4DRHA

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
NNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 30
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drhA00
1QPFA 1B6CA 5HTGA 2PPOA 5DITA 4GIVA 2LKNA 2MPHA 2XP8A 4U86A 2L2SA 3O5KA 5GPGA 2M2AA 3GPKA 3UF8A 2XP4A 1D7HA 3O5OA 2XP7A 5B8IC 1FKHA 1FKBA 5DIUA 1JVWA 2RUCA 3TC5A 3WH0A 3IHZA 3KAGA 5HUAA 1FKLA 1FAPA 1QZ2A 4ODMA 4R0XA 2MF9A 1F8AB 1FKIA 1NSGA 4LAVA 1J4RA 2KI3A 1FKSA 1D7JA 1P5QA 1ZK6A 2ZQVA 3LUOA 4TW7A 3B7XA 4ODNA 3O5EA 1FKTA 4ODQA 4U84A 2DG4A 5J6EA 4ODOA 1Q6HA 3KADA 3KZ7A 2ZR4A 5HWCA 3CGNA 4TX0A 2AWGA 1L1PA 4TW6A 2K8IA 4N19A 5HKGA 3IKDA 4ODKA 4DZ3A 2N87A 4TNSA 2F4EA 5HT1A 2XP5A 2ZR6A 2D9FA 3JXVA 2XP3A 4ODPA 2FKEA 4J4NA 5HW7A 4ODLA 3OOBA 3UI5A 1W26A 1A7XA 1NMWA 2F21A 2RUQA 2RQSA 2MLZA 1ROUA 2ZR5A 4ITZA 2RUDA 4DT4A 4U85A 1Y0OA 1HXVA 4MGVA 3KAIA 3TDBA 4DRPA 2MNTA 2IF4A 2MLYA 2ZQSA 4DRIA 1FKJA 4TYOA 3NRKA 5DIVA 2XP6A 4DRMA 1JNSA 1JNTA 2XPBA 2DG9A 4DZ2A 3KABA 4DRQA 2ZQTA 2OFNA 4QT2A 4DRJA 2PV2A 3ODKA 3VAWA 3IK8A 2ZQUA 2KO7A 3UQBA 2XPAA 1M5YA 1J4HA 4JFKA 1R9HA 4DROA 4G50A 2M1IA 3PRBA 2MLXA 4G2PA 3CGMA 4NNRA 4ODRA 3RGCA 2LPVA 4DRKA 3EY6A 3PRDA 1D6OA 2DG3A 2XP9A 1J6YA 1EYMA 1FKFA 2LGOA 3MDYB 3O5FA 2PBCA 4DRHA 5HW8A 1BKFA 3UI6A 5HWBA 3KAFA 3TCZA 4QIBA 4FN2A 3FAPA 3UQIA 5HW6A 4C02B 1YW5A 4GGQA 3KAHA 1TCOC 4IQ2A 1T11A 1YATA 1C9HA 2RURA 3H9RB 4LAXA 2PPPA 4LAYA 3O5DA 2LJ4A 2PPNA 1FKKA 2VN1A 3JYJA 3O5QA 3O5JA 1PBKA 4IPXA 2FAPA 4JFIA 1Q6IA 1QPLA 2F2DA 1KT0A 1FD9A 4JFMA 4JFLA 4FAPA 5D75A 1ROTA 1KT1A 2PV3A 2RSEA 4JFJA 1Q1CA 2KFWA 1N1AA 3O5MA 4LAWA 1EQ3A 4TW8A 5I98A 4BF8A 4DIPA 1FKGA 3O5IA 1BL4A 3KACA 2PV1A 4QT3A 4W9QA 4IQCA 3NI6A 3I6CA 3JYMA 1U79A 1NMVA 2M08A 3KCEA 3O5GA 4W9PA 2KR7A 1PINA 4JYSA 3O5LA 1FJDA 4O2TA 1Q6UA 2VCDA 2JZVA 1FKDA 4J4OA 3O5RA 4W9OA 1FKRA 2ITKA 4DH0A 4DRNA 1F40A 3NTPA 1ZCNA 1D7IA 3RFWA 2Q5AA 2Y78A 3UQAA 3UI4A 1J4IA 4MSPA 2UZ5A 3IKGA 5BXJA 2KE0A 3PA7A 2KGJA 3O5PA
chains in the Genus database with same CATH superfamily
3ARUA 5HTGA 2P4VA 1ZBWA 3AS2A 2MPHA 2L2SA 3AS0A 1D2KA 3ARZA 3B8SA 3O5OA 1W1TA 3RM4A 1SR0A 2G8ZA 2XP7A 5DIUA 1JVWA 1IX5A 3IHZA 2MF9A 1FKIA 2O92A 1D7JA 2ZQVA 1JNDA 4P8XA 4ODNA 4Q7NA 1NWSA 1X6NA 4TW6A 5HKGA 1EIBA 4HARA 4ODKA 2N87A 3WD2A 2F4EA 5HT1A 1W9VA 2XP3A 1W9PA 5HW7A 1OWQA 1XHGA 3PR9A 1A7XA 4S3KA 2ZR5A 4ITZA 1Y0OA 1UR9A 4MGVA 4DRPA 2DSZA 4TYOA 2ZQTA 2EULA 3IK8A 4Z2KA 3UQBA 2XPAA 1M5YA 1R9HA 4ZPWR 4DROA 4ODRA 4NNRA 1D6OA 2DG3A 2XP9A 3ARRA 3ARQA 2LGOA 1BKFA 4QZVB 5HWBA 1E6PA 3KAFA 1HKJA 1LG1A 4ODMA 3ALFA 1TCOC 5DITA 1T11A 1C9HA 2DT0A 1FKKA 2PPNA 2VN1A 2ETNA 3O5JA 4JFIA 2DSWA 