4DRKA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-(3,3-dimethyl-2-oxopentanoyl)piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drkA00
2ZR4A 4LAWA 1JNSA 4U84A 4IPXA 1D7IA 2ITKA 3OOBA 4ODLA 3IKGA 2Q5AA 5DIUA 3O5JA 2XP3A 2XPAA 3H9RB 2M2AA 2RUQA 1FD9A 3UQAA 1M5YA 1ROUA 1FKFA 4QT2A 2F4EA 2F21A 4J4NA 1JNTA 4DRIA 2K8IA 4GGQA 5B8IC 2ZQVA 5HUAA 4MSPA 1J4HA 3O5IA 1ZK6A 5HT1A 4BF8A 3KAFA 2RURA 1BKFA 1FKHA 4ODPA 3O5GA 4C02B 2FAPA 2L2SA 4TW7A 2OFNA 2XP8A 4GIVA 2KGJA 3O5FA 4ODQA 1N1AA 5HKGA 4ODKA 2ZR5A 4JFKA 1FKTA 4QIBA 4G2PA 4DROA 3CGMA 4IQCA 4JFLA 4DRHA 2VN1A 1D7HA 4N19A 2MLYA 1FKIA 4ODRA 4TYOA 1Q6UA 4MGVA 5HTGA 2XP5A 4ODOA 1NSGA 1FJDA 2N87A 2PBCA 3IK8A 2PV2A 1ZCNA 2D9FA 2XP7A 2LJ4A 2Y78A 4U85A 1J4IA 2MLZA 3NRKA 1C9HA 3O5RA 1FKLA 2PPPA 4DT4A 1FKBA 1P5QA 4TX0A 2XP9A 5HW7A 4FAPA 1FAPA 3IKDA 4LAYA 3NI6A 2XP4A 2XPBA 3O5OA 3TCZA 4DH0A 3UQIA 2KI3A 1Q1CA 4DRJA 2RQSA 2M08A 4TW6A 3JYMA 1NMVA 3JXVA 2MF9A 3O5MA 2MNTA 3UI4A 4U86A 3RGCA 2PPOA 3KCEA 1YW5A 1NMWA 3KACA 3LUOA 4ODNA 3CGNA 1YATA 1FKRA 5HW8A 2DG9A 2DG3A 4DRPA 2KO7A 5I98A 2XP6A 3IHZA 3MDYB 3O5PA 3O5DA 4DRKA 2IF4A 2ZQSA 1QZ2A 3KAGA 4R0XA 1FKDA 1D6OA 1W26A 3KADA 4QT3A 4W9OA 1KT1A 3KABA 3RFWA 2MLXA 2PPNA 4DRMA 4W9PA 1FKGA 2AWGA 3NTPA 1HXVA 1PINA 1QPFA 3PRDA 4J4OA 4W9QA 3TDBA 1ROTA 3UF8A 1A7XA 4DRNA 3O5LA 2PV3A 1Q6IA 2RUDA 4FN2A 4DIPA 2KE0A 2JZVA 3ODKA 3PA7A 3O5KA 4DZ2A 4DRQA 1F8AB 3O5EA 2VCDA 3GPKA 1D7JA 2KR7A 4ODMA 3JYJA 3KAHA 3UI6A 1FKJA 4DZ3A 1L1PA 4TW8A 1EYMA 1QPLA 2M1IA 5DITA 5BXJA 1KT0A 1FKKA 1EQ3A 4O2TA 1TCOC 1J6YA 1R9HA 4LAVA 4JFJA 2DG4A 2MPHA 3O5QA 1Y0OA 1U79A 2ZQTA 5GPGA 1J4RA 1BL4A 5D75A 2FKEA 1JVWA 3VAWA 3UI5A 2LKNA 3TC5A 5HWCA 2F2DA 3I6CA 4JYSA 3UQBA 3FAPA 5HW6A 2PV1A 1PBKA 3B7XA 2RUCA 2KFWA 1B6CA 2LGOA 2LPVA 3KZ7A 4G50A 1F40A 4TNSA 4LAXA 1Q6HA 3EY6A 4ITZA 5HWBA 3KAIA 4IQ2A 5DIVA 2RSEA 3PRBA 1FKSA 2ZR6A 2ZQUA 4JFMA 3WH0A 4JFIA 1T11A 4NNRA 2UZ5A 5J6EA
chains in the Genus database with same CATH superfamily
