4DRIB

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
b'GAMDPEFMEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 38
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4driB00
4DRHB 2GAQA 2FAPB 3FAPB 4DRIB 4FAPB 2RSEB 5GPGB 1NSGB 4DRJB 2NPUA 1FAPB 1AUEA
chains in the Genus database with same CATH superfamily
4JCHA 2JPUA 4R32A 3RF3A 4NTFA 4Z9HA 1M2VB 4CDAA 3NKEA 1L7CA 2W9YA 2CCYA 1SYQA 4YL3A 1WWPA 2IM8A 4Q7CA 3U3BA 2KYHA 2L6FA 3C8ZA 4ZLCA 3JRMO 2JD3A 2HJMA 4Q4ZF 2XXAB 3M1CB 1RMVA 3JSEO 3NMIA 5L0IA 1OCCC 4CIHA 1Y6DA 2CNWD 2YL1A 2AU5A 5A6KA 5FZTA 3DZAA 3Q6NA 2VCAA 2YLDA 3V5ZA 2OOCA 2R7WA 2XLVA 2KC3A 2DYRC 2YEVA 2ZXOA 3S0XA 4MVRA 2XM4A 5A69A 4XWJA 4MW3A 3AGTA 1Z7Qc 4DRHB 5L3QA 3OA1A 2P6VA 2KW3C 2AWCA 4AE4A 1T5OA 2YKZA 3LEOA 5AC5A 3C63A 5DS4A 1YYXA 2G3KA 2P61A 2LFDA 1D0YA 2Q9AA 4CS8C 1OKKD 3AQBA 4KNVA 2A69F 3IQCA 3O39A 5E3CA 5JS5A 1YAUO 3TOMA 3ZSUA 1V4AA 1NZEA 4MVZA 1B68A 4AL1A 1MMAA 3N24A 4YK5A 3SZRA 1TWHA 2EPNA 4MVQA 2ZXWC 3DWWA 3CQZA 3JZ0A 2R7OA 4P9FA 4CS8A 4DVZA 1E83A 2M64A 3DAGA 2OU6A 4ANJA 4JIOA 3DKAA 1EKYA 1LPEA 3W2VA 2NUTA 3U2LA 4CS9C 4GEHA 5KYXA 1YA7O 3QVYA 2DGJA 3DD7A 2YHSA 3KL4A 3LLKA 4E0HA 1BR1A 4D4XA 1ZW2A 4XQ1A 1BR2A 3EQLF 3ZWIA 4D4NA 2J9BA 3QVZA 2R7VA 3OEOA 4OD4A 1AEPA 3ZTZA 1HMOA 3HLZA 4JC7A 4BPMA 3ZQYA 1HMDA 5JVEA 5DVWA 4OINF 2OQMA 2XLEA 2XLHA 3GM2A 1VTMP 1KNYA 3JT1A 2LIGA 3K33A 3AGUA 4E7ZA 3C8GA 3TQOA 5L0JA 3K7DA 3VAYA 3QMKA 1M56C 3DAFA 3PMRA 1CGNA 3EJNA 3S27A 1RKEB 4NCQA 4ZLDA 2KNHA 4G78A 4MVSA 4WGZA 3WAQA 1SZIA 2Y3HA 3N2ZB 3HNKA 3O10A 4HFKB 1QLEC 4U5CE 3W4YA 2BL2A 2YL7A 2EPOA 1MQVA 2YLIA 3ECSA 3FOOA 4DRIB 5KYXB 1MMNA 2XLWA 3H2UA 2QTVA 4NY3A 4IJJA 4LACB 4XLPF 1DOVA 1M2OA 3LNRA 5D92A 3HNLA 5JLIA 2R7UA 4JTAB 4YT5A 4JEAA 5B3IA 3L0IA 4MQ9F 4H4KC 4MW8A 1OXKA 1OR3A 2PX0A 3EHMA 3ZQVA 5F5FA 3EZIA 4N6HA 1FFHA 3EGXB 4J30B 4X0RA 4AL0A 1AUEA 2D5RB 5EGYA 2J8WA 2W45A 2Y3GA 2V3CC 2VCBA 3RQGA 4CJOA 3A11A 2HKVA 2Q9BA 4J7YA 4NC3A 2QUPA 2RD9A 3FVYA 2EPKX 5A6BA 3EGDA 3GWNA 1I4YA 4KNWA 2E87A 1BZ4A 1VMAA 2YWAA 2R9RB 4LDRA 3PHF2 4QI0A 3U9MA 5DS5A 1LKXA 1M2VA 4PK4A 4AX2A 1UG7A 1ZU4A 3AG1C 3ZC4A 3X2QC 3UNGC 2P1AA 3RKOF 1C02A 3B0PA 3M4BA 2PBEA 5BUOA 1VB5A 2A6EF 3R2PA 2B0JA 2OEXA 1S05A 3LUTB 2IBFA 1YYJA 3WODF 5KYYB 2HS5A 3L8IA 2XXAA 2H7BA 1Y4CA 3NDBB 2Q7RA 2R25A 5HSWA 3UR3C 5D91A 2KQ9A 3LEVA 4CJGA 3HNJA 1OW6A 4YL1A 