4DRIB

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
GAMDPEFMEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 38
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4driB00
2RSEB 1AUEA 4DRJB 3FAPB 4FAPB 2FAPB 5GPGB 2GAQA 4DRIB 2NPUA 4DRHB 1NSGB 1FAPB
chains in the Genus database with same CATH superfamily
3RKOF 1YA7O 3EGDA 1I4ZA 3J06A 1WATA 4U5GA 2Q9AA 1NG1A 1OKKD 4CSAA 3WHNA 5A6BA 2J7PD 1D0YA 1FAPB 3DI5A 1ST6A 1WN0A 3L0IA 3Q6NA 3TJ5A 3U2LA 4JIOA 4CJGA 1APCA 2ZPAA 1Q0GA 1LE4A 2PP4A 2XRHA 3LS0A 1Q0FA 1VK5A 2R7WA 2R03A 2YL1A 4N6CA 3NDBB 4MVRA 5E33A 5L3QA 4CX9A 5KYYA 3HKKA 4MS2A 1CGOA 5L0HA 3LLKA 2LCHA 3CQZA 1OCCC 3OEOA 2PX0A 4K1OA 4AK9A 3MBGA 1RKEB 3CSKA 2L81A 3IQTA 2A6HF 2JPUA 3G50A 4W8PA 4OINF 3AG1C 1YAUO 4LLCA 4NTAA 2CNWD 2ZXWC 4I3MA 2WZFA 3EH1A 4NCQA 3U5SA 3WAQA 5A6JA 4OIQF 4AL0A 2XSEA 5JRAA 2XM4A 2Y39A 2Q3TA 4YT8A 3PHF2 4XPXA 1PD0A 1S7ZA 4EIYA 3VYWA 2P1AA 3K1HA 4EBJA 5KYWA 4C7OB 2EIJC 2PFDA 3KKBA 3N24A 5BQHA 3FHDA 3JRTA 4JTDB 4D4XA 2XS8A 4AE4B 4JEBA 1M2OA 4QDLA 1Z6AA 1RCPA 2R7XA 1AUEA 3DXJF 4XPYA 1GS9A 3DWWA 1SF8A 1U89A 1FMVA 4EHPA 1J8MF 4LACB 2V26A 1MQVA 4O79A 1TKNA 3QZCA 4IJJA 3DJUB 4A2NB 3JRMO 3EGDB 4YT5A 1JMWA 4JC7A 2QLAA 3TULA 4Z9JA 1L7CA 3GM2A 4JZAA 1A41A 3H65A 5CI8A 1V54C 5EK0A 4Q5SF 2I8BA 2XS1A 2YQYA 1D1CA 3Q7LA 4MVUA 2KJGA 4U5EE 5KYWB 3NMJA 4JJFA 4C7OA 1VYIA 1M2VB 1N1CA 1TWGA 2L7AA 1T6UA 2G3VA 2W4MA 3LAYA 3MFNA 3Q7GA 4MQ9F 4XEKA 3RQFA 4XQ1A 1Z5ZA 3TK0A 3TQOA 1ORJA 1EI7A 3ZQYA 4I44A 4AE4A 1Z3IX 5COGA 3RQEA 4YK5A 2HKVA 1R5ID 2DB4A 2HJ3A 1T5OA 4LERA 1J8YF 1PV3A 3EGXA 4HEAJ 2BC5A 2DI3A 3C7JA 3S27A 4ANJA 2WVNA 2KW3C 4BJ6C 3RVZA 3NYMA 4E0HA 2KC3A 1H7IA 2L6FA 2PNOA 2WL8A 4IB4A 4O6NA 3SNHA 1LIHA 2J9VA 3NKEA 3ASNC 2BE5F 3IHUA 3JSZA 3S28A 1OW8A 2OU6A 1I4YA 1XZQA 2HSQA 2J8WA 2W45A 4Z9IA 4PJJA 2R7UA 3NKDA 4J32B 3ZDLA 2EINC 3LUTB 1AVOB 2LQGA 3B0PA 5F28E 4MTOA 3KYIA 1M57C 2HJMA 3EJNA 3KH2A 1HE9A 3T9OA 4R32A 1FFTC 1KU2A 3M15A 4BJ5C 1AEPA 3TD7A 2CGEA 1YYJA 2C04A 4CS7A 3F47A 2AVKA 2JX0A 1V4AA 1CGNA 4U5DE 5AC4A 1TWCA 5F5HA 5L0CA 4A4AA 4CS8A 2J9UA 2XLOA 2HSBA 1ZHTA 2NSGA 2YHSA 1LI5A 3NG1A 1DOWA 2R7VA 2OCCC 2YRFA 3NMIA 4PR9A 3ZSUA 2FGYA 2CDQA 4K7BA 4PJNA 3ZWIA 4MVMA 4NQFA 4P9TA 1PCXA 3V7OA 4BJTA 3H2UA 4C3DA 1MMGA 4MVOA 1QSPA 1YLMA 2LFFA 4YT4A 5BQIA 2EPOA 3W2WA 1C02A 1LS1A 4L6RA 4N4WA 1YA9A 2LK4A 3SXYA 2Q9BA 