4DRKA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-(3,3-dimethyl-2-oxopentanoyl)piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drkA00
4DRPA 3ODKA 2ITKA 4J4OA 2MF9A 2XP7A 1F8AB 2MPHA 3O5DA 4ODPA 3TC5A 2XP8A 4ODMA 1L1PA 4JFKA 1QPLA 1J4IA 4TX0A 3WH0A 1JNSA 1TCOC 4ODNA 3PRBA 2PV3A 1FKTA 1T11A 2ZR6A 4ITZA 2Y78A 2XP5A 4IQCA 2F21A 4DROA 4DRIA 4DH0A 3O5QA 3O5JA 2XP4A 4TW8A 5GPGA 1FKRA 3UI5A 4DZ2A 2ZQVA 5DIUA 3KCEA 2MNTA 3KAIA 1YATA 1BL4A 1D7JA 2MLYA 2N87A 2RURA 2LPVA 3JYMA 3KAGA 4O2TA 3UI6A 4GIVA 4ODQA 4ODKA 5HWCA 5HT1A 1NSGA 3LUOA 3O5FA 3O5RA 2RQSA 3FAPA 2XPAA 1ROTA 2KE0A 3UQIA 4MSPA 2PV2A 1Q6UA 3GPKA 4DZ3A 1C9HA 2OFNA 1ROUA 4TNSA 2JZVA 4ODOA 1EQ3A 1FAPA 2M2AA 4NNRA 4QT3A 4DRJA 4JFJA 2PBCA 5DIVA 3KADA 1YW5A 1PBKA 1D6OA 2RSEA 1B6CA 1QZ2A 4LAXA 1ZK6A 4MGVA 3EY6A 3O5IA 5I98A 1J4HA 2KGJA 2VN1A 1Q6HA 1FKFA 1FD9A 1NMVA 3CGMA 2ZR5A 3O5OA 3RGCA 2F2DA 2IF4A 4R0XA 1Y0OA 2KR7A 3IKGA 4N19A 1FKKA 1KT0A 1NMWA 4FN2A 1J4RA 4IQ2A 4TW6A 2UZ5A 3KZ7A 1FKBA 3PRDA 2AWGA 2PV1A 1JNTA 4G50A 1FKDA 3RFWA 1FKIA 4JYSA 3IK8A 4QT2A 2KI3A 3KAFA 3IHZA 3O5EA 4ODRA 5HW6A 1M5YA 4W9OA 4FAPA 2PPPA 2XP6A 5HW7A 2RUDA 2DG3A 2FKEA 3KABA 4U86A 2RUQA 1FKHA 1U79A 2XP9A 2ZR4A 4DRKA 3TCZA 3UQAA 4DIPA 4TW7A 2PPOA 5D75A 4ODLA 4DT4A 3UI4A 2ZQUA 3OOBA 2DG9A 4IPXA 4DRMA 1BKFA 1KT1A 3JXVA 4DRHA 4U84A 4U85A 2F4EA 4LAVA 4QIBA 2DG4A 2L2SA 4J4NA 1R9HA 3I6CA 2MLXA 2VCDA 4JFIA 4LAWA 4W9QA 5HTGA 4DRNA 2Q5AA 3UQBA 2M1IA 3PA7A 1JVWA 1D7IA 1PINA 2FAPA 5HW8A 5B8IC 5HUAA 4DRQA 1FKJA 4W9PA 2LJ4A 5DITA 5BXJA 1F40A 3O5LA 4JFLA 3VAWA 2D9FA 5HWBA 1FKGA 3NTPA 1J6YA 5HKGA 1N1AA 2M08A 3H9RB 3IKDA 1EYMA 1D7HA 3O5MA 1FKLA 2KO7A 4LAYA 5J6EA 1HXVA 2MLZA 3NI6A 2XP3A 2ZQTA 3JYJA 1Q1CA 3NRKA 4JFMA 4G2PA 4C02B 2ZQSA 2XPBA 3O5GA 2RUCA 3O5PA 1FJDA 4BF8A 1QPFA 3TDBA 3KAHA 3CGNA 3B7XA 1A7XA 1ZCNA 2LKNA 2PPNA 1P5QA 1Q6IA 2KFWA 3MDYB 3O5KA 4TYOA 4GGQA 1FKSA 2K8IA 1W26A 3UF8A 2LGOA 3KACA
chains in the Genus database with same CATH superfamily
4J4OA 1ZU8A 3TC5A 4ODPA 2XP8A 3B9EA 1QPLA 1TFVA 1NWUA 1VF8A 3PRBA 1T11A 4ITZA 1NWRA 5DEZA 3O5JA 2YBTA 1FKRA 3KCEA 3ARTA 1LJYA 2DT0A 1IX5A 4URIA 3WD1A 1EIBA 5HWCA 1E6ZA 1EDQA 3RMEA 2RQSA 2XPAA 3ARUA 2G41A 3GPKA 1C9HA 1ROUA 4ML4A 4DRJA 2PBCA 5DIVA 1PBKA 1HJVA 4MGVA 4Z2GA 2KGJA 3CGMA 4Q22A 2F2DA 1CTNA 4P8UA 1Y0OA 1FKKA 3KZ7A 4Q7NA 3PRDA 3W4RA 3AS1A 1FKIA 3O5EA 5HW6A 4W9OA 1UR8A 1W9UA 4WIWA 5HW7A 1GPFA 3PRAA 1LL7A 2RUQA 3AS0A 2WLYA 3TCZA 3UI4A 2DG9A 4IPXA 1BKFA 1WNOA 2F4EA 4KR0B 3RM9A 2L2SA 4J4NA 4W9QA 2G8ZA 4MNMA 4W9PA 2LJ4A 3O5LA 1GOIA 3FY1A 1X6NA 1GUVA 1W9PA 1N1AA 3H9RB 3O5MA 1FKLA 2KO7A 5J6EA 4XAKA 