3GEEA 3RVZA 3ZVRA 1WGWA 4CSAC 3U9JA 3EPVA 3RQEA 2R7TA 4HEAJ 3VYWA 1Q0DA 3RVYA 4EKWA 1A41A 1V55C 4PFOA 2V26A 4DXWA 1O5HA 4L6RA 1MMGA 4NTBA 1TWAA 2XLDA 3W2WA 4XPYA 2J0XA 1OKKA 1A7VA 2GDCA 2ICWG 5T1DB 4W8PA 1C17M 5DS6A 1YLMA 4KI2A 2GAQA 4H54A 3W8IA 3RYLA 2YZSA 4MS2A 4ONSA 5F28E 4FX5A 3ABLC 3KMIA 1EI7A 1VOMA 1R5ID 4DVYP 4FESA 5FCLA 1G5ZA 2LQGA 2CW0F 2NUPA 3TJ5A 4JZAA 5AC4A 2XS8A 4WGYA 5CI8A 1LVKA 3FAPB 3G4ZA 4IGGA 4PFPA 2LCHA 5KYNA 3GANA 5JRAA 2A0BA 1FR0A 2XL6A 3AJMA 2J7PA 3T6BA 1IZMA 2C04A 4JCZA 4A4AA 1M57C 4LDQA 3KPHA 1F1MA 2Q9CA 4I44A 3U2MA 1KU2A 2W4MA 3BRJA 5GPGB 4IB4A 4GQHA 3MYFA 4PJLA 3TD7A 3LLIA 1Z23A 2HMQA 4U5DE 2HJ3A 4FWVA 1D1CA 4EBBA 1ORYA 5L3VA 1XZPA 2Y69C 3IQ6A 4DRJB 4O6NA 4DBRA 1E85A 2R7QA 1RKEA 4GYTA 5EHHA 2YLGA 3EHNA 3EH1A 1E2XA 2GWWA 2OJED 2NUPB 2L6GA 2L81A 2Q00A 2EPLX 3EZHA 4C3EA 3S90A 4Q5SF 1HE9A 2J45A 5T3WA 1D1AA 3IQ5A 3E70C 2Q4FA 3SP1A 3AG3C 4O6YA 1GM5A 3JSZA 1APCA 1QQ3A 4CX9A 3CEXA 1ZHXA 2L6HA 1JRAA 1FMWA 3L34A 2XLOA 3PCVA 3QW1A 4CBEA 1AVOB 2J9VA 1MNEA 1J8YF 1HE1A 4J32B 5CIVA 1U6HA 1WTYA 3B29A 4N6CA 1FMVA 4QI2A 1I4ZA 2DB4A 1GGQA 3IEEA 3S29A 1ORSC 2EIKC 2WVQA 4BG0A 1ZHTA 5BQIA 3I4UA 3EGXA 2HV6A 4U9EA 4ULWA 2UUHA 1VLSA 1YZCA 2XL8A 4CS9A 1JR8A 1SF8A 3EG9B 4G0HA 1LIHA 2ZXRA 2JX0A 3KH2A 3NYLA 1ORJA 4LDKA 1XZQA 2QY9A 4XEKA 1CPQA 3LJBA 2IXNA 3S28A 4OIPF 4RBNA 4G7HF 4CSAA 3UMIA 4K7BA 4P6IC 3SNHA 2VB6A 2HUJA 1T6UA 1N1CA 1TKNA 3KKBA 3S9OA 2ASRA 1ZW3A 3RW0A 2AWYA 3AG4C 3DMDA 3ABMC 3CAXA 3OWTA 5JSLA 2I15A 3K1HA 3UMHA 3F47A 4XEFA 1H9GA 2LK4A 2PX3A 1OCOC 5KYYA 5KYWA 3IQTA 5TJ5E 4C7OB 1QKRA 2HSBA 1TWGA 4LERA 1LS4A 1G8XA 3FMSA 3EFOB 2OG2A 1Z3IX 1A7DA 4U5GA 3RH3A 3Q7LA 2Y39A 1TFOB 3UGOA 3H2VA 3N0TA 1JOGA 2LP4A 4OIQF 3NMJA 2R7XA 2EINC 3HNIA 3E9VA 3MLGA 1TFKB 4XTKA 2X0CA 3K6BA 3MX3A 3V7OA 3QW0A 1D0ZA 1ZYRF 4PACA 1LI5A 4U5BE 4O7GA 1U89A 1VYIA 4RD9A 1SR2A 4U5HA 1YZAA 1LS1A 1OCZC 3GM1A 4E17A 2TMVP 2O9XA 3JRTA 1QZXA 2A68F 2IYLD 4PJJA 2YL0A 2M4EA 3AG2C 1ZHYA 2GFHA 2VASA 1QSPA 1A0BA 2KK1A 3ZDLA 2NSFA 1Q0GA 5A6JA 3T6JA 3EH2A 2IOQA 1A7EA 3Q7GA 5CI9A 5B1AC 1FTSA 4I1OB 1NU7D 2EILC 1Q0KA 4PJMA 3C62A 3GEHA 4I1MA 2CNWA 3M79A 3K66A 5COFA 2F22A 3LESA 3SXZA 4JJFA 1H6GA 2KSFA 3ASNC 3C8GD 5EK0A 4U5FE 3SXKA 1C03A 3C7JA 5A6AA 4OIOF 2WVNA 3K1IA 1HW1A 1NU9C 2BC5A 3IPMO 4JRZA 5K0IA 4JE9A 4EWCA 2VH3A 4LLEA 3FOPA 2HZ8A 2Q3TA 1NSGB 2MWQA 5B1BC 