4DRIB

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
b'GAMDPEFMEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 38
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4driB00
2NPUA 5GPGB 2GAQA 4DRJB 4DRIB 4FAPB 1NSGB 4DRHB 1FAPB 2RSEB 1AUEA 3FAPB 2FAPB
chains in the Genus database with same CATH superfamily
4XQ1A 2B0JA 3RVYA 3C8GA 1PCXA 3GODA 3JRTA 4G7HF 3KL4A 1XWJA 3I5PA 4FWVA 4U5DE 3EZHA 4EBKA 2HUJA 3RYLA 2LD6A 5KYXA 3ABMC 4JCZA 1TWCA 5CIVA 2I15A 5T3WA 4Z9IA 3GWLA 1TWHA 2A69F 2HJ3A 2W9YA 2YL7A 4EBJA 4XLPF 1G4WR 3DD7A 1FFHA 3QTHA 3AG1C 3DJNB 4DVYP 3LLKA 2H7OA 4MQ9F 2BC5A 4U9EA 3SEOA 1ZW3A 4YL0A 3U8VA 2W4BA 3TJ5A 3HTKC 3NRHA 3RFYA 3UNGC 1L7CA 2Y39A 4XLNF 4CS9C 4JEAA 3T6BA 2H7BA 2HFIA 1ZU5A 4YWQA 4MS2A 2JD3A 3I5QA 4YL1A 2HV6A 4LDQA 3N0TA 1HMDA 1NSGB 2A0UA 2ZXOA 1ZHZA 2HJMA 1I4ZA 1RKCA 3DXJF 1V4AA 2OEXA 2Y69C 3FAPB 3O10A 5KYXB 1TQGA 2R7UA 1C02A 1BDJB 1QLEC 1R5ID 1NLXA 3RF3A 1FMVA 2L6GA 1H6GA 4EIYA 3DMDA 5JVEA 2R7OA 4IAQA 5L3QA 3AQCA 1OCZC 5EHHA 4LLCA 1TFKB 2XLVA 3K1IC 2PF4E 2RD9A 1ORYA 3S29A 4CJGA 3VM6A 1ZW2A 2AP3A 3GEIA 3OWTA 4NTFA 4BPMA 5DS4A 1E86A 4MW3A 3EFOA 3U3BA 1CGOA 3K1HA 1RJ9A 1LVKA 5F28E 2VASA 2H8AA 4J7YA 3DKAA 3TJ6A 3NYMA 3SP1A 4LERA 3GANA 3DZAA 3N2ZB 1EI7A 4EBBA 4G7ZF 3G4ZA 4MVOA 1J8YF 4CBEA 3FMSA 1APCA 2J8WA 2KW3C 3ZTMA 4AK9A 3EJNA 3KH2A 2YWAA 3N24A 5EK0A 2NPUA 3M79A 1A0BA 1Z23A 5AGFA 4CIHA 3GM2A 3WODF 3UGOA 4YT8A 1TWGA 2EPNA 3GEEA 1NFNA 4MVZA 3RQGA 3U5SA 2NUTB 2QUPA 3DJUB 1FTSA 3IHUA 3R7CA 3LEVA 3ASNC 2F22A 3AQBA 4H54A 3V5XA 3GM1A 1V54C 3KYIA 3W2WA 3H65A 4K0DA 2OJQA 2PNOA 4OIQF 2XRHA 4FX5A 1Q0GA 4ZLCA 2XXAA 3EFOB 1EQ1A 4NTBA 2Q9BA 4K7BA 4JE9A 2AWCA 3SXKA 3PHF2 3JSZA 1ST6A 4E17A 4C3EA 1LI5A 4XEKA 4EUKB 3RQEA 4DJ9A 3G50A 2CDQA 2B0HA 4I1MA 3F46A 3SNHA 3TULA 4DRJB 1U89A 2J7PD 1T9KA 1LE2A 3GEHA 5L0DA 3C18A 3OEOA 4JKVA 4XEFA 2XM0A 2XLEA 2R7RA 3EPVA 4XEVA 3M15A 3WAQA 2XLOA 4B6IA 4CDAA 3C62A 1WWPA 3DI5A 5D92A 5T1DB 4JURI 1AEPA 1YA9A 4MTOA 2R03A 3AGTA 4MW8A 4PK4A 4Z9JA 1M2VA 4I3MA 4IWBA 1QVXA 2XXAB 4DBRA 5L0HA 1JOGA 2QTVA 3FOOA 1O3UA 1Q0MA 1UFBA 3A9CA 2V26A 3IQ5A 3MX3A 1ZHTA 4M63A 5JRAA 256BA 3E9VA 3HNKA 4ULVA 1D1BA 1FMWA 3SZRA 1YVIA 5A6AA 1Y6DA 4LLEA 4BJTA 3JSEO 3V7OA 2EPMX 4N6HA 4XWJA 3X1OA 2VC9A 3B0PA 3JTLO 4U5GA 4AE4B 4JCHA 2ZXPA 1O5HA 5GPGB 2HKVA 2Q9CA 2LCHA 3MYIA 1FR0A 4UDVA 1NU7D 5AC5A 1MNEA 