4DRIB

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
GAMDPEFMEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 38
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4driB00
2FAPB 1AUEA 3FAPB 4FAPB 4DRJB 5GPGB 2GAQA 2RSEB 1FAPB 4DRIB 4DRHB 1NSGB 2NPUA
chains in the Genus database with same CATH superfamily
5KYWA 2LD6A 1C03A 1RCPA 3I5PA 5DQZA 4C3DA 1ZU4A 3GM1A 4LDRA 4PJJA 3WODF 3T6BA 3QMKA 5TJ5E 4Q4ZF 1R4TA 5A6AA 4CJOA 3JRMO 2WVNA 1HW2A 2YEVA 4IB4A 3TD7A 5B3IA 1Y6DA 3DXJF 2P1AA 3SZRA 3NYLA 1MMNA 1OKKD 3JCUQ 2J9UA 2YL1A 2M4EA 2WVQA 3B71A 4CIHA 2Q4FA 2R7QA 4BJTA 3J06A 5F28E 2OOCA 1OCZC 3MYFA 1Q0MA 2BE5F 3X2QC 1HMOA 4CDYA 2A0UA 4OIOF 1YDIA 1LS4A 2RD9A 2HFIA 4J7YA 2YLDA 4U5EE 3S28A 2PX3A 4PR9A 3WAQA 1Q0DA 4AX2A 3O55A 4P6IC 2QTVA 3UMKA 2G62A 4IAOA 5GPGB 2IOQA 2J7PD 2PNOA 1SF8A 1V55C 2GDCA 2OCCC 2CCYA 4IARA 4JC7A 3W2WA 3C63A 2LFFA 5AGFA 5L0DA 4U5FE 5KYYA 1QVXA 1Z3IX 2IXOA 4ULVA 2D5RB 4JJGA 5E3CA 1LE2A 2IYLD 4YT4A 3ZVRA 2EINC 3MFNA 2B0HA 2J0XA 4L6RA 2V26A 3GWNA 4MVSA 3M1CB 2R05A 3EZHA 3G4XA 3HKKA 5FZTA 3RQGA 2OKUA 2A6EF 5KYXA 3C8GA 4EWCA 3NYMA 1EA8A 2VC9A 1U89A 2YWAA 4DRIB 1TFOB 5E3AA 1NSGB 1Z6AA 1OCCC 2GWWA 3EJNA 4EIYA 1EKYA 5A6BA 3R7CA 2KW3C 4BEJA 1ZYRF 3W4YA 3DZAA 2LK4A 2IBFA 2A0BA 4U9DA 1ZW2A 1H9GA 3VAYA 4G7HF 3N24A 4RD9A 5D92A 4MVUA 4XLPF 4KI2A 4LDKA 1YA7O 3DKAA 4MVMA 4R32A 2XLOA 4RBNA 3U3FA 5BQIA 1AEPA 1UFBA 5JT4A 4PFOA 1I5NA 4C7OA 2EPMX 3B0VC 4U5GA 4FWVA 2A68F 1MMAA 3AOUA 3OA1A 3NDBB 3EHNA 4CDVA 3A11A 3DD7A 1RKEB 2PF4E 1CPRA 2Y69C 3IEEA 2HSQA 4EKWA 2DYSC 4ZLCA 4G7ZF 1QLEC 4JIOA 2RSEB 3M15A 4AK9A 1JRAA 2KYHA 3U9MA 3B9QA 2BL2A 1YVIA 2HS5A 1SYQA 4CS8A 3Q7GA 2ETSA 1MQVA 3E9VA 1Q0GA 3KYJA 3V5ZA 5L0JA 4QI2A 3KYIA 1I4ZA 1AVOB 1FMVA 2R02A 1UG7A 1S7ZA 2CNWA 2HMZA 4FESA 4DXWA 2EPKX 2JX0A 1QZXA 3LUTB 3ATPA 4OD4A 2WB7A 2CGEA 3LS1A 1ZHWA 2XL8A 3C8GD 1U0BB 2EPLX 3HLZA 4E7ZA 4G78A 2VASA 4LLEA 4LACB 3FOOA 4JURI 4QI0A 2J8WA 2KGOA 3RW0A 2WVOA 3H2UA 4DBQA 2A1DD 4NC3A 1ZHTA 1SR2A 1WWPA 4RDAA 4AE4A 5A6BD 4AL0A 5EGYA 4BJ5C 4KNVA 3DAFA 3EG9A 2NG1A 3EGXB 1ZU5A 2Y3BA 3ABKC 2YRFA 4LLCA 1D0ZA 3ZIBA 1M2VA 4B6IA 4DBRA 1EI7A 2NUTA 1QPUA 5KYUB 4I3MA 4JTDB 3A9CA 4JW1A 1C17M 4HEAJ 3FAJA 1BDJB 3K66A 1YYXA 1NZEA 1GQAA 3Q7LA 1OCOC 2LFDA 3K1HA 4I44A 3U2LA 2KNHA 1XZQA 3ASOC 5HSWA 5L3QA 4WGYA 3RF3A 3RH3A 3KKBA 3Q6MA 4EBBA 3GEIA 2KQ9A 5T3WA 