4DRIB

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
GAMDPEFMEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
molecule tags Isomerase/transferase
source organism Homo sapiens
total genus 38
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4driB00
1AUEA 5GPGB 4DRHB 1NSGB 2GAQA 4DRJB 4DRIB 1FAPB 3FAPB 4FAPB 2FAPB 2RSEB 2NPUA
chains in the Genus database with same CATH superfamily
2CYDA 4DOZA 4Q4ZF 4O7GA 4QI2A 5FCLA 2EIMC 3AG3C 4UDVA 1VLTA 1CPQA 3ZIBA 3ZWIA 1GM5A 4K1OA 4JIOA 1JAFA 1M2VB 4O6NA 2XRHA 2W4MA 3VAYA 4YJWA 3A9CA 1Q0DA 3X2QC 1M6TA 2WZGA 3AGTA 2Y3GA 2QNLA 2XS8A 2NUPA 2YWAA 2R9RB 1Z7Qc 2Q7RA 3EPVA 3ASOC 1APCA 2P7VA 3MLGA 5B3SC 2H7BA 3WAQA 3ZSUA 2HUJA 3M4CA 4FAPB 2XLWA 2P1AA 1H9TA 3IQ5A 2GFHA 5B1AC 1CGME 4OD5A 4O6YA 1ZU5A 3FVYA 4DRHB 4WGZA 3ZTMA 4JW1A 3CEXA 3JCUQ 4U5FE 2D4UA 2YRFA 4Q7CA 1ZHWA 2L6GA 3ZTZA 2XS1A 2IYLD 3VM6A 2WVQA 3GEEA 2PNOA 5JRAA 3I5QA 3HJCA 1M2VA 2A6EF 5BQHA 1NG1A 3IQ6A 4XEVA 4E7SA 4IGGA 4EBJA 1PD1A 5KYXB 3L0IA 3W4YA 3FMSA 4EBBA 1H6GA 3ATPA 1FMVA 1K40A 2HMQA 1HMDA 1Q0FA 2M4EA 1C03A 3M4BA 4WABA 3TULA 1C02A 1LE2A 3GM1A 4XPYA 1RKEB 4XPWA 3NRHA 2Q3TA 5KYYA 4XQ1A 4F4BA 2Z15A 3R7CA 3RW0A 5A6BD 3CQZA 2LK4A 3SP1A 3LEVA 2RD9A 1HMOA 3S28A 2NPUA 1K05A 2A1DD 2VCBA 5E3CA 1ZYRF 3M15A 2OQMA 3IQCA 3JTLO 2IXOA 4C3BA 4CJGA 4Q5SF 1GS9A 4MTOA 1E2XA 1N1CA 2A69F 4JVSA 4C3DA 3V5ZA 3HNKA 2YKZA 2WL8A 1SR2A 4BPMA 2A6HF 3JRMO 4LDQA 1KNYA 4JCHA 1OW7A 3EFOA 2P0NA 1SMYF 4IJJA 1IZMA 1VLSA 3EH2A 3RYLA 4MVRA 1YARO 2R7QA 2XL6A 4JTDB 3C8GD 3ABLC 3DKAA 5DQZA 5B1BC 5JVEA 4X0RA 3Q7GA 4XEKA 4CX9A 2CNWA 2A0BA 2ZD9A 3RFYA 3SEOA 2ZXRA 4KNWA 5D91A 2YLGA 4Z9HA 3VYWA 4ZLCA 1VB5A 4CDVA 4MW8A 3U5SA 3ZDLA 3ZQYA 3LNMB 2LD6A 4YN0B 3LLIA 3MBGA 3LAYA 3AOUA 4BEJA 1YVIA 1RJ9B 4CS9C 1QLEC 1YZCA 4BJ6C 3T6JA 2Y39A 2KC3A 3H2VA 3FDQA 4G78A 3DZAA 3DM9B 1QKRA 3NMIA 1LVKA 5DQTA 1LI5A 1ZZPA 1U0BB 1XZQA 3L1MA 1A41A 4AL0A 2OEVA 4J7TA 1A7EA 1MNEA 1YZAA 3DE8A 2NG1A 2PX0A 3Q7LA 2W9YA 4XEFA 2W45A 4MTFA 4LDRA 4N6HA 3RIPA 4JJGA 2H8AA 4CS8C 1G4WR 5A6KA 3RVYA 4OD4A 4W8KA 2R7OA 3NKDA 3TQOA 4OIOF 1D0YA 2R7TA 5JS5A 3BRJA 2LFFA 1LS1A 4PJLA 3MFNA 2EPMX 3G50A 3TJ6A 1EKYA 1A7VA 3CAXA 4G0HA 1MMGA 3UNGC 1VYKA 4DVYP 4L6RA 2Y3DA 4CDAA 3UR3C 4E0HA 5L0HA 2BC5A 1OR2A 2C04A 2NUPB 3HLZA 4P9FA 3JYYA 4P9TA 4OIRF 1FAPB 2HV7A 4DJ9A 3ABKC 3S27A 3TJ5A 3UGOA 3N24A 2H7VC 5COMA 4O6MA 