4WKFA 4MAVA 1FD9A 4JFLA 5D75A 4HBEA 4DWSC 4JFJA 1WAWA 1Q1CA 3AS3A 1K9TA 4WKHA 4LAWA 2A3BA 1NH6A 5I98A 3ARVA 1OGGA 1FKGA 3KACA 1NMVA 3FY1A 1O6IA 3WD0A 3O5GA 4JYSA 1GUVA 3O5LA 1Q6UA 4L72B 1LG2A 3O5RA 1W1PA 1ZCNA 3RFWA 5GQBA 4Z2HA 3UQAA 3UI4A 4MSPA 2UZ5A 5DEZA 3PA7A 2OLHA 1B6CA 1TFVA 2B5UB 4S3JA 2LKNA 1ZB5A 4U86A 5GPGA 3O5KA 2A3EA 3GPKA 1KFWA 3KAGA 1FKLA 1FAPA 1NSGA 4LAVA 1FKSA 1ZK6A 3G6LA 4Z2GA 3ARXA 4ODQA 4ML4A 1Q6HA 3KZ7A 3CGNA 3ARWA 1ZBKA 1W1VA 2ZR6A 2D9FA 1FFQA 2FKEA 4ODLA 1NMWA 2F21A 2MLZA 3EIPA 2RUDA 4DT4A 4U85A 1X6LA 1NWRA 2MLYA 3WKZA 1LJYA 3NRKA 5DIVA 4DRMA 1WNOA 4DRQA 2OFNA 1EDQA 4MPKA 1ZL1A 3ARYA 3PRDA 1J6YA 1EYMA 4L3NA 4XAKA 3WL0A 2F23A 3O5FA 2PBCA 1RD6A 3QOKA 4QIBA 3GTYX 2AOSA 3KAHA 4LAYA 1YATA 2FDMA 3H9RB 3GU0A 2PPPA 2PI6A 3JYJA 1PBKA 5GPRA 1Q6IA 4FAPA 3WQVA 1ROTA 2PV3A 1HKIA 1NWTA 1EQ3A 1H0GA 1NWUA 4MNJA 4PTMA 1JCHB 2WLZA 2PV1A 3RM9A 1UR8A 1ZU8A 3RM8A 3JYMA 2M08A 2WK2A 4W9PA 2KR7A 1PINA 3WQWA 4O2TA 2VCDA 2JZVA 1FKDA 4W9OA 1FKRA 2ITKA 4DRNA 2Q5AA 4P8UA 4AY1A 1J4IA 4DWSB 3IKGA 4HBOA 2KGJA 1P5QA 1ITXA 1ZBCA 3AROA 2PPOA 1HKKA 4GIVA 2XP8A 2M2AA 4NSBA 3UF8A 2XP4A 1FKHA 1FKBA 1HKMA 4WJXA 2RUCA 1E6ZA 3TC5A 4R0XA 4IT6A 4DWSD 1F8AB 1H0IA 3LUOA 1HJXA 1FKTA 2DG4A 1VF8A 3FXYA 3KADA 5HBFA 2K8IA 4N19A 2YBTA 4DWSA 2DT2A 2XP5A 1E6RA 1E6NA 2DT3A 3OOBA 2YBUA 3WD1A 2RUQA 2RQSA 1ROUA 1HXVA 3TDBA 4DRIA 4R5EA 1FKJA 1JNSA 3KABA 3ARPA 2G41A 2ZQUA 4MNMA 5DO2A 4JFKA 4NZCA 3W4RA 2MLXA 4G2PA 3CGMA 2LPVA 5JH8A 1FKFA 2DT1A 3MDYB 5HW8A 2IUZA 3TCZA 4P8VA 3WD3A 1E9LA 4Q22A 3UQIA 5HW6A 4C02B 4IQ2A 1LL6A 4LAXA 1HJWA 3O5DA 1KT0A 4JFMA 2RSEA 2DSVA 3RMEA 2KFWA 1N1AA 4Z2IA 3O5MA 4TW8A 4KR0B 4BF8A 1EHNA 3WIJA 3CHDA 4IQCA 3NI6A 1U79A 4WK9A 2DPEA 3NTPA 1D7IA 1GRJA 4MNLA 2WM0A 2KE0A 4IT4A 4Z2JA 3O5PA 3UI5A 1QPFA 2O9OA 5DF0A 3B9DA 3AQUA 4ZPVR 1D7HA 5B8IC 4URIA 3WH0A 5HUAA 1QZ2A 2A3AA 4KQZA 2ESCA 1J4RA 2KI3A 1CTNA 4LGXA 4TW7A 4ZS6A 3B7XA 3CZ8A 1LL4A 1WB0A 3O5EA 3OA5A 4U84A 2A3CA 5J6EA 4ODOA 5HWCA 2ZR4A 2AWGA 3ALGA 2WLYA 3IKDA 3AS1A 4DZ3A 4MNKA 4TNSA 1E44A 1ZBVA 3JXVA 4ODPA 4J4NA 3B9EA 1FFRA 3WL1A 1W26A 1JNEA 3CH9A 1HJVA 1LQ0A 3KAIA 2MNTA 2IF4A 2ZQSA 1SYTA 2XP6A 4ZPTR 1JNTA 2XPBA 2DG9A 4DZ2A 4QT2A 4DRJA 2PV2A 3ODKA 3VAWA 2KO7A 1W9UA 4MTVA 1J4HA 3B9AA 4G50A 2M1IA 3PRBA 3RGCA 1L1PA 3CHFA 4DRKA 3EY6A 4W5UA 3CHEA 3G6MA 4DRHA 3UI6A 3BMBA 4FN2A 3FAPA 1E15A 1YW5A 4GGQA 4TX0A 2RURA 2LJ4A 3O5QA 4IPXA 2FAPA 1QPLA 2F2DA 1OGBA 1KT1A 2B31A 2QF8A 4DIPA 2PN0A 3CHCA 3O5IA 1BL4A 4Z2LA 4QT3A 4W9QA 3WD4A 3I6CA 3KCEA 1GOIA 1FJDA 3ARSA 3ARTA 4WIWA 4J4OA 4UDMA 1GPFA 3PRAA 4WKAA 4DH0A 1F40A 2DSUA 2Y78A 1XRVA 1LL7A 3BXWA 4P8WA 5BXJA 1W1YA