1PV3A 5CIVA 1OXKA 2FAPB 1HMDA 2EIKC 2MHRA 2WZLA 3K33A 4E0HA 4JJFA 1JPNA 2DGJA 1CGOA 4YN0B 2J9WA 2XLHA 1YLMA 2EILC 3ABLC 3UGPA 4OIQF 2CNWD 2CYDA 1NG1A 3SP1A 2LCHA 2H7VC 3HNKA 3JYHA 2WL8A 3M4BA 1M2OA 5AC4A 2O9XA 2XXAA 3QW1A 4HFFB 4O7GA 5JRAA 3ZDLA 3IHUA 3MBGA 1T01A 3O10A 3ZG1A 1ORJA 1OR3A 3TQOA 1WATA 3TK0A 4Q7CA 2KJGA 1Z63A 4K0DA 2HZ8A 3IQ5A 4Q5SF 4BG0A 5CI9A 4BJ1A 1PCXA 1OQCA 3RKOF 3ZSUA 5F5FA 4H4KC 4F4BA 2Q00A 2Y3GA 1M57C 2P6VA 5IY5C 1U6HA 4D4XA 3PMRA 2F22A 2YL7A 3EQLF 4C3EA 1FMWA 4XEKA 3RIPA 1EQ1A 1XWJA 1VOMA 4EBJA 4OD5A 2HV7A 3DM9B 3OEOA 5DQTA 2EPOA 3PDMP 1SZIA 3C18A 3NRHA 1WGWA 2W4BA 2J0WA 2ZD9A 1ORSC 2A6HF 3JYYA 3JSZA 3DJNB 3FHDA 4K7BA 3WHNA 1RJ9B 3L1MA 2XM4A 1T9KA 1TR2A 2FGYA 4ONSA 4W8PA 1FNTc 2YZSA 3UNGC 1DOVA 2XRHA 3CZ6A 1E2XA 1PD1A 3I4UA 2AVKA 1H6GA 1BZ4A 4MTOA 4MVZA 1O5HA 2OU6A 4FAPB 1YYJA 3AG4C 3HJCA 3AQBA 1T6QA 3VM6A 1SMYF 4E7SA 1BBHA 4UDVA 3UMIA 3UGOA 2I15A 4DJ9A 3IPMO 2P0NA 4KNWA 3AG3C 4GYTA 3VYWA 2OQMA 3JRTA 1TWHA 3WG7C 2P7VA 4U5DE 3W8HA 1CGME 2R7TA 4MNDA 3LNRA 3K1IC 4P9FA 4GQHA 3LESA 1RKCA 1YARO 1ZZPA 1JAFA 1HW1A 2EIMC 3LJBA 3H65A 3NKEA 4U5BE 2HV6A 4WJ0A 3POVA 2HMQA 4I1OB 4BJ5A 1I4YA 2J46A 3H2VA 2LQGA 2J9VA 2ZXRA 4ULWA 1OW6A 2YLIA 5BQGA 4JEAA 1ST6A 1F1MA 1VYIA 3GWLA 1OW8A 4YWQA 2MWQA 3LEOA 1KU2A 2H8AA 1XZPA 2QY9A 2YVKA 2FFHA 4EUKB 4LDQA 2KSFA 2DYRC 3EFOB 3ECSA 4XWJA 2XM0A 1LE4A 1G8XA 4IJJA 1HE1A 1L7CA 3EGDB 3U5SA 1AUEA 2XLWA 2YLGA 3U9JA 4DVYP 3GANA 3HNIA 1FFTC 2ZXOA 1DOWA 3B29A 4O6MA 5JUAA 3AQCA 3SXZA 1E84A 2NUPB 2XLEA 3K7DA 4XTKA 4YK5A 4ANJA 1Z7Qc 4YJWA 4NY3A 1V4AA 2JPUA 5DVWA 2AWYA 3SXYA 3LLKA 2AWCA 2XSEA 3DM5A 3QVZA 3NMIA 1Y4CA 3FMSA 1PD0A 3M79A 3S29A 5T1DB 1LI7A 1O3UA 3VF0A 1LS1A 4AL1A 3F46A 4N6HA 3U3BA 3V5YA 1WTYA 3DWWA 5JS5A 2ZPAA 4CIPA 2ZXWC 3JZ0A 5A6JA 4PK4A 5DS4A 1MNEA 2W45A 2DI3A 2VCCA 5EK0A 3TOLA 3HNLA 4PFPA 1MMDA 1BR2A 2L6GA 2PP4A 1E86A 3EG9B 2R7XA 2CW0F 4MW3A 1K05A 3ZWIA 3E70C 1BR1A 4E17A 1CGNA 3DE9A 2LIGA 3Q6NA 3SXKA 1MNDA 3T4RA 5A69A 1ZVZA 4MQ9F 4IGGA 5B1BC 2IXNA 3ITFA 3TULA 1A7VA 4JVSA 4XPXA 4WABA 1JOGA 2XS1A 2Y3DA 4JE9A 2Q9AA 4LERA 5JP7A 1HY5A 3FVYA 4DVZA 2MYSA 3ZQVA 1YZCA 1JR8A 4KBLA 2B0JA 2Z15A 3DI5A 2OG2A 3NKDA 4MVOA 1D1CA 1T6IA 4IWBA 3ZC4A 1VYKA 3NMKA 1S05A 2C04A 3LNMB 3US6A 1LKXA 1D1AA 3EGXA 3KL4A 4WGZA 3SEOA 3T6JA 4D4NA 5L0HA 2XXAB 3TJ5A 2NSGA 5L0IA 4A2NB 4CJGA 4NQFA 1K40A 3K6BA 4PJLA 