3DD7A 5F5FA 4NTBA 1OQCA 2PX3A 1NSGB 3I4UA 4JE9A 1BR2A 3NYLA 4CBEA 5KYNA 3CZ6A 3W2VA 3RF3A 3KH2A 2WB7A 3WODF 3HNJA 4GYTA 4HE8D 3LJBA 2EPKX 2J46A 4EKWA 2Q4FA 3ITFA 5TJ5E 3GEIA 3QMKA 3L8JA 4W8PA 4CSAC 2OJQA 4P6IC 2YQYA 3G4ZA 4U5EE 2E87A 5L3QA 1UG7A 2EIJC 3T9OA 1IW7F 2EIKC 3TOMA 1DOVA 3AG2C 1NU9C 3ABMC 4FX5A 4PACA 1FFHA 4LLEA 2IM8A 3IHUA 1OCZC 3KL4A 1QSPA 4KNVA 3S29A 1T6UA 2J9BA 1ZW3A 1U6HA 2PFDA 5FZTA 2I15A 2XLDA 4JZAA 2Q00A 5EHHA 3F46A 1MMAA 2ZXOA 2IXMA 4Z9IA 2W4BA 1AUEA 3O6XA 4BEMJ 4CS7A 4LACB 3AGUA 1CGOA 5KYYB 2WVNA 1ZU4A 5CI8A 4KC9A 2H7OA 4IARA 1LE4A 2LFDA 2NSGA 3N0TA 3DMDA 2ASRA 3LS0A 1SF8A 3PCVA 4YL3A 2WZFA 4BJ1A 1RXQA 3EH1A 3C18A 4N06A 3SZRA 1SZIA 2V26A 3AG4C 3R2PA 1HW1A 1JMWA 1J8MF 3EZIA 3KMIA 4KBLA 256BA 3U3FA 1TWGA 4JCZA 4YT8A 2Y3BA 3C8ZA 3N2ZB 3NYMA 2XL4A 2XLHA 3GM2A 2XL8A 3EFOB 3SXZA 1ORJA 3AQCA 3T4RA 5IY5C 3EHMA 2OJED 3OEOA 4H4KC 4LERA 3RQGA 2KSFA 4GEHA 2MHRA 5A6BA 2Y3HA 1WASA 1YJGA 4PJMA 3FXHA 4ULVA 2M64A 4N4WA 3V5XA 2VCCA 3GORA 3ASNC 3IEEA 4N6CA 3WHNA 4EBKA 2L9JA 2YLIA 4CDYA 5D92A 3GWNA 1OXBA 2VASA 4U5DE 2R7RA 2ZXPA 3Q6MA 1HE1A 2I8BA 3EJNA 3GM3A 4AE4A 3AQBA 2BL2A 3DJNB 1RCPA 2HFIA 3U9MA 2EPLX 2OOCA 1UFBA 3DWWA 1TR2A 2ETSA 2VCAA 1W2WA 3U2LA 3US6A 1V55C 2EPOA 4EUKB 2KK1A 1JOGA 2BE5F 3JT1A 3S0XA 3B29A 3V7OA 3QVZA 3JYHA 1AVOB 1JR8A 1Y4CA 1FFTC 1H9GA 5COFA 1T6IA 4U5CE 3C8GA 2QTVA 1VTMP 3J06A 2Q9AA 1NZEA 2J0WA 3Q6NA 2HJ3A 2R7XA 2R02A 3KKBA 1SYQA 4NY3A 1NFNA 1O87A 4QI0A 2MYSA 4HFKB 5JSLA 3RQFA 4D4XA 5CIVA 5A69A 1KTMA 2HS5A 1Z3IX 2GA0A 4IAOA 1QZXA 3SXMA 4AL1A 3O10A 4JC7A 2HJMA 3K1HA 5L3VA 4OIQF 4CS9A 1E84A 2QE9A 3A11A 1LM3B 4O79A 3LNRA 1JRAA 2GDCA 2VC9A 3MYIA 4ONSA 5F5HA 4BJ6A 3FHDA 3H2UA 2XSEA 3O55A 4MVQA 4A2NB 2L6FA 4U5HA 4DBQA 5DS4A 2JX0A 3DJUB 3HNIA 3IPMO 3UMIA 1A7DA 1HY5A 3U0CA 2L7AA 1VMAA 4YK5A 2OU6A 5HV9A 3I5PA 1Q0KA 2G3VA 2XLMA 4H54A 4IWBA 3T6BA 3C63A 1TWCA 4AX2A 4MS2A 4EHPA 2DB4A 4HFFB 4ULWA 3E70C 3QTHA 4MQ9F 4CS8A 4EIYA 4MVUA 1OKKD 2PF4E 1OCRC 3LESA 4JRZA 4BJ5C 3DM5A 4I3MA 4KI2A 2NSFA 1S7ZA 3OWTA 4JJFA 3TK0A 2UUHA 4K0DA 1OW8A 1BR4A 5GPGB 4G7HF 2IOQA 1EI7A 3EG9A 4C3EA 1MMNA 4YWQA 1Z23A 2V3CC 4NTAA 3B71A 3E9VA 1PCXA 2IBFA 5T3WA 3BEHA 1FNTc 1OCOC 3UMKA 4G7OF 3ZVRA 2J9WA 2X51A 5JUAA 5COGA 1BBHA 3ZG1A 1OXKA 2WZLA 4JTCB 3RVZA 1GQAA 2J9VA 4J7YA 5E3AA 3VRCA 4G7ZF 3L34A 2B0HA 4D4NA 2Y69C 2YL3A 3DI5A 3NMJA 3U9JA 2XXAB 1BR1A 