chains in the Genus database with same CATH topology
3ARUA 5HTGA 3AS2A 1ZBWA 2MPHA 2L2SA 3AS0A 1D2KA 3ARZA 3B8SA 3O5OA 1W1TA 3RM4A 1SR0A 2G8ZA 2XP7A 5DIUA 1JVWA 1IX5A 3IHZA 2MF9A 1FKIA 2O92A 1D7JA 2ZQVA 1JNDA 4P8XA 4ODNA 4Q7NA 1NWSA 1X6NA 4TW6A 5HKGA 1EIBA 4HARA 4ODKA 2N87A 3WD2A 2F4EA 5HT1A 1W9VA 2XP3A 1W9PA 5HW7A 1OWQA 1XHGA 3PR9A 1A7XA 4S3KA 2ZR5A 4ITZA 1Y0OA 1UR9A 4MGVA 4DRPA 2DSZA 4TYOA 2ZQTA 3IK8A 4Z2KA 3UQBA 2XPAA 1M5YA 1R9HA 4ZPWR 4DROA 4ODRA 4NNRA 1D6OA 2DG3A 2XP9A 3ARRA 3ARQA 2LGOA 1BKFA 4QZVB 5HWBA 1E6PA 3KAFA 1HKJA 1LG1A 4ODMA 3ALFA 1TCOC 5DITA 1T11A 1C9HA 2DT0A 1FKKA 2PPNA 4JFIA 2VN1A 3O5JA 4WKFA 2DSWA 4MAVA 1FD9A 4JFLA 5D75A 4HBEA 4DWSC 4JFJA 1WAWA 1Q1CA 3AS3A 1K9TA 4WKHA 4LAWA 2A3BA 1NH6A 5I98A 3ARVA 1OGGA 1FKGA 3KACA 1NMVA 3FY1A 1O6IA 3WD0A 3O5GA 4JYSA 1GUVA 3O5LA 1Q6UA 4L72B 1LG2A 3O5RA 1W1PA 1ZCNA 3RFWA 5GQBA 4Z2HA 3UQAA 3UI4A 4MSPA 2UZ5A 5DEZA 3PA7A 2OLHA 1B6CA 1TFVA 4S3JA 2LKNA 1ZB5A 4U86A 5GPGA 3O5KA 2A3EA 3GPKA 1KFWA 3KAGA 1FKLA 1FAPA 1NSGA 4LAVA 1FKSA 1ZK6A 3G6LA 4Z2GA 3ARXA 4ODQA 4ML4A 1Q6HA 3KZ7A 3CGNA 3ARWA 1ZBKA 1W1VA 2ZR6A 2D9FA 1FFQA 2FKEA 4ODLA 1NMWA 2F21A 2MLZA 2RUDA 4DT4A 4U85A 1X6LA 1NWRA 2MLYA 3WKZA 1LJYA 3NRKA 5DIVA 4DRMA 1WNOA 4DRQA 2OFNA 1EDQA 4MPKA 1ZL1A 3ARYA 3PRDA 1J6YA 1EYMA 4L3NA 4XAKA 3WL0A 3O5FA 2PBCA 1RD6A 3QOKA 4QIBA 2AOSA 3KAHA 4LAYA 1YATA 2FDMA 3H9RB 2PPPA 2PI6A 3JYJA 1PBKA 5GPRA 1Q6IA 4FAPA 3WQVA 1ROTA 2PV3A 1HKIA 1NWTA 1EQ3A 1H0GA 1NWUA 4MNJA 4PTMA 2WLZA 2PV1A 3RM9A 1UR8A 1ZU8A 3RM8A 3JYMA 2M08A 2WK2A 4W9PA 2KR7A 1PINA 3WQWA 4O2TA 2VCDA 2JZVA 1FKDA 4W9OA 1FKRA 2ITKA 4DRNA 2Q5AA 4P8UA 4AY1A 1J4IA 4DWSB 3IKGA 4HBOA 2KGJA 1P5QA 1ITXA 1ZBCA 3AROA 2PPOA 1HKKA 4GIVA 2XP8A 2M2AA 4NSBA 3UF8A 2XP4A 1FKHA 1FKBA 1HKMA 4WJXA 2RUCA 1E6ZA 3TC5A 4R0XA 4IT6A 4DWSD 1F8AB 1H0IA 3LUOA 1HJXA 1FKTA 2DG4A 1VF8A 3FXYA 3KADA 5HBFA 2K8IA 4N19A 2YBTA 4DWSA 2DT2A 2XP5A 1E6RA 1E6NA 2DT3A 3OOBA 2YBUA 3WD1A 2RUQA 2RQSA 1ROUA 1HXVA 3TDBA 4DRIA 4R5EA 1FKJA 1JNSA 3KABA 3ARPA 2G41A 2ZQUA 4MNMA 5DO2A 4JFKA 4NZCA 3W4RA 2MLXA 4G2PA 3CGMA 2LPVA 5JH8A 1FKFA 2DT1A 3MDYB 5HW8A 2IUZA 3TCZA 4P8VA 3WD3A 1E9LA 4Q22A 3UQIA 5HW6A 4C02B 4IQ2A 1LL6A 4LAXA 1HJWA 3O5DA 1KT0A 4JFMA 2RSEA 2DSVA 3RMEA 2KFWA 1N1AA 4Z2IA 3O5MA 4TW8A 4KR0B 4BF8A 1EHNA 3WIJA 3CHDA 4IQCA 3NI6A 1U79A 4WK9A 2DPEA 3NTPA 1D7IA 4MNLA 2WM0A 2KE0A 4IT4A 4Z2JA 3O5PA 3UI5A 1QPFA 2O9OA 5DF0A 3B9DA 3AQUA 4ZPVR 1D7HA 5B8IC 4URIA 3WH0A 5HUAA 1QZ2A 2A3AA 4KQZA 2ESCA 1J4RA 2KI3A 1CTNA 4LGXA 4TW7A 4ZS6A 3B7XA 3CZ8A 1LL4A 1WB0A 3O5EA 3OA5A 4U84A 2A3CA 5J6EA 4ODOA 5HWCA 2ZR4A 2AWGA 