2CGEA 1FAPB 1YVIA 1G4WR 3DE9A 2LSEA 2MYSA 2YRFA 3W8HA 3JCUQ 4JKVA 3ZTMA 2QNLA 4C3DA 5IY5C 4LLCA 5COGA 4F4BA 1KTMA 4JW1A 1J8MF 4BJTA 3DE8A 4YN0B 2GA0A 4U9DA 3J06A 3ABKC 4FAPB 1DOWA 4XEVA 5L0DA 5BQGA 5L0CA 4U5EE 5DQZA 2XS1A 1CGOA 1LM3B 1MNDA 1HY5A 2DYSC 4NQFA 4W8KA 1ST6A 1CGME 2L7AA 2H7OA 1T01A 2J0WA 4HE8D 3WHNA 4J7TA 2UUIA 4MNDA 2WZGA 4MVMA 1BR4A 3RFYA 2HSQA 3RQFA 1I5NA 2XL4A 5T3TA 5A6BD 1RCPA 1RXQA 1OW8A 3V5XA 2OEVA 2R05A 1IW7F 1QPUA 1VK5A 3C18A 3QTHA 3TK0A 4NTAA 1RJ9A 4CDVA 2C03A 2LFFA 3NG1A 2WVOA 1PD0A 1OR2A 3HJCA 1O87A 4JJGA 2XSEA 4N4WA 3IHUA 3B0VC 2HMZA 3A9CA 4JTCB 3POVA 3DI5A 3GWLA 1YA9A 4MTFA 1V74B 3UMKA 2H7VC 1HW2A 4I3MA 5L0GA 1VLTA 2EIJC 1M6TA 3CZ6A 3G4XA 2A6HF 4WABA 3EG9A 3B0UX 1TR2A 3ATPA 4N06A 4BJ5C 5B3SC 3NYJA 3VM6A 4C3BA 4DJ9A 4KBLA 1CPRA 1T6QA 2P0NA 2FAPB 2YQYA 1UFBA 3JYYA 1FNTc 4BJ5A 2XM0A 5E2QA 3QZCA 1U0BB 4YT8A 1H7IA 2J9WA 5HV9A 5KYWB 1YJGA 3L8JA 2FFHA 3O55A 3U8VA 2J46A 4JEBA 4BJ6C 3T9OA 1RJ9B 2VC9A 3H65A 3LAYA 3LNMB 1PCXA 1YARO 3FXHA 4JTDB 4C7OA 1D0XA 2YVKA 4G7ZF 4YJWA 1V54C 1Z6AA 2XLMA 3M15A 4IAQA 4PR9A 2KJGA 5E33A 3EFOA 3SYNA 1RKCA 1BDJB 3NKDA 2Y3BA 3NYMA 3VRCA 4EBKA 3U8PA 5JUAA 4BJ6A 4A2NB 1NBBA 2B0HA 4EIYA 3CSKA 2L9JA 4XPWA 5DLJA 4CS7A 2YL3A 5JP7A 2VCCA 4BEMJ 4IAOA 2R7SA 2OKUA 2XRHA 2ZD9A 3B9QA 3BEHA 4MVUA 3DJUB 4O79A 2AVKA 2HV7A 1MMDA 2I8BA 3HTKC 4MVOA 2WZFA 2R03A 4ULVA 1NFOA 2OCCC 3MFNA 3DJNB 5L0HA 3L1MA 4HFFB 4E18A 2D4UA 2ETSA 1WASA 1VYKA 1L3PA 2J7PD 2NPUA 5KYUA 4B6IA 2Z15A 3V5YA 4YT4A 3US6A 2EIMC 3NMKA 4BJ1A 1LI7A 3AOUA 4IWBA 4AE4B 3ASOC 1D1BA 1YDIA 2KGOA 3M4CA 1EQ1A 4EHPA 3FDQA 1ZHZA 4DOZA 3T4RA 1OXBA 3B71A 3TJ6A 1Q0FA 2A1DD 4CDYA 5JT4A 4K0DA 2WZLA 4WJ0A 1WN0A 1Z5ZA 2R02A 5BQHA 3FHDA 1NG1A 3I5QA 2PFDA 5AGFA 4KC9A 3ZG1A 5DQTA 2NUTB 2A0UA 4DBQA 1TQGA 4UDVA 2G3VA 1W2WA 4EUKB 3S84A 2CDQA 2Y3DA 3SEOA 2WB7A 2DI3A 4YWQA 1T6IA 4O6MA 1TWCA 1K40A 3MBGA 5KYUB 2QLAA 1WOLA 1Z63A 4JURI 1OQCA 3R7CA 4Z9IA 1K05A 3U3FA 3U5SA 1EA8A 3PDMP 2HFIA 3X1OA 3Q6MA 4YL0A 2W4BA 4EBJA 3K1IC 3UGPA 1R4TA 1LE4A 1ZVZA 2QE9A 3C8GB 4E0IA 1JPJA 2P7VA 2ZPAA 3DM9B 3MYIA 3JYHA 1T9KA 3WG7C 3VF0A 1GS9A 1ZU5A 2EPMX 5L0FA 3HKKA 3LS0A 5F5HA 2G62A 4JVSA 4P9TA 2WL8A 1XWJA 2PP4A 2ZXPA 4MTOA 3RIPA 3FAJA 1NLXA 1LE2A 1SMYF 3NRHA 4CIPA 1GQAA 1E86A 1JPNA 1JAFA 4XPXA 2NG1A 1G4US 1NFNA 1O3UA 2H8AA 1JMWA 2AP3A 2X51A 1H9TA 2NSGA 3GORA 4BEJA 4IRUA 4QDLA 