4S3KA 2XPBA 2RUCA 4NZCA 1FJDA 1QPFA 2YBUA 3B7XA 1KFWA 1A7XA 1ZB5A 3ARVA 1Q6IA 3CHCA 1OGGA 3RM4A 3QOKA 4WKFA 1W26A 2LGOA 4DRPA 4MNLA 4Z2LA 1SYTA 2ITKA 4PTMA 2XP7A 2MPHA 4ZPTR 1W1TA 3ARPA 1O6IA 1HKKA 4WKAA 2DPEA 2XP5A 1OGBA 4IQCA 4ZPWR 4L3NA 4TW8A 3UI5A 3GU0A 1NH6A 5DIUA 4KQZA 3UI6A 3JYMA 2LPVA 3WD3A 2A3BA 4ODQA 2DT3A 1ZBKA 4IT6A 1ROTA 3ALFA 1EQ3A 3AQUA 3G6MA 4JFJA 4MPKA 3KADA 4S3JA 1D6OA 2RSEA 1ZK6A 4MAVA 3EY6A 1E15A 3O5IA 5GPRA 2VN1A 1Q6HA 3WQWA 2KR7A 4N19A 1KT0A 4TW6A 1H0GA 1FKDA 1LL6A 3IK8A 3KAFA 3IHZA 2DT2A 4WKHA 1NWSA 2RUDA 3KABA 4L72B 1HKJA 1U79A 4DRKA 2FDMA 2F23A 4DIPA 2PPOA 5D75A 5GQBA 1WB0A 1UR9A 3OOBA 1WAWA 4LGXA 2DSWA 1LL4A 1ZBWA 3I6CA 5HTGA 2M1IA 1LG2A 5HUAA 5B8IC 1ITXA 2DT1A 2A3EA 4MTVA 1FKGA 3NTPA 1J6YA 3BXWA 1JNDA 3IKDA 2AOSA 1D7HA 4R5EA 5DF0A 3WL0A 1ZBCA 2XP3A 4P8WA 1Q1CA 1ZL1A 4C02B 2WM0A 3O5PA 4BF8A 2O9OA 1ZCNA 2PPNA 1P5QA 2KFWA 3O5KA 2OLHA 4GGQA 4TYOA 3B8SA 2K8IA 4NSBA 3ODKA 3O5DA 1F8AB 1L1PA 3WH0A 1HKMA 4ODNA 2F21A 3WD0A 2QF8A 4DH0A 2XP4A 3ARRA 4W5UA 4UDMA 2ZQVA 3ALGA 4DWSD 2IUZA 1E6NA 1YATA 1BL4A 1D7JA 2MLYA 2RURA 4O2TA 3EIPA 2P4VA 4GIVA 5HT1A 3LUOA 3O5FA 3O5RA 3FAPA 3WIJA 2KE0A 2WK2A 1HKIA 2PV2A 4DZ3A 4TNSA 1FAPA 3AS2A 4NNRA 2A3CA 2ETNA 4AY1A 1GRJA 1B6CA 1QZ2A 4MNJA 3WD4A 4DWSA 3G6LA 1LG1A 4DROA 3O5OA 1FD9A 2ZR5A 3RGCA 3GTYX 2IF4A 2ESCA 4R0XA 1NMWA 3WKZA 2UZ5A 2PV1A 3RFWA 5JH8A 4QT2A 3CZ8A 4ODRA 4FAPA 2XP6A 1E6PA 2DG3A 2FKEA 1W1YA 4U86A 1EHNA 3UQAA 2XP9A 2DSZA 1E6RA 1W1PA 4TW7A 2ZQUA 4DRHA 1SR0A 4LAVA 3WD2A 4QIBA 3BMBA 5HBFA 1R9HA 3CHEA 4JFIA 4LAWA 1RD6A 4DRNA 3PA7A 1D7IA 3WQVA 5HW8A 1FKJA 1H0IA 3ARWA 5BXJA 4JFLA 4QZVB 5HWBA 5HKGA 2M08A 1EYMA 1E9LA 4LAYA 3ARQA 2MLZA 3NI6A 3JYJA 5DO2A 3NRKA 4WK9A 3O5GA 4DWSB 3TDBA 3MDYB 1FKSA 3KACA 2B31A 4HBOA 2MF9A 1OWQA 4ODMA 4JFKA 1J4IA 1W9VA 2B5UB 3ARXA 4TX0A 1JNSA 1TCOC 3WL1A 2PV3A 1FKTA 2ZR6A 2Y78A 4DRIA 1JNEA 3O5QA 3PR9A 1X6LA 5GPGA 1FFRA 4DZ2A 4Z2IA 2MNTA 3KAIA 1E44A 2N87A 3KAGA 4P8VA 4ODKA 1NSGA 4WJXA 1W1VA 3UQIA 4MSPA 1Q6UA 2OFNA 2JZVA 4ODOA 2M2AA 1K9TA 4QT3A 3CHFA 2DSUA 4MNKA 1YW5A 1HJWA 3CHDA 1D2KA 4LAXA 2DSVA 1ZBVA 5I98A 1J4HA 4Z2KA 1FKFA 1NMVA 4ZPVR 1NWTA 3IKGA 3AROA 4FN2A 4IQ2A 1LQ0A 4P8XA 1J4RA 3RM8A 1FKBA 3CH9A 2AWGA 1JNTA 4G50A 4JYSA 3FXYA 2KI3A 2O92A 1M5YA 4HBEA 2PPPA 3ARZA 1FKHA 2ZR4A 3OA5A 2PN0A 3ARYA 2PI6A 1JCHB 4ODLA 4DT4A 4DRMA 1KT1A 3JXVA 4U84A 4U85A 2DG4A 3AS3A 1HJXA 4HARA 2MLXA 2VCDA 2EULA 3UQBA 3B9AA 2Q5AA 1HXVA 1JVWA 1PINA 2FAPA 4DRQA 4Z2JA 1XHGA 5DITA 4Z2HA 1F40A 3VAWA 2D9FA 3B9DA 1XRVA 2ZQTA 4JFMA 4G2PA 2ZQSA 3ARSA 4ZS6A 3KAHA 3CGNA 4IT4A 2LKNA 4DWSC 1FFQA 3UF8A 2WLZA 2A3AA
