4DRHA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
b'NNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 30
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drhA00
5J6EA 3O5LA 2F2DA 1NMVA 2XP6A 4ODPA 2ITKA 3O5KA 4W9QA 1Q6UA 4JFJA 4N19A 4ODKA 2M2AA 3IK8A 4DZ2A 1TCOC 2LJ4A 1D7JA 1FKJA 2ZQTA 2M1IA 2XP8A 3KADA 4DRNA 1ZK6A 3VAWA 5HTGA 1QZ2A 4ODLA 1YATA 2XP4A 3O5PA 2D9FA 2ZQUA 1J4RA 2VN1A 4DIPA 2RSEA 1U79A 3UI4A 4NNRA 3O5GA 3O5RA 3NI6A 3UQAA 3ODKA 4TW7A 1QPLA 4JFIA 4TW6A 2LPVA 3NTPA 2KGJA 1Q1CA 2Q5AA 2F4EA 3OOBA 4GIVA 1FKTA 3RFWA 4R0XA 2RUQA 5HT1A 1EQ3A 1FJDA 2RUDA 3KABA 1FKGA 1FD9A 3KAHA 1HXVA 4JFKA 4ODNA 2IF4A 3WH0A 3CGMA 1ROUA 4DROA 4FAPA 1J4HA 4ODOA 4O2TA 4LAVA 2XP7A 4TW8A 1BL4A 1C9HA 1JVWA 2XPBA 5B8IC 4DH0A 4W9OA 3O5FA 2FKEA 4DT4A 1FKFA 1FKDA 1ZCNA 1NMWA 4DRIA 4C02B 2L2SA 1JNSA 3B7XA 2UZ5A 4QT3A 2XPAA 5BXJA 3KCEA 4U86A 4JYSA 4ODQA 3TDBA 3RGCA 4ITZA 4DRJA 2ZR6A 2ZQSA 5HW7A 2PV2A 3PRDA 2RURA 2OFNA 1Q6HA 3KACA 4G50A 1P5QA 4IQCA 3JYMA 4DRHA 5HWCA 2RQSA 4JFLA 3CGNA 2Y78A 3UQIA 1YW5A 3IKDA 3UI5A 4U84A 3UQBA 2KR7A 3JYJA 4G2PA 2MPHA 3IKGA 4DRPA 5HUAA 1J6YA 1Q6IA 4LAXA 1F40A 4LAYA 5DITA 1QPFA 2FAPA 3JXVA 2PV1A 2PPNA 5DIVA 1FKIA 4TYOA 2F21A 3KZ7A 4GGQA 4IQ2A 4W9PA 3EY6A 1PINA 2LKNA 4ODRA 1F8AB 3UI6A 1FKKA 2KO7A 3KAGA 4LAWA 5HW8A 5HKGA 1Y0OA 1ROTA 3O5DA 4J4OA 2VCDA 1D7HA 4U85A 3TCZA 1FKSA 3O5QA 4DRKA 1L1PA 1JNTA 1KT1A 2ZQVA 2XP5A 2PBCA 4QIBA 2MLYA 2DG3A 2PPOA 2AWGA 3O5JA 1J4IA 1M5YA 2JZVA 2KI3A 2M08A 2RUCA 3H9RB 3KAFA 3NRKA 3O5IA 3O5OA 1D6OA 1W26A 3I6CA 5HWBA 4BF8A 1A7XA 1PBKA 1FKRA 1BKFA 4FN2A 3IHZA 1FKBA 1D7IA 4MSPA 3TC5A 3UF8A 4DRMA 2DG4A 4TX0A 1FAPA 2MLXA 1EYMA 1FKLA 1N1AA 4DRQA 4DZ3A 5I98A 3O5MA 1T11A 2ZR4A 4MGVA 5HW6A 2N87A 4QT2A 2PV3A 4IPXA 1NSGA 3FAPA 3PRBA 1FKHA 2PPPA 4J4NA 4ODMA 2K8IA 4TNSA 2MLZA 1B6CA 2MF9A 5GPGA 2XP3A 4JFMA 5D75A 3KAIA 1R9HA 1KT0A 2DG9A 2KFWA 2XP9A 2MNTA 2ZR5A 3MDYB 3PA7A 3GPKA 3LUOA 2KE0A 3O5EA 2LGOA 5DIUA
chains in the Genus database with same CATH superfamily
5J6EA 2F2DA 3O5KA 2QF8A 3IK8A 1FKJA 4DWSC 3WL0A 3B9EA 2D9FA 4DIPA 2RSEA 3UI4A 4TW7A 4TW6A 2LPVA 2KGJA 2Q5AA 1NWRA 1W1VA 2RUDA 2DT2A 4DWSA 1HXVA 4JFKA 3ARPA 2IF4A 3CGMA 5DEZA 1BL4A 1JVWA 4P8WA 2XPBA 5B8IC 2A3BA 3O5FA 4DRIA 1ZCNA 2L2SA 1ZBCA 2XPAA 5BXJA 2B5UB 4JYSA 3WKZA 4LGXA 3AS0A 4P8UA 4L72B 1E6ZA 1LL4A 1LG1A 4DRHA 5HWCA 2A3EA 1UR8A 1ZBVA 2RQSA 4JFLA 3UQIA 4DRPA 3GU0A 3AS3A 3AQUA 2DSVA 4ZPVR 4XAKA 1FKIA 4TYOA 2F21A 3AS1A 3KZ7A 1JNEA 4GGQA 4ODRA 1F8AB 1O6IA 4MNJA 3AS2A 1ROTA 3ARRA 1OGGA 3O5QA 2XP5A 4QIBA 3WL1A 2AWGA 1J4IA 1M5YA 1W26A 3I6CA 1FKRA 3CHCA 4ML4A 1E6RA 1K9TA 4MSPA 