1K04A 3AQCA 1E84A 3KYIA 2FGYA 2PNOA 4OD5A 1OCRC 3O6XA 4G7OF 4ER9A 2LD6A 2PF4E 2CYDA 4Z9JA 3G50A 2IXMA 4IARA 1PV3A 4XLNF 3LS1A 2IXOA 3GM3A 4OIRF 3TULA 1S7ZA 2OJQA 3SXMA 4AK9A 3GEIA 3U0CA 1OW7A 5COMA 3F46A 2R7RA 4MTGA 1PD1A 1QVXA 1WATA 3DM5A 3JTLO 1ZHWA 4RDAA 3DXJF 3T6GB 3ZIBA 5E3AA 3GODA 4E7SA 4K1OA 4PJNA 3TOLA 3KYJA 2MHRA 4YT2A 3EGDB 4M63A 1BBHA 3ITFA 2RSEB 1FFTC 3I5PA 1Q0MA 2BE5F 2IXPA 1ZZPA 256BA 3SXYA 2J9UA
chains in the Genus database with same CATH topology
4DRHB 2GAQA 2FAPB 3FAPB 4DRIB 4FAPB 2RSEB 5GPGB 1NSGB 4DRJB 2NPUA 1FAPB 1AUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRH B;  2GAQ A;  2FAP B;  3FAP B;  4DRI B;  4FAP B;  2RSE B;  5GPG B;  1NSG B;  4DRJ B;  2NPU A;  1FAP B;  1AUE A; 
#chains in the Genus database with same CATH topology
 4JCH A;  2JPU A;  4R32 A;  3RF3 A;  4NTF A;  4Z9H A;  1M2V B;  4CDA A;  3NKE A;  1L7C A;  2W9Y A;  2CCY A;  1SYQ A;  4YL3 A;  1WWP A;  2IM8 A;  4Q7C A;  3U3B A;  2KYH A;  2L6F A;  3C8Z A;  4ZLC A;  3JRM O;  2JD3 A;  2HJM A;  4Q4Z F;  2XXA B;  3M1C B;  1RMV A;  3JSE O;  3NMI A;  5L0I A;  1OCC C;  4CIH A;  1Y6D A;  2CNW D;  2YL1 A;  2AU5 A;  5A6K A;  5FZT A;  3DZA A;  3Q6N A;  2VCA A;  2YLD A;  3V5Z A;  2OOC A;  2R7W A;  2XLV A;  2KC3 A;  2DYR C;  2YEV A;  2ZXO A;  3S0X A;  4MVR A;  2XM4 A;  5A69 A;  4XWJ A;  4MW3 A;  3AGT A;  1Z7Q c;  4DRH B;  5L3Q A;  3OA1 A;  2P6V A;  2KW3 C;  2AWC A;  4AE4 A;  1T5O A;  2YKZ A;  3LEO A;  5AC5 A;  3C63 A;  5DS4 A;  1YYX A;  2G3K A;  2P61 A;  2LFD A;  1D0Y A;  2Q9A A;  4CS8 C;  1OKK D;  3AQB A;  4KNV A;  2A69 F;  3IQC A;  3O39 A;  5E3C A;  5JS5 A;  1YAU O;  3TOM A;  3ZSU A;  1V4A A;  1NZE A;  4MVZ A;  1B68 A;  4AL1 A;  1MMA A;  3N24 A;  4YK5 A;  3SZR A;  1TWH A;  2EPN A;  4MVQ A;  2ZXW C;  3DWW A;  3CQZ A;  3JZ0 A;  2R7O A;  4P9F A;  4CS8 A;  4DVZ A;  1E83 A;  2M64 A;  3DAG A;  2OU6 A;  4ANJ A;  4JIO A;  3DKA A;  1EKY A;  1LPE A;  3W2V A;  2NUT A;  3U2L A;  4CS9 C;  4GEH A;  5KYX A;  1YA7 O;  3QVY A;  2DGJ A;  3DD7 A;  2YHS A;  3KL4 A;  3LLK A;  4E0H A;  1BR1 A;  4D4X A;  1ZW2 A;  4XQ1 A;  1BR2 A;  3EQL F;  3ZWI A;  4D4N A;  2J9B A;  3QVZ A;  2R7V A;  3OEO A;  4OD4 A;  1AEP A;  3ZTZ A;  1HMO A;  3HLZ A;  4JC7 A;  4BPM A;  3ZQY A;  1HMD A;  5JVE A;  5DVW A;  4OIN F;  2OQM A;  2XLE A;  2XLH A;  3GM2 A;  1VTM P;  1KNY A;  3JT1 A;  2LIG