chains in the Genus database with same CATH topology
4J4OA 1ZU8A 3TC5A 4ODPA 2XP8A 3B9EA 1QPLA 1TFVA 1NWUA 1VF8A 3PRBA 1T11A 4ITZA 1NWRA 5DEZA 3O5JA 2YBTA 1FKRA 3KCEA 3ARTA 1LJYA 2DT0A 1IX5A 4URIA 3WD1A 1EIBA 5HWCA 1E6ZA 1EDQA 3RMEA 2RQSA 2XPAA 3ARUA 2G41A 3GPKA 1C9HA 1ROUA 4ML4A 4DRJA 2PBCA 5DIVA 1PBKA 1HJVA 4MGVA 4Z2GA 2KGJA 3CGMA 4Q22A 2F2DA 1CTNA 4P8UA 1Y0OA 1FKKA 3KZ7A 4Q7NA 3PRDA 3W4RA 3AS1A 1FKIA 3O5EA 5HW6A 4W9OA 1UR8A 1W9UA 4WIWA 5HW7A 1GPFA 3PRAA 1LL7A 2RUQA 3AS0A 2WLYA 3TCZA 3UI4A 2DG9A 4IPXA 1BKFA 1WNOA 2F4EA 4KR0B 3RM9A 2L2SA 4J4NA 4W9QA 2G8ZA 4MNMA 4W9PA 2LJ4A 3O5LA 1GOIA 3FY1A 1X6NA 1GUVA 1W9PA 1N1AA 3H9RB 3O5MA 1FKLA 2KO7A 5J6EA 4XAKA 4S3KA 2XPBA 2RUCA 4NZCA 1FJDA 1QPFA 2YBUA 3B7XA 1KFWA 1A7XA 1ZB5A 3ARVA 1Q6IA 3CHCA 1OGGA 3RM4A 3QOKA 4WKFA 1W26A 2LGOA 4DRPA 4MNLA 4Z2LA 1SYTA 2ITKA 4PTMA 2XP7A 2MPHA 4ZPTR 1W1TA 3ARPA 1O6IA 1HKKA 4WKAA 2DPEA 2XP5A 1OGBA 4IQCA 4ZPWR 4L3NA 4TW8A 3UI5A 1NH6A 5DIUA 4KQZA 3UI6A 3JYMA 2LPVA 3WD3A 2A3BA 4ODQA 2DT3A 1ZBKA 4IT6A 1ROTA 3ALFA 1EQ3A 3AQUA 3G6MA 4JFJA 4MPKA 3KADA 4S3JA 1D6OA 2RSEA 1ZK6A 4MAVA 3EY6A 1E15A 3O5IA 5GPRA 2VN1A 1Q6HA 3WQWA 2KR7A 4N19A 1KT0A 4TW6A 1H0GA 1FKDA 1LL6A 3IK8A 3KAFA 3IHZA 2DT2A 4WKHA 1NWSA 2RUDA 3KABA 4L72B 1HKJA 1U79A 4DRKA 2FDMA 4DIPA 2PPOA 5D75A 5GQBA 1WB0A 1UR9A 3OOBA 1WAWA 4LGXA 2DSWA 1LL4A 1ZBWA 3I6CA 5HTGA 2M1IA 1LG2A 5HUAA 5B8IC 1ITXA 2DT1A 2A3EA 4MTVA 1FKGA 3NTPA 1J6YA 3BXWA 1JNDA 3IKDA 2AOSA 1D7HA 4R5EA 5DF0A 3WL0A 1ZBCA 2XP3A 4P8WA 1Q1CA 1ZL1A 4C02B 2WM0A 3O5PA 4BF8A 2O9OA 1ZCNA 2PPNA 1P5QA 2KFWA 3O5KA 2OLHA 4GGQA 4TYOA 3B8SA 2K8IA 4NSBA 3ODKA 3O5DA 1F8AB 1L1PA 3WH0A 1HKMA 4ODNA 2F21A 3WD0A 2QF8A 4DH0A 2XP4A 3ARRA 4W5UA 2ZQVA 3ALGA 4DWSD 2IUZA 1E6NA 1YATA 1BL4A 1D7JA 2MLYA 2RURA 4O2TA 4GIVA 5HT1A 3LUOA 3O5FA 3O5RA 3FAPA 3WIJA 2KE0A 2WK2A 1HKIA 2PV2A 4DZ3A 4TNSA 1FAPA 3AS2A 4NNRA 2A3CA 4AY1A 1B6CA 1QZ2A 4MNJA 3WD4A 4DWSA 3G6LA 1LG1A 4DROA 3O5OA 1FD9A 2ZR5A 3RGCA 2IF4A 2ESCA 4R0XA 1NMWA 3WKZA 2UZ5A 2PV1A 3RFWA 5JH8A 4QT2A 3CZ8A 4ODRA 4FAPA 2XP6A 1E6PA 2DG3A 2FKEA 1W1YA 4U86A 1EHNA 3UQAA 2XP9A 2DSZA 1E6RA 1W1PA 4TW7A 2ZQUA 4DRHA 1SR0A 4LAVA 3WD2A 4QIBA 5HBFA 1R9HA 3CHEA 4JFIA 4LAWA 1RD6A 4DRNA 3PA7A 1D7IA 3WQVA 5HW8A 1FKJA 1H0IA 3ARWA 5BXJA 4JFLA 4QZVB 5HWBA 5HKGA 2M08A 1EYMA 1E9LA 4LAYA 3ARQA 2MLZA 3NI6A 3JYJA 5DO2A 3NRKA 4WK9A 3O5GA 4DWSB 3TDBA 3MDYB 1FKSA 3KACA 2B31A 4HBOA 2MF9A 1OWQA 4ODMA 4JFKA 1J4IA 1W9VA 4TX0A 3ARXA 1JNSA 1TCOC 3WL1A 2PV3A 1FKTA 2ZR6A 2Y78A 4DRIA 1JNEA 3O5QA 3PR9A 1X6LA 5GPGA 1FFRA 4DZ2A 4Z2IA 2MNTA 3KAIA 2N87A 3KAGA 4P8VA 4ODKA 1NSGA 4WJXA 1W1VA 3UQIA 4MSPA 