2EIJC 1TWAA 1ZYRF 2EIKC 1K05A 2Y3HA 4GEHA 2UUIA 1MQVA 5L0FA 3KYJA 3EG9B 1YARO 3ABLC 3B9QA 4JIOA 2OJED 4KI2A 1S7ZA 1BR4A 1J8MF 3H2VA 2EPOA 2X51A 4U5CE 5EGYA 1ZHXA 3I4UA 1ORSC 2YVKA 3EHMA 3L34A 3IPMO 3POVA 2XS1A 1HW1A 4N06A 1B68A 5BQIA 4CIPA 2KJGA 4YT4A 5F5HA 1BR2A 2FGYA 1Z63A 1OCCC 4JJGA 3G4XA 3UR3C 3U9MA 5KYWB 1JPJA 4OD4A 2EPLX 4ZLDA 3OA1A 4N6CA 3B0UX 1BR1A 2Y3DA 2IYLD 3TQOA 4IB4A 1XZQA 1HMOA 4KNVA 3O55A 2HMZA 2Q00A 2LFDA 3S9OA 1JR8A 2HZ8A 3FOPA 1LS1A 3ITFA 4P9FA 4RBNA 2PX3A 2R7QA 3J06A 4X0RA 3RW0A 4DOZA 2DYRC 4CDVA 3JRMO 2YEVA 2DI3A 1M56C 2VCCA 1E2XA 5F5FA 2XLWA 1NZEA 3RH3A 4AL0A 1OR2A 4JTAB 1OXBA 1QPUA 2WB7A 5B3IA 2VB6A 2ZXRA 3GM3A 2OU6A 3NKDA 4JC7A 4R32A 3S0XA 1VK5A 2DGJA 2KYHA 3AGUA 3Q7GA 2NSFA 4IAOA 5CI8A 5A6BA 3L1MA 2A6EF 1CGNA 1D1CA 1T5OA 5E3CA 4OIOF 4U5BE 5D91A 5L0JA 1QQ3A 2WZGA 1OKKD 2VCAA 3K6BA 4PJLA 4XPWA 1GM5A 2V3CC 2R7XA 1AVOB 4QI2A 2H7VC 3NYJA 2QE9A 2MWQA 1D1AA 2NUTA 1QZXA 3VAYA 3LAYA 4C3BA 2JX0A 3FDQA 1T6IA 1N1CA 2CCYA 3QZCA 3H2UA 1LE4A 3AG2C 3QW1A 2J9WA 4U5FE 1KTMA 2J7PA 2E87A 1OW6A 2YL3A 3RKOF 2OOCA 1H9GA 1RKEB 4BJ1A 1OW8A 1VYIA 1EA8A 3SXMA 1IZMA 2IXOA 1V74B 4MVSA 1E84A 2J45A 4D4XA 2VCBA 2YQYA 4O6YA 4CSAA 5L0CA 4OIRF 3QW0A 3CZ6A 4XTKA 3W8HA 2GDCA 4BEJA 2ETSA 3AJMA 2R7WA 3U3FA 2CGEA 1MMAA 1M57C 3C8GD 3MFNA 4YJWA 5DS5A 4NY3A 2OCCC 4Q7CA 1JAFA 3S27A 5B1AC 1UG7A 4FAPB 3TK0A 5DQTA 3M1CB 1L3PA 5HSWA 2D4UA 4KC9A 5L0GA 3UMKA 4DBQA 3L0IA 4PFOA 2XLHA 1ZHYA 3CSKA 1R4TA 2Y3BA 2YLIA 2GFHA 2OKUA 3E70C 4YK5A 2NSGA 3ZC4A 4AX2A 3B0VC 4W8KA 1E85A 3UMIA 2FFHA 2HSBA 5KYUA 2IBFA 1YLMA 3M4CA 1G8XA 1Q0DA 3HNLA 3GORA 3HLZA 3JCUQ 3U8PA 1MMDA 2J9BA 5TJ5E 1JRAA 1ZHWA 2R9RB 1PD1A 2NUPA 4WABA 3RIPA 3X2QC 4AE4A 2KGOA 2UUHA 1RCPA 1SYQA 1WASA 2KQ9A 1VLSA 2WVNA 2MYSA 2Q3TA 4NCQA 4CS7A 1EKYA 4W8PA 4P9TA 1GS9A 1BZ4A 2XL4A 1T6UA 2A68F 3EG9A 3IQTA 5FZTA 4BJ6A 2XL8A 4MVMA 4LACB 2A6HF 2W4MA 3KMIA 4XPXA 3B71A 1OCRC 4QI0A 5BQGA 5A6KA 4IGGA 2R7SA 3Q7LA 4JTCB 4H4KC 4IRUA 2R02A 1H7IA 4BEMJ 2Q7RA 2OQMA 3K33A 5KYUB 5B1BC 1Z6AA 5AC4A 5KYWA 3U2LA 4U5EE 4NTAA 2PBEA 3ZWIA 4YT2A 4OIPF 3ZTZA 2NUPB 2LIGA 4PACA 2HMQA 2Q4FA 2R05A 3DAGA 1NG1A 4HE8D 4JTDB 4A4AA 1M2OA 2J0XA 2W45A 5JSLA 5COFA 3WG7C 3BEHA 3LS0A 1JPNA 3O6XA 2R7TA 4RDAA 3RQFA 1LIHA 4N4WA 4IARA 2HS5A 1S05A 2WVQA 2YL0A 1OQCA 2ICWG 4U9DA 1A7VA 4JZAA 2KNHA 1W2WA 1ZU4A 1I4YA 1A41A 2I8BA 2XLMA 3MBGA 