1T9KA 5A6BD 1QKRA 3N0TA 3AG4C 1XWJA 3C8GA 1HW1A 3FVYA 3X2QC 4MTGA 4OIOF 5KYUA 1W2WA 1ZW3A 2Q4FA 3LS1A 4WGYA 3RQGA 5HSWA 2R7RA 2XLEA 3AQCA 1OXKA 4ER9A 3GEHA 1OXBA 3LEOA 5A6KA 1QZXA 4FAPB 3TOLA 1C17M 3GWLA 3ZTZA 3US6A 5B3IA 2A69F 3SXKA 1YDIA 3KL4A 2IOQA 5L0FA 1Y4CA 4KI2A 5JVEA 5AC5A 1H6GA 2UUIA 3KMIA 2G3KA 3GWNA 4MNDA 5L0IA 2YLDA 3HLZA 5K0IA 3N2ZB 4GYTA 3CZ6A 3GORA 2HMZA 4E0IA 4XWJA 3S90A 2A6EF 3H2VA 3NYLA 2L9JA 4W8KA 1YVIA 1E85A 3NMKA 3EFOB 4J7YA 1YYXA 1FNTc 3TJ6A 5JUAA 4OIPF 4G78A 4HE8D 1EKYA 5T3TA 3K1IA 4DRHB 4G7HF 3BEHA 1Z23A 3S29A 4MVQA 4EBBA 2CNWA 3GM1A 2NSFA 1U0BB 3RIPA 2C03A 1Z7Qc 3E9VA 1G8XA 3FMSA 3EFOA 4U5HA 1OR3A 1DOVA 2O9XA 2OQMA 2CCYA 4BEMJ 3S84A 1CGME 1BR1A 2OEVA 3DE8A 3JCUQ 3K33A 4E18A 3B9QA 3EPVA 4JW1A 1YARO 3WG7C 3GODA 3JZ0A 3IQCA 2W9YA 1Q0DA 3LEVA 2FFHA 4YN0B 1QVXA 1YZAA 4G0HA 5B1BC 1T6IA 3C8GB 3UMHA 4ZLCA 4MVZA 1LPEA 2IXNA 3VAYA 4N06A 2YEVA 5T1DB 4B6IA 2FAPB 4JTAB 5E3AA 1NU7D 3HNLA 4CDAA 2R7SA 4P6IC 1MMAA 2XM0A 3F46A 1WWPA 2F22A 3G4XA 2W4BA 3HNIA 2R7TA 3M4BA 2B0JA 2D5RB 1K04A 1K05A 4LDRA 3FXHA 2LP4A 2J0XA 4RDAA 1E83A 3KYJA 3LESA 4H4KC 5B3SC 1TR2A 2XL8A 3BRJA 1OW6A 3ASOC 3DAGA 2AU5A 2A1DD 4C3EA 2OOCA 1OQCA 2OEXA 4DRJB 3EZIA 1SR2A 3MX3A 5AGFA 1LVKA 1B68A 2VB6A 3K7DA 4IARA 1QQ3A 1PD1A 2VASA 1D0ZA 4XTKA 5DQTA 4BPMA 1OW7A 5L0GA 2YZSA 3GM3A 5T3WA 4DVYP 3WODF 4ZLDA 3GANA 2M64A 4EBKA 2HV6A 2EPMX 1ZU5A 3ABMC 1LKXA 2H8AA 4O6YA 2Y3DA 4RBNA 1V74B 2YVKA 2HMQA 3DM9B 4NTBA 4GEHA 1YZCA 4P9FA 4G7ZF 1VTMP 2X0CA 1BR4A 3HJCA 3W4YA 2BL2A 1LS4A 3ZIBA 3QMKA 3E70C 2OKUA 1M56C 1EA8A 3EZHA 2J46A 3ITFA 5COFA 4DJ9A 3AOUA 4HFFB 5BQGA 4F4BA 4I1OB 5KYNA 4Z9HA 2YLGA 1RKEA 4KBLA 3TOMA 3UR3C 1OKKA 4CIHA 5DLJA 1GGQA 3EG9A 4DOZA 1JPNA 4WABA 2H7BA 5DS5A 3C63A 3ATPA 5DVWA 2NUTA 1Z63A 5CIVA 4XPWA 3RF3A 1UG7A 4IWBA 4NY3A 1GM5A 2ZXOA 5D91A 2EIKC 1GQAA 3VM6A 3DM5A 1S05A 2WVOA 3NRHA 3FAJA 1IW7F 2J9BA 4U9EA 2P7VA 2JD3A 2R05A 2XLHA 3EQLF 2XLWA 3S9OA 4DVZA 2WZGA 3AG3C 1RJ9A 5HV9A 1TFKB 5IY5C 1QPUA 1SYQA 4J30B 4G7OF 1TFOB 2GFHA 1ZYRF 2G62A 1G4WR 2UUHA 5COMA 3SXMA 5D92A 1WASA 5L0DA 3CAXA 4OIRF 4XLNF 2Y3BA 4JJGA 4CDYA 1M2VA 3NYJA 4DBQA 1RXQA 2KYHA 1ZHWA 1ZZPA 2IBFA 2OG2A 2PF4E 1HMOA 3A9CA 2TMVP 1XZPA 2QUPA 2VCAA 2X51A 2YKZA 2NUTB 3JYYA 3DJNB 3LLIA 1EQ1A 2AWYA 1Q0KA 2XL6A 3O6XA 3SXZA 3ZG1A 2A0BA 2CW0F 5JS5A 4C3BA 2ICWG 5DQZA 5EHHA 3EHMA 1NFOA 2OJQA 3FOOA 