2A3BA 2K8IA 2DSZA 1QPFA 3B8SA 4TYOA 1Q1CA 5GQBA 4DZ2A 3TDBA 4ODMA 4ZPTR 1FFRA 4U84A 5DITA 2OFNA 5HWBA 4LAYA 4P8WA 4JFLA 4IT6A 2PV3A 1FKLA 1ITXA 1ZB5A 4JFKA 3CH9A 3G6LA 1OGBA 3WL0A 3ARRA 1E6ZA 2MLZA 2WK2A 3ARXA 1HKIA 4TW7A 4MNMA 2M08A 1GUVA 1X6LA 4GIVA 3FY1A 1NSGA 4P8XA 1VF8A 3O5QA 2RUDA 4ODOA 3WD0A 4U85A 4MNLA 1OWQA 3UI5A 1O6IA 5GPGA 4JFIA 2ZQTA 4W9PA 2FKEA 2ZR6A 4ODPA 1D7IA 2F2DA 1PBKA 4L3NA 3ARQA 1FKHA 3TCZA 1ZL1A 4JFJA 1NWSA 1B6CA 5DO2A 4QT3A 1Y0OA 2ITKA 4WKAA 1ROUA 5HBFA 3UQIA 2F21A 3NI6A 2O92A 4DRNA 1K9TA 2PBCA 4DWSB 4DRIA 1W9VA 2LJ4A 1HXVA 1FD9A 1E6PA 3O5FA 3GPKA 4DH0A 4N19A 3RGCA 2XP5A 3ARWA 4MTVA 4BF8A 1KFWA 3ARSA 3W4RA 4U86A 3KACA 3CHDA 4LAVA 1N1AA 3O5OA 2G8ZA 1EQ3A 3ALGA 3BXWA 4ODRA 1NMWA 1WB0A 1Q6IA 1FKKA 1W9PA 3AS2A 1HJXA 3WQWA 3O5KA 3MDYB 1RD6A 2A3CA 3IHZA 1Q6HA 1C9HA 4DRJA 3RM8A 1HKJA 2PV2A 4QZVB 4DRPA 3O5JA 1D2KA 4XAKA 2F23A 3RM9A 5HUAA 4JYSA 3WD3A 1JVWA 1FKFA 1NWTA 2XP6A 2XP7A 2FDMA 2KR7A 4LAWA 4DIPA 4DT4A 1W26A 4HBOA 1R9HA 2VCDA 1U79A 2UZ5A 2RURA 1LJYA 1FKDA 3O5DA 1LQ0A 2PPOA 2YBUA 4MNJA 4R5EA 2DT2A 1ZU8A 3O5IA 4AY1A 3QOKA 1J4RA 1JNDA 1BKFA 4Z2LA 1LL7A 3EIPA 2MLYA 1JNTA 1YW5A 2L2SA 2DG3A 1HJVA 4NNRA 1HKKA 2O9OA 4ODNA 1X6NA 4DRHA 1ZBWA 1A7XA 3UF8A 1L1PA 1IX5A 3KAHA 1E6RA 3BMBA 4URIA 1SYTA 1FKBA 3AS1A 2RQSA 1FKIA 1W9UA 5HW8A 2B31A 2G41A 3UQBA 3PA7A 4WIWA 3WH0A 2WM0A 3WIJA 1EDQA 1LL6A 1NWUA 1QZ2A 4R0XA 2DT3A 4MGVA 1E6NA 4DRKA 3KAIA 3ARPA 3WL1A 4P8UA 4JFMA 3KCEA 3WQVA 5DF0A 2PI6A 2VN1A 1NH6A 4DRQA 3FAPA 3FXYA 3PRAA 5B8IC 4ODKA 1ZBCA 2PPPA 2JZVA 4UDMA 4ZPVR 2ZQUA 1E15A 2DSWA 4DROA 2LKNA 3PRBA 2M1IA 5BXJA 3CGMA 4WJXA 3GU0A 4IT4A 4J4NA 4HARA 4MPKA 5I98A 3O5EA 4TW8A 4PTMA 2MF9A 3H9RB 1H0GA
chains in the Genus database with same CATH topology
2A3EA 3ARVA 1D6OA 1UR9A 3O5RA 4L72B 1ZCNA 3PR9A 2Q5AA 3JYJA 1BL4A 3KAFA 3PRDA 4IPXA 1NWRA 3ARYA 3VAWA 4ODLA 1WNOA 5HKGA 2MNTA 2MLXA 4KR0B 2IF4A 1ROTA 2OLHA 3KZ7A 2PV1A 1FKTA 1P5QA 2XPAA 1TFVA 1XRVA 2QF8A 4Q22A 3EY6A 4W9QA 4WK9A 1SR0A 1CTNA 2RUCA 1FKGA 3JXVA 4S3KA 2DT0A 4Z2IA 3AS0A 2D9FA 1TCOC 1LL4A 3WD2A 1OGGA 3ARTA 3LUOA 1GOIA 2KE0A 4C02B 1PINA 2AWGA 3RM4A 2DG9A 4ML4A 3CHFA 3B9AA 1D7JA 2ESCA 5J6EA 