2FDMA 2PN0A 4WKAA 4U84A 3IKGA 2Q5AA 5DO2A 2XPAA 3UQAA 1M5YA 1LL7A 2F4EA 1E9LA 1NH6A 1E6PA 2OLHA 4GGQA 1ZL1A 2ETNA 4HBOA 2B5UB 3O5GA 2L2SA 2XP8A 1LG1A 1E6NA 3QOKA 3WD2A 4S3KA 4DROA 3CGMA 3WD4A 2MLYA 1FKIA 4MGVA 1FJDA 1FFQA 1O6IA 2AOSA 2XP7A 1J4IA 4DWSC 1C9HA 5HW7A 4P8VA 1H0IA 2XPBA 3PRAA 1Q1CA 2WK2A 1W9PA 1E6ZA 1NMVA 3O5MA 1NMWA 1CTNA 3CGNA 1FKRA 3IHZA 2A3EA 2ZQSA 1HKMA 3KAGA 4S3JA 4DWSA 4R0XA 1FKDA 3G6LA 3KADA 4QT3A 1KT1A 1W1TA 2PPNA 4DRMA 1HKIA 3TDBA 3PRDA 4W9QA 1ROTA 1A7XA 3ARUA 1Q6IA 3BXWA 1ZU8A 2JZVA 4DZ2A 2G41A 4ZS6A 3O5EA 3ARTA 2VCDA 2KR7A 3UI6A 3JYJA 3G6MA 4WK9A 1OGBA 4QZVB 2P4VA 5BXJA 1EQ3A 1E15A 1UR9A 1SYTA 1TCOC 4LAVA 1XRVA 3CHCA 3ARZA 2DG4A 3O5QA 4Z2JA 3UI5A 2LKNA 1E44A 5HWCA 3OA5A 5HW6A 3B7XA 2LPVA 5JH8A 1HKJA 1F40A 4TNSA 3GU0A 1W9VA 3PRBA 4Q22A 4JFMA 2O92A 5J6EA 4LAWA 1JNSA 3AS0A 2DSWA 1FKFA 3AS2A 2A3BA 3ARVA 5HUAA 3O5IA 4NSBA 3B8SA 5HT1A 4BF8A 5DF0A 1JNEA 4KQZA 4TW7A 2OFNA 2KGJA 1N1AA 3WQVA 2ZR5A 2A3AA 1FKTA 4QIBA 3WD0A 4G2PA 4IQCA 3B9AA 1W1VA 4N19A 5HTGA 3CZ8A 2XP5A 2DSUA 2PV2A 2Y78A 5HBFA 3NRKA 2MLZA 3O5RA 1FKLA 4DT4A 3CHEA 3WD3A 1LQ0A 3TCZA 1OWQA 2KI3A 3ALFA 2RQSA 2M08A 4Z2HA 4U86A 4MNKA 4W5UA 2WLYA 5HW8A 4IT4A 2DG9A 2DG3A 2KO7A 2WLZA 4HBEA 3O5PA 4DRKA 4LGXA 4MNMA 3GTYX 3ARQA 4W9OA 1D6OA 1W26A 3RFWA 3WL1A 3W4RA 1FKGA 1HJXA 1HXVA 1QPFA 4J4OA 3UF8A 3O5LA 2RUDA 4AY1A 2WM0A 4ZPTR 3O5KA 1NWRA 2QF8A 3WL0A 4DRQA 4Q7NA 1GRJA 1QPLA 2M1IA 5DITA 1GPFA 4O2TA 1WAWA 4MNJA 2DSZA 1R9HA 4L72B 1LJYA 2EULA 1KFWA 3B9DA 2FKEA 1JVWA 3VAWA 2F2DA 4JYSA 3UQBA 2RUCA 2DSVA 4G50A 3ARXA 4NZCA 5HWBA 1VF8A 2RSEA 2ZR6A 3AQUA 1RD6A 2ZR4A 4IPXA 1D7IA 2ITKA 3OOBA 4ODLA 5DIUA 3H9RB 1FD9A 1ZB5A 1ROUA 2F21A 1JNTA 4DRIA 2K8IA 5B8IC 2ZQVA 1JNDA 4Z2GA 4MSPA 4WIWA 1K9TA 3WQWA 4UDMA 3KAFA 2RURA 1FKHA 1H0GA 4C02B 4GIVA 5HKGA 3O5FA 4DWSD 1D7HA 4TYOA 1Q6UA 1TFVA 4ODOA 1NSGA 2N87A 1GOIA 2PBCA 1UR8A 4WJXA 3IK8A 1ZCNA 2D9FA 4U85A 1EHNA 2PPPA 3ARPA 1FKBA 1LL4A 2DT1A 4FAPA 1FAPA 3O5OA 3AROA 4WKHA 4TW6A 3JXVA 2MNTA 2B31A 3ARYA 1WNOA 3RGCA 3KCEA 3KACA 3LUOA 3WIJA 1YATA 3ARSA 3WD1A 3O5DA 2IF4A 1QZ2A 3AS1A 2MLXA 4IT6A 4W9PA 3NTPA 1PINA 4P8WA 4DRNA 4DIPA 4FN2A 2KE0A 3ODKA 3PA7A 3RM8A 4ODMA 1ZBCA 1GUVA 2F23A 1KT0A 1FKKA 4ML4A 3CH9A 2MPHA 1Y0OA 4MTVA 3ARWA 1XHGA 5GPGA 1BL4A 5D75A 4R5EA 3I6CA 3FXYA 3FAPA 1PBKA 1D2KA 2KFWA 3KZ7A 1Q6HA 3EY6A 4ITZA 4IQ2A 3ARRA 1X6LA 1ZBVA 2ZQUA 4JFIA 4Z2KA 1T11A 4NNRA 1LG2A 4PTMA 2UZ5A 3CHFA 4KR0B 3O5JA 2XP3A 2M2AA 2RUQA 