4JCZA 4YL3A 5KYUA 3T6GB 1OKKA 2YL3A 1H9TA 2C03A 4E18A 5COGA 4JRZA 3SYNA 5KYWB 3RYLA 2J45A 3K1IA 4W8KA 3NG1A 3UR3C 1OXBA 4OIRF 2Y3HA 2YL0A 4PJMA 3GORA 4XEVA 5JLIA 4OIPF 1YJGA 3U2MA 3MYIA 5E2QA 1J8YF 2YHSA 3UMHA 3GM3A 4JEBA 4N6CA 5E33A 2R03A 1WASA 2P61A 3L8JA 3QZCA 2VCAA 2PFDA 3GODA 3S9OA 4U5CE 4HFKB 4Z9HA 1OR2A 4MVQA 5DS5A 1T5OA 1VB5A 2VCBA 1FFHA 4XQ1A 3SNHA 5F5HA 2M64A 4C3BA 2R7VA 3V7OA 4GEHA 3S27A 3QVYA 2HJMA 1YAUO 3IQTA 3MX3A 4J7TA 3G50A 4XPYA 5AC5A 2W4MA 1GS9A 2R7SA 4MW8A 4O6NA 1TKNA 4BPMA 3KMIA 3EH1A 1ZHZA 2IXPA 4U9EA 1NLXA 5JVEA 5B1AC 3SXMA 1T6UA 5KYYB 1B68A 2LP4A 1A41A 3W8IA 4CX9A 2OEVA 3RQFA 1G4WR 3CAXA 1CPQA 2QE9A 5JSLA 1JMWA 1RXQA 2V3CC 4NCQA 2AP3A 1GGQA 3C62A 2VB6A 4X0RA 2R25A 4XEFA 2L7AA 2PBEA 4PACA 3C8GB 5KYXB 4JZAA 3DE8A 3AGUA 3LEVA 1WN0A 5L0GA 4YL0A 1LVKA 2ASRA 1TWCA 4CS9A 2XL6A 2W9YA 2HSBA 1LM3B 2XLVA 3S0XA 2HUJA 1D1BA 5COFA 1RJ9A 3QTHA 3HNJA 4NTFA 2Q7RA 2X0CA 2OJED 4MVRA 2OJQA 1G5ZA 5DS6A 3EPVA 1LPEA 2R7WA 3RFYA 3AG2C 3JTLO 3IQCA 4CSAC 4BEMJ 2UUIA 4C7OB 1NBBA 2Q9BA 4G0HA 1LIHA 3CEXA 3R2PA 1Q0KA 4EBKA 4M63A 4U5HA 1VTMP 4XPWA 1VLSA 3CSKA 3L0IA 2BC5A 4NTAA 4O6YA 4EHPA 1KTMA 3EHMA 3U0CA 2A69F 2GAQA 2GFHA 2VH3A 3FOPA 3TJ6A 1VMAA 3HTKC 2KC3A 1IW7F 3NYJA 3F47A 4FX5A 2J9BA 1A7EA 3KH2A 1R5ID 1ZHYA 2DB4A 1QSPA 4K1OA 4DRJB 4CDAA 2XL4A 1VLTA 256BA 3CQZA 4BJ6A 1N1CA 3FDQA 2NPUA 5KYNA 2R9RB 1TWGA 4DOZA 1MMGA 4IAQA 1APCA 1E85A 1RMVA 2X51A 2NSFA 3S90A 1FR0A 3ABMC 1KNYA 4H54A 4Z9JA 2L6HA 5K0IA 2Q9CA 2QLAA 3PHF2 1YZAA 2CDQA 3EFOA 3M4CA 1OCRC 2HJ3A 5COMA 3V5XA 3LLIA 1GM5A 1O87A 1JPJA 3EGDA 4CS9C 4AE4B 1RKEA 3B0PA 3DJUB 3B0UX 5A6KA 2UUHA 2R7UA 2ICWG 3LS0A 1TFKB 2OEXA 1M56C 4MTFA 2H7OA 3RVZA 2NUPA 3T9OA 1ZW3A 4N4WA 3IQ6A 1M2VB 4CS7A 3BEHA 2NUTB 2ZXPA 1E83A 2LSEA 1FAPB 4J32B 1IZMA 2GA0A 3U8PA 2R7OA 4JCHA 4JTAB 1OW7A 4YT8A 3LAYA 5B3SC 4JTCB 5L0FA 4MTGA 1J8MF 3ZTZA 3S84A 2R7RA 3N0TA 2G3KA 1FTSA 4Z9IA 4J30B 1A0BA 2YKZA 2L9JA 2Q3TA 2WZFA 3KPHA 4G7OF 3L34A 3X1OA 2EPNA 1NFOA 3QW0A 2H7BA 2KK1A 3G4ZA 3O6XA 4O79A 2PX0A 2Y39A 3C7JA 3NMJA 3RVYA 4PJNA 5BQHA 4A4AA 1C02A 2XLMA 4N06A 3O39A 5DLJA 5CI8A 3JT1A 1K04A 3JSEO 4QDLA 3GEEA 5D91A 3EZIA 4XLNF 1D0YA 5T3TA 4BJ6C 4E0IA 5L0CA 2XLDA 4MS2A 3ZQYA 4ER9A 2QNLA 2L6FA 1WOLA 3DAGA 3DMDA 3GEHA 4IRUA 3ZTMA 4YT2A 1QKRA 2QUPA 1H7IA 4KC9A 1BR4A 3VRCA 1NFNA 1HE9A 2I8BA 4JKVA 2IM8A 3N2ZB 1A7DA 3OWTA 