3OOBA 4TX0A 4ODQA 2KFWA 3B9DA 4O2TA 4G2PA 4MSPA 4LGXA 1FKSA 2LGOA 2XP4A 3ARUA 2KGJA 2WLZA 3OA5A 3ALFA 2A3AA 3AROA 2DPEA 2ZR5A 3TC5A 3O5LA 4IQ2A 1ZBVA 3WD4A 2LPVA 2XP9A 4Z2JA 3CHCA 1FKJA 2WLYA 1KT0A 2Y78A 2YBTA 5DIUA 1W1YA 4G50A 1HJWA 4NSBA 5DIVA 3O5MA 1J4IA 2DSVA 1W1VA 1EYMA 4WKFA 2PPNA 4TW6A 3UI4A 1FFQA 5D75A 3B7XA 4DWSD 4LAXA 4ITZA 4Q7NA 1W1TA 4S3JA 2KO7A 1HKMA 2ZQVA 1ZBKA 1FKRA 3RFWA 1F8AB 2F4EA 2M2AA 2RSEA 2DSUA 4IQCA 4DZ3A 5HTGA 3UI6A 3AQUA 4FN2A 1ZK6A 3CZ8A 4FAPA 4DWSA 4MNKA 4KQZA 5GPRA 5HW6A 1WAWA 1Q6UA 2XP3A 4HBEA 1XHGA 3B9EA 3IK8A 1EHNA 3IKGA 4QT2A 2AOSA 1JNSA 2XPBA 4QIBA 2N87A 4Z2KA 1GPFA 1YATA 3CHEA 1E9LA 1LG2A 1EIBA 5HWCA 1W1PA 2XP8A 1FAPA 4DRMA 1M5YA 1UR8A 3KADA 4W5UA 3AS3A 3KABA 5JH8A 2DT1A 3O5PA 4NZCA 2FAPA 4ZS6A 2ZQSA 5DEZA 5HT1A 2KI3A 4W9OA 1KT1A 3WD1A 3UQAA 3NRKA 3CGNA 5HW7A 3KAGA 4Z2HA 1LG1A 3WKZA 4Z2GA 2IUZA 1T11A 4GGQA 1JNEA 1QPLA 3G6MA 1FJDA 2ZR4A 2DG4A 4WKHA 4DWSC 3ARZA 3ODKA 3RMEA 1J4HA 1H0IA 3I6CA 4ZPWR 3NTPA 3IKDA 4P8VA 4J4OA 2RUQA 1F40A 3JYMA 4MAVA 1D7HA 2MPHA 3O5GA 1NMVA 4TNSA 1J6YA 2A3BA 2K8IA 2DSZA 1QPFA 3B8SA 4TYOA 1Q1CA 5GQBA 4DZ2A 3TDBA 4ODMA 4ZPTR 1FFRA 4U84A 5DITA 2OFNA 5HWBA 4LAYA 4P8WA 4JFLA 4IT6A 2PV3A 1FKLA 1ITXA 1ZB5A 4JFKA 3CH9A 3G6LA 1OGBA 3WL0A 3ARRA 1E6ZA 2MLZA 2WK2A 3ARXA 1HKIA 4TW7A 4MNMA 2M08A 1GUVA 1X6LA 4GIVA 3FY1A 1NSGA 4P8XA 1VF8A 3O5QA 2RUDA 4ODOA 3WD0A 4U85A 4MNLA 1OWQA 3UI5A 1O6IA 5GPGA 4JFIA 2ZQTA 4W9PA 2FKEA 2ZR6A 4ODPA 1D7IA 2F2DA 1PBKA 4L3NA 3ARQA 1FKHA 3TCZA 1ZL1A 4JFJA 1NWSA 1B6CA 5DO2A 4QT3A 1Y0OA 2ITKA 4WKAA 1ROUA 5HBFA 3UQIA 2F21A 3NI6A 2O92A 4DRNA 1K9TA 2PBCA 4DWSB 4DRIA 1W9VA 2LJ4A 1HXVA 1FD9A 1E6PA 3O5FA 3GPKA 4DH0A 4N19A 3RGCA 2XP5A 3ARWA 4MTVA 4BF8A 1KFWA 3ARSA 3W4RA 4U86A 3KACA 3CHDA 4LAVA 1N1AA 3O5OA 2G8ZA 1EQ3A 3ALGA 3BXWA 4ODRA 1NMWA 1WB0A 1Q6IA 1FKKA 1W9PA 3AS2A 1HJXA 3WQWA 3O5KA 3MDYB 1RD6A 2A3CA 3IHZA 1Q6HA 1C9HA 4DRJA 3RM8A 1HKJA 2PV2A 4QZVB 4DRPA 3O5JA 1D2KA 4XAKA 3RM9A 5HUAA 4JYSA 3WD3A 1JVWA 1FKFA 1NWTA 2XP6A 2XP7A 2FDMA 2KR7A 4LAWA 4DIPA 4DT4A 1W26A 4HBOA 1R9HA 2VCDA 1U79A 2UZ5A 2RURA 1LJYA 1FKDA 3O5DA 1LQ0A 2PPOA 2YBUA 4MNJA 4R5EA 2DT2A 1ZU8A 3O5IA 4AY1A 3QOKA 1J4RA 