1Q6UA 2OFNA 2JZVA 4ODOA 2M2AA 1K9TA 4QT3A 3CHFA 2DSUA 4MNKA 1YW5A 1HJWA 3CHDA 1D2KA 4LAXA 2DSVA 1ZBVA 5I98A 1J4HA 4Z2KA 1FKFA 1NMVA 4ZPVR 1NWTA 3IKGA 3AROA 4FN2A 4IQ2A 1LQ0A 4P8XA 1J4RA 3RM8A 1FKBA 3CH9A 2AWGA 1JNTA 4G50A 4JYSA 3FXYA 2KI3A 2O92A 1M5YA 4HBEA 2PPPA 3ARZA 1FKHA 2ZR4A 3OA5A 3ARYA 2PI6A 4ODLA 4DT4A 4DRMA 1KT1A 3JXVA 4U84A 4U85A 2DG4A 3AS3A 1HJXA 4HARA 2MLXA 2VCDA 3UQBA 3B9AA 2Q5AA 1HXVA 1JVWA 1PINA 2FAPA 4DRQA 4Z2JA 1XHGA 5DITA 4Z2HA 1F40A 3VAWA 2D9FA 3B9DA 1XRVA 2ZQTA 4JFMA 4G2PA 2ZQSA 3ARSA 4ZS6A 3KAHA 3CGNA 4IT4A 2LKNA 4DWSC 1FFQA 3UF8A 2WLZA 2A3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRP A;  3ODK A;  2ITK A;  4J4O A;  2MF9 A;  2XP7 A;  1F8A B;  2MPH A;  3O5D A;  4ODP A;  3TC5 A;  2XP8 A;  4ODM A;  1L1P A;  4JFK A;  1QPL A;  1J4I A;  4TX0 A;  3WH0 A;  1JNS A;  1TCO C;  4ODN A;  3PRB A;  2PV3 A;  1FKT A;  1T11 A;  2ZR6 A;  4ITZ A;  2Y78 A;  2XP5 A;  4IQC A;  2F21 A;  4DRO A;  4DRI A;  4DH0 A;  3O5Q A;  3O5J A;  2XP4 A;  4TW8 A;  5GPG A;  1FKR A;  3UI5 A;  4DZ2 A;  2ZQV A;  5DIU A;  3KCE A;  2MNT A;  3KAI A;  1YAT A;  1BL4 A;  1D7J A;  2MLY A;  2N87 A;  2RUR A;  2LPV A;  3JYM A;  3KAG A;  4O2T A;  3UI6 A;  4GIV A;  4ODQ A;  4ODK A;  5HWC A;  5HT1 A;  1NSG A;  3LUO A;  3O5F A;  3O5R A;  2RQS A;  3FAP A;  2XPA A;  1ROT A;  2KE0 A;  3UQI A;  4MSP A;  2PV2 A;  1Q6U A;  3GPK A;  4DZ3 A;  1C9H A;  2OFN A;  1ROU A;  4TNS A;  2JZV A;  4ODO A;  1EQ3 A;  1FAP A;  2M2A A;  4NNR A;  4QT3 A;  4DRJ A;  4JFJ A;  2PBC A;  5DIV A;  3KAD A;  1YW5 A;  1PBK A;  1D6O A;  2RSE A;  1B6C A;  1QZ2 A;  4LAX A;  1ZK6 A;  4MGV A;  3EY6 A;  3O5I A;  5I98 A;  1J4H A;  2KGJ A;  2VN1 A;  1Q6H A;  1FKF A;  1FD9 A;  1NMV A;  3CGM A;  2ZR5 A;  3O5O A;  3RGC A;  2F2D A;  2IF4 A;  4R0X A;  1Y0O A;  2KR7 A;  3IKG A;  4N19 A;  1FKK A;  1KT0 A;  1NMW A;  4FN2 A;  1J4R A;  4IQ2 A;  4TW6 A;  2UZ5 A;  3KZ7 A;  1FKB A;  3PRD A;  2AWG A;  2PV1 A;  1JNT A;  4G50 A;  1FKD A;  3RFW A;  1FKI A;  4JYS A;  3IK8 A;  4QT2 A;  2KI3 A;  3KAF A;  3IHZ A;  3O5E A;  4ODR A;  5HW6 A;  1M5Y A;  4W9O A;  4FAP A;  2PPP A;  2XP6 A;  5HW7 A;  2RUD A;  2DG3 A;  2FKE A;  3KAB A;  4U86 A;  2RUQ A;  1FKH A;  1U79 A;  2XP9 A;  2ZR4 A;  4DRK A;  3TCZ A;  3UQA A;  4DIP A;  4TW7 A;  2PPO A;  5D75 A;  4ODL A;  4DT4 A;  3UI4 A;  2ZQU A;  3OOB A;  2DG9 A;  4IPX A;  4DRM A;  1BKF A;  1KT1 A;  3JXV A;  4DRH A;  4U84 A;  4U85 A;  2F4E A;  4LAV A;  4QIB A;  2DG4 A;  2L2S A;  4J4N A;  1R9H A;  3I6C A;  2MLX A;  2VCD A;  4JFI A;  4LAW A;  4W9Q A;  5HTG A;  4DRN A;  2Q5A A;  3UQB A;  2M1I A;  3PA7 A;  1JVW A;  