A;  3K33 A;  3AGU A;  4E7Z A;  3C8G A;  3TQO A;  5L0J A;  3K7D A;  3VAY A;  3QMK A;  1M56 C;  3DAF A;  3PMR A;  1CGN A;  3EJN A;  3S27 A;  1RKE B;  4NCQ A;  4ZLD A;  2KNH A;  4G78 A;  4MVS A;  4WGZ A;  3WAQ A;  1SZI A;  2Y3H A;  3N2Z B;  3HNK A;  3O10 A;  4HFK B;  1QLE C;  4U5C E;  3W4Y A;  2BL2 A;  2YL7 A;  2EPO A;  1MQV A;  2YLI A;  3ECS A;  3FOO A;  4DRI B;  5KYX B;  1MMN A;  2XLW A;  3H2U A;  2QTV A;  4NY3 A;  4IJJ A;  4LAC B;  4XLP F;  1DOV A;  1M2O A;  3LNR A;  5D92 A;  3HNL A;  5JLI A;  2R7U A;  4JTA B;  4YT5 A;  4JEA A;  5B3I A;  3L0I A;  4MQ9 F;  4H4K C;  4MW8 A;  1OXK A;  1OR3 A;  2PX0 A;  3EHM A;  3ZQV A;  5F5F A;  3EZI A;  4N6H A;  1FFH A;  3EGX B;  4J30 B;  4X0R A;  4AL0 A;  1AUE A;  2D5R B;  5EGY A;  2J8W A;  2W45 A;  2Y3G A;  2V3C C;  2VCB A;  3RQG A;  4CJO A;  3A11 A;  2HKV A;  2Q9B A;  4J7Y A;  4NC3 A;  2QUP A;  2RD9 A;  3FVY A;  2EPK X;  5A6B A;  3EGD A;  3GWN A;  1I4Y A;  4KNW A;  2E87 A;  1BZ4 A;  1VMA A;  2YWA A;  2R9R B;  4LDR A;  3PHF 2;  4QI0 A;  3U9M A;  5DS5 A;  1LKX A;  1M2V A;  4PK4 A;  4AX2 A;  1UG7 A;  1ZU4 A;  3AG1 C;  3ZC4 A;  3X2Q C;  3UNG C;  2P1A A;  3RKO F;  1C02 A;  3B0P A;  3M4B A;  2PBE A;  5BUO A;  1VB5 A;  2A6E F;  3R2P A;  2B0J A;  2OEX A;  1S05 A;  3LUT B;  2IBF A;  1YYJ A;  3WOD F;  5KYY B;  2HS5 A;  3L8I A;  2XXA A;  2H7B A;  1Y4C A;  3NDB B;  2Q7R A;  2R25 A;  5HSW A;  3UR3 C;  5D91 A;  2KQ9 A;  3LEV A;  4CJG A;  3HNJ A;  1OW6 A;  4YL1 A;  3GEE A;  3RVZ A;  3ZVR A;  1WGW A;  4CSA C;  3U9J A;  3EPV A;  3RQE A;  2R7T A;  4HEA J;  3VYW A;  1Q0D A;  3RVY A;  4EKW A;  1A41 A;  1V55 C;  4PFO A;  2V26 A;  4DXW A;  1O5H A;  4L6R A;  1MMG A;  4NTB A;  1TWA A;  2XLD A;  3W2W A;  4XPY A;  2J0X A;  1OKK A;  1A7V A;  2GDC A;  2ICW G;  5T1D B;  4W8P A;  1C17 M;  5DS6 A;  1YLM A;  4KI2 A;  2GAQ A;  4H54 A;  3W8I A;  3RYL A;  2YZS A;  4MS2 A;  4ONS A;  5F28 E;  4FX5 A;  3ABL C;  3KMI A;  1EI7 A;  1VOM A;  1R5I D;  4DVY P;  4FES A;  5FCL A;  1G5Z A;  2LQG A;  2CW0 F;  2NUP A;  3TJ5 A;  4JZA A;  5AC4 A;  2XS8 A;  4WGY A;  5CI8 A;  1LVK A;  3FAP B;  3G4Z A;  4IGG A;  4PFP A;  2LCH A;  5KYN A;  3GAN A;  5JRA A;  2A0B A;  1FR0 A;  2XL6 A;  3AJM A;  2J7P A;  3T6B A;  1IZM A;  2C04 A;  4JCZ A;  4A4A A;  1M57 C;  4LDQ A;  3KPH A;  1F1M A;  2Q9C A;  4I44 A;  3U2M A;  1KU2 A;  2W4M A;  3BRJ A;  5GPG