2F23A 2DG4A 1H0IA 1FAPA 3ARSA 2MLXA 1FKLA 3WQWA 5JH8A 3ARQA 5I98A 1HKIA 4WKAA 5HW6A 2N87A 4QT2A 2PV3A 2DSZA 1NSGA 3PRBA 1FKHA 4J4NA 3BXWA 2K8IA 2MLZA 1B6CA 2MF9A 5GPGA 4JFMA 4DWSB 2KFWA 3PA7A 2KE0A 2XP6A 3ARTA 4ODPA 2ITKA 4W9QA 4ODKA 2DT3A 3BMBA 4DZ2A 2LJ4A 2ZQTA 3FY1A 1GOIA 2IUZA 2M1IA 1EHNA 4DRNA 3KADA 1QZ2A 4ODLA 3WQVA 1LG2A 2VN1A 1U79A 4NNRA 2DSWA 2DT0A 4JFIA 3ARXA 4Z2IA 3RFWA 2YBTA 1CTNA 1FD9A 3KAHA 4ZS6A 4FAPA 4L3NA 4ODOA 4TW8A 1W1TA 4Z2LA 4DH0A 4KQZA 4MTVA 2O92A 1NMWA 4C02B 1LL6A 3CHDA 1WB0A 4ZPTR 4MPKA 4U86A 4ODQA 4ITZA 1OGBA 2OFNA 4P8VA 4QZVB 3KACA 4G50A 4IQCA 3JYMA 4MNKA 1FFQA 3WD1A 1TFVA 3CGNA 2Y78A 4NZCA 1YW5A 3UQBA 4HARA 1JNDA 2KR7A 3CHFA 3WD0A 2MPHA 1J6YA 1Q6IA 1QPFA 2FAPA 3B9DA 4S3JA 3W4RA 1ZL1A 4MNLA 4W9PA 1PINA 2G8ZA 2FDMA 3UI6A 4WIWA 2KO7A 4LAWA 3WD3A 4P8XA 1EDQA 1HKMA 4Z2KA 4NSBA 4ZPWR 2MLYA 2JZVA 3H9RB 2A3CA 3O5IA 1A7XA 1PBKA 1SYTA 3UF8A 3TC5A 4DRMA 4Q22A 3RMEA 3PR9A 2ZR4A 4UDMA 2DT1A 4IPXA 3CHEA 3PRAA 3WD2A 4TNSA 1GRJA 3AROA 5D75A 3RM9A 1R9HA 2XP9A 1ZBWA 2ZR5A 3CZ8A 2LGOA 1XRVA 1NH6A 1WAWA 1Q6UA 2WK2A 4JFJA 4N19A 1SR0A 1TCOC 1W9UA 4Z2GA 2XP8A 1ZK6A 3VAWA 2ETNA 1KFWA 1YATA 1LL7A 5GQBA 3ODKA 1XHGA 5DO2A 1E6PA 3EIPA 4DWSD 3OOBA 4GIVA 4R0XA 4IT4A 5HT1A 1FJDA 3GTYX 1FKGA 4URIA 4MAVA 2YBUA 4KR0B 4DROA 1J4HA 1NWTA 3ARUA 4O2TA 2XP7A 1UR9A 4IT6A 1HJXA 4W9OA 2FKEA 2WLZA 4DT4A 1FKDA 3B7XA 3RM8A 4QT3A 3KCEA 1ZB5A 2O9OA 3TDBA 2PI6A 3OA5A 3RGCA 1E6NA 2ZR6A 2ZQSA 5GPRA 5HW7A 2PV2A 1ZBKA 1W1YA 1NWUA 1ZU8A 4HBEA 1Q6HA 4WJXA 1LQ0A 3IKDA 3UI5A 4U84A 4G2PA 1VF8A 3IKGA 4LAXA 1F40A 4LAYA 5DITA 3JXVA 2PV1A 1LJYA 2G41A 1FKKA 3KAGA 3ARYA 5HW8A 5HKGA 1GUVA 4J4OA 1E44A 4DRKA 1KT1A 2DG3A 3O5JA 2M08A 2KI3A 2ESCA 3O5OA 3ALFA 4BF8A 1BKFA 3IHZA 1D7IA 3RM4A 1X6LA 1EYMA 1HJVA 4DRQA 4DZ3A 3O5MA 4MGVA 3FAPA 2PPPA 5DF0A 1H0GA 3ARVA 2XP3A 3KAIA 1KT0A 2DG9A 2MNTA 3MDYB 5HBFA 1ITXA 3GPKA 3LUOA 3O5EA 3O5LA 4S3KA 1NMVA 1WNOA 2M2AA 4MNMA 1D7JA 5HTGA 2XP4A 3O5PA 2ZQUA 1J4RA 4AY1A 3O5GA 3O5RA 3NI6A 3UQAA 1QPLA 1HJWA 1W9VA 1GPFA 3NTPA 3G6MA 1Q1CA 1D2KA 2F4EA 1FKTA 2RUQA 1EQ3A 1EIBA 3KABA 4Z2HA 2DPEA 4ODNA 1W1PA 3FXYA 3WH0A 1E9LA 1ROUA 3CH9A 4WKHA 1OWQA 3ALGA 4R5EA 4LAVA 4PTMA 1C9HA 1W9PA 4Q7NA 1FKFA 1JNSA 2UZ5A 3WIJA 1JCHB 1IX5A 4DRJA 3PRDA 2RURA 2AOSA 1P5QA 3G6LA 4HBOA 2WM0A 2A3AA 1HKJA 3JYJA 5HUAA 2P4VA 2WLYA 4WK9A 1E15A 2PPNA 5DIVA 4IQ2A 3EY6A 2LKNA 1X6NA 4Z2JA 1Y0OA 1HKKA 2EULA 3O5DA 2VCDA 1D7HA 4U85A 3TCZA 1FKSA 1L1PA 1JNTA 2ZQVA 2PBCA 2PPOA 3ARWA 2RUCA 3NRKA 4W5UA 1FFRA 3KAFA 3B9AA 1D6OA 3ARZA 5HWBA 4FN2A 1FKBA 3WD4A 3QOKA 4TX0A 4WKFA 2OLHA 1N1AA 1RD6A 1T11A 2B31A 2PN0A 1NWSA 4ODMA 3B8SA 2DSUA 5DIUA