1D7I A;  1PIN A;  2FAP A;  5HW8 A;  5B8I C;  5HUA A;  4DRQ A;  1FKJ A;  4W9P A;  2LJ4 A;  5DIT A;  5BXJ A;  1F40 A;  3O5L A;  4JFL A;  3VAW A;  2D9F A;  5HWB A;  1FKG A;  3NTP A;  1J6Y A;  5HKG A;  1N1A A;  2M08 A;  3H9R B;  3IKD A;  1EYM A;  1D7H A;  3O5M A;  1FKL A;  2KO7 A;  4LAY A;  5J6E A;  1HXV A;  2MLZ A;  3NI6 A;  2XP3 A;  2ZQT A;  3JYJ A;  1Q1C A;  3NRK A;  4JFM A;  4G2P A;  4C02 B;  2ZQS A;  2XPB A;  3O5G A;  2RUC A;  3O5P A;  1FJD A;  4BF8 A;  1QPF A;  3TDB A;  3KAH A;  3CGN A;  3B7X A;  1A7X A;  1ZCN A;  2LKN A;  2PPN A;  1P5Q A;  1Q6I A;  2KFW A;  3MDY B;  3O5K A;  4TYO A;  4GGQ A;  1FKS A;  2K8I A;  1W26 A;  3UF8 A;  2LGO A;  3KAC A; 
#chains in the Genus database with same CATH topology
 4J4O A;  1ZU8 A;  3TC5 A;  4ODP A;  2XP8 A;  3B9E A;  1QPL A;  1TFV A;  1NWU A;  1VF8 A;  3PRB A;  1T11 A;  4ITZ A;  1NWR A;  5DEZ A;  3O5J A;  2YBT A;  1FKR A;  3KCE A;  3ART A;  1LJY A;  2DT0 A;  1IX5 A;  4URI A;  3WD1 A;  1EIB A;  5HWC A;  1E6Z A;  1EDQ A;  3RME A;  2RQS A;  2XPA A;  3ARU A;  2G41 A;  3GPK A;  1C9H A;  1ROU A;  4ML4 A;  4DRJ A;  2PBC A;  5DIV A;  1PBK A;  1HJV A;  4MGV A;  4Z2G A;  2KGJ A;  3CGM A;  4Q22 A;  2F2D A;  1CTN A;  4P8U A;  1Y0O A;  1FKK A;  3KZ7 A;  4Q7N A;  3PRD A;  3W4R A;  3AS1 A;  1FKI A;  3O5E A;  5HW6 A;  4W9O A;  1UR8 A;  1W9U A;  4WIW A;  5HW7 A;  1GPF A;  3PRA A;  1LL7 A;  2RUQ A;  3AS0 A;  2WLY A;  3TCZ A;  3UI4 A;  2DG9 A;  4IPX A;  1BKF A;  1WNO A;  2F4E A;  4KR0 B;  3RM9 A;  2L2S A;  4J4N A;  4W9Q A;  2G8Z A;  4MNM A;  4W9P A;  2LJ4 A;  3O5L A;  1GOI A;  3FY1 A;  1X6N A;  1GUV A;  1W9P A;  1N1A A;  3H9R B;  3O5M A;  1FKL A;  2KO7 A;  5J6E A;  4XAK A;  4S3K A;  2XPB A;  2RUC A;  4NZC A;  1FJD A;  1QPF A;  2YBU A;  3B7X A;  1KFW A;  1A7X A;  1ZB5 A;  3ARV A;  1Q6I A;  3CHC A;  1OGG A;  3RM4 A;  3QOK A;  4WKF A;  1W26 A;  2LGO A;  4DRP A;  4MNL A;  4Z2L A;  1SYT A;  2ITK A;  4PTM A;  2XP7 A;  2MPH A;  4ZPT R;  1W1T A;  3ARP A;  1O6I A;  1HKK A;  4WKA A;  2DPE A;  2XP5 A;  1OGB A;  4IQC A;  4ZPW R;  4L3N A;  4TW8 A;  3UI5 A;  3GU0 A;  1NH6 A;  5DIU A;  4KQZ A;  3UI6 A;  3JYM A;  2LPV A;  3WD3 A;  2A3B A;  4ODQ A;  2DT3 A;  1ZBK A;  4IT6 A;  1ROT A;  3ALF A;  1EQ3 A;  3AQU A;  3G6M A;  4JFJ A;  4MPK A;  3KAD A;  4S3J A;  1D6O A;  2RSE A;  1ZK6 A;  4MAV A;  3EY6 A;  1E15 A;  3O5I A;  5GPR A;  2VN1 A;  1Q6H A;  3WQW A;  2KR7 A;  4N19 A;  1KT0 A;  4TW6 A;  1H0G A;  1FKD A;  1LL6 A;  3IK8 A;  3KAF A;  3IHZ A;  2DT2 A;  4WKH A;  1NWS A;  2RUD A;  3KAB A;  4L72 B;  1HKJ A;  1U79 A;  4DRK A;  2FDM A;  2F23 A;  4DIP A;  2PPO A;  