5BUOA 1ORYA 3B0UX 3C8ZA 1D1BA 4PFPA 3DMDA 2HFIA 1E2XA 2PBEA 2QNLA 2VCBA 4MTFA 2R7QA 3C18A 2J0WA 2QE9A 3VRCA 2GWWA 4E7ZA 2EPKX 3POVA 5F5FA 4CDVA 3LJBA 2WVQA 4N6HA 3I5PA 1E84A 1BZ4A 2L6GA 3GEEA 3ZTMA 3L34A 4ULWA 4JTCB 1MMNA 3RYLA 3UMIA 4QI2A 1HMDA 4IRUA 4OD4A 4XEVA 5JP7A 4OD5A 5DS6A 2IXPA 3MLGA 1H9GA 2WB7A 4IGGA 4IAQA 3V5XA 4PFOA 1WTYA 1A0BA 2L6HA 3FOPA 3QTHA 4DXWA 5DS4A 3B29A 1V55C 1VLTA 2LD6A 2HZ8A 3JTLO 2P6VA 3PCVA 1F1MA 4CBEA 3K1IC 1K40A 1OR2A 2XL4A 3RW0A 2XXAB 4U5CE 2HS5A 4FX5A 2HV7A 1MNDA 4K0DA 2R25A 3I4UA 4BG0A 4BEJA 4MVSA 2QTVA 4AX2A 4JURI 2NUPA 4UDVA 2R7OA 2KK1A 3DE9A 1T6QA 3CEXA 1Y6DA 4LDQA 3L1MA 3T6GB 3X1OA 3L8IA 3U2MA 1C03A 2Y69C 3B0VC 4IAOA 4CS9C 1BDJB 1TWHA 4U5FE 1IZMA 5GPGB 4ULVA 2IM8A 4NC3A 4PJMA 5FCLA 4KC9A 4EWCA 1LM3B 4WJ0A 2WZLA 4FWVA 3FAPB 3QVYA 4EUKB 2DYSC 4CSAC 1HW2A 3SEOA 3VF0A 2V3CC 1ZU4A 1JAFA 5TJ5E 4YWQA 2ZXRA 3JSEO 4D4NA 2MWQA 1ORSC 1OCZC 2KSFA 3EGXB 1RKCA 2PX3A 2XLDA 3M79A 3O55A 1A7VA 1JR8A 1YJGA 2D4UA 3IPMO 4M63A 1I5NA 4AL1A 3T4RA 2DGJA 3HTKC 1O3UA 2I15A 2RD9A 1FMWA 1M6TA 4XLPF 1UFBA 2J7PA 4PACA 5E3CA 2H7OA 2GA0A 1QLEC 2LSEA 3I5QA 5FZTA 4BJ5A 3T6JA 3JYHA 4MW8A 1CPRA 2EPLX 4MW3A 3IQ6A 1LI7A 4DRIB 1VLSA 4CS9A 1A7EA 3UMKA 3G4ZA 2J45A 3K6BA 3HNKA 3MYIA 3SP1A 1MMDA 1TQGA 2XLVA 3ABKC 4YL1A 2XLMA 1ZW2A 1RJ9B 4WGZA 3V5YA 5JSLA 5JT4A 2A68F 1E86A 3ABLC 5CI9A 3W8IA 3UGPA 1NFNA 1ZHZA 3AQBA 3QVZA 3AGUA 3FDQA 3LNMB 3HNJA 5A6AA 3ECSA 4U9DA 2R9RB 2EIMC 3U9MA 2YL0A 1SZIA 3SYNA 3ZC4A 4E17A 3EHNA 2MYSA 3L8JA 3UNGC 4O6MA 4PJLA 3EH2A 5KYXB 1HY5A 4JCHA 5E2QA 4CJOA 4QI0A 1L3PA 2IXOA 3A11A 3C8GD 3M4CA 1FFHA 4U5BE 3AJMA 1KNYA 3R7CA 3U9JA 3ZQVA 2R02A 1BBHA 3LNRA 4GQHA 3S0XA 2NG1A 1NLXA 4ONSA 4HFKB 2P61A 4YJWA 1VYKA 1SMYF 1VB5A 3IEEA 3QW1A 4BJ6A 2DYRC 3GEIA 5KYYB 4BJ1A 3U0CA 3R2PA 2IXMA 2YL7A 1U6HA 3DKAA 4JKVA 4XEFA 1KTMA 1HE1A 1H9TA 4J7TA 2HUJA 1ZHYA 2Q00A 3DZAA 3O39A 2Y3GA 3W2VA 2KGOA 5B1AC 1CPQA 2ETSA 1ZHXA 2AP3A 1JOGA 4NTFA 1VMAA 4FESA 4YL0A 1WGWA 3RVYA 1R4TA 1T01A 2NPUA 3K66A 2Y3HA 2IYLD 1VOMA 3IQ5A 1D0XA 1JRAA 2OJED 3RFYA 2QY9A 3RH3A 1FTSA 3OA1A 2EPNA 1O87A 3W8HA 4H54A 1D1AA 1A7DA 3V5ZA 1MNEA 3PMRA 2Q7RA 4CS8C 2XXAA 1FR0A 1TWAA 3AGTA 5KYXA 2E87A 1G5ZA 4LLEA 1NU9C 4YL3A 3U3BA 3T6BA 3C62A 4I1MA 3U8PA 4DBRA 4Q7CA 4CIPA 1BR2A 4KNWA 3MYFA 1NBBA 1OCOC 2ZXPA 2CYDA 2YWAA 2YL3A 5L3VA 256BA 4KNVA 2KNHA 2ZD9A 4JVSA 5EGYA 