3ALGA 2WLYA 3IKDA 3AS1A 4DZ3A 4MNKA 4TNSA 1ZBVA 3JXVA 4ODPA 4J4NA 3B9EA 1FFRA 3WL1A 1W26A 1JNEA 3CH9A 1HJVA 1LQ0A 3KAIA 2MNTA 2IF4A 2ZQSA 1SYTA 2XP6A 4ZPTR 1JNTA 2XPBA 2DG9A 4DZ2A 4QT2A 4DRJA 2PV2A 3ODKA 3VAWA 2KO7A 1W9UA 4MTVA 1J4HA 3B9AA 4G50A 2M1IA 3PRBA 3RGCA 1L1PA 3CHFA 4DRKA 3EY6A 4W5UA 3CHEA 3G6MA 4DRHA 3UI6A 4FN2A 3FAPA 1E15A 1YW5A 4GGQA 4TX0A 2RURA 2LJ4A 3O5QA 4IPXA 2FAPA 1QPLA 2F2DA 1OGBA 1KT1A 2B31A 2QF8A 4DIPA 3CHCA 3O5IA 1BL4A 4Z2LA 4QT3A 4W9QA 3WD4A 3I6CA 3KCEA 1GOIA 1FJDA 3ARSA 3ARTA 4WIWA 4J4OA 1GPFA 3PRAA 4WKAA 4DH0A 1F40A 2DSUA 2Y78A 1XRVA 1LL7A 3BXWA 4P8WA 5BXJA 1W1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPF A;  1B6C A;  5HTG A;  2PPO A;  5DIT A;  4GIV A;  2LKN A;  2MPH A;  2XP8 A;  4U86 A;  2L2S A;  3O5K A;  5GPG A;  2M2A A;  3GPK A;  3UF8 A;  2XP4 A;  1D7H A;  3O5O A;  2XP7 A;  5B8I C;  1FKH A;  1FKB A;  5DIU A;  1JVW A;  2RUC A;  3TC5 A;  3WH0 A;  3IHZ A;  3KAG A;  5HUA A;  1FKL A;  1FAP A;  1QZ2 A;  4ODM A;  4R0X A;  2MF9 A;  1F8A B;  1FKI A;  1NSG A;  4LAV A;  1J4R A;  2KI3 A;  1FKS A;  1D7J A;  1P5Q A;  1ZK6 A;  2ZQV A;  3LUO A;  4TW7 A;  3B7X A;  4ODN A;  3O5E A;  1FKT A;  4ODQ A;  4U84 A;  2DG4 A;  5J6E A;  4ODO A;  1Q6H A;  3KAD A;  3KZ7 A;  2ZR4 A;  5HWC A;  3CGN A;  4TX0 A;  2AWG A;  1L1P A;  4TW6 A;  2K8I A;  4N19 A;  5HKG A;  3IKD A;  4ODK A;  4DZ3 A;  2N87 A;  4TNS A;  2F4E A;  5HT1 A;  2XP5 A;  2ZR6 A;  2D9F A;  3JXV A;  2XP3 A;  4ODP A;  2FKE A;  4J4N A;  5HW7 A;  4ODL A;  3OOB A;  3UI5 A;  1W26 A;  1A7X A;  1NMW A;  2F21 A;  2RUQ A;  2RQS A;  2MLZ A;  1ROU A;  2ZR5 A;  4ITZ A;  2RUD A;  4DT4 A;  4U85 A;  1Y0O A;  1HXV A;  4MGV A;  3KAI A;  3TDB A;  4DRP A;  2MNT A;  2IF4 A;  2MLY A;  2ZQS A;  4DRI A;  1FKJ A;  4TYO A;  3NRK A;  5DIV A;  2XP6 A;  4DRM A;  1JNS A;  1JNT A;  2XPB A;  2DG9 A;  4DZ2 A;  3KAB A;  4DRQ A;  2ZQT A;  2OFN A;  4QT2 A;  4DRJ A;  2PV2 A;  3ODK A;  3VAW A;  3IK8 A;  2ZQU A;  2KO7 A;  3UQB A;  2XPA A;  1M5Y A;  1J4H A;  4JFK A;  1R9H A;  4DRO A;  4G50 A;  2M1I A;  3PRB A;  2MLX A;  4G2P A;  3CGM A;  4NNR A;  4ODR A;  3RGC A;  2LPV A;  4DRK A;  3EY6 A;  3PRD A;  1D6O A;  2DG3 A;  2XP9 A;  1J6Y A;  1EYM A;  1FKF A;  2LGO A;  3MDY B;  3O5F A;  2PBC A;  4DRH A;  5HW8 A;  1BKF A;  3UI6 A;  5HWB A;  3KAF A;  3TCZ A;  4QIB A;  4FN2 A;  3FAP A;  3UQI A;  5HW6 A;  4C02 B;  1YW5 A;  4GGQ A;  3KAH A;  1TCO C;  4IQ2 A;  1T11 A;  1YAT A;  1C9H A;  2RUR A;  3H9R B;  4LAX A;  2PPP A;  4LAY A;  3O5D A;  2LJ4 A;  2PPN A;  1FKK A;  2VN1 A;  3JYJ A;  3O5Q A;  3O5J A;  1PBK A;  4IPX A;  2FAP A;  4JFI A;  1Q6I A;  1QPL