B;  4IB4 A;  4GQH A;  3MYF A;  4PJL A;  3TD7 A;  3LLI A;  1Z23 A;  2HMQ A;  4U5D E;  2HJ3 A;  4FWV A;  1D1C A;  4EBB A;  1ORY A;  5L3V A;  1XZP A;  2Y69 C;  3IQ6 A;  4DRJ B;  4O6N A;  4DBR A;  1E85 A;  2R7Q A;  1RKE A;  4GYT A;  5EHH A;  2YLG A;  3EHN A;  3EH1 A;  1E2X A;  2GWW A;  2OJE D;  2NUP B;  2L6G A;  2L81 A;  2Q00 A;  2EPL X;  3EZH A;  4C3E A;  3S90 A;  4Q5S F;  1HE9 A;  2J45 A;  5T3W A;  1D1A A;  3IQ5 A;  3E70 C;  2Q4F A;  3SP1 A;  3AG3 C;  4O6Y A;  1GM5 A;  3JSZ A;  1APC A;  1QQ3 A;  4CX9 A;  3CEX A;  1ZHX A;  2L6H A;  1JRA A;  1FMW A;  3L34 A;  2XLO A;  3PCV A;  3QW1 A;  4CBE A;  1AVO B;  2J9V A;  1MNE A;  1J8Y F;  1HE1 A;  4J32 B;  5CIV A;  1U6H A;  1WTY A;  3B29 A;  4N6C A;  1FMV A;  4QI2 A;  1I4Z A;  2DB4 A;  1GGQ A;  3IEE A;  3S29 A;  1ORS C;  2EIK C;  2WVQ A;  4BG0 A;  1ZHT A;  5BQI A;  3I4U A;  3EGX A;  2HV6 A;  4U9E A;  4ULW A;  2UUH A;  1VLS A;  1YZC A;  2XL8 A;  4CS9 A;  1JR8 A;  1SF8 A;  3EG9 B;  4G0H A;  1LIH A;  2ZXR A;  2JX0 A;  3KH2 A;  3NYL A;  1ORJ A;  4LDK A;  1XZQ A;  2QY9 A;  4XEK A;  1CPQ A;  3LJB A;  2IXN A;  3S28 A;  4OIP F;  4RBN A;  4G7H F;  4CSA A;  3UMI A;  4K7B A;  4P6I C;  3SNH A;  2VB6 A;  2HUJ A;  1T6U A;  1N1C A;  1TKN A;  3KKB A;  3S9O A;  2ASR A;  1ZW3 A;  3RW0 A;  2AWY A;  3AG4 C;  3DMD A;  3ABM C;  3CAX A;  3OWT A;  5JSL A;  2I15 A;  3K1H A;  3UMH A;  3F47 A;  4XEF A;  1H9G A;  2LK4 A;  2PX3 A;  1OCO C;  5KYY A;  5KYW A;  3IQT A;  5TJ5 E;  4C7O B;  1QKR A;  2HSB A;  1TWG A;  4LER A;  1LS4 A;  1G8X A;  3FMS A;  3EFO B;  2OG2 A;  1Z3I X;  1A7D A;  4U5G A;  3RH3 A;  3Q7L A;  2Y39 A;  1TFO B;  3UGO A;  3H2V A;  3N0T A;  1JOG A;  2LP4 A;  4OIQ F;  3NMJ A;  2R7X A;  2EIN C;  3HNI A;  3E9V A;  3MLG A;  1TFK B;  4XTK A;  2X0C A;  3K6B A;  3MX3 A;  3V7O A;  3QW0 A;  1D0Z A;  1ZYR F;  4PAC A;  1LI5 A;  4U5B E;  4O7G A;  1U89 A;  1VYI A;  4RD9 A;  1SR2 A;  4U5H A;  1YZA A;  1LS1 A;  1OCZ C;  3GM1 A;  4E17 A;  2TMV P;  2O9X A;  3JRT A;  1QZX A;  2A68 F;  2IYL D;  4PJJ A;  2YL0 A;  2M4E A;  3AG2 C;  1ZHY A;  2GFH A;  2VAS A;  1QSP A;  1A0B A;  2KK1 A;  3ZDL A;  2NSF A;  1Q0G A;  5A6J A;  3T6J A;  3EH2 A;  2IOQ A;  1A7E A;  3Q7G A;  5CI9 A;  5B1A C;  1FTS A;  4I1O B;  1NU7 D;  2EIL C;  1Q0K A;  4PJM A;  3C62 A;  3GEH A;  4I1M A;  2CNW A;  3M79 A;  3K66 A;  5COF A;  2F22 A;  3LES A;  