3ZDLA 1OKKA 3MYFA 3V5YA 1G5ZA 3R2PA 4CX9A 3ECSA 4DRIB 5DQZA 2J9UA 2ASRA 3ASOC 3HNJA 4G7OF 3SYNA 2OG2A 3US6A 1O87A 3VRCA 5JLIA 4AL1A 3S28A 1A7EA 2EILC 2YLGA 3U2MA 2L81A 3ZIBA 2Q9AA 1VB5A 1LKXA 3IEEA 4BJ5A 4HFKB 2YZSA 1TKNA 3EHNA 1VYKA 3ZQVA 1H9TA 3DAFA 3SXYA 2WVOA 4E7ZA 3M4BA 3ZG1A 3K7DA 4QDLA 2TMVP 3L8JA 3S84A 1PV3A 3EGDA 3TOMA 4XPYA 3Q6NA 1QKRA 4O6NA 5JT4A 1VMAA 4JVSA 3V5ZA 2R25A 1GQAA 4CSAC 3PMRA 3JYHA 1ZZPA 4YN0B 1YYJA 2PP4A 2RSEB 2Z15A 4Z9HA 3VF0A 3DE9A 4IJJA 2IM8A 3A11A 1Q0FA 1RKEA 2YLDA 3B29A 2XL6A 3GWNA 3NYLA 3QMKA 2CNWD 4MVUA 4NQFA 4PR9A 1MNDA 2PFDA 2ZPAA 4PJNA 1YZCA 2CW0F 3W2VA 1NU9C 2P7VA 1VLTA 1FNTc 2XSEA 2LFFA 3T6JA 3RVZA 4Q4ZF 1D0XA 1MMNA 3EGXA 5KYNA 4J30B 3UMHA 1Q0KA 3JT1A 2KC3A 1U6HA 4A2NB 2A0BA 2AWYA 1DOWA 3EGDB 3EQLF 5COGA 4E7SA 2YRFA 4J32B 5IY5C 4K1OA 2HV7A 4ANJA 5BQHA 1RXQA 1T6QA 2LP4A 4WGZA 1Z7Qc 1VTMP 2AU5A 3DM5A 3LESA 4C3DA 3HNIA 3EH1A 3S90A 1WOLA 4DRHB 3T9OA 2YHSA 5B3SC 3LJBA 5A69A 3PDMP 4EWCA 3C8GB 3DM9B 4O7GA 4DVZA 1OCOC 4RD9A 1U0BB 2GA0A 2PX0A 4LDRA 4CS8A 3FXHA 2BL2A 3CAXA 2DYSC 4JEBA 4FESA 3SXZA 4C7OA 1YYXA 1JMWA 4BJ6C 4JRZA 1ZVZA 4ONSA 2LK4A 1Y4CA 3JYYA 5A6JA 4CDYA 3T6GB 1HW2A 1CPRA 3EGXB 1GGQA 1LPEA 4I1OB 3C7JA 2L6FA 2NG1A 2WZLA 4WGYA 4OINF 3DE8A 2GAQA 1TFOB 1YZAA 3Q6MA 2XLDA 5T3TA 3NMIA 5KYYA 1VOMA 5CI9A 1C03A 3EH2A 4CJOA 1F1MA 2Y3GA 3W4YA 2ZD9A 4YT5A 5E3AA 1D0ZA 3U9JA 2G3VA 3C8ZA 3QVZA 2QY9A 1FFTC 1WATA 2EINC 4E0HA 3PCVA 3AG4C 1YA7O 3TD7A 3LNRA 1ORJA 4BG0A 2J0WA 3CEXA 3TOLA 3NMJA 1WTYA 3MLGA 5L0IA 4MVRA 1WN0A 2IOQA 4C7OB 2G62A 1BBHA 4CS9A 4PFPA 3JZ0A 5E2QA 3VYWA 4D4NA 2HSQA 2J46A 1SZIA 3O39A 3ZQYA 3U0CA 1M6TA 2CYDA 5A6BD 1I5NA 3NDBB 2XS8A 5DS6A 1WGWA 1HE9A 3KPHA 5L3VA 1MMGA 5BUOA 2R7VA 5JS5A 2WZFA 3UGPA 5KYYB 3CQZA 5COMA 4L6RA 1V55C 2EIMC 1E83A 2X0CA 1RJ9B 2QNLA 1D0YA 1OR3A 1TR2A 1LI7A 1NBBA 2MHRA 2YL1A 3IQ6A 3KKBA 3L8IA 3ZVRA 2L6HA 4BJ5C 4DXWA 1C17M 3HKKA 3K1IA 2FAPB 4OD5A 1YJGA 1YAUO 3BRJA 1LS4A 4ULWA 4F4BA 3IQCA 2LSEA 1YDIA 3FVYA 3LS1A 1SF8A 4KNWA 5HV9A 4HEAJ 3NKEA 4U5HA 2D5RB 4EHPA 4JJFA 2IXPA 1G4US 4LDKA 4MTGA 4O79A 1HY5A 3NG1A 1RMVA 2M64A 1K40A 2A1DD 5E33A 3ZSUA 4Q5SF 1Z3IX 3AG3C 2GWWA 2JPUA 2LQGA 4ER9A 4G0HA 3LUTB 1IW7F 2CNWA 1CPQA 4PJJA 2AVKA 1CGME 5K0IA 2OEVA 2KK1A 2ZXWC 4MVQA 2IXMA 1DOVA 4GQHA 4EKWA 4I44A 2L9JA 3HJCA 5DVWA 2EPKX 2WL8A 1PD0A 1AUEA 2KSFA 2YKZA 2J9VA 1K04A 4KBLA 