1JNDA 1BKFA 4Z2LA 1LL7A 2MLYA 1JNTA 1YW5A 2L2SA 2DG3A 1HJVA 4NNRA 1HKKA 2O9OA 4ODNA 1X6NA 4DRHA 1ZBWA 1A7XA 3UF8A 1L1PA 1IX5A 3KAHA 1E6RA 4URIA 1SYTA 1FKBA 3AS1A 2RQSA 1FKIA 1W9UA 5HW8A 2B31A 2G41A 3UQBA 3PA7A 4WIWA 3WH0A 2WM0A 3WIJA 1EDQA 1LL6A 1NWUA 1QZ2A 4R0XA 2DT3A 4MGVA 1E6NA 4DRKA 3KAIA 3ARPA 3WL1A 4P8UA 4JFMA 3KCEA 3WQVA 5DF0A 2PI6A 2VN1A 1NH6A 4DRQA 3FAPA 3FXYA 3PRAA 5B8IC 4ODKA 1ZBCA 2PPPA 2JZVA 4ZPVR 2ZQUA 1E15A 2DSWA 4DROA 2LKNA 3PRBA 2M1IA 5BXJA 3CGMA 4WJXA 4IT4A 4J4NA 4HARA 4MPKA 5I98A 3O5EA 4TW8A 4PTMA 2MF9A 3H9RB 1H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7X A;  4LAX A;  4U84 A;  5DIT A;  4ITZ A;  1D6O A;  2OFN A;  5HUA A;  4JYS A;  5HWB A;  3O5R A;  4LAY A;  1JVW A;  4JFL A;  1FKF A;  1ZCN A;  2PV3 A;  2XP6 A;  2Q5A A;  1FKL A;  2KO7 A;  2XP7 A;  4JFK A;  2KR7 A;  3JYJ A;  1BL4 A;  4LAW A;  4DIP A;  3KAF A;  1W26 A;  4DT4 A;  3PRD A;  4IPX A;  2MLZ A;  2ZQV A;  3VAW A;  1FKR A;  4ODL A;  3RFW A;  5HKG A;  4TW7 A;  1F8A B;  1R9H A;  2F4E A;  2M2A A;  2VCD A;  2RSE A;  1U79 A;  2M08 A;  2UZ5 A;  2RUR A;  4IQC A;  2MNT A;  1FKD A;  4GIV A;  3O5D A;  2PPO A;  1NSG A;  4DZ3 A;  5HTG A;  2MLX A;  3UI6 A;  4FN2 A;  1ZK6 A;  3O5I A;  4FAP A;  2IF4 A;  1J4R A;  3TDB A;  1BKF A;  3O5Q A;  5HW6 A;  1ROT A;  3KZ7 A;  1Q6U A;  2PV1 A;  2RUD A;  2XP3 A;  1FKT A;  1P5Q A;  3IK8 A;  4ODO A;  4U85 A;  2XPA A;  3IKG A;  4QT2 A;  2MLY A;  1JNT A;  1YW5 A;  3UI5 A;  1JNS A;  5GPG A;  1HXV A;  4JFI A;  2ZQT A;  2L2S A;  2DG3 A;  2XPB A;  3EY6 A;  4NNR A;  4W9Q A;  4W9P A;  4QIB A;  4DZ2 A;  2RUC A;  2FKE A;  2N87 A;  1FKG A;  3JXV A;  2ZR6 A;  4ODN A;  1YAT A;  1D7I A;  4ODP A;  2F2D A;  4DRH A;  1PBK A;  1A7X A;  2D9F A;  1TCO C;  3UF8 A;  1L1P A;  3KAH A;  1FKH A;  3LUO A;  3TCZ A;  2KE0 A;  4JFJ A;  5HWC A;  4C02 B;  1FKB A;  1PIN A;  2AWG A;  2XP8 A;  1B6C A;  1FAP A;  2RQS A;  1FKI A;  4DRM A;  1M5Y A;  2DG9 A;  4QT3 A;  3KAD A;  5HW8 A;  1D7J A;  1Y0O A;  3UQB A;  3KAB A;  3PA7 A;  2ITK A;  1ROU A;  3WH0 A;  3UQI A;  5J6E A;  2F21 A;  3NI6 A;  3O5P A;  3OOB A;  4ODQ A;  4TX0 A;  2FAP A;  1QZ2 A;  2KFW A;  4DRN A;  2ZQS A;  5HT1 