5D75 A;  5GQB A;  1WB0 A;  1UR9 A;  3OOB A;  1WAW A;  4LGX A;  2DSW A;  1LL4 A;  1ZBW A;  3I6C A;  5HTG A;  2M1I A;  1LG2 A;  5HUA A;  5B8I C;  1ITX A;  2DT1 A;  2A3E A;  4MTV A;  1FKG A;  3NTP A;  1J6Y A;  3BXW A;  1JND A;  3IKD A;  2AOS A;  1D7H A;  4R5E A;  5DF0 A;  3WL0 A;  1ZBC A;  2XP3 A;  4P8W A;  1Q1C A;  1ZL1 A;  4C02 B;  2WM0 A;  3O5P A;  4BF8 A;  2O9O A;  1ZCN A;  2PPN A;  1P5Q A;  2KFW A;  3O5K A;  2OLH A;  4GGQ A;  4TYO A;  3B8S A;  2K8I A;  4NSB A;  3ODK A;  3O5D A;  1F8A B;  1L1P A;  3WH0 A;  1HKM A;  4ODN A;  2F21 A;  3WD0 A;  2QF8 A;  4DH0 A;  2XP4 A;  3ARR A;  4W5U A;  4UDM A;  2ZQV A;  3ALG A;  4DWS D;  2IUZ A;  1E6N A;  1YAT A;  1BL4 A;  1D7J A;  2MLY A;  2RUR A;  4O2T A;  3EIP A;  2P4V A;  4GIV A;  5HT1 A;  3LUO A;  3O5F A;  3O5R A;  3FAP A;  3WIJ A;  2KE0 A;  2WK2 A;  1HKI A;  2PV2 A;  4DZ3 A;  4TNS A;  1FAP A;  3AS2 A;  4NNR A;  2A3C A;  2ETN A;  4AY1 A;  1GRJ A;  1B6C A;  1QZ2 A;  4MNJ A;  3WD4 A;  4DWS A;  3G6L A;  1LG1 A;  4DRO A;  3O5O A;  1FD9 A;  2ZR5 A;  3RGC A;  3GTY X;  2IF4 A;  2ESC A;  4R0X A;  1NMW A;  3WKZ A;  2UZ5 A;  2PV1 A;  3RFW A;  5JH8 A;  4QT2 A;  3CZ8 A;  4ODR A;  4FAP A;  2XP6 A;  1E6P A;  2DG3 A;  2FKE A;  1W1Y A;  4U86 A;  1EHN A;  3UQA A;  2XP9 A;  2DSZ A;  1E6R A;  1W1P A;  4TW7 A;  2ZQU A;  4DRH A;  1SR0 A;  4LAV A;  3WD2 A;  4QIB A;  3BMB A;  5HBF A;  1R9H A;  3CHE A;  4JFI A;  4LAW A;  1RD6 A;  4DRN A;  3PA7 A;  1D7I A;  3WQV A;  5HW8 A;  1FKJ A;  1H0I A;  3ARW A;  5BXJ A;  4JFL A;  4QZV B;  5HWB A;  5HKG A;  2M08 A;  1EYM A;  1E9L A;  4LAY A;  3ARQ A;  2MLZ A;  3NI6 A;  3JYJ A;  5DO2 A;  3NRK A;  4WK9 A;  3O5G A;  4DWS B;  3TDB A;  3MDY B;  1FKS A;  3KAC A;  2B31 A;  4HBO A;  2MF9 A;  1OWQ A;  4ODM A;  4JFK A;  1J4I A;  1W9V A;  2B5U B;  3ARX A;  4TX0 A;  1JNS A;  1TCO C;  3WL1 A;  2PV3 A;  1FKT A;  2ZR6 A;  2Y78 A;  4DRI A;  1JNE A;  3O5Q A;  3PR9 A;  1X6L A;  5GPG A;  1FFR A;  4DZ2 A;  4Z2I A;  2MNT A;  3KAI A;  1E44 A;  2N87 A;  3KAG A;  4P8V A;  4ODK A;  1NSG A;  4WJX A;  1W1V A;  3UQI A;  4MSP A;  1Q6U A;  2OFN A;  2JZV A;  4ODO A;  2M2A A;  1K9T A;  4QT3 A;  3CHF A;  2DSU A;  4MNK A;  1YW5 A;  1HJW A;  3CHD A;  1D2K A;  4LAX A;  2DSV A;  1ZBV A;  5I98 A;  1J4H A;  4Z2K A;  1FKF A;  1NMV A;  4ZPV R;  1NWT A;  3IKG A;  3ARO A;  4FN2 A;  4IQ2 A;  1LQ0 A;  4P8X A;  1J4R A;  3RM8 A;  1FKB A;  3CH9 A;  2AWG A;  1JNT A;  4G50 A;  4JYS A;  3FXY A;  2KI3 A;  2O92 A;  1M5Y A;  4HBE A;  2PPP A;  3ARZ A;  1FKH A;  2ZR4 A;  3OA5 A;  2PN0 A;  3ARY A;  2PI6 A;  1JCH B;  4ODL A;  4DT4 A;  4DRM A;  1KT1 A;  3JXV A;  4U84 A;  4U85 A;  2DG4 A;  3AS3 A;  1HJX A;  4HAR A;  2MLX A;  2VCD A;  2EUL A;  3UQB A;  3B9A A;  2Q5A A;  1HXV A;  1JVW A;  1PIN A;  2FAP A;  4DRQ A;  4Z2J A;  1XHG A;  5DIT A;  4Z2H A;  1F40 A;  3VAW A;  2D9F A;  3B9D A;  1XRV A;  2ZQT A;  4JFM A;  4G2P A;  2ZQS A;  3ARS A;  4ZS6 A;  3KAH A;  3CGN A;  4IT4 A;  2LKN A;  4DWS C;  1FFQ A;  3UF8 A;  2WLZ A;  2A3A A; 