3QW0A 5E33A 2AWCA 3U8VA 1D0XA 3ZC4A 4E7ZA 4YT4A 1E86A 3K1IC 3C7JA 2FFHA 2G3KA 4WJ0A 1HW2A 1U89A 4RD9A 3MX3A 4GQHA 1B68A 5JP7A 2DYSC 2C03A 2AVKA 2OG2A 3C62A 2IXNA 3MYFA 1R5ID 4IRUA 3CSKA 2DI3A 5BQIA 1MMDA 1C17M 4YL1A 2FGYA 1Y6DA 1DOWA 3JZ0A 4JEAA 3HKKA 4NTFA 1EQ1A 1M56C 1TQGA 2FAPB 2Q9BA 2HV6A 2J7PD 4NC3A 2J0XA 4ER9A 2NUTB 1VYIA 2L81A 2HKVA 3EGXA 3LUTB 1FR0A 1YDIA 1ZHYA 2KGOA 4WGYA 5CI9A 3LEOA 3L8IA 4B6IA 5K0IA 2Q9CA 4FESA 3TD7A 2R03A 2AU5A 4XWJA 5BQGA 1ZHZA 5KYWB 3SXYA 1EA8A 3NYJA 2XXAA 4PJJA 3SXKA 1T01A 3ZQVA 2ZPAA 1ST6A 4DRIB 2LIGA 2G62A 4CIHA 4MW3A 1CPRA 3GANA 4MTGA 3OA1A 4AE4B 5B3IA 3GEHA 5F28E 2CCYA 4OINF 1OCCC 1I4ZA 2OEXA 3KPHA 3M79A 2EPNA 2X0CA 5DLJA 1WN0A 1I5NA 4RBNA 3RQEA 3U3BA 3EGDB 3UMHA 2KQ9A 3EQLF 3FAPB 3S84A 2LP4A 2JD3A 1GGQA 5HSWA 3WG7C 5A6JA 5L0DA 1XZPA 1NFOA 2XM0A 4RDAA 2OCCC 4BG0A 3AG1C 2OKUA 3K6BA 5L0CA 3C8GB 4CJOA 2NUTA 3LS1A 3POVA 4C7OB 2YZSA 2HZ8A 1KU2A 1BZ4A 1I4YA 2LCHA 3G4XA 2R7UA 4CIPA 1CGNA 1D1CA 3H65A 5EK0A 3RKOF 4YL0A 5AC5A 2VH3A 3GWLA 3NKEA 3U2MA 5KYWA 5T1DB 4FWVA 3K66A 4MVMA 3U8PA 3FOOA 4PJNA 5E2QA 3ECSA 5AC4A 3PDMP 3HNLA 1FTSA 1HE9A 4LDKA 4PK4A 4U9DA 5DS5A 5T3TA 5EGYA 5KYUB 2A0UA 3DAGA 3T6GB 1NBBA 1PD0A 3TOLA 1H7IA 3FOPA 1K04A 3EGDA 1LKXA 4DVZA 2J45A 1AEPA 2P61A 1L7CA 4MVOA 2RSEB 4HEAJ 2R7WA 2LQGA 4JEBA 1M57C 2DYRC 3K33A 2MWQA 2EILC 2KW3C 1G8XA 4C7OA 1V4AA 1TFOB 1VK5A 1YYXA 1RMVA 1VOMA 3K7DA 2YLDA 5L0JA 2QLAA 2R7VA 2GWWA 2R7SA 3FAJA 1LPEA 4XLNF 2ICWG 4XLPF 3JSZA 4M63A 2AWYA 4DBRA 1YA9A 1ORSC 2ZXWC 2J9UA 4LLCA 4YT2A 1FMWA 1V74B 4PFOA 4BJTA 4MVZA 1F1MA 1XWJA 2YVKA 3GODA 3DAFA 5KYUA 4JKVA 3RH3A 5DS6A 1WWPA 3LLKA 5KYXA 1NU7D 3QZCA 4E18A 2CW0F 3PHF2 4EWCA 3EG9B 2YL1A 4I1MA 1LS4A 4U5GA 3W8HA 1O3UA 4K7BA 2HMZA 5JLIA 1T6QA 3KYIA 3JRTA 4R32A 1RKEA 1T9KA 1D0ZA 1BDJB 4QDLA 2D5RB 4IB4A 3B0UX 2TMVP 1ZHTA 2O9XA 3AJMA 4I1OB 1L3PA 1YLMA 2WVOA 2XLVA 2XLOA 1YYJA 2CNWD 1A0BA 3M1CB 4MNDA 2HSBA 4U9EA 1WGWA 2YL0A 1OKKA 1ORYA 3EZHA 4ANJA 3B0VC 3V5YA 3QW1A 4U5BE 1MQVA 2KJGA 1M2OA 5A6AA 2GAQA 2YHSA 4OIPF 1WTYA 4BJ5A 4ZLDA 1YA7O 1D1BA 4A4AA 2J8WA 2EINC 1JPNA 1OR3A 5L0GA 1TWHA 3F47A 1T5OA 3VF0A 1OW6A 3SYNA 2P6VA 1YAUO 4PFPA 2KNHA 2PP4A 1TKNA 1RKCA 1QQ3A 1MNDA 1ZW2A 3JSEO 4JURI 4PR9A 2IXPA 4DRJB 1Z6AA 2AP3A 4I44A 1ZVZA 3PMRA 3KYJA 4Z9JA 3S90A 3NDBB 2QY9A 4DXWA 4E17A 1J8YF 1NLXA 1WATA 2L6HA 4E0IA 5JT4A 1LIHA 2R05A 2YEVA 3EGXB 