A;  2PBC A;  4DRI A;  4R0X A;  2KI3 A;  2LJ4 A;  4O2T A;  1KT1 A;  4W9O A;  4G2P A;  4MSP A;  3UQA A;  1FD9 A;  3NRK A;  3O5F A;  3CGN A;  3GPK A;  4MGV A;  4DH0 A;  1FKS A;  5HW7 A;  4N19 A;  2LGO A;  3KAG A;  3KAI A;  3RGC A;  4DRK A;  2XP4 A;  2XP5 A;  2KGJ A;  4BF8 A;  4JFM A;  1T11 A;  4GGQ A;  4U86 A;  3KCE A;  3KAC A;  1QPL A;  1FJD A;  2ZR5 A;  4LAV A;  3TC5 A;  1N1A A;  2VN1 A;  2ZR4 A;  3O5L A;  4IQ2 A;  3O5O A;  1EQ3 A;  2LPV A;  2DG4 A;  2XP9 A;  3ODK A;  4DRQ A;  3FAP A;  1J4H A;  4ODR A;  1NMW A;  1Q6I A;  3I6C A;  5B8I C;  1FKJ A;  1FKK A;  3IKD A;  3NTP A;  4ODK A;  2PPP A;  4J4O A;  1KT0 A;  2JZV A;  2Y78 A;  2RUQ A;  1F40 A;  3O5K A;  2ZQU A;  3JYM A;  3MDY B;  5DIU A;  4G50 A;  1D7H A;  2MPH A;  4DRO A;  2LKN A;  5DIV A;  3PRB A;  3O5G A;  2M1I A;  3O5M A;  1NMV A;  3IHZ A;  4TNS A;  5BXJ A;  1J4I A;  1J6Y A;  1Q6H A;  1C9H A;  3CGM A;  4DRJ A;  2K8I A;  1EYM A;  4J4N A;  2PV2 A;  1QPF A;  5I98 A;  3O5E A;  2PPN A;  4TW8 A;  4TW6 A;  4TYO A;  2MF9 A;  3UI4 A;  1Q1C A;  3H9R B;  4DRP A;  3O5J A;  4ODM A;  5D75 A; 
#chains in the Genus database with same CATH topology
 2A3E A;  3ARV A;  1D6O A;  1UR9 A;  3O5R A;  4L72 B;  1ZCN A;  3PR9 A;  2Q5A A;  3JYJ A;  1BL4 A;  3KAF A;  3PRD A;  4IPX A;  1NWR A;  3ARY A;  3VAW A;  4ODL A;  1WNO A;  5HKG A;  2MNT A;  2MLX A;  4KR0 B;  2IF4 A;  2P4V A;  1ROT A;  2OLH A;  3KZ7 A;  2PV1 A;  1FKT A;  1P5Q A;  2XPA A;  1TFV A;  1XRV A;  2QF8 A;  4Q22 A;  3EY6 A;  4W9Q A;  4WK9 A;  1SR0 A;  1CTN A;  2RUC A;  1FKG A;  3JXV A;  4S3K A;  2DT0 A;  4Z2I A;  3AS0 A;  2D9F A;  1TCO C;  1LL4 A;  3WD2 A;  1OGG A;  3ART A;  3LUO A;  1GOI A;  2KE0 A;  4C02 B;  1PIN A;  2AWG A;  3RM4 A;  2DG9 A;  4ML4 A;  3CHF A;  3B9A A;  1D7J A;  2ESC A;  5J6E A;  3OOB A;  4TX0 A;  4ODQ A;  2KFW A;  3B9D A;  4O2T A;  4G2P A;  4MSP A;  4LGX A;  1FKS A;  2LGO A;  2XP4 A;  3ARU A;  2KGJ A;  2WLZ A;  3OA5 A;  3ALF A;  2A3A A;  3ARO A;  2DPE A;  2ZR5 A;  3TC5 A;  3O5L A;  4IQ2 A;  1ZBV A;  3WD4 A;  2LPV A;  2ETN A;  2XP9 A;  4Z2J A;  3CHC A;  1FKJ A;  2WLY A;  1KT0 A;  2Y78 A;  2YBT A;  5DIU A;  1W1Y A;  4G50 A;  1HJW A;  4NSB A;  