3FHDA 1A7DA 1Z5ZA 3NMKA 1OW7A 4MTFA 4PJMA 4G78A 2O9XA 3FAJA 3T4RA 4HFFB 1SMYF 1FAPB 2M4EA 3ATPA 2P61A 3DWWA 4J7TA 5FCLA 1OXKA 2P1AA 2C03A 2VH3A 4JW1A 4P6IC 4YL3A 2G3KA 3W8IA 4E0IA 2P0NA 3AOUA 5JP7A 1LM3B 5JUAA 4NC3A 2IXNA 1T01A 3LEOA 1HE1A 3LNMB 4E18A 3EZIA 3ABKC 4GYTA 1M2VB 2C04A 3F47A 3WHNA 4CS8C 2P6VA 3LLIA 4MNDA 3QVYA 1KU2A 2BE5F 2QLAA 1XZPA 4O6MA 4WJ0A 2XM4A 5DLJA 1NFOA 1SR2A 1KNYA 2L7AA 3C63A 3K66A 1QSPA 2DB4A
chains in the Genus database with same CATH topology
2NPUA 5GPGB 2GAQA 4DRJB 4DRIB 4FAPB 1NSGB 4DRHB 1FAPB 2RSEB 1AUEA 3FAPB 2FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPU A;  5GPG B;  2GAQ A;  4DRJ B;  4DRI B;  4FAP B;  1NSG B;  4DRH B;  1FAP B;  2RSE B;  1AUE A;  3FAP B;  2FAP B; 
#chains in the Genus database with same CATH topology
 4XQ1 A;  2B0J A;  3RVY A;  3C8G A;  1PCX A;  3GOD A;  3JRT A;  4G7H F;  3KL4 A;  1XWJ A;  3I5P A;  4FWV A;  4U5D E;  3EZH A;  4EBK A;  2HUJ A;  3RYL A;  2LD6 A;  5KYX A;  3ABM C;  4JCZ A;  1TWC A;  5CIV A;  2I15 A;  5T3W A;  4Z9I A;  3GWL A;  1TWH A;  2A69 F;  2HJ3 A;  2W9Y A;  2YL7 A;  4EBJ A;  4XLP F;  1G4W R;  3DD7 A;  1FFH A;  3QTH A;  3AG1 C;  3DJN B;  4DVY P;  3LLK A;  2H7O A;  4MQ9 F;  2BC5 A;  4U9E A;  3SEO A;  1ZW3 A;  4YL0 A;  3U8V A;  2W4B A;  3TJ5 A;  3HTK C;  3NRH A;  3RFY A;  3UNG C;  1L7C A;  2Y39 A;  4XLN F;  4CS9 C;  4JEA A;  3T6B A;  2H7B A;  2HFI A;  1ZU5 A;  4YWQ A;  4MS2 A;  2JD3 A;  3I5Q A;  4YL1 A;  2HV6 A;  4LDQ A;  3N0T A;  1HMD A;  1NSG B;  2A0U A;  2ZXO A;  1ZHZ A;  2HJM A;  1I4Z A;  1RKC A;  3DXJ F;  1V4A A;  2OEX A;  2Y69 C;  3FAP B;  3O10 A;  5KYX B;  1TQG A;  2R7U A;  1C02 A;  1BDJ B;  1QLE C;  1R5I D;  1NLX A;  3RF3 A;  1FMV A;  2L6G A;  1H6G A;  4EIY A;  3DMD A;  5JVE A;  2R7O A;  4IAQ A;  5L3Q A;  3AQC A;  1OCZ C;  5EHH A;  4LLC A;  1TFK B;  2XLV A;  3K1I C;  2PF4 E;  2RD9 A;  1ORY A;  3S29 A;  4CJG A;  3VM6 A;  1ZW2 A;  2AP3 A;  3GEI A;  3OWT A;  4NTF A;  4BPM A;  5DS4 A;  1E86 A;  4MW3 A;  3EFO A;  3U3B A;  1CGO A;  3K1H A;  1RJ9 A;  1LVK A;  5F28 E;  2VAS A;  2H8A A;  4J7Y A;  3DKA A;  3TJ6 A;  3NYM A;  3SP1 A;  4LER A;  3GAN A;  3DZA A;  3N2Z B;  1EI7 A;  4EBB A;  4G7Z F;  3G4Z A;  4MVO A;  1J8Y F;  4CBE A;  3FMS A;  1APC A;  2J8W A;  2KW3 C;  3ZTM A;  4AK9 A;  3EJN A;  3KH2 A;  2YWA A;  3N24 A;  5EK0 A;  2NPU A;  3M79 A;  1A0B