#chains in the Genus database with same CATH homology
 4J4O A;  1ZU8 A;  3TC5 A;  4ODP A;  2XP8 A;  3B9E A;  1QPL A;  1TFV A;  1NWU A;  1VF8 A;  3PRB A;  1T11 A;  4ITZ A;  1NWR A;  5DEZ A;  3O5J A;  2YBT A;  1FKR A;  3KCE A;  3ART A;  1LJY A;  2DT0 A;  1IX5 A;  4URI A;  3WD1 A;  1EIB A;  5HWC A;  1E6Z A;  1EDQ A;  3RME A;  2RQS A;  2XPA A;  3ARU A;  2G41 A;  3GPK A;  1C9H A;  1ROU A;  4ML4 A;  4DRJ A;  2PBC A;  5DIV A;  1PBK A;  1HJV A;  4MGV A;  4Z2G A;  2KGJ A;  3CGM A;  4Q22 A;  2F2D A;  1CTN A;  4P8U A;  1Y0O A;  1FKK A;  3KZ7 A;  4Q7N A;  3PRD A;  3W4R A;  3AS1 A;  1FKI A;  3O5E A;  5HW6 A;  4W9O A;  1UR8 A;  1W9U A;  4WIW A;  5HW7 A;  1GPF A;  3PRA A;  1LL7 A;  2RUQ A;  3AS0 A;  2WLY A;  3TCZ A;  3UI4 A;  2DG9 A;  4IPX A;  1BKF A;  1WNO A;  2F4E A;  4KR0 B;  3RM9 A;  2L2S A;  4J4N A;  4W9Q A;  2G8Z A;  4MNM A;  4W9P A;  2LJ4 A;  3O5L A;  1GOI A;  3FY1 A;  1X6N A;  1GUV A;  1W9P A;  1N1A A;  3H9R B;  3O5M A;  1FKL A;  2KO7 A;  5J6E A;  4XAK A;  4S3K A;  2XPB A;  2RUC A;  4NZC A;  1FJD A;  1QPF A;  2YBU A;  3B7X A;  1KFW A;  1A7X A;  1ZB5 A;  3ARV A;  1Q6I A;  3CHC A;  1OGG A;  3RM4 A;  3QOK A;  4WKF A;  1W26 A;  2LGO A;  4DRP A;  4MNL A;  4Z2L A;  1SYT A;  2ITK A;  4PTM A;  2XP7 A;  2MPH A;  4ZPT R;  1W1T A;  3ARP A;  1O6I A;  1HKK A;  4WKA A;  2DPE A;  2XP5 A;  1OGB A;  4IQC A;  4ZPW R;  4L3N A;  4TW8 A;  3UI5 A;  1NH6 A;  5DIU A;  4KQZ A;  3UI6 A;  3JYM A;  2LPV A;  3WD3 A;  2A3B A;  4ODQ A;  2DT3 A;  1ZBK A;  4IT6 A;  1ROT A;  3ALF A;  1EQ3 A;  3AQU A;  3G6M A;  4JFJ A;  4MPK A;  3KAD A;  4S3J A;  1D6O A;  2RSE A;  1ZK6 A;  4MAV A;  3EY6 A;  1E15 A;  3O5I A;  5GPR A;  2VN1 A;  1Q6H A;  3WQW A;  2KR7 A;  4N19 A;  1KT0 A;  4TW6 A;  1H0G A;  1FKD A;  1LL6 A;  3IK8 A;  3KAF A;  3IHZ A;  2DT2 A;  4WKH A;  1NWS A;  2RUD A;  3KAB A;  4L72 B;  1HKJ A;  1U79 A;  4DRK A;  2FDM A;  4DIP A;  2PPO A;  5D75 A;  5GQB A;  1WB0 A;  1UR9 A;  3OOB A;  1WAW A;  4LGX A;  2DSW A;  1LL4 A;  1ZBW A;  3I6C A;  5HTG A;  2M1I A;  1LG2 A;  5HUA A;  5B8I C;  1ITX A;  2DT1 A;  2A3E A;  4MTV A;  1FKG A;  3NTP A;  1J6Y A;  3BXW A;  1JND A;  3IKD A;  2AOS A;  1D7H A;  4R5E A;  5DF0 A;  3WL0 A;  1ZBC A;  2XP3 A;  4P8W A;  1Q1C