5DIV A;  3O5M A;  1J4I A;  2DSV A;  1W1V A;  1EYM A;  4WKF A;  2PPN A;  4TW6 A;  3UI4 A;  1FFQ A;  5D75 A;  3B7X A;  4DWS D;  4LAX A;  4ITZ A;  4Q7N A;  1W1T A;  4S3J A;  1GRJ A;  2KO7 A;  1HKM A;  2ZQV A;  1ZBK A;  1FKR A;  3RFW A;  1F8A B;  2F4E A;  2M2A A;  2RSE A;  2DSU A;  4IQC A;  4DZ3 A;  5HTG A;  3UI6 A;  3AQU A;  4FN2 A;  1ZK6 A;  3CZ8 A;  4FAP A;  4DWS A;  4MNK A;  4KQZ A;  5GPR A;  5HW6 A;  1WAW A;  1Q6U A;  2XP3 A;  4HBE A;  1XHG A;  3B9E A;  3IK8 A;  1EHN A;  3IKG A;  4QT2 A;  2AOS A;  1JNS A;  2XPB A;  4QIB A;  2N87 A;  4Z2K A;  1GPF A;  1YAT A;  3GTY X;  3CHE A;  1E9L A;  1LG2 A;  1EIB A;  2B5U B;  5HWC A;  1W1P A;  2XP8 A;  1FAP A;  4DRM A;  1M5Y A;  1E44 A;  1UR8 A;  3KAD A;  4W5U A;  3AS3 A;  3KAB A;  5JH8 A;  2DT1 A;  3O5P A;  4NZC A;  2FAP A;  4ZS6 A;  2ZQS A;  5DEZ A;  5HT1 A;  2KI3 A;  4W9O A;  1KT1 A;  3WD1 A;  3UQA A;  3NRK A;  3CGN A;  5HW7 A;  3KAG A;  4Z2H A;  1LG1 A;  3WKZ A;  4Z2G A;  2IUZ A;  1T11 A;  4GGQ A;  1JNE A;  2EUL A;  1QPL A;  3G6M A;  1FJD A;  2ZR4 A;  2DG4 A;  4WKH A;  4DWS C;  3ARZ A;  3ODK A;  3RME A;  1J4H A;  1H0I A;  3I6C A;  4ZPW R;  2PN0 A;  3NTP A;  3IKD A;  4P8V A;  1JCH B;  4J4O A;  2RUQ A;  1F40 A;  3JYM A;  4MAV A;  1D7H A;  2MPH A;  3O5G A;  1NMV A;  4TNS A;  1J6Y A;  2A3B A;  2K8I A;  2DSZ A;  1QPF A;  3B8S A;  4TYO A;  1Q1C A;  5GQB A;  4DZ2 A;  3TDB A;  4ODM A;  4ZPT R;  1FFR A;  4U84 A;  5DIT A;  2OFN A;  5HWB A;  4LAY A;  4P8W A;  4JFL A;  4IT6 A;  2PV3 A;  1FKL A;  1ITX A;  1ZB5 A;  4JFK A;  3CH9 A;  3G6L A;  1OGB A;  3WL0 A;  3ARR A;  1E6Z A;  2MLZ A;  2WK2 A;  3ARX A;  1HKI A;  4TW7 A;  4MNM A;  2M08 A;  1GUV A;  1X6L A;  4GIV A;  3FY1 A;  1NSG A;  4P8X A;  1VF8 A;  3O5Q A;  2RUD A;  4ODO A;  3WD0 A;  4U85 A;  4MNL A;  1OWQ A;  3UI5 A;  1O6I A;  5GPG A;  4JFI A;  2ZQT A;  4W9P A;  2FKE A;  2ZR6 A;  4ODP A;  1D7I A;  2F2D A;  1PBK A;  4L3N A;  3ARQ A;  1FKH A;  3TCZ A;  1ZL1 A;  4JFJ A;  1NWS A;  1B6C A;  5DO2 A;  4QT3 A;  1Y0O A;  2ITK A;  4WKA A;  1ROU A;  5HBF A;  3UQI A;  2F21 A;  3NI6 A;  2O92 A;  4DRN A;  1K9T A;  2PBC A;  4DWS B;  4DRI A;  1W9V A;  2LJ4 A;  1HXV A;  1FD9 A;  