5BUOA 3EHNA 5L0FA 3X1OA 3SNHA 3O39A 1E85A 1QVXA 1RJ9A 2A68F 2KYHA 4J32B 4MVSA 3IQTA 3B9QA 1G4US 2JPUA 3HTKC 4JTAB 3W8IA 2B0JA 1Z5ZA 5AGFA 1JPJA 3S9OA 2LSEA 3NMKA 2PBEA 4IAQA 4CSAA 1QPUA 3K1IA 4NCQA 2YL7A 3UGPA 4YT5A 1LI7A 4NQFA 1TFKB 5L0IA 2UUIA 1G5ZA 4J30B 1Q0MA 1S05A 2F22A 3QVYA 2XM4A 3B0PA 4AK9A 1E83A 1Q0GA 1R4TA 2XLEA 2J7PA 3DXJF 1ZHXA 2R25A 2CGEA 1TWAA 2DGJA 1WOLA 1D1AA 2CDQA 4XTKA 5DVWA 1Z63A 1PV3A 3NG1A 3DE9A 2QUPA 4XPXA 1V54C 2VB6A 3W2WA 1O5HA 2HSQA
chains in the Genus database with same CATH topology
1AUEA 5GPGB 4DRHB 1NSGB 2GAQA 4DRJB 4DRIB 1FAPB 3FAPB 4FAPB 2FAPB 2RSEB 2NPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUE A;  5GPG B;  4DRH B;  1NSG B;  2GAQ A;  4DRJ B;  4DRI B;  1FAP B;  3FAP B;  4FAP B;  2FAP B;  2RSE B;  2NPU A; 
#chains in the Genus database with same CATH topology
 2CYD A;  4DOZ A;  4Q4Z F;  4O7G A;  4QI2 A;  5FCL A;  2EIM C;  3AG3 C;  4UDV A;  1VLT A;  1CPQ A;  3ZIB A;  3ZWI A;  1GM5 A;  4K1O A;  4JIO A;  1JAF A;  1M2V B;  4O6N A;  2XRH A;  2W4M A;  3VAY A;  4YJW A;  3A9C A;  1Q0D A;  3X2Q C;  1M6T A;  2WZG A;  3AGT A;  2Y3G A;  2QNL A;  2XS8 A;  2NUP A;  2YWA A;  2R9R B;  1Z7Q c;  2Q7R A;  3EPV A;  3ASO C;  1APC A;  2P7V A;  3MLG A;  5B3S C;  2H7B A;  3WAQ A;  3ZSU A;  2HUJ A;  3M4C A;  4FAP B;  2XLW A;  2P1A A;  1H9T A;  3IQ5 A;  2GFH A;  5B1A C;  1CGM E;  4OD5 A;  4O6Y A;  1ZU5 A;  3FVY A;  4DRH B;  4WGZ A;  3ZTM A;  4JW1 A;  3CEX A;  3JCU Q;  4U5F E;  2D4U A;  2YRF A;  4Q7C A;  1ZHW A;  2L6G A;  3ZTZ A;  2XS1 A;  2IYL D;  3VM6 A;  2WVQ A;  3GEE A;  2PNO A;  5JRA A;  3I5Q A;  3HJC A;  1M2V A;  2A6E F;  5BQH A;  1NG1 A;  3IQ6 A;  4XEV A;  4E7S A;  4IGG A;  4EBJ A;  1PD1 A;  5KYX B;  3L0I A;  3W4Y A;  3FMS A;  4EBB A;  1H6G A;  3ATP A;  1FMV A;  1K40 A;  2HMQ A;  1HMD A;  1Q0F A;  2M4E A;  1C03 A;  3M4B A;  4WAB A;  3TUL A;  1C02 A;  1LE2 A;  3GM1 A;  4XPY A;  1RKE B;  4XPW A;  3NRH A;  2Q3T A;  5KYY A;  4XQ1 A;  4F4B A;  2Z15 A;  3R7C A;  3RW0 A;  5A6B D;  3CQZ A;  2LK4 A;  3SP1 A;  3LEV A;  2RD9 A;  1HMO A;  3S28 A;  2NPU A;  1K05 A;  2A1D D;  2VCB A;  5E3C A;  1ZYR F;  3M15 A;  2OQM A;  3IQC A;  3JTL O;  2IXO A;  4C3B A;  4CJG A;  4Q5S F;  1GS9 A;  4MTO A;  1E2X A;  1N1C A;  2A69 F;  4JVS A;  4C3D A;  3V5Z A;  3HNK A;  2YKZ A;  2WL8 A;  1SR2 A;  4BPM A;  2A6H F;  3JRM O;  4LDQ A;  1KNY