A;  1Z23 A;  5AGF A;  4CIH A;  3GM2 A;  3WOD F;  3UGO A;  4YT8 A;  1TWG A;  2EPN A;  3GEE A;  1NFN A;  4MVZ A;  3RQG A;  3U5S A;  2NUT B;  2QUP A;  3DJU B;  1FTS A;  3IHU A;  3R7C A;  3LEV A;  3ASN C;  2F22 A;  3AQB A;  4H54 A;  3V5X A;  3GM1 A;  1V54 C;  3KYI A;  3W2W A;  3H65 A;  4K0D A;  2OJQ A;  2PNO A;  4OIQ F;  2XRH A;  4FX5 A;  1Q0G A;  4ZLC A;  2XXA A;  3EFO B;  1EQ1 A;  4NTB A;  2Q9B A;  4K7B A;  4JE9 A;  2AWC A;  3SXK A;  3PHF 2;  3JSZ A;  1ST6 A;  4E17 A;  4C3E A;  1LI5 A;  4XEK A;  4EUK B;  3RQE A;  4DJ9 A;  3G50 A;  2CDQ A;  2B0H A;  4I1M A;  3F46 A;  3SNH A;  3TUL A;  4DRJ B;  1U89 A;  2J7P D;  1T9K A;  1LE2 A;  3GEH A;  5L0D A;  3C18 A;  3OEO A;  4JKV A;  4XEF A;  2XM0 A;  2XLE A;  2R7R A;  3EPV A;  4XEV A;  3M15 A;  3WAQ A;  2XLO A;  4B6I A;  4CDA A;  3C62 A;  1WWP A;  3DI5 A;  5D92 A;  5T1D B;  4JUR I;  1AEP A;  1YA9 A;  4MTO A;  2R03 A;  3AGT A;  4MW8 A;  4PK4 A;  4Z9J A;  1M2V A;  4I3M A;  4IWB A;  1QVX A;  2XXA B;  4DBR A;  5L0H A;  1JOG A;  2QTV A;  3FOO A;  1O3U A;  1Q0M A;  1UFB A;  3A9C A;  2V26 A;  3IQ5 A;  3MX3 A;  1ZHT A;  4M63 A;  5JRA A;  256B A;  3E9V A;  3HNK A;  4ULV A;  1D1B A;  1FMW A;  3SZR A;  1YVI A;  5A6A A;  1Y6D A;  4LLE A;  4BJT A;  3JSE O;  3V7O A;  2EPM X;  4N6H A;  4XWJ A;  3X1O A;  2VC9 A;  3B0P A;  3JTL O;  4U5G A;  4AE4 B;  4JCH A;  2ZXP A;  1O5H A;  5GPG B;  2HKV A;  2Q9C A;  2LCH A;  3MYI A;  1FR0 A;  4UDV A;  1NU7 D;  5AC5 A;  1MNE A;  2EIJ C;  1TWA A;  1ZYR F;  2EIK C;  1K05 A;  2Y3H A;  4GEH A;  2UUI A;  1MQV A;  5L0F A;  3KYJ A;  3EG9 B;  1YAR O;  3ABL C;  3B9Q A;  4JIO A;  2OJE D;  4KI2 A;  1S7Z A;  1BR4 A;  1J8M F;  3H2V A;  2EPO A;  2X51 A;  4U5C E;  5EGY A;  1ZHX A;  3I4U A;  1ORS C;  2YVK A;  3EHM A;  3L34 A;  3IPM O;  3POV A;  2XS1 A;  1HW1 A;  4N06 A;  1B68 A;  5BQI A;  4CIP A;  2KJG A;  4YT4 A;  5F5H A;  1BR2 A;  2FGY A;  1Z63 A;  1OCC C;  4JJG A;  3G4X A;  3UR3 C;  3U9M A;  5KYW B;  1JPJ A;  4OD4 A;  2EPL X;  4ZLD A;  3OA1 A;  4N6C A;  3B0U X;  1BR1 A;  2Y3D A;  2IYL D;  3TQO A;  4IB4 A;  1XZQ A;  1HMO A;  4KNV A;  3O55 A;  2HMZ A;  2Q00 A;  2LFD A;  3S9O A;  1JR8 A;  2HZ8 A;  3FOP A;  1LS1 A;  3ITF A;  4P9F A;  4RBN A;  2PX3 A;  2R7Q A;  3J06 A;  4X0R A;  3RW0 A;  4DOZ A;  2DYR C;  4CDV A;  3JRM O;  2YEV A;  2DI3 A;  1M56 C;  2VCC A;  1E2X A;  5F5F A;  