2ASRA 2KQ9A 2VH3A 2EILC 4JE9A 4LDKA 5KYUB 1NZEA 2LFDA 2M4EA 3AG2C 2LIGA 5A69A 3Q6MA 2B0HA 4JRZA 2YLIA 1ZVZA 2MHRA 2Z15A 5JLIA 3UGOA 1Q0MA 1JPJA 2GAQA 4EKWA 3U3FA 2AWCA 4O7GA 3PDMP 3EG9B 2VC9A 4JEAA 3QW0A 5L0JA 2P0NA 2Q9CA 4Q4ZF 1G4US 4JCZA 3U8VA 2NUPB 1RMVA 3DD7A 1LE2A 1NSGB 2A0UA 2H7VC 2VCCA 4PK4A 4RD9A 3SZRA 3O10A 2RSEB 3M1CB 3JT1A 4YT2A 3KPHA 3OWTA 1O5HA 4E7SA 3B71A 3DAFA 3ZVRA 1OCRC 2J9WA 1WOLA 2GDCA 4X0RA
chains in the Genus database with same CATH topology
2RSEB 1AUEA 4DRJB 3FAPB 4FAPB 2FAPB 5GPGB 2GAQA 4DRIB 2NPUA 4DRHB 1NSGB 1FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSE B;  1AUE A;  4DRJ B;  3FAP B;  4FAP B;  2FAP B;  5GPG B;  2GAQ A;  4DRI B;  2NPU A;  4DRH B;  1NSG B;  1FAP B; 
#chains in the Genus database with same CATH topology
 3RKO F;  1YA7 O;  3EGD A;  1I4Z A;  3J06 A;  1WAT A;  4U5G A;  2Q9A A;  1NG1 A;  1OKK D;  4CSA A;  3WHN A;  5A6B A;  2J7P D;  1D0Y A;  1FAP B;  3DI5 A;  1ST6 A;  1WN0 A;  3L0I A;  3Q6N A;  3TJ5 A;  3U2L A;  4JIO A;  4CJG A;  1APC A;  2ZPA A;  1Q0G A;  1LE4 A;  2PP4 A;  2XRH A;  3LS0 A;  1Q0F A;  1VK5 A;  2R7W A;  2R03 A;  2YL1 A;  4N6C A;  3NDB B;  4MVR A;  5E33 A;  5L3Q A;  4CX9 A;  5KYY A;  3HKK A;  4MS2 A;  1CGO A;  5L0H A;  3LLK A;  2LCH A;  3CQZ A;  1OCC C;  3OEO A;  2PX0 A;  4K1O A;  4AK9 A;  3MBG A;  1RKE B;  3CSK A;  2L81 A;  3IQT A;  2A6H F;  2JPU A;  3G50 A;  4W8P A;  4OIN F;  3AG1 C;  1YAU O;  4LLC A;  4NTA A;  2CNW D;  2ZXW C;  4I3M A;  2WZF A;  3EH1 A;  4NCQ A;  3U5S A;  3WAQ A;  5A6J A;  4OIQ F;  4AL0 A;  2XSE A;  5JRA A;  2XM4 A;  2Y39 A;  2Q3T A;  4YT8 A;  3PHF 2;  4XPX A;  1PD0 A;  1S7Z A;  4EIY A;  3VYW A;  2P1A A;  3K1H A;  4EBJ A;  5KYW A;  4C7O B;  2EIJ C;  2PFD A;  3KKB A;  3N24 A;  5BQH A;  3FHD A;  3JRT A;  4JTD B;  4D4X A;  2XS8 A;  4AE4 B;  4JEB A;  1M2O A;  4QDL A;  1Z6A A;  1RCP A;  2R7X A;  1AUE A;  3DXJ F;  4XPY A;  1GS9 A;  3DWW A;  1SF8 A;  1U89 A;  1FMV A;  4EHP A;  1J8M F;  4LAC B;  2V26 A;  1MQV A;  4O79 A;  1TKN A;  3QZC A;  4IJJ A;  3DJU B;  4A2N B;  3JRM O;  3EGD B;  4YT5 A;  1JMW A;  4JC7 A;  2QLA A;  3TUL A;  4Z9J A;  1L7C A;  3GM2 A;  4JZA A;  1A41 A;  3H65 A;  5CI8 A;  1V54 C;  5EK0 A;  4Q5S F;  2I8B A;  2XS1 A;  2YQY A;  1D1C A;  3Q7L A;  4MVU A;  2KJG A;  4U5E E;  5KYW B;  3NMJ A;  4JJF A;  4C7O A;  1VYI A;  1M2V B;  1N1C