chains in the Genus database with same CATH topology
5J6EA 2F2DA 3O5KA 2QF8A 3IK8A 1FKJA 4DWSC 3WL0A 3B9EA 2D9FA 4DIPA 2RSEA 3UI4A 4TW7A 4TW6A 2LPVA 2KGJA 2Q5AA 1NWRA 1W1VA 2RUDA 2DT2A 4DWSA 1HXVA 4JFKA 3ARPA 2IF4A 3CGMA 5DEZA 1BL4A 1JVWA 4P8WA 2XPBA 5B8IC 2A3BA 3O5FA 4DRIA 1ZCNA 2L2SA 1ZBCA 2XPAA 5BXJA 4JYSA 3WKZA 4LGXA 3AS0A 4P8UA 4L72B 1E6ZA 1LL4A 1LG1A 4DRHA 5HWCA 2A3EA 1UR8A 1ZBVA 2RQSA 4JFLA 3UQIA 4DRPA 3AS3A 3AQUA 2DSVA 4ZPVR 4XAKA 1FKIA 4TYOA 2F21A 3AS1A 3KZ7A 1JNEA 4GGQA 4ODRA 1F8AB 1O6IA 4MNJA 3AS2A 1ROTA 3ARRA 1OGGA 3O5QA 2XP5A 4QIBA 3WL1A 2AWGA 1J4IA 1M5YA 1W26A 3I6CA 1FKRA 3CHCA 4ML4A 1E6RA 1K9TA 4MSPA 2DG4A 1H0IA 1FAPA 3ARSA 2MLXA 1FKLA 3WQWA 5JH8A 3ARQA 5I98A 1HKIA 4WKAA 5HW6A 2N87A 4QT2A 2PV3A 2DSZA 1NSGA 3PRBA 1FKHA 4J4NA 3BXWA 2K8IA 2MLZA 1B6CA 2MF9A 5GPGA 4JFMA 4DWSB 2KFWA 3PA7A 2KE0A 2XP6A 3ARTA 4ODPA 2ITKA 4W9QA 4ODKA 2DT3A 4DZ2A 2LJ4A 2ZQTA 3FY1A 1GOIA 2IUZA 2M1IA 1EHNA 4DRNA 3KADA 1QZ2A 4ODLA 3WQVA 1LG2A 2VN1A 1U79A 4NNRA 2DSWA 2DT0A 4JFIA 3ARXA 4Z2IA 3RFWA 2YBTA 1CTNA 1FD9A 3KAHA 4ZS6A 4FAPA 4L3NA 4ODOA 4TW8A 1W1TA 4Z2LA 4DH0A 4KQZA 4MTVA 2O92A 1NMWA 4C02B 1LL6A 3CHDA 1WB0A 4ZPTR 4MPKA 4U86A 4ODQA 4ITZA 1OGBA 2OFNA 4P8VA 4QZVB 3KACA 4G50A 4IQCA 3JYMA 4MNKA 1FFQA 3WD1A 1TFVA 3CGNA 2Y78A 4NZCA 1YW5A 3UQBA 4HARA 1JNDA 2KR7A 3CHFA 3WD0A 2MPHA 1J6YA 1Q6IA 1QPFA 2FAPA 3B9DA 4S3JA 3W4RA 1ZL1A 4MNLA 4W9PA 1PINA 2G8ZA 2FDMA 3UI6A 4WIWA 2KO7A 4LAWA 3WD3A 4P8XA 1EDQA 1HKMA 4Z2KA 4NSBA 4ZPWR 2MLYA 2JZVA 3H9RB 2A3CA 3O5IA 1A7XA 1PBKA 1SYTA 3UF8A 3TC5A 4DRMA 4Q22A 3RMEA 3PR9A 2ZR4A 2DT1A 4IPXA 3CHEA 3PRAA 2DSUA 3WD2A 4TNSA 3AROA 5D75A 3RM9A 1R9HA 2XP9A 1ZBWA 2ZR5A 3CZ8A 2LGOA 1XRVA 1NH6A 1WAWA 1Q6UA 2WK2A 4JFJA 4N19A 1SR0A 1TCOC 1W9UA 4Z2GA 2XP8A 1ZK6A 3VAWA 1KFWA 1YATA 1LL7A 5GQBA 3ODKA 1XHGA 5DO2A 1E6PA 4DWSD 3OOBA 4GIVA 4R0XA 4IT4A 5HT1A 1FJDA 1FKGA 4URIA 4MAVA 2YBUA 4KR0B 4DROA 1J4HA 1NWTA 3ARUA 4O2TA 2XP7A 1UR9A 4IT6A 1HJXA 4W9OA 2FKEA 2WLZA 4DT4A 1FKDA 3B7XA 3RM8A 4QT3A 3KCEA 1ZB5A 2O9OA 3TDBA 2PI6A 3OA5A 3RGCA 1E6NA 2ZR6A 2ZQSA 5GPRA 5HW7A 2PV2A 1ZBKA 1W1YA 1NWUA 1ZU8A 4HBEA 1Q6HA 4WJXA 1LQ0A 3IKDA 3UI5A 4U84A 4G2PA 1VF8A 3IKGA 4LAXA 1F40A 4LAYA 5DITA 3JXVA 2PV1A 1LJYA 2G41A 1FKKA 3KAGA 3ARYA 5HW8A 5HKGA 1GUVA 4J4OA 4DRKA 1KT1A 2DG3A 3O5JA 2M08A 2KI3A 2ESCA 3ALFA 4BF8A 1BKFA 3IHZA 1D7IA 3RM4A 1X6LA 1EYMA 1HJVA 4DRQA 4DZ3A 3O5MA 4MGVA 3FAPA 2PPPA 5DF0A 1H0GA 3ARVA 2XP3A 3KAIA 1KT0A 2DG9A 2MNTA 3MDYB 5HBFA 1ITXA 3GPKA 3LUOA 3O5EA 3O5LA 4S3KA 1NMVA 1WNOA 2M2AA 4MNMA 1D7JA 5HTGA 2XP4A 3O5PA 2ZQUA 1J4RA 4AY1A 3O5GA 3O5RA 3NI6A 