A;  4JCH A;  1OW7 A;  3EFO A;  2P0N A;  1SMY F;  4IJJ A;  1IZM A;  1VLS A;  3EH2 A;  3RYL A;  4MVR A;  1YAR O;  2R7Q A;  2XL6 A;  4JTD B;  3C8G D;  3ABL C;  3DKA A;  5DQZ A;  5B1B C;  5JVE A;  4X0R A;  3Q7G A;  4XEK A;  4CX9 A;  2CNW A;  2A0B A;  2ZD9 A;  3RFY A;  3SEO A;  2ZXR A;  4KNW A;  5D91 A;  2YLG A;  4Z9H A;  3VYW A;  4ZLC A;  1VB5 A;  4CDV A;  4MW8 A;  3U5S A;  3ZDL A;  3ZQY A;  3LNM B;  2LD6 A;  4YN0 B;  3LLI A;  3MBG A;  3LAY A;  3AOU A;  4BEJ A;  1YVI A;  1RJ9 B;  4CS9 C;  1QLE C;  1YZC A;  4BJ6 C;  3T6J A;  2Y39 A;  2KC3 A;  3H2V A;  3FDQ A;  4G78 A;  3DZA A;  3DM9 B;  1QKR A;  3NMI A;  1LVK A;  5DQT A;  1LI5 A;  1ZZP A;  1U0B B;  1XZQ A;  3L1M A;  1A41 A;  4AL0 A;  2OEV A;  4J7T A;  1A7E A;  1MNE A;  1YZA A;  3DE8 A;  2NG1 A;  2PX0 A;  3Q7L A;  2W9Y A;  4XEF A;  2W45 A;  4MTF A;  4LDR A;  4N6H A;  3RIP A;  4JJG A;  2H8A A;  4CS8 C;  1G4W R;  5A6K A;  3RVY A;  4OD4 A;  4W8K A;  2R7O A;  3NKD A;  3TQO A;  4OIO F;  1D0Y A;  2R7T A;  5JS5 A;  3BRJ A;  2LFF A;  1LS1 A;  4PJL A;  3MFN A;  2EPM X;  3G50 A;  3TJ6 A;  1EKY A;  1A7V A;  3CAX A;  4G0H A;  1MMG A;  3UNG C;  1VYK A;  4DVY P;  4L6R A;  2Y3D A;  4CDA A;  3UR3 C;  4E0H A;  5L0H A;  2BC5 A;  1OR2 A;  2C04 A;  2NUP B;  3HLZ A;  4P9F A;  3JYY A;  4P9T A;  4OIR F;  1FAP B;  2HV7 A;  4DJ9 A;  3ABK C;  3S27 A;  3TJ5 A;  3UGO A;  3N24 A;  2H7V C;  5COM A;  4O6M A;  3DD7 A;  5F5F A;  4NTB A;  1OQC A;  2PX3 A;  1NSG B;  3I4U A;  4JE9 A;  1BR2 A;  3NYL A;  4CBE A;  5KYN A;  3CZ6 A;  3W2V A;  3RF3 A;  3KH2 A;  2WB7 A;  3WOD F;  3HNJ A;  4GYT A;  4HE8 D;  3LJB A;  2EPK X;  2J46 A;  4EKW A;  2Q4F A;  3ITF A;  5TJ5 E;  3GEI A;  3QMK A;  3L8J A;  4W8P A;  4CSA C;  2OJQ A;  4P6I C;  2YQY A;  3G4Z A;  4U5E E;  2E87 A;  5L3Q A;  1UG7 A;  2EIJ C;  3T9O A;  1IW7 F;  2EIK C;  3TOM A;  1DOV A;  3AG2 C;  1NU9 C;  3ABM C;  4FX5 A;  4PAC A;  1FFH A;  4LLE A;  2IM8 A;  3IHU A;  1OCZ C;  3KL4 A;  1QSP A;  4KNV A;  3S29 A;  1T6U A;  2J9B A;  1ZW3 A;  1U6H A;  2PFD A;  5FZT A;  2I15 A;  2XLD A;  4JZA A;  2Q00 A;  5EHH A;  3F46 A;  1MMA A;  2ZXO A;  2IXM A;  4Z9I A;  2W4B A;  1AUE A;  3O6X A;  4BEM J;  4CS7 A;  4LAC B;  3AGU A;  1CGO A;  5KYY B;  2WVN A;  1ZU4 A;  5CI8 A;  4KC9 A;  2H7O A;  4IAR A;  1LE4 A;  2LFD A;  2NSG A;  3N0T A;  3DMD A;  2ASR A;  3LS0 A;  1SF8 A;  3PCV A;  4YL3 A;  