5BUOA 5HV9A 2IXMA 1VK5A 2EIJC 5EHHA 5FCLA 3FXHA 4P9TA 2TMVP 4I1MA 3L8IA 1TQGA 4YL1A 3C8ZA 3U8VA 1ORYA 4CS8C 2G3VA 1D0XA 3W2VA 4DRHB 1M6TA 3ASNC 1L3PA 2JD3A 2XS8A 3I5QA 1NU9C 3PCVA 1TWAA 1Z23A 2J7PA 3TOMA 1YA9A 2E87A 1G4US 3AG1C 4CSAA 2WZGA 1QQ3A 1V54C 3MLGA 2D4UA 4NTBA 5L3VA 2YQYA 4YT5A 3BRJA 3EH2A 3RQEA 3FAPB 1NU7D 1V74B 4ZLDA 4HE8D 1W2WA 3AGTA 3AJMA 1ZHXA 1Z5ZA 2HKVA 2L81A 4CBEA 1Q0FA 3GM2A 2AU5A 1LI5A 4OINF
chains in the Genus database with same CATH topology
2FAPB 1AUEA 3FAPB 4FAPB 4DRJB 5GPGB 2GAQA 2RSEB 1FAPB 4DRIB 4DRHB 1NSGB 2NPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP B;  1AUE A;  3FAP B;  4FAP B;  4DRJ B;  5GPG B;  2GAQ A;  2RSE B;  1FAP B;  4DRI B;  4DRH B;  1NSG B;  2NPU A; 
#chains in the Genus database with same CATH topology
 5KYW A;  2LD6 A;  1C03 A;  1RCP A;  3I5P A;  5DQZ A;  4C3D A;  1ZU4 A;  3GM1 A;  4LDR A;  4PJJ A;  3WOD F;  3T6B A;  3QMK A;  5TJ5 E;  4Q4Z F;  1R4T A;  5A6A A;  4CJO A;  3JRM O;  2WVN A;  1HW2 A;  2YEV A;  4IB4 A;  3TD7 A;  5B3I A;  1Y6D A;  3DXJ F;  2P1A A;  3SZR A;  3NYL A;  1MMN A;  1OKK D;  3JCU Q;  2J9U A;  2YL1 A;  2M4E A;  2WVQ A;  3B71 A;  4CIH A;  2Q4F A;  2R7Q A;  4BJT A;  3J06 A;  5F28 E;  2OOC A;  1OCZ C;  3MYF A;  1Q0M A;  2BE5 F;  3X2Q C;  1HMO A;  4CDY A;  2A0U A;  4OIO F;  1YDI A;  1LS4 A;  2RD9 A;  2HFI A;  4J7Y A;  2YLD A;  4U5E E;  3S28 A;  2PX3 A;  4PR9 A;  3WAQ A;  1Q0D A;  4AX2 A;  3O55 A;  4P6I C;  2QTV A;  3UMK A;  2G62 A;  4IAO A;  5GPG B;  2IOQ A;  2J7P D;  2PNO A;  1SF8 A;  1V55 C;  2GDC A;  2OCC C;  2CCY A;  4IAR A;  4JC7 A;  3W2W A;  3C63 A;  2LFF A;  5AGF A;  5L0D A;  4U5F E;  5KYY A;  1QVX A;  1Z3I X;  2IXO A;  4ULV A;  2D5R B;  4JJG A;  5E3C A;  1LE2 A;  2IYL D;  4YT4 A;  3ZVR A;  2EIN C;  3MFN A;  2B0H A;  2J0X A;  4L6R A;  2V26 A;  3GWN A;  4MVS A;  3M1C B;  2R05 A;  3EZH A;  3G4X A;  3HKK A;  5FZT A;  3RQG A;  2OKU A;  2A6E F;  5KYX A;  3C8G A;  4EWC A;  3NYM A;  1EA8 A;  2VC9 A;  1U89 A;  2YWA A;  4DRI B;  1TFO B;  5E3A A;  1NSG B;  1Z6A A;  1OCC C;  2GWW A;  3EJN A;  4EIY A;  1EKY A;  5A6B A;  3R7C A;  2KW3 C;  4BEJ A;  1ZYR F;  3W4Y A;  3DZA A;  2LK4 A;  2IBF A;  2A0B A;  4U9D A;  1ZW2 A;  1H9G A;  3VAY A;  4G7H F;  3N24 A;  4RD9 A;  5D92 A;  4MVU A;  4XLP F;  4KI2 A;  4LDK A;  1YA7 O;  3DKA A;  4MVM A;  4R32 A;  2XLO A;  4RBN