3UQAA 1QPLA 1HJWA 1W9VA 1GPFA 3NTPA 3G6MA 1Q1CA 1D2KA 2F4EA 1FKTA 2RUQA 1EQ3A 1EIBA 3KABA 4Z2HA 2DPEA 4ODNA 1W1PA 3FXYA 3WH0A 1E9LA 1ROUA 3CH9A 4WKHA 1OWQA 3ALGA 4R5EA 4LAVA 4PTMA 1C9HA 1W9PA 4Q7NA 1FKFA 1JNSA 2UZ5A 3WIJA 1IX5A 4DRJA 3PRDA 2RURA 2AOSA 1P5QA 3G6LA 4HBOA 2WM0A 2A3AA 1HKJA 3JYJA 5HUAA 2WLYA 4WK9A 1E15A 2PPNA 5DIVA 4IQ2A 3EY6A 2LKNA 1X6NA 4Z2JA 1Y0OA 1HKKA 3O5DA 2VCDA 1D7HA 4U85A 3TCZA 1FKSA 1L1PA 1JNTA 2ZQVA 2PBCA 2PPOA 3ARWA 3NRKA 2RUCA 4W5UA 1FFRA 3KAFA 3B9AA 1D6OA 3ARZA 5HWBA 4FN2A 1FKBA 3WD4A 3QOKA 4TX0A 4WKFA 2OLHA 1N1AA 1RD6A 1T11A 2B31A 1NWSA 4ODMA 3B8SA 3O5OA 5DIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J6E A;  3O5L A;  2F2D A;  1NMV A;  2XP6 A;  4ODP A;  2ITK A;  3O5K A;  4W9Q A;  1Q6U A;  4JFJ A;  4N19 A;  4ODK A;  2M2A A;  3IK8 A;  4DZ2 A;  1TCO C;  2LJ4 A;  1D7J A;  1FKJ A;  2ZQT A;  2M1I A;  2XP8 A;  3KAD A;  4DRN A;  1ZK6 A;  3VAW A;  5HTG A;  1QZ2 A;  4ODL A;  1YAT A;  2XP4 A;  3O5P A;  2D9F A;  2ZQU A;  1J4R A;  2VN1 A;  4DIP A;  2RSE A;  1U79 A;  3UI4 A;  4NNR A;  3O5G A;  3O5R A;  3NI6 A;  3UQA A;  3ODK A;  4TW7 A;  1QPL A;  4JFI A;  4TW6 A;  2LPV A;  3NTP A;  2KGJ A;  1Q1C A;  2Q5A A;  2F4E A;  3OOB A;  4GIV A;  1FKT A;  3RFW A;  4R0X A;  2RUQ A;  5HT1 A;  1EQ3 A;  1FJD A;  2RUD A;  3KAB A;  1FKG A;  1FD9 A;  3KAH A;  1HXV A;  4JFK A;  4ODN A;  2IF4 A;  3WH0 A;  3CGM A;  1ROU A;  4DRO A;  4FAP A;  1J4H A;  4ODO A;  4O2T A;  4LAV A;  2XP7 A;  4TW8 A;  1BL4 A;  1C9H A;  1JVW A;  2XPB A;  5B8I C;  4DH0 A;  4W9O A;  3O5F A;  2FKE A;  4DT4 A;  1FKF A;  1FKD A;  1ZCN A;  1NMW A;  4DRI A;  4C02 B;  2L2S A;  1JNS A;  3B7X A;  2UZ5 A;  4QT3 A;  2XPA A;  5BXJ A;  3KCE A;  4U86 A;  4JYS A;  4ODQ A;  3TDB A;  3RGC A;  4ITZ A;  4DRJ A;  2ZR6 A;  2ZQS A;  5HW7 A;  2PV2 A;  3PRD A;  2RUR A;  2OFN A;  1Q6H A;  3KAC A;  4G50 A;  1P5Q A;  4IQC A;  3JYM A;  4DRH A;  5HWC A;  2RQS A;  4JFL A;  3CGN A;  2Y78 A;  3UQI A;  1YW5 A;  3IKD A;  3UI5 A;  4U84 A;  3UQB A;  2KR7 A;  3JYJ A;  4G2P A;  2MPH A;  3IKG A;  4DRP A;  5HUA A;  1J6Y A;  1Q6I A;  4LAX A;  1F40 A;  4LAY A;  5DIT A;  1QPF A;  2FAP A;  3JXV A;  2PV1 A;  2PPN A;  5DIV A;  1FKI A;  4TYO A;  2F21 A;  3KZ7 A;  4GGQ A;  4IQ2 A;  4W9P A;  3EY6 A;  1PIN A;  2LKN A;  4ODR A;  1F8A B;  3UI6 A;  1FKK A;  2KO7 A;  3KAG A;  4LAW A;  5HW8 A;  5HKG A;  1Y0O A;  1ROT A;  3O5D A;  4J4O A;  2VCD A;  1D7H A;  4U85 A;  3TCZ A;  1FKS A;  3O5Q A;  4DRK A;  1L1P A;  1JNT A;  1KT1 A;  2ZQV A;  2XP5 A;  2PBC A;  4QIB A;  2MLY A;  2DG3 A;  2PPO A;  2AWG A;  3O5J A;  1J4I A;  1M5Y A;  2JZV A;  2KI3 A;  2M08 