A;  1TWG A;  2L7A A;  1T6U A;  2G3V A;  2W4M A;  3LAY A;  3MFN A;  3Q7G A;  4MQ9 F;  4XEK A;  3RQF A;  4XQ1 A;  1Z5Z A;  3TK0 A;  3TQO A;  1ORJ A;  1EI7 A;  3ZQY A;  4I44 A;  4AE4 A;  1Z3I X;  5COG A;  3RQE A;  4YK5 A;  2HKV A;  1R5I D;  2DB4 A;  2HJ3 A;  1T5O A;  4LER A;  1J8Y F;  1PV3 A;  3EGX A;  4HEA J;  2BC5 A;  2DI3 A;  3C7J A;  3S27 A;  4ANJ A;  2WVN A;  2KW3 C;  4BJ6 C;  3RVZ A;  3NYM A;  4E0H A;  2KC3 A;  1H7I A;  2L6F A;  2PNO A;  2WL8 A;  4IB4 A;  4O6N A;  3SNH A;  1LIH A;  2J9V A;  3NKE A;  3ASN C;  2BE5 F;  3IHU A;  3JSZ A;  3S28 A;  1OW8 A;  2OU6 A;  1I4Y A;  1XZQ A;  2HSQ A;  2J8W A;  2W45 A;  4Z9I A;  4PJJ A;  2R7U A;  3NKD A;  4J32 B;  3ZDL A;  2EIN C;  3LUT B;  1AVO B;  2LQG A;  3B0P A;  5F28 E;  4MTO A;  3KYI A;  1M57 C;  2HJM A;  3EJN A;  3KH2 A;  1HE9 A;  3T9O A;  4R32 A;  1FFT C;  1KU2 A;  3M15 A;  4BJ5 C;  1AEP A;  3TD7 A;  2CGE A;  1YYJ A;  2C04 A;  4CS7 A;  3F47 A;  2AVK A;  2JX0 A;  1V4A A;  1CGN A;  4U5D E;  5AC4 A;  1TWC A;  5F5H A;  5L0C A;  4A4A A;  4CS8 A;  2J9U A;  2XLO A;  2HSB A;  1ZHT A;  2NSG A;  2YHS A;  1LI5 A;  3NG1 A;  1DOW A;  2R7V A;  2OCC C;  2YRF A;  3NMI A;  4PR9 A;  3ZSU A;  2FGY A;  2CDQ A;  4K7B A;  4PJN A;  3ZWI A;  4MVM A;  4NQF A;  4P9T A;  1PCX A;  3V7O A;  4BJT A;  3H2U A;  4C3D A;  1MMG A;  4MVO A;  1QSP A;  1YLM A;  2LFF A;  4YT4 A;  5BQI A;  2EPO A;  3W2W A;  1C02 A;  1LS1 A;  4L6R A;  4N4W A;  1YA9 A;  2LK4 A;  3SXY A;  2Q9B A;  1T9K A;  5A6B D;  1QKR A;  3N0T A;  3AG4 C;  1XWJ A;  3C8G A;  1HW1 A;  3FVY A;  3X2Q C;  4MTG A;  4OIO F;  5KYU A;  1W2W A;  1ZW3 A;  2Q4F A;  3LS1 A;  4WGY A;  3RQG A;  5HSW A;  2R7R A;  2XLE A;  3AQC A;  1OXK A;  4ER9 A;  3GEH A;  1OXB A;  3LEO A;  5A6K A;  1QZX A;  4FAP B;  3TOL A;  1C17 M;  3GWL A;  3ZTZ A;  3US6 A;  5B3I A;  2A69 F;  3SXK A;  1YDI A;  3KL4 A;  2IOQ A;  5L0F A;  1Y4C A;  4KI2 A;  5JVE A;  5AC5 A;  1H6G A;  2UUI A;  3KMI A;  2G3K A;  3GWN A;  4MND A;  5L0I A;  2YLD A;  3HLZ A;  5K0I A;  3N2Z B;  4GYT A;  3CZ6 A;  3GOR A;  2HMZ A;  4E0I A;  4XWJ A;  3S90 A;  2A6E F;  3H2V A;  3NYL A;  2L9J A;  4W8K A;  1YVI A;  1E85 A;  3NMK A;  3EFO B;  4J7Y A;  1YYX A;  1FNT c;  3TJ6 A;  5JUA A;  4OIP F;  4G78 A;  4HE8 D;  1EKY A;  5T3T A;  3K1I A;  4DRH B;  4G7H F;  3BEH A;  1Z23 A;  3S29 A;  4MVQ A;  4EBB A;  2CNW A;  3GM1 A;  2NSF