2XLW A;  1NZE A;  3RH3 A;  4AL0 A;  1OR2 A;  4JTA B;  1OXB A;  1QPU A;  2WB7 A;  5B3I A;  2VB6 A;  2ZXR A;  3GM3 A;  2OU6 A;  3NKD A;  4JC7 A;  4R32 A;  3S0X A;  1VK5 A;  2DGJ A;  2KYH A;  3AGU A;  3Q7G A;  2NSF A;  4IAO A;  5CI8 A;  5A6B A;  3L1M A;  2A6E F;  1CGN A;  1D1C A;  1T5O A;  5E3C A;  4OIO F;  4U5B E;  5D91 A;  5L0J A;  1QQ3 A;  2WZG A;  1OKK D;  2VCA A;  3K6B A;  4PJL A;  4XPW A;  1GM5 A;  2V3C C;  2R7X A;  1AVO B;  4QI2 A;  2H7V C;  3NYJ A;  2QE9 A;  2MWQ A;  1D1A A;  2NUT A;  1QZX A;  3VAY A;  3LAY A;  4C3B A;  2JX0 A;  3FDQ A;  1T6I A;  1N1C A;  2CCY A;  3QZC A;  3H2U A;  1LE4 A;  3AG2 C;  3QW1 A;  2J9W A;  4U5F E;  1KTM A;  2J7P A;  2E87 A;  1OW6 A;  2YL3 A;  3RKO F;  2OOC A;  1H9G A;  1RKE B;  4BJ1 A;  1OW8 A;  1VYI A;  1EA8 A;  3SXM A;  1IZM A;  2IXO A;  1V74 B;  4MVS A;  1E84 A;  2J45 A;  4D4X A;  2VCB A;  2YQY A;  4O6Y A;  4CSA A;  5L0C A;  4OIR F;  3QW0 A;  3CZ6 A;  4XTK A;  3W8H A;  2GDC A;  4BEJ A;  2ETS A;  3AJM A;  2R7W A;  3U3F A;  2CGE A;  1MMA A;  1M57 C;  3C8G D;  3MFN A;  4YJW A;  5DS5 A;  4NY3 A;  2OCC C;  4Q7C A;  1JAF A;  3S27 A;  5B1A C;  1UG7 A;  4FAP B;  3TK0 A;  5DQT A;  3M1C B;  1L3P A;  5HSW A;  2D4U A;  4KC9 A;  5L0G A;  3UMK A;  4DBQ A;  3L0I A;  4PFO A;  2XLH A;  1ZHY A;  3CSK A;  1R4T A;  2Y3B A;  2YLI A;  2GFH A;  2OKU A;  3E70 C;  4YK5 A;  2NSG A;  3ZC4 A;  4AX2 A;  3B0V C;  4W8K A;  1E85 A;  3UMI A;  2FFH A;  2HSB A;  5KYU A;  2IBF A;  1YLM A;  3M4C A;  1G8X A;  1Q0D A;  3HNL A;  3GOR A;  3HLZ A;  3JCU Q;  3U8P A;  1MMD A;  2J9B A;  5TJ5 E;  1JRA A;  1ZHW A;  2R9R B;  1PD1 A;  2NUP A;  4WAB A;  3RIP A;  3X2Q C;  4AE4 A;  2KGO A;  2UUH A;  1RCP A;  1SYQ A;  1WAS A;  2KQ9 A;  1VLS A;  2WVN A;  2MYS A;  2Q3T A;  4NCQ A;  4CS7 A;  1EKY A;  4W8P A;  4P9T A;  1GS9 A;  1BZ4 A;  2XL4 A;  1T6U A;  2A68 F;  3EG9 A;  3IQT A;  5FZT A;  4BJ6 A;  2XL8 A;  4MVM A;  4LAC B;  2A6H F;  2W4M A;  3KMI A;  4XPX A;  3B71 A;  1OCR C;  4QI0 A;  5BQG A;  5A6K A;  4IGG A;  2R7S A;  3Q7L A;  4JTC B;  4H4K C;  4IRU A;  2R02 A;  1H7I A;  4BEM J;  2Q7R A;  2OQM A;  3K33 A;  5KYU B;  5B1B C;  1Z6A A;  5AC4 A;  5KYW A;  3U2L A;  4U5E E;  4NTA A;  2PBE A;  3ZWI A;  4YT2 A;  4OIP F;  3ZTZ A;  2NUP B;  2LIG A;  4PAC A;  2HMQ A;  2Q4F A;  2R05 A;  3DAG A;  1NG1 A;  4HE8 D;  4JTD B;  4A4A A;  1M2O A;  2J0X A;  