1E6P A;  3O5F A;  3GPK A;  4DH0 A;  4N19 A;  3RGC A;  2XP5 A;  3ARW A;  4MTV A;  4BF8 A;  1KFW A;  3ARS A;  3W4R A;  4U86 A;  3KAC A;  3CHD A;  4LAV A;  1N1A A;  3O5O A;  2G8Z A;  1EQ3 A;  3ALG A;  3BXW A;  4ODR A;  1NMW A;  1WB0 A;  1Q6I A;  1FKK A;  1W9P A;  3AS2 A;  1HJX A;  3WQW A;  3O5K A;  3MDY B;  1RD6 A;  2A3C A;  3IHZ A;  1Q6H A;  1C9H A;  4DRJ A;  3RM8 A;  1HKJ A;  2PV2 A;  4QZV B;  4DRP A;  3O5J A;  1D2K A;  4XAK A;  2F23 A;  3RM9 A;  5HUA A;  4JYS A;  3WD3 A;  1JVW A;  1FKF A;  1NWT A;  2XP6 A;  2XP7 A;  2FDM A;  2KR7 A;  4LAW A;  4DIP A;  4DT4 A;  1W26 A;  4HBO A;  1R9H A;  2VCD A;  1U79 A;  2UZ5 A;  2RUR A;  1LJY A;  1FKD A;  3O5D A;  1LQ0 A;  2PPO A;  2YBU A;  4MNJ A;  4R5E A;  2DT2 A;  1ZU8 A;  3O5I A;  4AY1 A;  3QOK A;  1J4R A;  1JND A;  1BKF A;  4Z2L A;  1LL7 A;  3EIP A;  2MLY A;  1JNT A;  1YW5 A;  2L2S A;  2DG3 A;  1HJV A;  4NNR A;  1HKK A;  2O9O A;  4ODN A;  1X6N A;  4DRH A;  1ZBW A;  1A7X A;  3UF8 A;  1L1P A;  1IX5 A;  3KAH A;  1E6R A;  3BMB A;  4URI A;  1SYT A;  1FKB A;  3AS1 A;  2RQS A;  1FKI A;  1W9U A;  5HW8 A;  2B31 A;  2G41 A;  3UQB A;  3PA7 A;  4WIW A;  3WH0 A;  2WM0 A;  3WIJ A;  1EDQ A;  1LL6 A;  1NWU A;  1QZ2 A;  4R0X A;  2DT3 A;  4MGV A;  1E6N A;  4DRK A;  3KAI A;  3ARP A;  3WL1 A;  4P8U A;  4JFM A;  3KCE A;  3WQV A;  5DF0 A;  2PI6 A;  2VN1 A;  1NH6 A;  4DRQ A;  3FAP A;  3FXY A;  3PRA A;  5B8I C;  4ODK A;  1ZBC A;  2PPP A;  2JZV A;  4UDM A;  4ZPV R;  2ZQU A;  1E15 A;  2DSW A;  4DRO A;  2LKN A;  3PRB A;  2M1I A;  5BXJ A;  3CGM A;  4WJX A;  3GU0 A;  4IT4 A;  4J4N A;  4HAR A;  4MPK A;  5I98 A;  3O5E A;  4TW8 A;  4PTM A;  2MF9 A;  3H9R B;  1H0G A; 
#chains in the Genus database with same CATH homology
 2A3E A;  3ARV A;  1D6O A;  1UR9 A;  3O5R A;  4L72 B;  1ZCN A;  3PR9 A;  2Q5A A;  3JYJ A;  1BL4 A;  3KAF A;  3PRD A;  4IPX A;  1NWR A;  3ARY A;  3VAW A;  4ODL A;  1WNO A;  5HKG A;  2MNT A;  2MLX A;  4KR0 B;  2IF4 A;  1ROT A;  2OLH A;  3KZ7 A;  2PV1 A;  1FKT A;  1P5Q A;  2XPA A;  1TFV A;  1XRV A;  2QF8 A;  4Q22 A;  3EY6 A;  4W9Q A;  4WK9 A;  1SR0 A;  1CTN A;  2RUC A;  1FKG A;  3JXV A;  4S3K A;  2DT0 A;  4Z2I A;  3AS0 A;  