A;  2F2D A;  1KT0 A;  1FD9 A;  4JFM A;  4JFL A;  4FAP A;  5D75 A;  1ROT A;  1KT1 A;  2PV3 A;  2RSE A;  4JFJ A;  1Q1C A;  2KFW A;  1N1A A;  3O5M A;  4LAW A;  1EQ3 A;  4TW8 A;  5I98 A;  4BF8 A;  4DIP A;  1FKG A;  3O5I A;  1BL4 A;  3KAC A;  2PV1 A;  4QT3 A;  4W9Q A;  4IQC A;  3NI6 A;  3I6C A;  3JYM A;  1U79 A;  1NMV A;  2M08 A;  3KCE A;  3O5G A;  4W9P A;  2KR7 A;  1PIN A;  4JYS A;  3O5L A;  1FJD A;  4O2T A;  1Q6U A;  2VCD A;  2JZV A;  1FKD A;  4J4O A;  3O5R A;  4W9O A;  1FKR A;  2ITK A;  4DH0 A;  4DRN A;  1F40 A;  3NTP A;  1ZCN A;  1D7I A;  3RFW A;  2Q5A A;  2Y78 A;  3UQA A;  3UI4 A;  1J4I A;  4MSP A;  2UZ5 A;  3IKG A;  5BXJ A;  2KE0 A;  3PA7 A;  2KGJ A;  3O5P A; 
#chains in the Genus database with same CATH topology
 3ARU A;  5HTG A;  2P4V A;  1ZBW A;  3AS2 A;  2MPH A;  2L2S A;  3AS0 A;  1D2K A;  3ARZ A;  3B8S A;  3O5O A;  1W1T A;  3RM4 A;  1SR0 A;  2G8Z A;  2XP7 A;  5DIU A;  1JVW A;  1IX5 A;  3IHZ A;  2MF9 A;  1FKI A;  2O92 A;  1D7J A;  2ZQV A;  1JND A;  4P8X A;  4ODN A;  4Q7N A;  1NWS A;  1X6N A;  4TW6 A;  5HKG A;  1EIB A;  4HAR A;  4ODK A;  2N87 A;  3WD2 A;  2F4E A;  5HT1 A;  1W9V A;  2XP3 A;  1W9P A;  5HW7 A;  1OWQ A;  1XHG A;  3PR9 A;  1A7X A;  4S3K A;  2ZR5 A;  4ITZ A;  1Y0O A;  1UR9 A;  4MGV A;  4DRP A;  2DSZ A;  4TYO A;  2ZQT A;  2EUL A;  3IK8 A;  4Z2K A;  3UQB A;  2XPA A;  1M5Y A;  1R9H A;  4ZPW R;  4DRO A;  4ODR A;  4NNR A;  1D6O A;  2DG3 A;  2XP9 A;  3ARR A;  3ARQ A;  2LGO A;  1BKF A;  4QZV B;  5HWB A;  1E6P A;  3KAF A;  1HKJ A;  1LG1 A;  4ODM A;  3ALF A;  1TCO C;  5DIT A;  1T11 A;  1C9H A;  2DT0 A;  1FKK A;  2PPN A;  2VN1 A;  2ETN A;  3O5J A;  4JFI A;  2DSW A;  4WKF A;  4MAV A;  1FD9 A;  4JFL A;  5D75 A;  4HBE A;  4DWS C;  4JFJ A;  1WAW A;  1Q1C A;  3AS3 A;  1K9T A;  4WKH A;  4LAW A;  2A3B A;  1NH6 A;  5I98 A;  3ARV A;  1OGG A;  1FKG A;  3KAC A;  1NMV A;  3FY1 A;  1O6I A;  3WD0 A;  3O5G A;  4JYS A;  1GUV A;  3O5L A;  1Q6U A;  4L72 B;  1LG2 A;  3O5R A;  1W1P A;  1ZCN A;  3RFW A;  5GQB A;  4Z2H A;  3UQA A;  3UI4 A;  4MSP A;  2UZ5 A;  5DEZ A;  3PA7 A;  2OLH A;  1B6C A;  1TFV A;  2B5U B;  4S3J A;  2LKN A;  1ZB5 A;  4U86 A;  5GPG A;  3O5K A;  2A3E A;  3GPK A;  1KFW A;  3KAG A;  1FKL A;  1FAP A;  1NSG A;  4LAV A;  1FKS A;  1ZK6 A;  3G6L A;  4Z2G A;  3ARX A;  4ODQ A;  4ML4 A;  1Q6H A;  3KZ7 A;  3CGN A;  3ARW A;  1ZBK A;  1W1V A;  2ZR6 A;  2D9F A;  1FFQ A;  2FKE A;  4ODL A;  1NMW A;  2F21 A;  2MLZ A;  3EIP A;  2RUD A;  4DT4 A;  4U85 A;  1X6L A;  1NWR A;  2MLY A;  3WKZ A;  1LJY A;  3NRK A;  5DIV A;  4DRM A;  1WNO A;  4DRQ A;  2OFN A;  1EDQ A;  4MPK A;  1ZL1 A;  