3SXZ A;  4JJF A;  1H6G A;  2KSF A;  3ASN C;  3C8G D;  5EK0 A;  4U5F E;  3SXK A;  1C03 A;  3C7J A;  5A6A A;  4OIO F;  2WVN A;  3K1I A;  1HW1 A;  1NU9 C;  2BC5 A;  3IPM O;  4JRZ A;  5K0I A;  4JE9 A;  4EWC A;  2VH3 A;  4LLE A;  3FOP A;  2HZ8 A;  2Q3T A;  1NSG B;  2MWQ A;  5B1B C;  2CGE A;  1FAP B;  1YVI A;  1G4W R;  3DE9 A;  2LSE A;  2MYS A;  2YRF A;  3W8H A;  3JCU Q;  4JKV A;  3ZTM A;  2QNL A;  4C3D A;  5IY5 C;  4LLC A;  5COG A;  4F4B A;  1KTM A;  4JW1 A;  1J8M F;  4BJT A;  3DE8 A;  4YN0 B;  2GA0 A;  4U9D A;  3J06 A;  3ABK C;  4FAP B;  1DOW A;  4XEV A;  5L0D A;  5BQG A;  5L0C A;  4U5E E;  5DQZ A;  2XS1 A;  1CGO A;  1LM3 B;  1MND A;  1HY5 A;  2DYS C;  4NQF A;  4W8K A;  1ST6 A;  1CGM E;  2L7A A;  2H7O A;  1T01 A;  2J0W A;  4HE8 D;  3WHN A;  4J7T A;  2UUI A;  4MND A;  2WZG A;  4MVM A;  1BR4 A;  3RFY A;  2HSQ A;  3RQF A;  1I5N A;  2XL4 A;  5T3T A;  5A6B D;  1RCP A;  1RXQ A;  1OW8 A;  3V5X A;  2OEV A;  2R05 A;  1IW7 F;  1QPU A;  1VK5 A;  3C18 A;  3QTH A;  3TK0 A;  4NTA A;  1RJ9 A;  4CDV A;  2C03 A;  2LFF A;  3NG1 A;  2WVO A;  1PD0 A;  1OR2 A;  3HJC A;  1O87 A;  4JJG A;  2XSE A;  4N4W A;  3IHU A;  3B0V C;  2HMZ A;  3A9C A;  4JTC B;  3POV A;  3DI5 A;  3GWL A;  1YA9 A;  4MTF A;  1V74 B;  3UMK A;  2H7V C;  1HW2 A;  4I3M A;  5L0G A;  1VLT A;  2EIJ C;  1M6T A;  3CZ6 A;  3G4X A;  2A6H F;  4WAB A;  3EG9 A;  3B0U X;  1TR2 A;  3ATP A;  4N06 A;  4BJ5 C;  5B3S C;  3NYJ A;  3VM6 A;  4C3B A;  4DJ9 A;  4KBL A;  1CPR A;  1T6Q A;  2P0N A;  2FAP B;  2YQY A;  1UFB A;  3JYY A;  1FNT c;  4BJ5 A;  2XM0 A;  5E2Q A;  3QZC A;  1U0B B;  4YT8 A;  1H7I A;  2J9W A;  5HV9 A;  5KYW B;  1YJG A;  3L8J A;  2FFH A;  3O55 A;  3U8V A;  2J46 A;  4JEB A;  4BJ6 C;  3T9O A;  1RJ9 B;  2VC9 A;  3H65 A;  3LAY A;  3LNM B;  1PCX A;  1YAR O;  3FXH A;  4JTD B;  4C7O A;  1D0X A;  2YVK A;  4G7Z F;  4YJW A;  1V54 C;  1Z6A A;  2XLM A;  3M15 A;  4IAQ A;  4PR9 A;  2KJG A;  5E33 A;  3EFO A;  3SYN A;  1RKC A;  1BDJ B;  3NKD A;  2Y3B A;  3NYM A;  3VRC A;  4EBK A;  3U8P A;  5JUA A;  4BJ6 A;  4A2N B;  1NBB A;  2B0H A;  4EIY A;  3CSK A;  2L9J A;  4XPW A;  5DLJ A;  4CS7 A;  2YL3 A;  5JP7 A;  2VCC A;  4BEM J;  4IAO A;  2R7S A;  2OKU A;  2XRH A;  2ZD9 A;  3B9Q A;  3BEH A;  4MVU A;  3DJU B;  4O79 A;  2AVK A;  2HV7 A;  1MMD A;  2I8B A;  3HTK C;  4MVO A;  2WZF A;  2R03 A;  4ULV A;  1NFO A;  