1JCHB 4QT2A 4J4NA 2G8ZA 3AS3A 4URIA 1J4HA 1OGGA 1NWSA 1ZK6A 3WKZA 1FFRA 1LL6A 1BKFA 4ODPA 2O9OA 4Z2IA 2FAPA 4ODQA 4ODKA 4JFKA 2YBUA 2IUZA 5GPRA 4DRHA 4JFLA 3PR9A 2VN1A 1X6NA 2YBTA 3B9EA 4ODRA 1ZBWA 2DT0A 4MPKA 4P8UA 4WKFA 1IX5A 1SR0A 2LJ4A 4MAVA 1NWTA 1P5QA 4TX0A 2XP9A 3IKDA 1W9UA 3NI6A 3ALGA 1E6RA 2XP4A 4LAYA 4DH0A 3UQIA 4DRJA 3JYMA 2MF9A 3RMEA 3UI4A 2PPOA 1YW5A 2DT3A 4ODNA 4L3NA 1HKKA 5DEZA 4MNLA 4DRPA 5I98A 4ZPVR 2XP6A 1ITXA 1ZBKA 3MDYB 1W1PA 3BMBA 3KABA 2AWGA 3CHDA 2PV3A 4XAKA 4Z2LA 1F8AB 1HJVA 3GPKA 1D7JA 4DZ3A 3KAHA 2PI6A 1L1PA 1FKJA 4TW8A 1EYMA 1W1YA 1NWUA 2DT2A 4DWSB 1J6YA 4JFJA 1U79A 3EIPA 2ZQTA 1J4RA 4P8XA 1HJWA 3TC5A 1WB0A 3FY1A 2DPEA 2PV1A 1B6CA 2LGOA 3RM4A 4LAXA 4ZPWR 3RM9A 3KAIA 5DIVA 4HARA 1EIBA 2A3CA 2ESCA 1FKSA 3WH0A 1EDQA 5GQBA
chains in the Genus database with same CATH topology
2FDMA 4WKAA 4U84A 3IKGA 2Q5AA 5DO2A 2XPAA 3UQAA 1M5YA 1LL7A 2F4EA 1E9LA 1NH6A 1E6PA 2OLHA 4GGQA 1ZL1A 4HBOA 3O5GA 2L2SA 2XP8A 1LG1A 1E6NA 3QOKA 3WD2A 4S3KA 4DROA 3CGMA 3WD4A 2MLYA 1FKIA 4MGVA 1FJDA 1FFQA 1O6IA 2AOSA 2XP7A 1J4IA 4DWSC 1C9HA 5HW7A 4P8VA 1H0IA 2XPBA 3PRAA 1Q1CA 2WK2A 1W9PA 1E6ZA 1NMVA 3O5MA 1NMWA 1CTNA 3CGNA 1FKRA 3IHZA 2A3EA 2ZQSA 1HKMA 3KAGA 4S3JA 4DWSA 4R0XA 1FKDA 3G6LA 3KADA 4QT3A 1KT1A 1W1TA 2PPNA 4DRMA 1HKIA 3TDBA 3PRDA 4W9QA 1ROTA 1A7XA 3ARUA 1Q6IA 3BXWA 1ZU8A 2JZVA 4DZ2A 2G41A 4ZS6A 3O5EA 3ARTA 2VCDA 2KR7A 3UI6A 3JYJA 3G6MA 4WK9A 1OGBA 4QZVB 5BXJA 1EQ3A 1E15A 1UR9A 1SYTA 1TCOC 4LAVA 1XRVA 3CHCA 3ARZA 2DG4A 3O5QA 4Z2JA 3UI5A 2LKNA 5HWCA 3OA5A 5HW6A 3B7XA 2LPVA 5JH8A 1HKJA 1F40A 4TNSA 1W9VA 3PRBA 4Q22A 4JFMA 2O92A 5J6EA 4LAWA 1JNSA 3AS0A 2DSWA 1FKFA 3AS2A 2A3BA 3ARVA 5HUAA 3O5IA 4NSBA 3B8SA 5HT1A 4BF8A 5DF0A 1JNEA 4KQZA 4TW7A 2OFNA 2KGJA 1N1AA 3WQVA 2ZR5A 2A3AA 1FKTA 4QIBA 3WD0A 4G2PA 4IQCA 3B9AA 1W1VA 4N19A 5HTGA 3CZ8A 2XP5A 2DSUA 2PV2A 2Y78A 5HBFA 3NRKA 2MLZA 3O5RA 1FKLA 4DT4A 3CHEA 3WD3A 1LQ0A 3TCZA 1OWQA 2KI3A 3ALFA 2RQSA 2M08A 4Z2HA 4U86A 4MNKA 4W5UA 2WLYA 5HW8A 4IT4A 2DG9A 2DG3A 2KO7A 2WLZA 4HBEA 3O5PA 4DRKA 4LGXA 4MNMA 3ARQA 4W9OA 1D6OA 1W26A 3RFWA 3WL1A 3W4RA 1FKGA 1HJXA 1HXVA 1QPFA 4J4OA 3UF8A 3O5LA 2RUDA 4AY1A 2WM0A 4ZPTR 3O5KA 1NWRA 2QF8A 3WL0A 4DRQA 4Q7NA 1QPLA 