3ARY A;  3PRD A;  1J6Y A;  1EYM A;  4L3N A;  4XAK A;  3WL0 A;  2F23 A;  3O5F A;  2PBC A;  1RD6 A;  3QOK A;  4QIB A;  3GTY X;  2AOS A;  3KAH A;  4LAY A;  1YAT A;  2FDM A;  3H9R B;  3GU0 A;  2PPP A;  2PI6 A;  3JYJ A;  1PBK A;  5GPR A;  1Q6I A;  4FAP A;  3WQV A;  1ROT A;  2PV3 A;  1HKI A;  1NWT A;  1EQ3 A;  1H0G A;  1NWU A;  4MNJ A;  4PTM A;  1JCH B;  2WLZ A;  2PV1 A;  3RM9 A;  1UR8 A;  1ZU8 A;  3RM8 A;  3JYM A;  2M08 A;  2WK2 A;  4W9P A;  2KR7 A;  1PIN A;  3WQW A;  4O2T A;  2VCD A;  2JZV A;  1FKD A;  4W9O A;  1FKR A;  2ITK A;  4DRN A;  2Q5A A;  4P8U A;  4AY1 A;  1J4I A;  4DWS B;  3IKG A;  4HBO A;  2KGJ A;  1P5Q A;  1ITX A;  1ZBC A;  3ARO A;  2PPO A;  1HKK A;  4GIV A;  2XP8 A;  2M2A A;  4NSB A;  3UF8 A;  2XP4 A;  1FKH A;  1FKB A;  1HKM A;  4WJX A;  2RUC A;  1E6Z A;  3TC5 A;  4R0X A;  4IT6 A;  4DWS D;  1F8A B;  1H0I A;  3LUO A;  1HJX A;  1FKT A;  2DG4 A;  1VF8 A;  3FXY A;  3KAD A;  5HBF A;  2K8I A;  4N19 A;  2YBT A;  4DWS A;  2DT2 A;  2XP5 A;  1E6R A;  1E6N A;  2DT3 A;  3OOB A;  2YBU A;  3WD1 A;  2RUQ A;  2RQS A;  1ROU A;  1HXV A;  3TDB A;  4DRI A;  4R5E A;  1FKJ A;  1JNS A;  3KAB A;  3ARP A;  2G41 A;  2ZQU A;  4MNM A;  5DO2 A;  4JFK A;  4NZC A;  3W4R A;  2MLX A;  4G2P A;  3CGM A;  2LPV A;  5JH8 A;  1FKF A;  2DT1 A;  3MDY B;  5HW8 A;  2IUZ A;  3TCZ A;  4P8V A;  3WD3 A;  1E9L A;  4Q22 A;  3UQI A;  5HW6 A;  4C02 B;  4IQ2 A;  1LL6 A;  4LAX A;  1HJW A;  3O5D A;  1KT0 A;  4JFM A;  2RSE A;  2DSV A;  3RME A;  2KFW A;  1N1A A;  4Z2I A;  3O5M A;  4TW8 A;  4KR0 B;  4BF8 A;  1EHN A;  3WIJ A;  3CHD A;  4IQC A;  3NI6 A;  1U79 A;  4WK9 A;  2DPE A;  3NTP A;  1D7I A;  1GRJ A;  4MNL A;  2WM0 A;  2KE0 A;  4IT4 A;  4Z2J A;  3O5P A;  3UI5 A;  1QPF A;  2O9O A;  5DF0 A;  3B9D A;  3AQU A;  4ZPV R;  1D7H A;  5B8I C;  4URI A;  3WH0 A;  5HUA A;  1QZ2 A;  2A3A A;  4KQZ A;  2ESC A;  1J4R A;  2KI3 A;  1CTN A;  4LGX A;  4TW7 A;  4ZS6 A;  3B7X A;  3CZ8 A;  1LL4 A;  1WB0 A;  3O5E A;  3OA5 A;  4U84 A;  2A3C A;  5J6E A;  4ODO A;  5HWC A;  2ZR4 A;  2AWG A;  3ALG A;  2WLY A;  3IKD A;  3AS1 A;  4DZ3 A;  4MNK A;  4TNS A;  1E44 A;  1ZBV A;  3JXV A;  4ODP A;  4J4N A;  3B9E A;  1FFR A;  3WL1 A;  1W26 A;  1JNE A;  3CH9 A;  1HJV A;  1LQ0 A;  3KAI A;  2MNT A;  2IF4 A;  2ZQS A;  1SYT A;  2XP6 A;  4ZPT R;  1JNT A;  2XPB A;  2DG9 A;  4DZ2 A;  4QT2 A;  4DRJ A;  2PV2 A;  3ODK A;  3VAW A;  2KO7 A;  1W9U A;  4MTV A;  1J4H A;  3B9A A;  4G50 A;  2M1I A;  3PRB A;  3RGC A;  1L1P A;  3CHF A;  4DRK A;  3EY6 A;  4W5U A;  3CHE A;  3G6M A;  4DRH A;  3UI6 A;  3BMB A;  4FN2 A;  3FAP A;  1E15 A;  1YW5 A;  4GGQ A;  4TX0 A;  2RUR A;  2LJ4 A;  3O5Q A;  4IPX A;  2FAP A;  1QPL A;  2F2D A;  1OGB A;  1KT1 A;  2B31 A;  2QF8 A;  4DIP A;  2PN0 A;  3CHC A;  3O5I A;  1BL4 A;  4Z2L A;  4QT3 A;  4W9Q A;  3WD4 A;  3I6C A;  3KCE A;  1GOI A;  1FJD A;  3ARS A;  3ART A;  4WIW A;  4J4O A;  4UDM A;  1GPF A;  3PRA A;  4WKA A;  4DH0 A;  1F40 A;  2DSU A;  2Y78 A;  1XRV A;  1LL7 A;  3BXW A;  4P8W A;  5BXJ A;  1W1Y A; 