A;  1U0B B;  3RIP A;  2C03 A;  1Z7Q c;  3E9V A;  1G8X A;  3FMS A;  3EFO A;  4U5H A;  1OR3 A;  1DOV A;  2O9X A;  2OQM A;  2CCY A;  4BEM J;  3S84 A;  1CGM E;  1BR1 A;  2OEV A;  3DE8 A;  3JCU Q;  3K33 A;  4E18 A;  3B9Q A;  3EPV A;  4JW1 A;  1YAR O;  3WG7 C;  3GOD A;  3JZ0 A;  3IQC A;  2W9Y A;  1Q0D A;  3LEV A;  2FFH A;  4YN0 B;  1QVX A;  1YZA A;  4G0H A;  5B1B C;  1T6I A;  3C8G B;  3UMH A;  4ZLC A;  4MVZ A;  1LPE A;  2IXN A;  3VAY A;  4N06 A;  2YEV A;  5T1D B;  4B6I A;  2FAP B;  4JTA B;  5E3A A;  1NU7 D;  3HNL A;  4CDA A;  2R7S A;  4P6I C;  1MMA A;  2XM0 A;  3F46 A;  1WWP A;  2F22 A;  3G4X A;  2W4B A;  3HNI A;  2R7T A;  3M4B A;  2B0J A;  2D5R B;  1K04 A;  1K05 A;  4LDR A;  3FXH A;  2LP4 A;  2J0X A;  4RDA A;  1E83 A;  3KYJ A;  3LES A;  4H4K C;  5B3S C;  1TR2 A;  2XL8 A;  3BRJ A;  1OW6 A;  3ASO C;  3DAG A;  2AU5 A;  2A1D D;  4C3E A;  2OOC A;  1OQC A;  2OEX A;  4DRJ B;  3EZI A;  1SR2 A;  3MX3 A;  5AGF A;  1LVK A;  1B68 A;  2VB6 A;  3K7D A;  4IAR A;  1QQ3 A;  1PD1 A;  2VAS A;  1D0Z A;  4XTK A;  5DQT A;  4BPM A;  1OW7 A;  5L0G A;  2YZS A;  3GM3 A;  5T3W A;  4DVY P;  3WOD F;  4ZLD A;  3GAN A;  2M64 A;  4EBK A;  2HV6 A;  2EPM X;  1ZU5 A;  3ABM C;  1LKX A;  2H8A A;  4O6Y A;  2Y3D A;  4RBN A;  1V74 B;  2YVK A;  2HMQ A;  3DM9 B;  4NTB A;  4GEH A;  1YZC A;  4P9F A;  4G7Z F;  1VTM P;  2X0C A;  1BR4 A;  3HJC A;  3W4Y A;  2BL2 A;  1LS4 A;  3ZIB A;  3QMK A;  3E70 C;  2OKU A;  1M56 C;  1EA8 A;  3EZH A;  2J46 A;  3ITF A;  5COF A;  4DJ9 A;  3AOU A;  4HFF B;  5BQG A;  4F4B A;  4I1O B;  5KYN A;  4Z9H A;  2YLG A;  1RKE A;  4KBL A;  3TOM A;  3UR3 C;  1OKK A;  4CIH A;  5DLJ A;  1GGQ A;  3EG9 A;  4DOZ A;  1JPN A;  4WAB A;  2H7B A;  5DS5 A;  3C63 A;  3ATP A;  5DVW A;  2NUT A;  1Z63 A;  5CIV A;  4XPW A;  3RF3 A;  1UG7 A;  4IWB A;  4NY3 A;  1GM5 A;  2ZXO A;  5D91 A;  2EIK C;  1GQA A;  3VM6 A;  3DM5 A;  1S05 A;  2WVO A;  3NRH A;  3FAJ A;  1IW7 F;  2J9B A;  4U9E A;  2P7V A;  2JD3 A;  2R05 A;  2XLH A;  3EQL F;  2XLW A;  3S9O A;  4DVZ A;  2WZG A;  3AG3 C;  1RJ9 A;  5HV9 A;  1TFK B;  5IY5 C;  1QPU A;  1SYQ A;  4J30 B;  4G7O F;  1TFO B;  2GFH A;  1ZYR F;  2G62 A;  1G4W R;  2UUH A;  5COM A;  3SXM A;  5D92 A;  1WAS A;  5L0D A;  3CAX A;  4OIR F;  4XLN F;  2Y3B A;  4JJG A;  4CDY A;  1M2V A;  3NYJ A;  4DBQ A;  1RXQ A;  2KYH A;  1ZHW A;  1ZZP A;  2IBF A;  