2M1IA 5DITA 1GPFA 4O2TA 1WAWA 4MNJA 2DSZA 1R9HA 4L72B 1LJYA 1KFWA 3B9DA 2FKEA 1JVWA 3VAWA 2F2DA 4JYSA 3UQBA 2RUCA 2DSVA 4G50A 3ARXA 4NZCA 5HWBA 1VF8A 2RSEA 2ZR6A 3AQUA 1RD6A 2ZR4A 4IPXA 1D7IA 2ITKA 3OOBA 4ODLA 5DIUA 3H9RB 1FD9A 1ZB5A 1ROUA 2F21A 1JNTA 4DRIA 2K8IA 5B8IC 2ZQVA 1JNDA 4Z2GA 4MSPA 4WIWA 1K9TA 3WQWA 3KAFA 2RURA 1FKHA 1H0GA 4C02B 4GIVA 5HKGA 3O5FA 4DWSD 1D7HA 4TYOA 1Q6UA 1TFVA 4ODOA 1NSGA 2N87A 1GOIA 2PBCA 1UR8A 4WJXA 3IK8A 1ZCNA 2D9FA 4U85A 1EHNA 2PPPA 3ARPA 1FKBA 1LL4A 2DT1A 4FAPA 1FAPA 3O5OA 3AROA 4WKHA 4TW6A 3JXVA 2MNTA 2B31A 3ARYA 1WNOA 3RGCA 3KCEA 3KACA 3LUOA 3WIJA 1YATA 3ARSA 3WD1A 3O5DA 2IF4A 1QZ2A 3AS1A 2MLXA 4IT6A 4W9PA 3NTPA 1PINA 4P8WA 4DRNA 4DIPA 4FN2A 2KE0A 3ODKA 3PA7A 3RM8A 4ODMA 1ZBCA 1GUVA 1KT0A 1FKKA 4ML4A 3CH9A 2MPHA 1Y0OA 4MTVA 3ARWA 1XHGA 5GPGA 1BL4A 5D75A 4R5EA 3I6CA 3FXYA 3FAPA 1PBKA 1D2KA 2KFWA 3KZ7A 1Q6HA 3EY6A 4ITZA 4IQ2A 3ARRA 1X6LA 1ZBVA 2ZQUA 4JFIA 4Z2KA 1T11A 4NNRA 1LG2A 4PTMA 2UZ5A 3CHFA 4KR0B 3O5JA 2XP3A 2M2AA 2RUQA 4QT2A 4J4NA 2G8ZA 3AS3A 4URIA 1J4HA 1OGGA 1NWSA 1ZK6A 3WKZA 1FFRA 1LL6A 1BKFA 4ODPA 2O9OA 4Z2IA 2FAPA 4ODQA 4ODKA 4JFKA 2YBUA 2IUZA 5GPRA 4DRHA 4JFLA 3PR9A 2VN1A 1X6NA 2YBTA 3B9EA 4ODRA 1ZBWA 2DT0A 4MPKA 4P8UA 4WKFA 1IX5A 1SR0A 2LJ4A 4MAVA 1NWTA 1P5QA 4TX0A 2XP9A 3IKDA 1W9UA 3NI6A 3ALGA 1E6RA 2XP4A 4LAYA 4DH0A 3UQIA 4DRJA 3JYMA 2MF9A 3RMEA 3UI4A 2PPOA 1YW5A 2DT3A 4ODNA 4L3NA 1HKKA 5DEZA 4MNLA 4DRPA 5I98A 4ZPVR 2XP6A 1ITXA 1ZBKA 3MDYB 1W1PA 3KABA 2AWGA 3CHDA 2PV3A 4XAKA 4Z2LA 1F8AB 1HJVA 3GPKA 1D7JA 4DZ3A 3KAHA 2PI6A 1L1PA 1FKJA 4TW8A 1EYMA 1W1YA 1NWUA 2DT2A 4DWSB 1J6YA 4JFJA 1U79A 2ZQTA 1J4RA 4P8XA 1HJWA 3TC5A 1WB0A 3FY1A 2DPEA 2PV1A 1B6CA 2LGOA 3RM4A 4LAXA 4ZPWR 3RM9A 3KAIA 5DIVA 4HARA 1EIBA 2A3CA 2ESCA 1FKSA 3WH0A 1EDQA 5GQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR4 A;  4LAW A;  1JNS A;  4U84 A;  4IPX A;  1D7I A;  2ITK A;  3OOB A;  4ODL A;  3IKG A;  2Q5A A;  5DIU A;  3O5J A;  2XP3 A;  2XPA A;  3H9R B;  2M2A A;  2RUQ A;  1FD9 A;  3UQA A;  1M5Y A;  1ROU A;  1FKF A;  4QT2 A;  2F4E A;  2F21 A;  4J4N A;  1JNT A;  4DRI A;  2K8I A;  4GGQ A;  5B8I C;  2ZQV A;  5HUA A;  4MSP A;  1J4H A;  3O5I A;  1ZK6 A;  5HT1 A;  4BF8 A;  3KAF