2W45 A;  5JSL A;  5COF A;  3WG7 C;  3BEH A;  3LS0 A;  1JPN A;  3O6X A;  2R7T A;  4RDA A;  3RQF A;  1LIH A;  4N4W A;  4IAR A;  2HS5 A;  1S05 A;  2WVQ A;  2YL0 A;  1OQC A;  2ICW G;  4U9D A;  1A7V A;  4JZA A;  2KNH A;  1W2W A;  1ZU4 A;  1I4Y A;  1A41 A;  2I8B A;  2XLM A;  3MBG A;  3ZDL A;  1OKK A;  3MYF A;  3V5Y A;  1G5Z A;  3R2P A;  4CX9 A;  3ECS A;  4DRI B;  5DQZ A;  2J9U A;  2ASR A;  3ASO C;  3HNJ A;  4G7O F;  3SYN A;  2OG2 A;  3US6 A;  1O87 A;  3VRC A;  5JLI A;  4AL1 A;  3S28 A;  1A7E A;  2EIL C;  2YLG A;  3U2M A;  2L81 A;  3ZIB A;  2Q9A A;  1VB5 A;  1LKX A;  3IEE A;  4BJ5 A;  4HFK B;  2YZS A;  1TKN A;  3EHN A;  1VYK A;  3ZQV A;  1H9T A;  3DAF A;  3SXY A;  2WVO A;  4E7Z A;  3M4B A;  3ZG1 A;  3K7D A;  4QDL A;  2TMV P;  3L8J A;  3S84 A;  1PV3 A;  3EGD A;  3TOM A;  4XPY A;  3Q6N A;  1QKR A;  4O6N A;  5JT4 A;  1VMA A;  4JVS A;  3V5Z A;  2R25 A;  1GQA A;  4CSA C;  3PMR A;  3JYH A;  1ZZP A;  4YN0 B;  1YYJ A;  2PP4 A;  2RSE B;  2Z15 A;  4Z9H A;  3VF0 A;  3DE9 A;  4IJJ A;  2IM8 A;  3A11 A;  1Q0F A;  1RKE A;  2YLD A;  3B29 A;  2XL6 A;  3GWN A;  3NYL A;  3QMK A;  2CNW D;  4MVU A;  4NQF A;  4PR9 A;  1MND A;  2PFD A;  2ZPA A;  4PJN A;  1YZC A;  2CW0 F;  3W2V A;  1NU9 C;  2P7V A;  1VLT A;  1FNT c;  2XSE A;  2LFF A;  3T6J A;  3RVZ A;  4Q4Z F;  1D0X A;  1MMN A;  3EGX A;  5KYN A;  4J30 B;  3UMH A;  1Q0K A;  3JT1 A;  2KC3 A;  1U6H A;  4A2N B;  2A0B A;  2AWY A;  1DOW A;  3EGD B;  3EQL F;  5COG A;  4E7S A;  2YRF A;  4J32 B;  5IY5 C;  4K1O A;  2HV7 A;  4ANJ A;  5BQH A;  1RXQ A;  1T6Q A;  2LP4 A;  4WGZ A;  1Z7Q c;  1VTM P;  2AU5 A;  3DM5 A;  3LES A;  4C3D A;  3HNI A;  3EH1 A;  3S90 A;  1WOL A;  4DRH B;  3T9O A;  2YHS A;  5B3S C;  3LJB A;  5A69 A;  3PDM P;  4EWC A;  3C8G B;  3DM9 B;  4O7G A;  4DVZ A;  1OCO C;  4RD9 A;  1U0B B;  2GA0 A;  2PX0 A;  4LDR A;  4CS8 A;  3FXH A;  2BL2 A;  3CAX A;  2DYS C;  4JEB A;  4FES A;  3SXZ A;  4C7O A;  1YYX A;  1JMW A;  4BJ6 C;  4JRZ A;  1ZVZ A;  4ONS A;  2LK4 A;  1Y4C A;  3JYY A;  5A6J A;  4CDY A;  3T6G B;  1HW2 A;  1CPR A;  3EGX B;  1GGQ A;  1LPE A;  4I1O B;  3C7J A;  2L6F A;  2NG1 A;  2WZL A;  4WGY A;  4OIN F;  3DE8 A;  2GAQ A;  1TFO B;  1YZA A;  3Q6M A;  2XLD A;  5T3T A;  3NMI A;  5KYY A;  1VOM A;  5CI9 A;  1C03 A;  3EH2 A;  4CJO A;  1F1M A;  2Y3G A;  3W4Y A;  2ZD9 A;  4YT5 A;  5E3A A;  1D0Z A;  3U9J A;  