2OG2 A;  2PF4 E;  1HMO A;  3A9C A;  2TMV P;  1XZP A;  2QUP A;  2VCA A;  2X51 A;  2YKZ A;  2NUT B;  3JYY A;  3DJN B;  3LLI A;  1EQ1 A;  2AWY A;  1Q0K A;  2XL6 A;  3O6X A;  3SXZ A;  3ZG1 A;  2A0B A;  2CW0 F;  5JS5 A;  4C3B A;  2ICW G;  5DQZ A;  5EHH A;  3EHM A;  1NFO A;  2OJQ A;  3FOO A;  5BUO A;  1ORY A;  3B0U X;  3C8Z A;  1D1B A;  4PFP A;  3DMD A;  2HFI A;  1E2X A;  2PBE A;  2QNL A;  2VCB A;  4MTF A;  2R7Q A;  3C18 A;  2J0W A;  2QE9 A;  3VRC A;  2GWW A;  4E7Z A;  2EPK X;  3POV A;  5F5F A;  4CDV A;  3LJB A;  2WVQ A;  4N6H A;  3I5P A;  1E84 A;  1BZ4 A;  2L6G A;  3GEE A;  3ZTM A;  3L34 A;  4ULW A;  4JTC B;  1MMN A;  3RYL A;  3UMI A;  4QI2 A;  1HMD A;  4IRU A;  4OD4 A;  4XEV A;  5JP7 A;  4OD5 A;  5DS6 A;  2IXP A;  3MLG A;  1H9G A;  2WB7 A;  4IGG A;  4IAQ A;  3V5X A;  4PFO A;  1WTY A;  1A0B A;  2L6H A;  3FOP A;  3QTH A;  4DXW A;  5DS4 A;  3B29 A;  1V55 C;  1VLT A;  2LD6 A;  2HZ8 A;  3JTL O;  2P6V A;  3PCV A;  1F1M A;  4CBE A;  3K1I C;  1K40 A;  1OR2 A;  2XL4 A;  3RW0 A;  2XXA B;  4U5C E;  2HS5 A;  4FX5 A;  2HV7 A;  1MND A;  4K0D A;  2R25 A;  3I4U A;  4BG0 A;  4BEJ A;  4MVS A;  2QTV A;  4AX2 A;  4JUR I;  2NUP A;  4UDV A;  2R7O A;  2KK1 A;  3DE9 A;  1T6Q A;  3CEX A;  1Y6D A;  4LDQ A;  3L1M A;  3T6G B;  3X1O A;  3L8I A;  3U2M A;  1C03 A;  2Y69 C;  3B0V C;  4IAO A;  4CS9 C;  1BDJ B;  1TWH A;  4U5F E;  1IZM A;  5GPG B;  4ULV A;  2IM8 A;  4NC3 A;  4PJM A;  5FCL A;  4KC9 A;  4EWC A;  1LM3 B;  4WJ0 A;  2WZL A;  4FWV A;  3FAP B;  3QVY A;  4EUK B;  2DYS C;  4CSA C;  1HW2 A;  3SEO A;  3VF0 A;  2V3C C;  1ZU4 A;  1JAF A;  5TJ5 E;  4YWQ A;  2ZXR A;  3JSE O;  4D4N A;  2MWQ A;  1ORS C;  1OCZ C;  2KSF A;  3EGX B;  1RKC A;  2PX3 A;  2XLD A;  3M79 A;  3O55 A;  1A7V A;  1JR8 A;  1YJG A;  2D4U A;  3IPM O;  4M63 A;  1I5N A;  4AL1 A;  3T4R A;  2DGJ A;  3HTK C;  1O3U A;  2I15 A;  2RD9 A;  1FMW A;  1M6T A;  4XLP F;  1UFB A;  2J7P A;  4PAC A;  5E3C A;  2H7O A;  2GA0 A;  1QLE C;  2LSE A;  3I5Q A;  5FZT A;  4BJ5 A;  3T6J A;  3JYH A;  4MW8 A;  1CPR A;  2EPL X;  4MW3 A;  3IQ6 A;  1LI7 A;  4DRI B;  1VLS A;  4CS9 A;  1A7E A;  3UMK A;  3G4Z A;  2J45 A;  3K6B A;  3HNK A;  3MYI A;  3SP1 A;  1MMD A;  1TQG A;  2XLV A;  3ABK C;  4YL1 A;  2XLM A;  1ZW2 A;  1RJ9 B;  4WGZ A;  3V5Y A;  5JSL A;  5JT4 A;  2A68 F;  1E86 A;  3ABL C;  5CI9 A;  3W8I A;  3UGP A;  1NFN A;  