A;  1ZL1 A;  4C02 B;  2WM0 A;  3O5P A;  4BF8 A;  2O9O A;  1ZCN A;  2PPN A;  1P5Q A;  2KFW A;  3O5K A;  2OLH A;  4GGQ A;  4TYO A;  3B8S A;  2K8I A;  4NSB A;  3ODK A;  3O5D A;  1F8A B;  1L1P A;  3WH0 A;  1HKM A;  4ODN A;  2F21 A;  3WD0 A;  2QF8 A;  4DH0 A;  2XP4 A;  3ARR A;  4W5U A;  2ZQV A;  3ALG A;  4DWS D;  2IUZ A;  1E6N A;  1YAT A;  1BL4 A;  1D7J A;  2MLY A;  2RUR A;  4O2T A;  4GIV A;  5HT1 A;  3LUO A;  3O5F A;  3O5R A;  3FAP A;  3WIJ A;  2KE0 A;  2WK2 A;  1HKI A;  2PV2 A;  4DZ3 A;  4TNS A;  1FAP A;  3AS2 A;  4NNR A;  2A3C A;  4AY1 A;  1B6C A;  1QZ2 A;  4MNJ A;  3WD4 A;  4DWS A;  3G6L A;  1LG1 A;  4DRO A;  3O5O A;  1FD9 A;  2ZR5 A;  3RGC A;  2IF4 A;  2ESC A;  4R0X A;  1NMW A;  3WKZ A;  2UZ5 A;  2PV1 A;  3RFW A;  5JH8 A;  4QT2 A;  3CZ8 A;  4ODR A;  4FAP A;  2XP6 A;  1E6P A;  2DG3 A;  2FKE A;  1W1Y A;  4U86 A;  1EHN A;  3UQA A;  2XP9 A;  2DSZ A;  1E6R A;  1W1P A;  4TW7 A;  2ZQU A;  4DRH A;  1SR0 A;  4LAV A;  3WD2 A;  4QIB A;  5HBF A;  1R9H A;  3CHE A;  4JFI A;  4LAW A;  1RD6 A;  4DRN A;  3PA7 A;  1D7I A;  3WQV A;  5HW8 A;  1FKJ A;  1H0I A;  3ARW A;  5BXJ A;  4JFL A;  4QZV B;  5HWB A;  5HKG A;  2M08 A;  1EYM A;  1E9L A;  4LAY A;  3ARQ A;  2MLZ A;  3NI6 A;  3JYJ A;  5DO2 A;  3NRK A;  4WK9 A;  3O5G A;  4DWS B;  3TDB A;  3MDY B;  1FKS A;  3KAC A;  2B31 A;  4HBO A;  2MF9 A;  1OWQ A;  4ODM A;  4JFK A;  1J4I A;  1W9V A;  4TX0 A;  3ARX A;  1JNS A;  1TCO C;  3WL1 A;  2PV3 A;  1FKT A;  2ZR6 A;  2Y78 A;  4DRI A;  1JNE A;  3O5Q A;  3PR9 A;  1X6L A;  5GPG A;  1FFR A;  4DZ2 A;  4Z2I A;  2MNT A;  3KAI A;  2N87 A;  3KAG A;  4P8V A;  4ODK A;  1NSG A;  4WJX A;  1W1V A;  3UQI A;  4MSP A;  1Q6U A;  2OFN A;  2JZV A;  4ODO A;  2M2A A;  1K9T A;  4QT3 A;  3CHF A;  2DSU A;  4MNK A;  1YW5 A;  1HJW A;  3CHD A;  1D2K A;  4LAX A;  2DSV A;  1ZBV A;  5I98 A;  1J4H A;  4Z2K A;  1FKF A;  1NMV A;  4ZPV R;  1NWT A;  3IKG A;  3ARO A;  4FN2 A;  4IQ2 A;  1LQ0 A;  4P8X A;  1J4R A;  3RM8 A;  1FKB A;  3CH9 A;  2AWG A;  1JNT A;  4G50 A;  4JYS A;  3FXY A;  2KI3 A;  2O92 A;  1M5Y A;  4HBE A;  2PPP A;  3ARZ A;  1FKH A;  2ZR4 A;  3OA5 A;  3ARY A;  2PI6 A;  4ODL A;  4DT4 A;  4DRM A;  1KT1 A;  3JXV A;  4U84 A;  4U85 A;  2DG4 A;  3AS3 A;  1HJX A;  4HAR A;  2MLX A;  2VCD A;  3UQB A;  3B9A A;  2Q5A A;  1HXV A;  1JVW A;  1PIN A;  2FAP A;  4DRQ A;  4Z2J A;  1XHG A;  5DIT A;  4Z2H A;  1F40 A;  3VAW A;  2D9F A;  3B9D A;  1XRV A;  2ZQT A;  4JFM A;  4G2P A;  2ZQS A;  3ARS A;  4ZS6 A;  3KAH A;  3CGN A;  4IT4 A;  2LKN A;  4DWS C;  1FFQ A;  3UF8 A;  2WLZ A;  2A3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...