A;  3U3F A;  5BQI A;  1AEP A;  1UFB A;  5JT4 A;  4PFO A;  1I5N A;  4C7O A;  2EPM X;  3B0V C;  4U5G A;  4FWV A;  2A68 F;  1MMA A;  3AOU A;  3OA1 A;  3NDB B;  3EHN A;  4CDV A;  3A11 A;  3DD7 A;  1RKE B;  2PF4 E;  1CPR A;  2Y69 C;  3IEE A;  2HSQ A;  4EKW A;  2DYS C;  4ZLC A;  4G7Z F;  1QLE C;  4JIO A;  2RSE B;  3M15 A;  4AK9 A;  1JRA A;  2KYH A;  3U9M A;  3B9Q A;  2BL2 A;  1YVI A;  2HS5 A;  1SYQ A;  4CS8 A;  3Q7G A;  2ETS A;  1MQV A;  3E9V A;  1Q0G A;  3KYJ A;  3V5Z A;  5L0J A;  4QI2 A;  3KYI A;  1I4Z A;  1AVO B;  1FMV A;  2R02 A;  1UG7 A;  1S7Z A;  2CNW A;  2HMZ A;  4FES A;  4DXW A;  2EPK X;  2JX0 A;  1QZX A;  3LUT B;  3ATP A;  4OD4 A;  2WB7 A;  2CGE A;  3LS1 A;  1ZHW A;  2XL8 A;  3C8G D;  1U0B B;  2EPL X;  3HLZ A;  4E7Z A;  4G78 A;  2VAS A;  4LLE A;  4LAC B;  3FOO A;  4JUR I;  4QI0 A;  2J8W A;  2KGO A;  3RW0 A;  2WVO A;  3H2U A;  4DBQ A;  2A1D D;  4NC3 A;  1ZHT A;  1SR2 A;  1WWP A;  4RDA A;  4AE4 A;  5A6B D;  4AL0 A;  5EGY A;  4BJ5 C;  4KNV A;  3DAF A;  3EG9 A;  2NG1 A;  3EGX B;  1ZU5 A;  2Y3B A;  3ABK C;  2YRF A;  4LLC A;  1D0Z A;  3ZIB A;  1M2V A;  4B6I A;  4DBR A;  1EI7 A;  2NUT A;  1QPU A;  5KYU B;  4I3M A;  4JTD B;  3A9C A;  4JW1 A;  1C17 M;  4HEA J;  3FAJ A;  1BDJ B;  3K66 A;  1YYX A;  1NZE A;  1GQA A;  3Q7L A;  1OCO C;  2LFD A;  3K1H A;  4I44 A;  3U2L A;  2KNH A;  1XZQ A;  3ASO C;  5HSW A;  5L3Q A;  4WGY A;  3RF3 A;  3RH3 A;  3KKB A;  3Q6M A;  4EBB A;  3GEI A;  2KQ9 A;  5T3W A;  1PV3 A;  5CIV A;  1OXK A;  2FAP B;  1HMD A;  2EIK C;  2MHR A;  2WZL A;  3K33 A;  4E0H A;  4JJF A;  1JPN A;  2DGJ A;  1CGO A;  4YN0 B;  2J9W A;  2XLH A;  1YLM A;  2EIL C;  3ABL C;  3UGP A;  4OIQ F;  2CNW D;  2CYD A;  1NG1 A;  3SP1 A;  2LCH A;  2H7V C;  3HNK A;  3JYH A;  2WL8 A;  3M4B A;  1M2O A;  5AC4 A;  2O9X A;  2XXA A;  3QW1 A;  4HFF B;  4O7G A;  5JRA A;  3ZDL A;  3IHU A;  3MBG A;  1T01 A;  3O10 A;  3ZG1 A;  1ORJ A;  1OR3 A;  3TQO A;  1WAT A;  3TK0 A;  4Q7C A;  2KJG A;  1Z63 A;  4K0D A;  2HZ8 A;  3IQ5 A;  4Q5S F;  4BG0 A;  5CI9 A;  4BJ1 A;  1PCX A;  1OQC A;  3RKO F;  3ZSU A;  5F5F A;  4H4K C;  4F4B A;  2Q00 A;  2Y3G A;  1M57 C;  2P6V A;  5IY5 C;  1U6H A;  4D4X A;  3PMR A;  2F22 A;  2YL7 A;  3EQL F;  4C3E A;  1FMW A;  4XEK A;  3RIP A;  1EQ1 A;  1XWJ A;  1VOM A;  4EBJ A;  4OD5 A;  2HV7 A;  3DM9 B;  3OEO A;  5DQT A;  2EPO A;  3PDM P;  1SZI