2WZF A;  4BJ1 A;  1RXQ A;  3EH1 A;  3C18 A;  4N06 A;  3SZR A;  1SZI A;  2V26 A;  3AG4 C;  3R2P A;  1HW1 A;  1JMW A;  1J8M F;  3EZI A;  3KMI A;  4KBL A;  256B A;  3U3F A;  1TWG A;  4JCZ A;  4YT8 A;  2Y3B A;  3C8Z A;  3N2Z B;  3NYM A;  2XL4 A;  2XLH A;  3GM2 A;  2XL8 A;  3EFO B;  3SXZ A;  1ORJ A;  3AQC A;  3T4R A;  5IY5 C;  3EHM A;  2OJE D;  3OEO A;  4H4K C;  4LER A;  3RQG A;  2KSF A;  4GEH A;  2MHR A;  5A6B A;  2Y3H A;  1WAS A;  1YJG A;  4PJM A;  3FXH A;  4ULV A;  2M64 A;  4N4W A;  3V5X A;  2VCC A;  3GOR A;  3ASN C;  3IEE A;  4N6C A;  3WHN A;  4EBK A;  2L9J A;  2YLI A;  4CDY A;  5D92 A;  3GWN A;  1OXB A;  2VAS A;  4U5D E;  2R7R A;  2ZXP A;  3Q6M A;  1HE1 A;  2I8B A;  3EJN A;  3GM3 A;  4AE4 A;  3AQB A;  2BL2 A;  3DJN B;  1RCP A;  2HFI A;  3U9M A;  2EPL X;  2OOC A;  1UFB A;  3DWW A;  1TR2 A;  2ETS A;  2VCA A;  1W2W A;  3U2L A;  3US6 A;  1V55 C;  2EPO A;  4EUK B;  2KK1 A;  1JOG A;  2BE5 F;  3JT1 A;  3S0X A;  3B29 A;  3V7O A;  3QVZ A;  3JYH A;  1AVO B;  1JR8 A;  1Y4C A;  1FFT C;  1H9G A;  5COF A;  1T6I A;  4U5C E;  3C8G A;  2QTV A;  1VTM P;  3J06 A;  2Q9A A;  1NZE A;  2J0W A;  3Q6N A;  2HJ3 A;  2R7X A;  2R02 A;  3KKB A;  1SYQ A;  4NY3 A;  1NFN A;  1O87 A;  4QI0 A;  2MYS A;  4HFK B;  5JSL A;  3RQF A;  4D4X A;  5CIV A;  5A69 A;  1KTM A;  2HS5 A;  1Z3I X;  2GA0 A;  4IAO A;  1QZX A;  3SXM A;  4AL1 A;  3O10 A;  4JC7 A;  2HJM A;  3K1H A;  5L3V A;  4OIQ F;  4CS9 A;  1E84 A;  2QE9 A;  3A11 A;  1LM3 B;  4O79 A;  3LNR A;  1JRA A;  2GDC A;  2VC9 A;  3MYI A;  4ONS A;  5F5H A;  4BJ6 A;  3FHD A;  3H2U A;  2XSE A;  3O55 A;  4MVQ A;  4A2N B;  2L6F A;  4U5H A;  4DBQ A;  5DS4 A;  2JX0 A;  3DJU B;  3HNI A;  3IPM O;  3UMI A;  1A7D A;  1HY5 A;  3U0C A;  2L7A A;  1VMA A;  4YK5 A;  2OU6 A;  5HV9 A;  3I5P A;  1Q0K A;  2G3V A;  2XLM A;  4H54 A;  4IWB A;  3T6B A;  3C63 A;  1TWC A;  4AX2 A;  4MS2 A;  4EHP A;  2DB4 A;  4HFF B;  4ULW A;  3E70 C;  3QTH A;  4MQ9 F;  4CS8 A;  4EIY A;  4MVU A;  1OKK D;  2PF4 E;  1OCR C;  3LES A;  4JRZ A;  4BJ5 C;  3DM5 A;  4I3M A;  4KI2 A;  2NSF A;  1S7Z A;  3OWT A;  4JJF A;  3TK0 A;  2UUH A;  4K0D A;  1OW8 A;  1BR4 A;  5GPG B;  4G7H F;  2IOQ A;  1EI7 A;  3EG9 A;  4C3E A;  1MMN A;  4YWQ A;  1Z23 A;  2V3C C;  4NTA A;  3B71 A;  3E9V A;  1PCX A;  2IBF A;  5T3W A;  3BEH A;  1FNT c;  1OCO C;  3UMK A;  4G7O F;  3ZVR A;  2J9W A;  2X51 A;  