A;  2RUR A;  1BKF A;  1FKH A;  4ODP A;  3O5G A;  4C02 B;  2FAP A;  2L2S A;  4TW7 A;  2OFN A;  2XP8 A;  4GIV A;  2KGJ A;  3O5F A;  4ODQ A;  1N1A A;  5HKG A;  4ODK A;  2ZR5 A;  4JFK A;  1FKT A;  4QIB A;  4G2P A;  4DRO A;  3CGM A;  4IQC A;  4JFL A;  4DRH A;  2VN1 A;  1D7H A;  4N19 A;  2MLY A;  1FKI A;  4ODR A;  4TYO A;  1Q6U A;  4MGV A;  5HTG A;  2XP5 A;  4ODO A;  1NSG A;  1FJD A;  2N87 A;  2PBC A;  3IK8 A;  2PV2 A;  1ZCN A;  2D9F A;  2XP7 A;  2LJ4 A;  2Y78 A;  4U85 A;  1J4I A;  2MLZ A;  3NRK A;  1C9H A;  3O5R A;  1FKL A;  2PPP A;  4DT4 A;  1FKB A;  1P5Q A;  4TX0 A;  2XP9 A;  5HW7 A;  4FAP A;  1FAP A;  3IKD A;  4LAY A;  3NI6 A;  2XP4 A;  2XPB A;  3O5O A;  3TCZ A;  4DH0 A;  3UQI A;  2KI3 A;  1Q1C A;  4DRJ A;  2RQS A;  2M08 A;  4TW6 A;  3JYM A;  1NMV A;  3JXV A;  2MF9 A;  3O5M A;  2MNT A;  3UI4 A;  4U86 A;  3RGC A;  2PPO A;  3KCE A;  1YW5 A;  1NMW A;  3KAC A;  3LUO A;  4ODN A;  3CGN A;  1YAT A;  1FKR A;  5HW8 A;  2DG9 A;  2DG3 A;  4DRP A;  2KO7 A;  5I98 A;  2XP6 A;  3IHZ A;  3MDY B;  3O5P A;  3O5D A;  4DRK A;  2IF4 A;  2ZQS A;  1QZ2 A;  3KAG A;  4R0X A;  1FKD A;  1D6O A;  1W26 A;  3KAD A;  4QT3 A;  4W9O A;  1KT1 A;  3KAB A;  3RFW A;  2MLX A;  2PPN A;  4DRM A;  4W9P A;  1FKG A;  2AWG A;  3NTP A;  1HXV A;  1PIN A;  1QPF A;  3PRD A;  4J4O A;  4W9Q A;  3TDB A;  1ROT A;  3UF8 A;  1A7X A;  4DRN A;  3O5L A;  2PV3 A;  1Q6I A;  2RUD A;  4FN2 A;  4DIP A;  2KE0 A;  2JZV A;  3ODK A;  3PA7 A;  3O5K A;  4DZ2 A;  4DRQ A;  1F8A B;  3O5E A;  2VCD A;  3GPK A;  1D7J A;  2KR7 A;  4ODM A;  3JYJ A;  3KAH A;  3UI6 A;  1FKJ A;  4DZ3 A;  1L1P A;  4TW8 A;  1EYM A;  1QPL A;  2M1I A;  5DIT A;  5BXJ A;  1KT0 A;  1FKK A;  1EQ3 A;  4O2T A;  1TCO C;  1J6Y A;  1R9H A;  4LAV A;  4JFJ A;  2DG4 A;  2MPH A;  3O5Q A;  1Y0O A;  1U79 A;  2ZQT A;  5GPG A;  1J4R A;  1BL4 A;  5D75 A;  2FKE A;  1JVW A;  3VAW A;  3UI5 A;  2LKN A;  3TC5 A;  5HWC A;  2F2D A;  3I6C A;  4JYS A;  3UQB A;  3FAP A;  5HW6 A;  2PV1 A;  1PBK A;  3B7X A;  2RUC A;  2KFW A;  1B6C A;  2LGO A;  2LPV A;  3KZ7 A;  4G50 A;  1F40 A;  4TNS A;  4LAX A;  1Q6H A;  3EY6 A;  4ITZ A;  5HWB A;  3KAI A;  4IQ2 A;  5DIV A;  2RSE A;  3PRB A;  1FKS A;  2ZR6 A;  2ZQU A;  4JFM A;  3WH0 A;  4JFI A;  1T11 A;  4NNR A;  2UZ5 A;  5J6E A; 