1ZHZ A;  3AQB A;  3QVZ A;  3AGU A;  3FDQ A;  3LNM B;  3HNJ A;  5A6A A;  3ECS A;  4U9D A;  2R9R B;  2EIM C;  3U9M A;  2YL0 A;  1SZI A;  3SYN A;  3ZC4 A;  4E17 A;  3EHN A;  2MYS A;  3L8J A;  3UNG C;  4O6M A;  4PJL A;  3EH2 A;  5KYX B;  1HY5 A;  4JCH A;  5E2Q A;  4CJO A;  4QI0 A;  1L3P A;  2IXO A;  3A11 A;  3C8G D;  3M4C A;  1FFH A;  4U5B E;  3AJM A;  1KNY A;  3R7C A;  3U9J A;  3ZQV A;  2R02 A;  1BBH A;  3LNR A;  4GQH A;  3S0X A;  2NG1 A;  1NLX A;  4ONS A;  4HFK B;  2P61 A;  4YJW A;  1VYK A;  1SMY F;  1VB5 A;  3IEE A;  3QW1 A;  4BJ6 A;  2DYR C;  3GEI A;  5KYY B;  4BJ1 A;  3U0C A;  3R2P A;  2IXM A;  2YL7 A;  1U6H A;  3DKA A;  4JKV A;  4XEF A;  1KTM A;  1HE1 A;  1H9T A;  4J7T A;  2HUJ A;  1ZHY A;  2Q00 A;  3DZA A;  3O39 A;  2Y3G A;  3W2V A;  2KGO A;  5B1A C;  1CPQ A;  2ETS A;  1ZHX A;  2AP3 A;  1JOG A;  4NTF A;  1VMA A;  4FES A;  4YL0 A;  1WGW A;  3RVY A;  1R4T A;  1T01 A;  2NPU A;  3K66 A;  2Y3H A;  2IYL D;  1VOM A;  3IQ5 A;  1D0X A;  1JRA A;  2OJE D;  3RFY A;  2QY9 A;  3RH3 A;  1FTS A;  3OA1 A;  2EPN A;  1O87 A;  3W8H A;  4H54 A;  1D1A A;  1A7D A;  3V5Z A;  1MNE A;  3PMR A;  2Q7R A;  4CS8 C;  2XXA A;  1FR0 A;  1TWA A;  3AGT A;  5KYX A;  2E87 A;  1G5Z A;  4LLE A;  1NU9 C;  4YL3 A;  3U3B A;  3T6B A;  3C62 A;  4I1M A;  3U8P A;  4DBR A;  4Q7C A;  4CIP A;  1BR2 A;  4KNW A;  3MYF A;  1NBB A;  1OCO C;  2ZXP A;  2CYD A;  2YWA A;  2YL3 A;  5L3V A;  256B A;  4KNV A;  2KNH A;  2ZD9 A;  4JVS A;  5EGY A;  2ASR A;  2KQ9 A;  2VH3 A;  2EIL C;  4JE9 A;  4LDK A;  5KYU B;  1NZE A;  2LFD A;  2M4E A;  3AG2 C;  2LIG A;  5A69 A;  3Q6M A;  2B0H A;  4JRZ A;  2YLI A;  1ZVZ A;  2MHR A;  2Z15 A;  5JLI A;  3UGO A;  1Q0M A;  1JPJ A;  2GAQ A;  4EKW A;  3U3F A;  2AWC A;  4O7G A;  3PDM P;  3EG9 B;  2VC9 A;  4JEA A;  3QW0 A;  5L0J A;  2P0N A;  2Q9C A;  4Q4Z F;  1G4U S;  4JCZ A;  3U8V A;  2NUP B;  1RMV A;  3DD7 A;  1LE2 A;  1NSG B;  2A0U A;  2H7V C;  2VCC A;  4PK4 A;  4RD9 A;  3SZR A;  3O10 A;  2RSE B;  3M1C B;  3JT1 A;  4YT2 A;  3KPH A;  3OWT A;  1O5H A;  4E7S A;  3B71 A;  3DAF A;  3ZVR A;  1OCR C;  2J9W A;  1WOL A;  2GDC A;  4X0R A; 
#chains in the Genus database with same CATH homology
 2RSE B;  1AUE A;  4DRJ B;  3FAP B;  4FAP B;  2FAP B;  5GPG B;  2GAQ A;  4DRI B;  2NPU A;  4DRH B;  1NSG B;  1FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...