A;  3C18 A;  3NRH A;  1WGW A;  2W4B A;  2J0W A;  2ZD9 A;  1ORS C;  2A6H F;  3JYY A;  3JSZ A;  3DJN B;  3FHD A;  4K7B A;  3WHN A;  1RJ9 B;  3L1M A;  2XM4 A;  1T9K A;  1TR2 A;  2FGY A;  4ONS A;  4W8P A;  1FNT c;  2YZS A;  3UNG C;  1DOV A;  2XRH A;  3CZ6 A;  1E2X A;  1PD1 A;  3I4U A;  2AVK A;  1H6G A;  1BZ4 A;  4MTO A;  4MVZ A;  1O5H A;  2OU6 A;  4FAP B;  1YYJ A;  3AG4 C;  3HJC A;  3AQB A;  1T6Q A;  3VM6 A;  1SMY F;  4E7S A;  1BBH A;  4UDV A;  3UMI A;  3UGO A;  2I15 A;  4DJ9 A;  3IPM O;  2P0N A;  4KNW A;  3AG3 C;  4GYT A;  3VYW A;  2OQM A;  3JRT A;  1TWH A;  3WG7 C;  2P7V A;  4U5D E;  3W8H A;  1CGM E;  2R7T A;  4MND A;  3LNR A;  3K1I C;  4P9F A;  4GQH A;  3LES A;  1RKC A;  1YAR O;  1ZZP A;  1JAF A;  1HW1 A;  2EIM C;  3LJB A;  3H65 A;  3NKE A;  4U5B E;  2HV6 A;  4WJ0 A;  3POV A;  2HMQ A;  4I1O B;  4BJ5 A;  1I4Y A;  2J46 A;  3H2V A;  2LQG A;  2J9V A;  2ZXR A;  4ULW A;  1OW6 A;  2YLI A;  5BQG A;  4JEA A;  1ST6 A;  1F1M A;  1VYI A;  3GWL A;  1OW8 A;  4YWQ A;  2MWQ A;  3LEO A;  1KU2 A;  2H8A A;  1XZP A;  2QY9 A;  2YVK A;  2FFH A;  4EUK B;  4LDQ A;  2KSF A;  2DYR C;  3EFO B;  3ECS A;  4XWJ A;  2XM0 A;  1LE4 A;  1G8X A;  4IJJ A;  1HE1 A;  1L7C A;  3EGD B;  3U5S A;  1AUE A;  2XLW A;  2YLG A;  3U9J A;  4DVY P;  3GAN A;  3HNI A;  1FFT C;  2ZXO A;  1DOW A;  3B29 A;  4O6M A;  5JUA A;  3AQC A;  3SXZ A;  1E84 A;  2NUP B;  2XLE A;  3K7D A;  4XTK A;  4YK5 A;  4ANJ A;  1Z7Q c;  4YJW A;  4NY3 A;  1V4A A;  2JPU A;  5DVW A;  2AWY A;  3SXY A;  3LLK A;  2AWC A;  2XSE A;  3DM5 A;  3QVZ A;  3NMI A;  1Y4C A;  3FMS A;  1PD0 A;  3M79 A;  3S29 A;  5T1D B;  1LI7 A;  1O3U A;  3VF0 A;  1LS1 A;  4AL1 A;  3F46 A;  4N6H A;  3U3B A;  3V5Y A;  1WTY A;  3DWW A;  5JS5 A;  2ZPA A;  4CIP A;  2ZXW C;  3JZ0 A;  5A6J A;  4PK4 A;  5DS4 A;  1MNE A;  2W45 A;  2DI3 A;  2VCC A;  5EK0 A;  3TOL A;  3HNL A;  4PFP A;  1MMD A;  1BR2 A;  2L6G A;  2PP4 A;  1E86 A;  3EG9 B;  2R7X A;  2CW0 F;  4MW3 A;  1K05 A;  3ZWI A;  3E70 C;  1BR1 A;  4E17 A;  1CGN A;  3DE9 A;  2LIG A;  3Q6N A;  3SXK A;  1MND A;  3T4R A;  5A69 A;  1ZVZ A;  4MQ9 F;  4IGG A;  5B1B C;  2IXN A;  3ITF A;  3TUL A;  1A7V A;  4JVS A;  4XPX A;  4WAB A;  1JOG A;  2XS1 A;  2Y3D A;  4JE9 A;  2Q9A A;  4LER A;  5JP7 A;  1HY5 A;  3FVY A;  4DVZ A;  2MYS A;  3ZQV A;  1YZC A;  1JR8 A;  4KBL A;  2B0J A;  2Z15 A;  3DI5 A;  