2OCC C;  3MFN A;  3DJN B;  5L0H A;  3L1M A;  4HFF B;  4E18 A;  2D4U A;  2ETS A;  1WAS A;  1VYK A;  1L3P A;  2J7P D;  2NPU A;  5KYU A;  4B6I A;  2Z15 A;  3V5Y A;  4YT4 A;  3US6 A;  2EIM C;  3NMK A;  4BJ1 A;  1LI7 A;  3AOU A;  4IWB A;  4AE4 B;  3ASO C;  1D1B A;  1YDI A;  2KGO A;  3M4C A;  1EQ1 A;  4EHP A;  3FDQ A;  1ZHZ A;  4DOZ A;  3T4R A;  1OXB A;  3B71 A;  3TJ6 A;  1Q0F A;  2A1D D;  4CDY A;  5JT4 A;  4K0D A;  2WZL A;  4WJ0 A;  1WN0 A;  1Z5Z A;  2R02 A;  5BQH A;  3FHD A;  1NG1 A;  3I5Q A;  2PFD A;  5AGF A;  4KC9 A;  3ZG1 A;  5DQT A;  2NUT B;  2A0U A;  4DBQ A;  1TQG A;  4UDV A;  2G3V A;  1W2W A;  4EUK B;  3S84 A;  2CDQ A;  2Y3D A;  3SEO A;  2WB7 A;  2DI3 A;  4YWQ A;  1T6I A;  4O6M A;  1TWC A;  1K40 A;  3MBG A;  5KYU B;  2QLA A;  1WOL A;  1Z63 A;  4JUR I;  1OQC A;  3R7C A;  4Z9I A;  1K05 A;  3U3F A;  3U5S A;  1EA8 A;  3PDM P;  2HFI A;  3X1O A;  3Q6M A;  4YL0 A;  2W4B A;  4EBJ A;  3K1I C;  3UGP A;  1R4T A;  1LE4 A;  1ZVZ A;  2QE9 A;  3C8G B;  4E0I A;  1JPJ A;  2P7V A;  2ZPA A;  3DM9 B;  3MYI A;  3JYH A;  1T9K A;  3WG7 C;  3VF0 A;  1GS9 A;  1ZU5 A;  2EPM X;  5L0F A;  3HKK A;  3LS0 A;  5F5H A;  2G62 A;  4JVS A;  4P9T A;  2WL8 A;  1XWJ A;  2PP4 A;  2ZXP A;  4MTO A;  3RIP A;  3FAJ A;  1NLX A;  1LE2 A;  1SMY F;  3NRH A;  4CIP A;  1GQA A;  1E86 A;  1JPN A;  1JAF A;  4XPX A;  2NG1 A;  1G4U S;  1NFN A;  1O3U A;  2H8A A;  1JMW A;  2AP3 A;  2X51 A;  1H9T A;  2NSG A;  3GOR A;  4BEJ A;  4IRU A;  4QDL A;  1K04 A;  3AQC A;  1E84 A;  3KYI A;  2FGY A;  2PNO A;  4OD5 A;  1OCR C;  3O6X A;  4G7O F;  4ER9 A;  2LD6 A;  2PF4 E;  2CYD A;  4Z9J A;  3G50 A;  2IXM A;  4IAR A;  1PV3 A;  4XLN F;  3LS1 A;  2IXO A;  3GM3 A;  4OIR F;  3TUL A;  1S7Z A;  2OJQ A;  3SXM A;  4AK9 A;  3GEI A;  3U0C A;  1OW7 A;  5COM A;  3F46 A;  2R7R A;  4MTG A;  1PD1 A;  1QVX A;  1WAT A;  3DM5 A;  3JTL O;  1ZHW A;  4RDA A;  3DXJ F;  3T6G B;  3ZIB A;  5E3A A;  3GOD A;  4E7S A;  4K1O A;  4PJN A;  3TOL A;  3KYJ A;  2MHR A;  4YT2 A;  3EGD B;  4M63 A;  1BBH A;  3ITF A;  2RSE B;  1FFT C;  3I5P A;  1Q0M A;  2BE5 F;  2IXP A;  1ZZP A;  256B A;  3SXY A;  2J9U A; 
#chains in the Genus database with same CATH homology
 4DRH B;  2GAQ A;  2FAP B;  3FAP B;  4DRI B;  4FAP B;  2RSE B;  5GPG B;  1NSG B;  4DRJ B;  2NPU A;  1FAP B;  1AUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...