A;  2RUC A;  3H9R B;  3KAF A;  3NRK A;  3O5I A;  3O5O A;  1D6O A;  1W26 A;  3I6C A;  5HWB A;  4BF8 A;  1A7X A;  1PBK A;  1FKR A;  1BKF A;  4FN2 A;  3IHZ A;  1FKB A;  1D7I A;  4MSP A;  3TC5 A;  3UF8 A;  4DRM A;  2DG4 A;  4TX0 A;  1FAP A;  2MLX A;  1EYM A;  1FKL A;  1N1A A;  4DRQ A;  4DZ3 A;  5I98 A;  3O5M A;  1T11 A;  2ZR4 A;  4MGV A;  5HW6 A;  2N87 A;  4QT2 A;  2PV3 A;  4IPX A;  1NSG A;  3FAP A;  3PRB A;  1FKH A;  2PPP A;  4J4N A;  4ODM A;  2K8I A;  4TNS A;  2MLZ A;  1B6C A;  2MF9 A;  5GPG A;  2XP3 A;  4JFM A;  5D75 A;  3KAI A;  1R9H A;  1KT0 A;  2DG9 A;  2KFW A;  2XP9 A;  2MNT A;  2ZR5 A;  3MDY B;  3PA7 A;  3GPK A;  3LUO A;  2KE0 A;  3O5E A;  2LGO A;  5DIU A; 
#chains in the Genus database with same CATH topology
 5J6E A;  2F2D A;  3O5K A;  2QF8 A;  3IK8 A;  1FKJ A;  4DWS C;  3WL0 A;  3B9E A;  2D9F A;  4DIP A;  2RSE A;  3UI4 A;  4TW7 A;  4TW6 A;  2LPV A;  2KGJ A;  2Q5A A;  1NWR A;  1W1V A;  2RUD A;  2DT2 A;  4DWS A;  1HXV A;  4JFK A;  3ARP A;  2IF4 A;  3CGM A;  5DEZ A;  1BL4 A;  1JVW A;  4P8W A;  2XPB A;  5B8I C;  2A3B A;  3O5F A;  4DRI A;  1ZCN A;  2L2S A;  1ZBC A;  2XPA A;  5BXJ A;  2B5U B;  4JYS A;  3WKZ A;  4LGX A;  3AS0 A;  4P8U A;  4L72 B;  1E6Z A;  1LL4 A;  1LG1 A;  4DRH A;  5HWC A;  2A3E A;  1UR8 A;  1ZBV A;  2RQS A;  4JFL A;  3UQI A;  4DRP A;  3GU0 A;  3AS3 A;  3AQU A;  2DSV A;  4ZPV R;  4XAK A;  1FKI A;  4TYO A;  2F21 A;  3AS1 A;  3KZ7 A;  1JNE A;  4GGQ A;  4ODR A;  1F8A B;  1O6I A;  4MNJ A;  3AS2 A;  1ROT A;  3ARR A;  1OGG A;  3O5Q A;  2XP5 A;  4QIB A;  3WL1 A;  2AWG A;  1J4I A;  1M5Y A;  1W26 A;  3I6C A;  1FKR A;  3CHC A;  4ML4 A;  1E6R A;  1K9T A;  4MSP A;  2F23 A;  2DG4 A;  1H0I A;  1FAP A;  3ARS A;  2MLX A;  1FKL A;  3WQW A;  5JH8 A;  3ARQ A;  5I98 A;  1HKI A;  4WKA A;  5HW6 A;  2N87 A;  4QT2 A;  2PV3 A;  2DSZ A;  1NSG A;  3PRB A;  1FKH A;  4J4N A;  3BXW A;  2K8I A;  2MLZ A;  1B6C A;  2MF9 A;  5GPG A;  4JFM A;  4DWS B;  2KFW A;  3PA7 A;  2KE0 A;  2XP6 A;  3ART A;  4ODP A;  2ITK A;  4W9Q A;  4ODK A;  2DT3 A;  3BMB A;  4DZ2 A;  2LJ4 A;  2ZQT A;  3FY1 A;  1GOI A;  2IUZ A;  2M1I A;  1EHN A;  4DRN A;  3KAD A;  1QZ2 A;  4ODL A;  3WQV A;  1LG2 A;  2VN1 A;  1U79 A;  4NNR A;  2DSW A;  2DT0 A;  4JFI A;  3ARX A;  4Z2I A;  3RFW A;  2YBT A;  1CTN A;  1FD9 A;  3KAH A;  4ZS6 A;  4FAP A;  4L3N A;  4ODO A;  4TW8 A;  1W1T A;  4Z2L A;  4DH0 A;  4KQZ A;  4MTV A;  2O92 A;  1NMW A;  4C02 B;  1LL6 A;  3CHD A;  1WB0 A;  4ZPT R;  4MPK A;  4U86 A;  4ODQ A;  4ITZ A;  1OGB A;  2OFN A;  4P8V A;  4QZV B;  3KAC A;  4G50 A;  4IQC A;  3JYM A;  4MNK A;  1FFQ A;  3WD1 A;  1TFV A;  