2D9F A;  1TCO C;  1LL4 A;  3WD2 A;  1OGG A;  3ART A;  3LUO A;  1GOI A;  2KE0 A;  4C02 B;  1PIN A;  2AWG A;  3RM4 A;  2DG9 A;  4ML4 A;  3CHF A;  3B9A A;  1D7J A;  2ESC A;  5J6E A;  3OOB A;  4TX0 A;  4ODQ A;  2KFW A;  3B9D A;  4O2T A;  4G2P A;  4MSP A;  4LGX A;  1FKS A;  2LGO A;  2XP4 A;  3ARU A;  2KGJ A;  2WLZ A;  3OA5 A;  3ALF A;  2A3A A;  3ARO A;  2DPE A;  2ZR5 A;  3TC5 A;  3O5L A;  4IQ2 A;  1ZBV A;  3WD4 A;  2LPV A;  2XP9 A;  4Z2J A;  3CHC A;  1FKJ A;  2WLY A;  1KT0 A;  2Y78 A;  2YBT A;  5DIU A;  1W1Y A;  4G50 A;  1HJW A;  4NSB A;  5DIV A;  3O5M A;  1J4I A;  2DSV A;  1W1V A;  1EYM A;  4WKF A;  2PPN A;  4TW6 A;  3UI4 A;  1FFQ A;  5D75 A;  3B7X A;  4DWS D;  4LAX A;  4ITZ A;  4Q7N A;  1W1T A;  4S3J A;  2KO7 A;  1HKM A;  2ZQV A;  1ZBK A;  1FKR A;  3RFW A;  1F8A B;  2F4E A;  2M2A A;  2RSE A;  2DSU A;  4IQC A;  4DZ3 A;  5HTG A;  3UI6 A;  3AQU A;  4FN2 A;  1ZK6 A;  3CZ8 A;  4FAP A;  4DWS A;  4MNK A;  4KQZ A;  5GPR A;  5HW6 A;  1WAW A;  1Q6U A;  2XP3 A;  4HBE A;  1XHG A;  3B9E A;  3IK8 A;  1EHN A;  3IKG A;  4QT2 A;  2AOS A;  1JNS A;  2XPB A;  4QIB A;  2N87 A;  4Z2K A;  1GPF A;  1YAT A;  3CHE A;  1E9L A;  1LG2 A;  1EIB A;  5HWC A;  1W1P A;  2XP8 A;  1FAP A;  4DRM A;  1M5Y A;  1UR8 A;  3KAD A;  4W5U A;  3AS3 A;  3KAB A;  5JH8 A;  2DT1 A;  3O5P A;  4NZC A;  2FAP A;  4ZS6 A;  2ZQS A;  5DEZ A;  5HT1 A;  2KI3 A;  4W9O A;  1KT1 A;  3WD1 A;  3UQA A;  3NRK A;  3CGN A;  5HW7 A;  3KAG A;  4Z2H A;  1LG1 A;  3WKZ A;  4Z2G A;  2IUZ A;  1T11 A;  4GGQ A;  1JNE A;  1QPL A;  3G6M A;  1FJD A;  2ZR4 A;  2DG4 A;  4WKH A;  4DWS C;  3ARZ A;  3ODK A;  3RME A;  1J4H A;  1H0I A;  3I6C A;  4ZPW R;  3NTP A;  3IKD A;  4P8V A;  4J4O A;  2RUQ A;  1F40 A;  3JYM A;  4MAV A;  1D7H A;  2MPH A;  3O5G A;  1NMV A;  4TNS A;  1J6Y A;  2A3B A;  2K8I A;  2DSZ A;  1QPF A;  3B8S A;  4TYO A;  1Q1C A;  5GQB A;  4DZ2 A;  3TDB A;  4ODM A;  4ZPT R;  1FFR A;  4U84 A;  5DIT A;  2OFN A;  5HWB A;  4LAY A;  4P8W A;  4JFL A;  4IT6 A;  2PV3 A;  1FKL A;  1ITX A;  1ZB5 A;  4JFK A;  3CH9 A;  3G6L A;  1OGB A;  3WL0 A;  3ARR A;  1E6Z A;  2MLZ A;  2WK2 A;  3ARX A;  1HKI A;  4TW7 A;  4MNM A;  2M08 A;  1GUV A;  