#chains in the Genus database with same CATH topology
 2FDM A;  2PN0 A;  4WKA A;  4U84 A;  3IKG A;  2Q5A A;  5DO2 A;  2XPA A;  3UQA A;  1M5Y A;  1LL7 A;  2F4E A;  1E9L A;  1NH6 A;  1E6P A;  2OLH A;  4GGQ A;  1ZL1 A;  2ETN A;  4HBO A;  2B5U B;  3O5G A;  2L2S A;  2XP8 A;  1LG1 A;  1E6N A;  3QOK A;  3WD2 A;  4S3K A;  4DRO A;  3CGM A;  3WD4 A;  2MLY A;  1FKI A;  4MGV A;  1FJD A;  1FFQ A;  1O6I A;  2AOS A;  2XP7 A;  1J4I A;  4DWS C;  1C9H A;  5HW7 A;  4P8V A;  1H0I A;  2XPB A;  3PRA A;  1Q1C A;  2WK2 A;  1W9P A;  1E6Z A;  1NMV A;  3O5M A;  1NMW A;  1CTN A;  3CGN A;  1FKR A;  3IHZ A;  2A3E A;  2ZQS A;  1HKM A;  3KAG A;  4S3J A;  4DWS A;  4R0X A;  1FKD A;  3G6L A;  3KAD A;  4QT3 A;  1KT1 A;  1W1T A;  2PPN A;  4DRM A;  1HKI A;  3TDB A;  3PRD A;  4W9Q A;  1ROT A;  1A7X A;  3ARU A;  1Q6I A;  3BXW A;  1ZU8 A;  2JZV A;  4DZ2 A;  2G41 A;  4ZS6 A;  3O5E A;  3ART A;  2VCD A;  2KR7 A;  3UI6 A;  3JYJ A;  3G6M A;  4WK9 A;  1OGB A;  4QZV B;  2P4V A;  5BXJ A;  1EQ3 A;  1E15 A;  1UR9 A;  1SYT A;  1TCO C;  4LAV A;  1XRV A;  3CHC A;  3ARZ A;  2DG4 A;  3O5Q A;  4Z2J A;  3UI5 A;  2LKN A;  1E44 A;  5HWC A;  3OA5 A;  5HW6 A;  3B7X A;  2LPV A;  5JH8 A;  1HKJ A;  1F40 A;  4TNS A;  3GU0 A;  1W9V A;  3PRB A;  4Q22 A;  4JFM A;  2O92 A;  5J6E A;  4LAW A;  1JNS A;  3AS0 A;  2DSW A;  1FKF A;  3AS2 A;  2A3B A;  3ARV A;  5HUA A;  3O5I A;  4NSB A;  3B8S A;  5HT1 A;  4BF8 A;  5DF0 A;  1JNE A;  4KQZ A;  4TW7 A;  2OFN A;  2KGJ A;  1N1A A;  3WQV A;  2ZR5 A;  2A3A A;  1FKT A;  4QIB A;  3WD0 A;  4G2P A;  4IQC A;  3B9A A;  1W1V A;  4N19 A;  5HTG A;  3CZ8 A;  2XP5 A;  2DSU A;  2PV2 A;  2Y78 A;  5HBF A;  3NRK A;  2MLZ A;  3O5R A;  1FKL A;  4DT4 A;  3CHE A;  3WD3 A;  1LQ0 A;  3TCZ A;  1OWQ A;  2KI3 A;  3ALF A;  2RQS A;  2M08 A;  4Z2H A;  4U86 A;  4MNK A;  4W5U A;  2WLY A;  5HW8 A;  4IT4 A;  2DG9 A;  2DG3 A;  2KO7 A;  2WLZ A;  4HBE A;  3O5P A;  4DRK A;  4LGX A;  4MNM A;  3GTY X;  3ARQ A;  4W9O A;  1D6O A;  1W26 A;  3RFW A;  3WL1 A;  3W4R A;  1FKG A;  1HJX A;  1HXV A;  1QPF A;  4J4O A;  3UF8 A;  3O5L A;  2RUD A;  4AY1 A;  2WM0 A;  4ZPT R;  3O5K A;  1NWR A;  2QF8 A;  3WL0 A;  4DRQ A;  4Q7N