3CGN A;  2Y78 A;  4NZC A;  1YW5 A;  3UQB A;  4HAR A;  1JND A;  2KR7 A;  3CHF A;  3WD0 A;  2MPH A;  1J6Y A;  1Q6I A;  1QPF A;  2FAP A;  3B9D A;  4S3J A;  3W4R A;  1ZL1 A;  4MNL A;  4W9P A;  1PIN A;  2G8Z A;  2FDM A;  3UI6 A;  4WIW A;  2KO7 A;  4LAW A;  3WD3 A;  4P8X A;  1EDQ A;  1HKM A;  4Z2K A;  4NSB A;  4ZPW R;  2MLY A;  2JZV A;  3H9R B;  2A3C A;  3O5I A;  1A7X A;  1PBK A;  1SYT A;  3UF8 A;  3TC5 A;  4DRM A;  4Q22 A;  3RME A;  3PR9 A;  2ZR4 A;  4UDM A;  2DT1 A;  4IPX A;  3CHE A;  3PRA A;  3WD2 A;  4TNS A;  1GRJ A;  3ARO A;  5D75 A;  3RM9 A;  1R9H A;  2XP9 A;  1ZBW A;  2ZR5 A;  3CZ8 A;  2LGO A;  1XRV A;  1NH6 A;  1WAW A;  1Q6U A;  2WK2 A;  4JFJ A;  4N19 A;  1SR0 A;  1TCO C;  1W9U A;  4Z2G A;  2XP8 A;  1ZK6 A;  3VAW A;  2ETN A;  1KFW A;  1YAT A;  1LL7 A;  5GQB A;  3ODK A;  1XHG A;  5DO2 A;  1E6P A;  3EIP A;  4DWS D;  3OOB A;  4GIV A;  4R0X A;  4IT4 A;  5HT1 A;  1FJD A;  3GTY X;  1FKG A;  4URI A;  4MAV A;  2YBU A;  4KR0 B;  4DRO A;  1J4H A;  1NWT A;  3ARU A;  4O2T A;  2XP7 A;  1UR9 A;  4IT6 A;  1HJX A;  4W9O A;  2FKE A;  2WLZ A;  4DT4 A;  1FKD A;  3B7X A;  3RM8 A;  4QT3 A;  3KCE A;  1ZB5 A;  2O9O A;  3TDB A;  2PI6 A;  3OA5 A;  3RGC A;  1E6N A;  2ZR6 A;  2ZQS A;  5GPR A;  5HW7 A;  2PV2 A;  1ZBK A;  1W1Y A;  1NWU A;  1ZU8 A;  4HBE A;  1Q6H A;  4WJX A;  1LQ0 A;  3IKD A;  3UI5 A;  4U84 A;  4G2P A;  1VF8 A;  3IKG A;  4LAX A;  1F40 A;  4LAY A;  5DIT A;  3JXV A;  2PV1 A;  1LJY A;  2G41 A;  1FKK A;  3KAG A;  3ARY A;  5HW8 A;  5HKG A;  1GUV A;  4J4O A;  1E44 A;  4DRK A;  1KT1 A;  2DG3 A;  3O5J A;  2M08 A;  2KI3 A;  2ESC A;  3O5O A;  3ALF A;  4BF8 A;  1BKF A;  3IHZ A;  1D7I A;  3RM4 A;  1X6L A;  1EYM A;  1HJV A;  4DRQ A;  4DZ3 A;  3O5M A;  4MGV A;  3FAP A;  2PPP A;  5DF0 A;  1H0G A;  3ARV A;  2XP3 A;  3KAI A;  1KT0 A;  2DG9 A;  2MNT A;  3MDY B;  5HBF A;  1ITX A;  3GPK A;  3LUO A;  3O5E A;  3O5L A;  4S3K A;  1NMV A;  1WNO A;  2M2A A;  4MNM A;  1D7J A;  5HTG A;  2XP4 A;  3O5P A;  2ZQU A;  1J4R A;  4AY1 A;  3O5G A;  3O5R A;  3NI6 A;  3UQA A;  1QPL A;  1HJW A;  1W9V A;  1GPF A;  3NTP A;  3G6M A;  1Q1C A;  1D2K A;  2F4E A;  1FKT A;  2RUQ A;  1EQ3 A;  1EIB A;  3KAB A;  4Z2H A;  2DPE A;  4ODN A;  1W1P A;  3FXY A;  3WH0 A;  1E9L A;  1ROU A;  3CH9 A;  4WKH A;  1OWQ A;  3ALG A;  4R5E A;  4LAV A;  4PTM A;  1C9H A;  1W9P A;  4Q7N A;  1FKF A;  1JNS A;  2UZ5 A;  3WIJ A;  1JCH B;  1IX5 A;  4DRJ A;  3PRD A;  2RUR A;  2AOS A;  1P5Q A;  3G6L A;  4HBO A;  2WM0 A;  2A3A A;  1HKJ A;  3JYJ A;  5HUA A;  2P4V A;  2WLY A;  4WK9 A;  1E15 A;  2PPN A;  5DIV A;  4IQ2 A;  3EY6 A;  2LKN A;  1X6N A;  4Z2J A;  1Y0O A;  1HKK A;  2EUL A;  3O5D A;  2VCD A;  1D7H A;  4U85 A;  3TCZ A;  1FKS A;  1L1P A;  1JNT A;  2ZQV A;  2PBC A;  2PPO A;  3ARW A;  2RUC A;  3NRK A;  4W5U A;  1FFR A;  3KAF A;  3B9A A;  1D6O A;  3ARZ A;  5HWB A;  4FN2 A;  1FKB A;  3WD4 A;  3QOK A;  4TX0 A;  4WKF A;  2OLH A;  1N1A A;  1RD6 A;  1T11 A;  2B31 A;  2PN0 A;  1NWS A;  4ODM A;  3B8S A;  2DSU A;  5DIU A; 