2OG2 A;  3NKD A;  4MVO A;  1D1C A;  1T6I A;  4IWB A;  3ZC4 A;  1VYK A;  3NMK A;  1S05 A;  2C04 A;  3LNM B;  3US6 A;  1LKX A;  1D1A A;  3EGX A;  3KL4 A;  4WGZ A;  3SEO A;  3T6J A;  4D4N A;  5L0H A;  2XXA B;  3TJ5 A;  2NSG A;  5L0I A;  4A2N B;  4CJG A;  4NQF A;  1K40 A;  3K6B A;  4PJL A;  4JCZ A;  4YL3 A;  5KYU A;  3T6G B;  1OKK A;  2YL3 A;  1H9T A;  2C03 A;  4E18 A;  5COG A;  4JRZ A;  3SYN A;  5KYW B;  3RYL A;  2J45 A;  3K1I A;  4W8K A;  3NG1 A;  3UR3 C;  1OXB A;  4OIR F;  2Y3H A;  2YL0 A;  4PJM A;  3GOR A;  4XEV A;  5JLI A;  4OIP F;  1YJG A;  3U2M A;  3MYI A;  5E2Q A;  1J8Y F;  2YHS A;  3UMH A;  3GM3 A;  4JEB A;  4N6C A;  5E33 A;  2R03 A;  1WAS A;  2P61 A;  3L8J A;  3QZC A;  2VCA A;  2PFD A;  3GOD A;  3S9O A;  4U5C E;  4HFK B;  4Z9H A;  1OR2 A;  4MVQ A;  5DS5 A;  1T5O A;  1VB5 A;  2VCB A;  1FFH A;  4XQ1 A;  3SNH A;  5F5H A;  2M64 A;  4C3B A;  2R7V A;  3V7O A;  4GEH A;  3S27 A;  3QVY A;  2HJM A;  1YAU O;  3IQT A;  3MX3 A;  4J7T A;  3G50 A;  4XPY A;  5AC5 A;  2W4M A;  1GS9 A;  2R7S A;  4MW8 A;  4O6N A;  1TKN A;  4BPM A;  3KMI A;  3EH1 A;  1ZHZ A;  2IXP A;  4U9E A;  1NLX A;  5JVE A;  5B1A C;  3SXM A;  1T6U A;  5KYY B;  1B68 A;  2LP4 A;  1A41 A;  3W8I A;  4CX9 A;  2OEV A;  3RQF A;  1G4W R;  3CAX A;  1CPQ A;  2QE9 A;  5JSL A;  1JMW A;  1RXQ A;  2V3C C;  4NCQ A;  2AP3 A;  1GGQ A;  3C62 A;  2VB6 A;  4X0R A;  2R25 A;  4XEF A;  2L7A A;  2PBE A;  4PAC A;  3C8G B;  5KYX B;  4JZA A;  3DE8 A;  3AGU A;  3LEV A;  1WN0 A;  5L0G A;  4YL0 A;  1LVK A;  2ASR A;  1TWC A;  4CS9 A;  2XL6 A;  2W9Y A;  2HSB A;  1LM3 B;  2XLV A;  3S0X A;  2HUJ A;  1D1B A;  5COF A;  1RJ9 A;  3QTH A;  3HNJ A;  4NTF A;  2Q7R A;  2X0C A;  2OJE D;  4MVR A;  2OJQ A;  1G5Z A;  5DS6 A;  3EPV A;  1LPE A;  2R7W A;  3RFY A;  3AG2 C;  3JTL O;  3IQC A;  4CSA C;  4BEM J;  2UUI A;  4C7O B;  1NBB A;  2Q9B A;  4G0H A;  1LIH A;  3CEX A;  3R2P A;  1Q0K A;  4EBK A;  4M63 A;  4U5H A;  1VTM P;  4XPW A;  1VLS A;  3CSK A;  3L0I A;  2BC5 A;  4NTA A;  4O6Y A;  4EHP A;  1KTM A;  3EHM A;  3U0C A;  2A69 F;  2GAQ A;  2GFH A;  2VH3 A;  3FOP A;  3TJ6 A;  1VMA A;  3HTK C;  2KC3 A;  1IW7 F;  3NYJ A;  3F47 A;  4FX5 A;  2J9B A;  1A7E A;  3KH2 A;  1R5I D;  1ZHY A;  2DB4 A;  1QSP A;  4K1O A;  4DRJ B;  4CDA A;  2XL4 A;  1VLT A;  256B A;  3CQZ A;  4BJ6 A;  1N1C A;  3FDQ A;  2NPU A;  5KYN A;  2R9R B;  