A;  1GRJ A;  1QPL A;  2M1I A;  5DIT A;  1GPF A;  4O2T A;  1WAW A;  4MNJ A;  2DSZ A;  1R9H A;  4L72 B;  1LJY A;  2EUL A;  1KFW A;  3B9D A;  2FKE A;  1JVW A;  3VAW A;  2F2D A;  4JYS A;  3UQB A;  2RUC A;  2DSV A;  4G50 A;  3ARX A;  4NZC A;  5HWB A;  1VF8 A;  2RSE A;  2ZR6 A;  3AQU A;  1RD6 A;  2ZR4 A;  4IPX A;  1D7I A;  2ITK A;  3OOB A;  4ODL A;  5DIU A;  3H9R B;  1FD9 A;  1ZB5 A;  1ROU A;  2F21 A;  1JNT A;  4DRI A;  2K8I A;  5B8I C;  2ZQV A;  1JND A;  4Z2G A;  4MSP A;  4WIW A;  1K9T A;  3WQW A;  4UDM A;  3KAF A;  2RUR A;  1FKH A;  1H0G A;  4C02 B;  4GIV A;  5HKG A;  3O5F A;  4DWS D;  1D7H A;  4TYO A;  1Q6U A;  1TFV A;  4ODO A;  1NSG A;  2N87 A;  1GOI A;  2PBC A;  1UR8 A;  4WJX A;  3IK8 A;  1ZCN A;  2D9F A;  4U85 A;  1EHN A;  2PPP A;  3ARP A;  1FKB A;  1LL4 A;  2DT1 A;  4FAP A;  1FAP A;  3O5O A;  3ARO A;  4WKH A;  4TW6 A;  3JXV A;  2MNT A;  2B31 A;  3ARY A;  1WNO A;  3RGC A;  3KCE A;  3KAC A;  3LUO A;  3WIJ A;  1YAT A;  3ARS A;  3WD1 A;  3O5D A;  2IF4 A;  1QZ2 A;  3AS1 A;  2MLX A;  4IT6 A;  4W9P A;  3NTP A;  1PIN A;  4P8W A;  4DRN A;  4DIP A;  4FN2 A;  2KE0 A;  3ODK A;  3PA7 A;  3RM8 A;  4ODM A;  1ZBC A;  1GUV A;  2F23 A;  1KT0 A;  1FKK A;  4ML4 A;  3CH9 A;  2MPH A;  1Y0O A;  4MTV A;  3ARW A;  1XHG A;  5GPG A;  1BL4 A;  5D75 A;  4R5E A;  3I6C A;  3FXY A;  3FAP A;  1PBK A;  1D2K A;  2KFW A;  3KZ7 A;  1Q6H A;  3EY6 A;  4ITZ A;  4IQ2 A;  3ARR A;  1X6L A;  1ZBV A;  2ZQU A;  4JFI A;  4Z2K A;  1T11 A;  4NNR A;  1LG2 A;  4PTM A;  2UZ5 A;  3CHF A;  4KR0 B;  3O5J A;  2XP3 A;  2M2A A;  2RUQ A;  1JCH B;  4QT2 A;  4J4N A;  2G8Z A;  3AS3 A;  4URI A;  1J4H A;  1OGG A;  1NWS A;  1ZK6 A;  3WKZ A;  1FFR A;  1LL6 A;  1BKF A;  4ODP A;  2O9O A;  4Z2I A;  2FAP A;  4ODQ A;  4ODK A;  4JFK A;  2YBU A;  2IUZ A;  5GPR A;  4DRH A;  4JFL A;  3PR9 A;  2VN1 A;  1X6N A;  2YBT A;  3B9E A;  4ODR A;  1ZBW A;  2DT0 A;  4MPK A;  4P8U A;  4WKF A;  1IX5 A;  1SR0 A;  2LJ4 A;  4MAV A;  1NWT A;  1P5Q A;  4TX0 A;  2XP9 A;  3IKD A;  1W9U A;  3NI6 A;  3ALG A;  1E6R A;  2XP4 A;  4LAY A;  4DH0 A;  3UQI A;  4DRJ A;  3JYM A;  2MF9 A;  3RME A;  3UI4 A;  2PPO A;  1YW5 A;  2DT3 A;  4ODN A;  4L3N A;  1HKK A;  5DEZ A;  4MNL A;  4DRP A;  5I98 