5JUA A;  5COG A;  1BBH A;  3ZG1 A;  1OXK A;  2WZL A;  4JTC B;  3RVZ A;  1GQA A;  2J9V A;  4J7Y A;  5E3A A;  3VRC A;  4G7Z F;  3L34 A;  2B0H A;  4D4N A;  2Y69 C;  2YL3 A;  3DI5 A;  3NMJ A;  3U9J A;  2XXA B;  1BR1 A;  3QW0 A;  5E33 A;  2AWC A;  3U8V A;  1D0X A;  3ZC4 A;  4E7Z A;  4YT4 A;  1E86 A;  3K1I C;  3C7J A;  2FFH A;  2G3K A;  4WJ0 A;  1HW2 A;  1U89 A;  4RD9 A;  3MX3 A;  4GQH A;  1B68 A;  5JP7 A;  2DYS C;  2C03 A;  2AVK A;  2OG2 A;  3C62 A;  2IXN A;  3MYF A;  1R5I D;  4IRU A;  3CSK A;  2DI3 A;  5BQI A;  1MMD A;  1C17 M;  4YL1 A;  2FGY A;  1Y6D A;  1DOW A;  3JZ0 A;  4JEA A;  3HKK A;  4NTF A;  1EQ1 A;  1M56 C;  1TQG A;  2FAP B;  2Q9B A;  2HV6 A;  2J7P D;  4NC3 A;  2J0X A;  4ER9 A;  2NUT B;  1VYI A;  2L81 A;  2HKV A;  3EGX A;  3LUT B;  1FR0 A;  1YDI A;  1ZHY A;  2KGO A;  4WGY A;  5CI9 A;  3LEO A;  3L8I A;  4B6I A;  5K0I A;  2Q9C A;  4FES A;  3TD7 A;  2R03 A;  2AU5 A;  4XWJ A;  5BQG A;  1ZHZ A;  5KYW B;  3SXY A;  1EA8 A;  3NYJ A;  2XXA A;  4PJJ A;  3SXK A;  1T01 A;  3ZQV A;  2ZPA A;  1ST6 A;  4DRI B;  2LIG A;  2G62 A;  4CIH A;  4MW3 A;  1CPR A;  3GAN A;  4MTG A;  3OA1 A;  4AE4 B;  5B3I A;  3GEH A;  5F28 E;  2CCY A;  4OIN F;  1OCC C;  1I4Z A;  2OEX A;  3KPH A;  3M79 A;  2EPN A;  2X0C A;  5DLJ A;  1WN0 A;  1I5N A;  4RBN A;  3RQE A;  3U3B A;  3EGD B;  3UMH A;  2KQ9 A;  3EQL F;  3FAP B;  3S84 A;  2LP4 A;  2JD3 A;  1GGQ A;  5HSW A;  3WG7 C;  5A6J A;  5L0D A;  1XZP A;  1NFO A;  2XM0 A;  4RDA A;  2OCC C;  4BG0 A;  3AG1 C;  2OKU A;  3K6B A;  5L0C A;  3C8G B;  4CJO A;  2NUT A;  3LS1 A;  3POV A;  4C7O B;  2YZS A;  2HZ8 A;  1KU2 A;  1BZ4 A;  1I4Y A;  2LCH A;  3G4X A;  2R7U A;  4CIP A;  1CGN A;  1D1C A;  3H65 A;  5EK0 A;  3RKO F;  4YL0 A;  5AC5 A;  2VH3 A;  3GWL A;  3NKE A;  3U2M A;  5KYW A;  5T1D B;  4FWV A;  3K66 A;  4MVM A;  3U8P A;  3FOO A;  4PJN A;  5E2Q A;  3ECS A;  5AC4 A;  3PDM P;  3HNL A;  1FTS A;  1HE9 A;  4LDK A;  4PK4 A;  4U9D A;  5DS5 A;  5T3T A;  5EGY A;  5KYU B;  2A0U A;  3DAG A;  3T6G B;  1NBB A;  1PD0 A;  3TOL A;  1H7I A;  3FOP A;  1K04 A;  3EGD A;  1LKX A;  4DVZ A;  2J45 A;  1AEP A;  2P61 A;  1L7C A;  4MVO A;  2RSE B;  4HEA J;  2R7W A;  2LQG A;  4JEB A;  1M57 C;  2DYR C;  3K33 A;  2MWQ A;  2EIL C;  2KW3 C;  1G8X A;  4C7O A;  1V4A A;  1TFO B;  1VK5 A;  1YYX A;  1RMV A;  1VOM A;  3K7D A;  2YLD A;  5L0J A;  2QLA A;  2R7V A;  