1TWG A;  4DOZ A;  1MMG A;  4IAQ A;  1APC A;  1E85 A;  1RMV A;  2X51 A;  2NSF A;  3S90 A;  1FR0 A;  3ABM C;  1KNY A;  4H54 A;  4Z9J A;  2L6H A;  5K0I A;  2Q9C A;  2QLA A;  3PHF 2;  1YZA A;  2CDQ A;  3EFO A;  3M4C A;  1OCR C;  2HJ3 A;  5COM A;  3V5X A;  3LLI A;  1GM5 A;  1O87 A;  1JPJ A;  3EGD A;  4CS9 C;  4AE4 B;  1RKE A;  3B0P A;  3DJU B;  3B0U X;  5A6K A;  2UUH A;  2R7U A;  2ICW G;  3LS0 A;  1TFK B;  2OEX A;  1M56 C;  4MTF A;  2H7O A;  3RVZ A;  2NUP A;  3T9O A;  1ZW3 A;  4N4W A;  3IQ6 A;  1M2V B;  4CS7 A;  3BEH A;  2NUT B;  2ZXP A;  1E83 A;  2LSE A;  1FAP B;  4J32 B;  1IZM A;  2GA0 A;  3U8P A;  2R7O A;  4JCH A;  4JTA B;  1OW7 A;  4YT8 A;  3LAY A;  5B3S C;  4JTC B;  5L0F A;  4MTG A;  1J8M F;  3ZTZ A;  3S84 A;  2R7R A;  3N0T A;  2G3K A;  1FTS A;  4Z9I A;  4J30 B;  1A0B A;  2YKZ A;  2L9J A;  2Q3T A;  2WZF A;  3KPH A;  4G7O F;  3L34 A;  3X1O A;  2EPN A;  1NFO A;  3QW0 A;  2H7B A;  2KK1 A;  3G4Z A;  3O6X A;  4O79 A;  2PX0 A;  2Y39 A;  3C7J A;  3NMJ A;  3RVY A;  4PJN A;  5BQH A;  4A4A A;  1C02 A;  2XLM A;  4N06 A;  3O39 A;  5DLJ A;  5CI8 A;  3JT1 A;  1K04 A;  3JSE O;  4QDL A;  3GEE A;  5D91 A;  3EZI A;  4XLN F;  1D0Y A;  5T3T A;  4BJ6 C;  4E0I A;  5L0C A;  2XLD A;  4MS2 A;  3ZQY A;  4ER9 A;  2QNL A;  2L6F A;  1WOL A;  3DAG A;  3DMD A;  3GEH A;  4IRU A;  3ZTM A;  4YT2 A;  1QKR A;  2QUP A;  1H7I A;  4KC9 A;  1BR4 A;  3VRC A;  1NFN A;  1HE9 A;  2I8B A;  4JKV A;  2IM8 A;  3N2Z B;  1A7D A;  3OWT A;  5BUO A;  5HV9 A;  2IXM A;  1VK5 A;  2EIJ C;  5EHH A;  5FCL A;  3FXH A;  4P9T A;  2TMV P;  4I1M A;  3L8I A;  1TQG A;  4YL1 A;  3C8Z A;  3U8V A;  1ORY A;  4CS8 C;  2G3V A;  1D0X A;  3W2V A;  4DRH B;  1M6T A;  3ASN C;  1L3P A;  2JD3 A;  2XS8 A;  3I5Q A;  1NU9 C;  3PCV A;  1TWA A;  1Z23 A;  2J7P A;  3TOM A;  1YA9 A;  2E87 A;  1G4U S;  3AG1 C;  4CSA A;  2WZG A;  1QQ3 A;  1V54 C;  3MLG A;  2D4U A;  4NTB A;  5L3V A;  2YQY A;  4YT5 A;  3BRJ A;  3EH2 A;  3RQE A;  3FAP B;  1NU7 D;  1V74 B;  4ZLD A;  4HE8 D;  1W2W A;  3AGT A;  3AJM A;  1ZHX A;  1Z5Z A;  2HKV A;  2L81 A;  4CBE A;  1Q0F A;  3GM2 A;  2AU5 A;  1LI5 A;  4OIN F; 
#chains in the Genus database with same CATH homology
 2FAP B;  1AUE A;  3FAP B;  4FAP B;  4DRJ B;  5GPG B;  2GAQ A;  2RSE B;  1FAP B;  4DRI B;  4DRH B;  1NSG B;  2NPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...