2G3V A;  3C8Z A;  3QVZ A;  2QY9 A;  1FFT C;  1WAT A;  2EIN C;  4E0H A;  3PCV A;  3AG4 C;  1YA7 O;  3TD7 A;  3LNR A;  1ORJ A;  4BG0 A;  2J0W A;  3CEX A;  3TOL A;  3NMJ A;  1WTY A;  3MLG A;  5L0I A;  4MVR A;  1WN0 A;  2IOQ A;  4C7O B;  2G62 A;  1BBH A;  4CS9 A;  4PFP A;  3JZ0 A;  5E2Q A;  3VYW A;  4D4N A;  2HSQ A;  2J46 A;  1SZI A;  3O39 A;  3ZQY A;  3U0C A;  1M6T A;  2CYD A;  5A6B D;  1I5N A;  3NDB B;  2XS8 A;  5DS6 A;  1WGW A;  1HE9 A;  3KPH A;  5L3V A;  1MMG A;  5BUO A;  2R7V A;  5JS5 A;  2WZF A;  3UGP A;  5KYY B;  3CQZ A;  5COM A;  4L6R A;  1V55 C;  2EIM C;  1E83 A;  2X0C A;  1RJ9 B;  2QNL A;  1D0Y A;  1OR3 A;  1TR2 A;  1LI7 A;  1NBB A;  2MHR A;  2YL1 A;  3IQ6 A;  3KKB A;  3L8I A;  3ZVR A;  2L6H A;  4BJ5 C;  4DXW A;  1C17 M;  3HKK A;  3K1I A;  2FAP B;  4OD5 A;  1YJG A;  1YAU O;  3BRJ A;  1LS4 A;  4ULW A;  4F4B A;  3IQC A;  2LSE A;  1YDI A;  3FVY A;  3LS1 A;  1SF8 A;  4KNW A;  5HV9 A;  4HEA J;  3NKE A;  4U5H A;  2D5R B;  4EHP A;  4JJF A;  2IXP A;  1G4U S;  4LDK A;  4MTG A;  4O79 A;  1HY5 A;  3NG1 A;  1RMV A;  2M64 A;  1K40 A;  2A1D D;  5E33 A;  3ZSU A;  4Q5S F;  1Z3I X;  3AG3 C;  2GWW A;  2JPU A;  2LQG A;  4ER9 A;  4G0H A;  3LUT B;  1IW7 F;  2CNW A;  1CPQ A;  4PJJ A;  2AVK A;  1CGM E;  5K0I A;  2OEV A;  2KK1 A;  2ZXW C;  4MVQ A;  2IXM A;  1DOV A;  4GQH A;  4EKW A;  4I44 A;  2L9J A;  3HJC A;  5DVW A;  2EPK X;  2WL8 A;  1PD0 A;  1AUE A;  2KSF A;  2YKZ A;  2J9V A;  1K04 A;  4KBL A;  3FHD A;  1A7D A;  1Z5Z A;  3NMK A;  1OW7 A;  4MTF A;  4PJM A;  4G78 A;  2O9X A;  3FAJ A;  3T4R A;  4HFF B;  1SMY F;  1FAP B;  2M4E A;  3ATP A;  2P61 A;  3DWW A;  4J7T A;  5FCL A;  1OXK A;  2P1A A;  2C03 A;  2VH3 A;  4JW1 A;  4P6I C;  4YL3 A;  2G3K A;  3W8I A;  4E0I A;  2P0N A;  3AOU A;  5JP7 A;  1LM3 B;  5JUA A;  4NC3 A;  2IXN A;  1T01 A;  3LEO A;  1HE1 A;  3LNM B;  4E18 A;  3EZI A;  3ABK C;  4GYT A;  1M2V B;  2C04 A;  3F47 A;  3WHN A;  4CS8 C;  2P6V A;  3LLI A;  4MND A;  3QVY A;  1KU2 A;  2BE5 F;  2QLA A;  1XZP A;  4O6M A;  4WJ0 A;  2XM4 A;  5DLJ A;  1NFO A;  1SR2 A;  1KNY A;  2L7A A;  3C63 A;  3K66 A;  1QSP A;  2DB4 A; 
#chains in the Genus database with same CATH homology
 2NPU A;  5GPG B;  2GAQ A;  4DRJ B;  4DRI B;  4FAP B;  1NSG B;  4DRH B;  1FAP B;  2RSE B;  1AUE A;  3FAP B;  2FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...