1X6L A;  4GIV A;  3FY1 A;  1NSG A;  4P8X A;  1VF8 A;  3O5Q A;  2RUD A;  4ODO A;  3WD0 A;  4U85 A;  4MNL A;  1OWQ A;  3UI5 A;  1O6I A;  5GPG A;  4JFI A;  2ZQT A;  4W9P A;  2FKE A;  2ZR6 A;  4ODP A;  1D7I A;  2F2D A;  1PBK A;  4L3N A;  3ARQ A;  1FKH A;  3TCZ A;  1ZL1 A;  4JFJ A;  1NWS A;  1B6C A;  5DO2 A;  4QT3 A;  1Y0O A;  2ITK A;  4WKA A;  1ROU A;  5HBF A;  3UQI A;  2F21 A;  3NI6 A;  2O92 A;  4DRN A;  1K9T A;  2PBC A;  4DWS B;  4DRI A;  1W9V A;  2LJ4 A;  1HXV A;  1FD9 A;  1E6P A;  3O5F A;  3GPK A;  4DH0 A;  4N19 A;  3RGC A;  2XP5 A;  3ARW A;  4MTV A;  4BF8 A;  1KFW A;  3ARS A;  3W4R A;  4U86 A;  3KAC A;  3CHD A;  4LAV A;  1N1A A;  3O5O A;  2G8Z A;  1EQ3 A;  3ALG A;  3BXW A;  4ODR A;  1NMW A;  1WB0 A;  1Q6I A;  1FKK A;  1W9P A;  3AS2 A;  1HJX A;  3WQW A;  3O5K A;  3MDY B;  1RD6 A;  2A3C A;  3IHZ A;  1Q6H A;  1C9H A;  4DRJ A;  3RM8 A;  1HKJ A;  2PV2 A;  4QZV B;  4DRP A;  3O5J A;  1D2K A;  4XAK A;  3RM9 A;  5HUA A;  4JYS A;  3WD3 A;  1JVW A;  1FKF A;  1NWT A;  2XP6 A;  2XP7 A;  2FDM A;  2KR7 A;  4LAW A;  4DIP A;  4DT4 A;  1W26 A;  4HBO A;  1R9H A;  2VCD A;  1U79 A;  2UZ5 A;  2RUR A;  1LJY A;  1FKD A;  3O5D A;  1LQ0 A;  2PPO A;  2YBU A;  4MNJ A;  4R5E A;  2DT2 A;  1ZU8 A;  3O5I A;  4AY1 A;  3QOK A;  1J4R A;  1JND A;  1BKF A;  4Z2L A;  1LL7 A;  2MLY A;  1JNT A;  1YW5 A;  2L2S A;  2DG3 A;  1HJV A;  4NNR A;  1HKK A;  2O9O A;  4ODN A;  1X6N A;  4DRH A;  1ZBW A;  1A7X A;  3UF8 A;  1L1P A;  1IX5 A;  3KAH A;  1E6R A;  4URI A;  1SYT A;  1FKB A;  3AS1 A;  2RQS A;  1FKI A;  1W9U A;  5HW8 A;  2B31 A;  2G41 A;  3UQB A;  3PA7 A;  4WIW A;  3WH0 A;  2WM0 A;  3WIJ A;  1EDQ A;  1LL6 A;  1NWU A;  1QZ2 A;  4R0X A;  2DT3 A;  4MGV A;  1E6N A;  4DRK A;  3KAI A;  3ARP A;  3WL1 A;  4P8U A;  4JFM A;  3KCE A;  3WQV A;  5DF0 A;  2PI6 A;  2VN1 A;  1NH6 A;  4DRQ A;  3FAP A;  3FXY A;  3PRA A;  5B8I C;  4ODK A;  1ZBC A;  2PPP A;  2JZV A;  4ZPV R;  2ZQU A;  1E15 A;  2DSW A;  4DRO A;  2LKN A;  3PRB A;  2M1I A;  5BXJ A;  3CGM A;  4WJX A;  4IT4 A;  4J4N A;  4HAR A;  4MPK A;  5I98 A;  3O5E A;  4TW8 A;  4PTM A;  2MF9 A;  3H9R B;  1H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...