2GWW A;  2R7S A;  3FAJ A;  1LPE A;  4XLN F;  2ICW G;  4XLP F;  3JSZ A;  4M63 A;  2AWY A;  4DBR A;  1YA9 A;  1ORS C;  2ZXW C;  2J9U A;  4LLC A;  4YT2 A;  1FMW A;  1V74 B;  4PFO A;  4BJT A;  4MVZ A;  1F1M A;  1XWJ A;  2YVK A;  3GOD A;  3DAF A;  5KYU A;  4JKV A;  3RH3 A;  5DS6 A;  1WWP A;  3LLK A;  5KYX A;  1NU7 D;  3QZC A;  4E18 A;  2CW0 F;  3PHF 2;  4EWC A;  3EG9 B;  2YL1 A;  4I1M A;  1LS4 A;  4U5G A;  3W8H A;  1O3U A;  4K7B A;  2HMZ A;  5JLI A;  1T6Q A;  3KYI A;  3JRT A;  4R32 A;  1RKE A;  1T9K A;  1D0Z A;  1BDJ B;  4QDL A;  2D5R B;  4IB4 A;  3B0U X;  2TMV P;  1ZHT A;  2O9X A;  3AJM A;  4I1O B;  1L3P A;  1YLM A;  2WVO A;  2XLV A;  2XLO A;  1YYJ A;  2CNW D;  1A0B A;  3M1C B;  4MND A;  2HSB A;  4U9E A;  1WGW A;  2YL0 A;  1OKK A;  1ORY A;  3EZH A;  4ANJ A;  3B0V C;  3V5Y A;  3QW1 A;  4U5B E;  1MQV A;  2KJG A;  1M2O A;  5A6A A;  2GAQ A;  2YHS A;  4OIP F;  1WTY A;  4BJ5 A;  4ZLD A;  1YA7 O;  1D1B A;  4A4A A;  2J8W A;  2EIN C;  1JPN A;  1OR3 A;  5L0G A;  1TWH A;  3F47 A;  1T5O A;  3VF0 A;  1OW6 A;  3SYN A;  2P6V A;  1YAU O;  4PFP A;  2KNH A;  2PP4 A;  1TKN A;  1RKC A;  1QQ3 A;  1MND A;  1ZW2 A;  3JSE O;  4JUR I;  4PR9 A;  2IXP A;  4DRJ B;  1Z6A A;  2AP3 A;  4I44 A;  1ZVZ A;  3PMR A;  3KYJ A;  4Z9J A;  3S90 A;  3NDB B;  2QY9 A;  4DXW A;  4E17 A;  1J8Y F;  1NLX A;  1WAT A;  2L6H A;  4E0I A;  5JT4 A;  1LIH A;  2R05 A;  2YEV A;  3EGX B;  5BUO A;  3EHN A;  5L0F A;  3X1O A;  3SNH A;  3O39 A;  1E85 A;  1QVX A;  1RJ9 A;  2A68 F;  2KYH A;  4J32 B;  4MVS A;  3IQT A;  3B9Q A;  1G4U S;  2JPU A;  3HTK C;  4JTA B;  3W8I A;  2B0J A;  1Z5Z A;  5AGF A;  1JPJ A;  3S9O A;  2LSE A;  3NMK A;  2PBE A;  4IAQ A;  4CSA A;  1QPU A;  3K1I A;  4NCQ A;  2YL7 A;  3UGP A;  4YT5 A;  1LI7 A;  4NQF A;  1TFK B;  5L0I A;  2UUI A;  1G5Z A;  4J30 B;  1Q0M A;  1S05 A;  2F22 A;  3QVY A;  2XM4 A;  3B0P A;  4AK9 A;  1E83 A;  1Q0G A;  1R4T A;  2XLE A;  2J7P A;  3DXJ F;  1ZHX A;  2R25 A;  2CGE A;  1TWA A;  2DGJ A;  1WOL A;  1D1A A;  2CDQ A;  4XTK A;  5DVW A;  1Z63 A;  1PV3 A;  3NG1 A;  3DE9 A;  2QUP A;  4XPX A;  1V54 C;  2VB6 A;  3W2W A;  1O5H A;  2HSQ A; 
#chains in the Genus database with same CATH homology
 1AUE A;  5GPG B;  4DRH B;  1NSG B;  2GAQ A;  4DRJ B;  4DRI B;  1FAP B;  3FAP B;  4FAP B;  2FAP B;  2RSE B;  2NPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...