#chains in the Genus database with same CATH homology
 3ARU A;  5HTG A;  3AS2 A;  1ZBW A;  2MPH A;  2L2S A;  3AS0 A;  1D2K A;  3ARZ A;  3B8S A;  3O5O A;  1W1T A;  3RM4 A;  1SR0 A;  2G8Z A;  2XP7 A;  5DIU A;  1JVW A;  1IX5 A;  3IHZ A;  2MF9 A;  1FKI A;  2O92 A;  1D7J A;  2ZQV A;  1JND A;  4P8X A;  4ODN A;  4Q7N A;  1NWS A;  1X6N A;  4TW6 A;  5HKG A;  1EIB A;  4HAR A;  4ODK A;  2N87 A;  3WD2 A;  2F4E A;  5HT1 A;  1W9V A;  2XP3 A;  1W9P A;  5HW7 A;  1OWQ A;  1XHG A;  3PR9 A;  1A7X A;  4S3K A;  2ZR5 A;  4ITZ A;  1Y0O A;  1UR9 A;  4MGV A;  4DRP A;  2DSZ A;  4TYO A;  2ZQT A;  3IK8 A;  4Z2K A;  3UQB A;  2XPA A;  1M5Y A;  1R9H A;  4ZPW R;  4DRO A;  4ODR A;  4NNR A;  1D6O A;  2DG3 A;  2XP9 A;  3ARR A;  3ARQ A;  2LGO A;  1BKF A;  4QZV B;  5HWB A;  1E6P A;  3KAF A;  1HKJ A;  1LG1 A;  4ODM A;  3ALF A;  1TCO C;  5DIT A;  1T11 A;  1C9H A;  2DT0 A;  1FKK A;  2PPN A;  4JFI A;  2VN1 A;  3O5J A;  4WKF A;  2DSW A;  4MAV A;  1FD9 A;  4JFL A;  5D75 A;  4HBE A;  4DWS C;  4JFJ A;  1WAW A;  1Q1C A;  3AS3 A;  1K9T A;  4WKH A;  4LAW A;  2A3B A;  1NH6 A;  5I98 A;  3ARV A;  1OGG A;  1FKG A;  3KAC A;  1NMV A;  3FY1 A;  1O6I A;  3WD0 A;  3O5G A;  4JYS A;  1GUV A;  3O5L A;  1Q6U A;  4L72 B;  1LG2 A;  3O5R A;  1W1P A;  1ZCN A;  3RFW A;  5GQB A;  4Z2H A;  3UQA A;  3UI4 A;  4MSP A;  2UZ5 A;  5DEZ A;  3PA7 A;  2OLH A;  1B6C A;  1TFV A;  4S3J A;  2LKN A;  1ZB5 A;  4U86 A;  5GPG A;  3O5K A;  2A3E A;  3GPK A;  1KFW A;  3KAG A;  1FKL A;  1FAP A;  1NSG A;  4LAV A;  1FKS A;  1ZK6 A;  3G6L A;  4Z2G A;  3ARX A;  4ODQ A;  4ML4 A;  1Q6H A;  3KZ7 A;  3CGN A;  3ARW A;  1ZBK A;  1W1V A;  2ZR6 A;  2D9F A;  1FFQ A;  2FKE A;  4ODL A;  1NMW A;  2F21 A;  2MLZ A;  2RUD A;  4DT4 A;  4U85 A;  1X6L A;  1NWR A;  2MLY A;  3WKZ A;  1LJY A;  3NRK A;  5DIV A;  4DRM A;  1WNO A;  4DRQ A;  2OFN A;  1EDQ A;  4MPK A;  1ZL1 A;  3ARY A;  3PRD A;  1J6Y A;  1EYM A;  4L3N A;  4XAK A;  3WL0 A;  3O5F A;  2PBC A;  1RD6 A;  3QOK A;  4QIB A;  2AOS A;  3KAH A;  4LAY A;  1YAT A;  2FDM A;  3H9R B;  2PPP A;  2PI6 A;  3JYJ A;  1PBK A;  5GPR A;  1Q6I A;  4FAP A;  3WQV A;  1ROT A;  2PV3 A;  1HKI A;  1NWT A;  1EQ3 A;  1H0G A;  1NWU A;  4MNJ A;  4PTM A;  2WLZ A;  2PV1 A;  3RM9 A;  