#chains in the Genus database with same CATH homology
 5J6E A;  2F2D A;  3O5K A;  2QF8 A;  3IK8 A;  1FKJ A;  4DWS C;  3WL0 A;  3B9E A;  2D9F A;  4DIP A;  2RSE A;  3UI4 A;  4TW7 A;  4TW6 A;  2LPV A;  2KGJ A;  2Q5A A;  1NWR A;  1W1V A;  2RUD A;  2DT2 A;  4DWS A;  1HXV A;  4JFK A;  3ARP A;  2IF4 A;  3CGM A;  5DEZ A;  1BL4 A;  1JVW A;  4P8W A;  2XPB A;  5B8I C;  2A3B A;  3O5F A;  4DRI A;  1ZCN A;  2L2S A;  1ZBC A;  2XPA A;  5BXJ A;  4JYS A;  3WKZ A;  4LGX A;  3AS0 A;  4P8U A;  4L72 B;  1E6Z A;  1LL4 A;  1LG1 A;  4DRH A;  5HWC A;  2A3E A;  1UR8 A;  1ZBV A;  2RQS A;  4JFL A;  3UQI A;  4DRP A;  3AS3 A;  3AQU A;  2DSV A;  4ZPV R;  4XAK A;  1FKI A;  4TYO A;  2F21 A;  3AS1 A;  3KZ7 A;  1JNE A;  4GGQ A;  4ODR A;  1F8A B;  1O6I A;  4MNJ A;  3AS2 A;  1ROT A;  3ARR A;  1OGG A;  3O5Q A;  2XP5 A;  4QIB A;  3WL1 A;  2AWG A;  1J4I A;  1M5Y A;  1W26 A;  3I6C A;  1FKR A;  3CHC A;  4ML4 A;  1E6R A;  1K9T A;  4MSP A;  2DG4 A;  1H0I A;  1FAP A;  3ARS A;  2MLX A;  1FKL A;  3WQW A;  5JH8 A;  3ARQ A;  5I98 A;  1HKI A;  4WKA A;  5HW6 A;  2N87 A;  4QT2 A;  2PV3 A;  2DSZ A;  1NSG A;  3PRB A;  1FKH A;  4J4N A;  3BXW A;  2K8I A;  2MLZ A;  1B6C A;  2MF9 A;  5GPG A;  4JFM A;  4DWS B;  2KFW A;  3PA7 A;  2KE0 A;  2XP6 A;  3ART A;  4ODP A;  2ITK A;  4W9Q A;  4ODK A;  2DT3 A;  4DZ2 A;  2LJ4 A;  2ZQT A;  3FY1 A;  1GOI A;  2IUZ A;  2M1I A;  1EHN A;  4DRN A;  3KAD A;  1QZ2 A;  4ODL A;  3WQV A;  1LG2 A;  2VN1 A;  1U79 A;  4NNR A;  2DSW A;  2DT0 A;  4JFI A;  3ARX A;  4Z2I A;  3RFW A;  2YBT A;  1CTN A;  1FD9 A;  3KAH A;  4ZS6 A;  4FAP A;  4L3N A;  4ODO A;  4TW8 A;  1W1T A;  4Z2L A;  4DH0 A;  4KQZ A;  4MTV A;  2O92 A;  1NMW A;  4C02 B;  1LL6 A;  3CHD A;  1WB0 A;  4ZPT R;  4MPK A;  4U86 A;  4ODQ A;  4ITZ A;  1OGB A;  2OFN A;  4P8V A;  4QZV B;  3KAC A;  4G50 A;  4IQC A;  3JYM A;  4MNK A;  1FFQ A;  3WD1 A;  1TFV A;  3CGN A;  2Y78 A;  4NZC A;  1YW5 A;  3UQB A;  4HAR A;  1JND A;  2KR7 A;  3CHF A;  3WD0 A;  2MPH A;  1J6Y A;  1Q6I A;  1QPF A;  2FAP A;  3B9D A;  4S3J A;  3W4R A;  1ZL1 A;  4MNL A;  4W9P A;  1PIN A;  2G8Z A;  2FDM A;  3UI6 A;  4WIW A;  2KO7 A;  4LAW A;  3WD3 A;  4P8X A;  1EDQ A;  1HKM A;  4Z2K A;  4NSB A;  4ZPW R;  2MLY A;  2JZV A;  