1UR8 A;  1ZU8 A;  3RM8 A;  3JYM A;  2M08 A;  2WK2 A;  4W9P A;  2KR7 A;  1PIN A;  3WQW A;  4O2T A;  2VCD A;  2JZV A;  1FKD A;  4W9O A;  1FKR A;  2ITK A;  4DRN A;  2Q5A A;  4P8U A;  4AY1 A;  1J4I A;  4DWS B;  3IKG A;  4HBO A;  2KGJ A;  1P5Q A;  1ITX A;  1ZBC A;  3ARO A;  2PPO A;  1HKK A;  4GIV A;  2XP8 A;  2M2A A;  4NSB A;  3UF8 A;  2XP4 A;  1FKH A;  1FKB A;  1HKM A;  4WJX A;  2RUC A;  1E6Z A;  3TC5 A;  4R0X A;  4IT6 A;  4DWS D;  1F8A B;  1H0I A;  3LUO A;  1HJX A;  1FKT A;  2DG4 A;  1VF8 A;  3FXY A;  3KAD A;  5HBF A;  2K8I A;  4N19 A;  2YBT A;  4DWS A;  2DT2 A;  2XP5 A;  1E6R A;  1E6N A;  2DT3 A;  3OOB A;  2YBU A;  3WD1 A;  2RUQ A;  2RQS A;  1ROU A;  1HXV A;  3TDB A;  4DRI A;  4R5E A;  1FKJ A;  1JNS A;  3KAB A;  3ARP A;  2G41 A;  2ZQU A;  4MNM A;  5DO2 A;  4JFK A;  4NZC A;  3W4R A;  2MLX A;  4G2P A;  3CGM A;  2LPV A;  5JH8 A;  1FKF A;  2DT1 A;  3MDY B;  5HW8 A;  2IUZ A;  3TCZ A;  4P8V A;  3WD3 A;  1E9L A;  4Q22 A;  3UQI A;  5HW6 A;  4C02 B;  4IQ2 A;  1LL6 A;  4LAX A;  1HJW A;  3O5D A;  1KT0 A;  4JFM A;  2RSE A;  2DSV A;  3RME A;  2KFW A;  1N1A A;  4Z2I A;  3O5M A;  4TW8 A;  4KR0 B;  4BF8 A;  1EHN A;  3WIJ A;  3CHD A;  4IQC A;  3NI6 A;  1U79 A;  4WK9 A;  2DPE A;  3NTP A;  1D7I A;  4MNL A;  2WM0 A;  2KE0 A;  4IT4 A;  4Z2J A;  3O5P A;  3UI5 A;  1QPF A;  2O9O A;  5DF0 A;  3B9D A;  3AQU A;  4ZPV R;  1D7H A;  5B8I C;  4URI A;  3WH0 A;  5HUA A;  1QZ2 A;  2A3A A;  4KQZ A;  2ESC A;  1J4R A;  2KI3 A;  1CTN A;  4LGX A;  4TW7 A;  4ZS6 A;  3B7X A;  3CZ8 A;  1LL4 A;  1WB0 A;  3O5E A;  3OA5 A;  4U84 A;  2A3C A;  5J6E A;  4ODO A;  5HWC A;  2ZR4 A;  2AWG A;  3ALG A;  2WLY A;  3IKD A;  3AS1 A;  4DZ3 A;  4MNK A;  4TNS A;  1ZBV A;  3JXV A;  4ODP A;  4J4N A;  3B9E A;  1FFR A;  3WL1 A;  1W26 A;  1JNE A;  3CH9 A;  1HJV A;  1LQ0 A;  3KAI A;  2MNT A;  2IF4 A;  2ZQS A;  1SYT A;  2XP6 A;  4ZPT R;  1JNT A;  2XPB A;  2DG9 A;  4DZ2 A;  4QT2 A;  4DRJ A;  2PV2 A;  3ODK A;  3VAW A;  2KO7 A;  1W9U A;  4MTV A;  1J4H A;  3B9A A;  4G50 A;  2M1I A;  3PRB A;  3RGC A;  1L1P A;  3CHF A;  4DRK A;  3EY6 A;  4W5U A;  3CHE A;  3G6M A;  4DRH A;  3UI6 A;  4FN2 A;  3FAP A;  1E15 A;  1YW5 A;  4GGQ A;  4TX0 A;  2RUR A;  2LJ4 A;  3O5Q A;  4IPX A;  2FAP A;  1QPL A;  2F2D A;  1OGB A;  1KT1 A;  2B31 A;  2QF8 A;  4DIP A;  3CHC A;  3O5I A;  1BL4 A;  4Z2L A;  4QT3 A;  4W9Q A;  3WD4 A;  3I6C A;  3KCE A;  1GOI A;  1FJD A;  3ARS A;  3ART A;  4WIW A;  4J4O A;  1GPF A;  3PRA A;  4WKA A;  4DH0 A;  1F40 A;  2DSU A;  2Y78 A;  1XRV A;  1LL7 A;  3BXW A;  4P8W A;  5BXJ A;  1W1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...