3H9R B;  2A3C A;  3O5I A;  1A7X A;  1PBK A;  1SYT A;  3UF8 A;  3TC5 A;  4DRM A;  4Q22 A;  3RME A;  3PR9 A;  2ZR4 A;  2DT1 A;  4IPX A;  3CHE A;  3PRA A;  2DSU A;  3WD2 A;  4TNS A;  3ARO A;  5D75 A;  3RM9 A;  1R9H A;  2XP9 A;  1ZBW A;  2ZR5 A;  3CZ8 A;  2LGO A;  1XRV A;  1NH6 A;  1WAW A;  1Q6U A;  2WK2 A;  4JFJ A;  4N19 A;  1SR0 A;  1TCO C;  1W9U A;  4Z2G A;  2XP8 A;  1ZK6 A;  3VAW A;  1KFW A;  1YAT A;  1LL7 A;  5GQB A;  3ODK A;  1XHG A;  5DO2 A;  1E6P A;  4DWS D;  3OOB A;  4GIV A;  4R0X A;  4IT4 A;  5HT1 A;  1FJD A;  1FKG A;  4URI A;  4MAV A;  2YBU A;  4KR0 B;  4DRO A;  1J4H A;  1NWT A;  3ARU A;  4O2T A;  2XP7 A;  1UR9 A;  4IT6 A;  1HJX A;  4W9O A;  2FKE A;  2WLZ A;  4DT4 A;  1FKD A;  3B7X A;  3RM8 A;  4QT3 A;  3KCE A;  1ZB5 A;  2O9O A;  3TDB A;  2PI6 A;  3OA5 A;  3RGC A;  1E6N A;  2ZR6 A;  2ZQS A;  5GPR A;  5HW7 A;  2PV2 A;  1ZBK A;  1W1Y A;  1NWU A;  1ZU8 A;  4HBE A;  1Q6H A;  4WJX A;  1LQ0 A;  3IKD A;  3UI5 A;  4U84 A;  4G2P A;  1VF8 A;  3IKG A;  4LAX A;  1F40 A;  4LAY A;  5DIT A;  3JXV A;  2PV1 A;  1LJY A;  2G41 A;  1FKK A;  3KAG A;  3ARY A;  5HW8 A;  5HKG A;  1GUV A;  4J4O A;  4DRK A;  1KT1 A;  2DG3 A;  3O5J A;  2M08 A;  2KI3 A;  2ESC A;  3ALF A;  4BF8 A;  1BKF A;  3IHZ A;  1D7I A;  3RM4 A;  1X6L A;  1EYM A;  1HJV A;  4DRQ A;  4DZ3 A;  3O5M A;  4MGV A;  3FAP A;  2PPP A;  5DF0 A;  1H0G A;  3ARV A;  2XP3 A;  3KAI A;  1KT0 A;  2DG9 A;  2MNT A;  3MDY B;  5HBF A;  1ITX A;  3GPK A;  3LUO A;  3O5E A;  3O5L A;  4S3K A;  1NMV A;  1WNO A;  2M2A A;  4MNM A;  1D7J A;  5HTG A;  2XP4 A;  3O5P A;  2ZQU A;  1J4R A;  4AY1 A;  3O5G A;  3O5R A;  3NI6 A;  3UQA A;  1QPL A;  1HJW A;  1W9V A;  1GPF A;  3NTP A;  3G6M A;  1Q1C A;  1D2K A;  2F4E A;  1FKT A;  2RUQ A;  1EQ3 A;  1EIB A;  3KAB A;  4Z2H A;  2DPE A;  4ODN A;  1W1P A;  3FXY A;  3WH0 A;  1E9L A;  1ROU A;  3CH9 A;  4WKH A;  1OWQ A;  3ALG A;  4R5E A;  4LAV A;  4PTM A;  1C9H A;  1W9P A;  4Q7N A;  1FKF A;  1JNS A;  2UZ5 A;  3WIJ A;  1IX5 A;  4DRJ A;  3PRD A;  2RUR A;  2AOS A;  1P5Q A;  3G6L A;  4HBO A;  2WM0 A;  2A3A A;  1HKJ A;  3JYJ A;  5HUA A;  2WLY A;  4WK9 A;  1E15 A;  2PPN A;  5DIV A;  4IQ2 A;  3EY6 A;  2LKN A;  1X6N A;  4Z2J A;  1Y0O A;  1HKK A;  3O5D A;  2VCD A;  1D7H A;  4U85 A;  3TCZ A;  1FKS A;  1L1P A;  1JNT A;  2ZQV A;  2PBC A;  2PPO A;  3ARW A;  3NRK A;  2RUC A;  4W5U A;  1FFR A;  3KAF A;  3B9A A;  1D6O A;  3ARZ A;  5HWB A;  4FN2 A;  1FKB A;  3WD4 A;  3QOK A;  4TX0 A;  4WKF A;  2OLH A;  1N1A A;  1RD6 A;  1T11 A;  2B31 A;  1NWS A;  4ODM A;  3B8S A;  3O5O A;  5DIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...