A;  4ZPV R;  2XP6 A;  1ITX A;  1ZBK A;  3MDY B;  1W1P A;  3BMB A;  3KAB A;  2AWG A;  3CHD A;  2PV3 A;  4XAK A;  4Z2L A;  1F8A B;  1HJV A;  3GPK A;  1D7J A;  4DZ3 A;  3KAH A;  2PI6 A;  1L1P A;  1FKJ A;  4TW8 A;  1EYM A;  1W1Y A;  1NWU A;  2DT2 A;  4DWS B;  1J6Y A;  4JFJ A;  1U79 A;  3EIP A;  2ZQT A;  1J4R A;  4P8X A;  1HJW A;  3TC5 A;  1WB0 A;  3FY1 A;  2DPE A;  2PV1 A;  1B6C A;  2LGO A;  3RM4 A;  4LAX A;  4ZPW R;  3RM9 A;  3KAI A;  5DIV A;  4HAR A;  1EIB A;  2A3C A;  2ESC A;  1FKS A;  3WH0 A;  1EDQ A;  5GQB A; 
#chains in the Genus database with same CATH homology
 2FDM A;  4WKA A;  4U84 A;  3IKG A;  2Q5A A;  5DO2 A;  2XPA A;  3UQA A;  1M5Y A;  1LL7 A;  2F4E A;  1E9L A;  1NH6 A;  1E6P A;  2OLH A;  4GGQ A;  1ZL1 A;  4HBO A;  3O5G A;  2L2S A;  2XP8 A;  1LG1 A;  1E6N A;  3QOK A;  3WD2 A;  4S3K A;  4DRO A;  3CGM A;  3WD4 A;  2MLY A;  1FKI A;  4MGV A;  1FJD A;  1FFQ A;  1O6I A;  2AOS A;  2XP7 A;  1J4I A;  4DWS C;  1C9H A;  5HW7 A;  4P8V A;  1H0I A;  2XPB A;  3PRA A;  1Q1C A;  2WK2 A;  1W9P A;  1E6Z A;  1NMV A;  3O5M A;  1NMW A;  1CTN A;  3CGN A;  1FKR A;  3IHZ A;  2A3E A;  2ZQS A;  1HKM A;  3KAG A;  4S3J A;  4DWS A;  4R0X A;  1FKD A;  3G6L A;  3KAD A;  4QT3 A;  1KT1 A;  1W1T A;  2PPN A;  4DRM A;  1HKI A;  3TDB A;  3PRD A;  4W9Q A;  1ROT A;  1A7X A;  3ARU A;  1Q6I A;  3BXW A;  1ZU8 A;  2JZV A;  4DZ2 A;  2G41 A;  4ZS6 A;  3O5E A;  3ART A;  2VCD A;  2KR7 A;  3UI6 A;  3JYJ A;  3G6M A;  4WK9 A;  1OGB A;  4QZV B;  5BXJ A;  1EQ3 A;  1E15 A;  1UR9 A;  1SYT A;  1TCO C;  4LAV A;  1XRV A;  3CHC A;  3ARZ A;  2DG4 A;  3O5Q A;  4Z2J A;  3UI5 A;  2LKN A;  5HWC A;  3OA5 A;  5HW6 A;  3B7X A;  2LPV A;  5JH8 A;  1HKJ A;  1F40 A;  4TNS A;  1W9V A;  3PRB A;  4Q22 A;  4JFM A;  2O92 A;  5J6E A;  4LAW A;  1JNS A;  3AS0 A;  2DSW A;  1FKF A;  3AS2 A;  2A3B A;  3ARV A;  5HUA A;  3O5I A;  4NSB A;  3B8S A;  5HT1 A;  4BF8 A;  5DF0 A;  1JNE A;  4KQZ A;  4TW7 A;  2OFN A;  2KGJ A;  1N1A A;  3WQV A;  2ZR5 A;  2A3A A;  1FKT A;  4QIB A;  3WD0 A;  4G2P A;  4IQC A;  3B9A A;  1W1V A;  4N19 A;  5HTG A;  3CZ8 A;  2XP5 A;  2DSU A;  2PV2 A;  2Y78 A;  5HBF A;  3NRK A;  2MLZ A;  3O5R A;  1FKL A;  4DT4 A;  3CHE A;  3WD3 A;  1LQ0 A;  3TCZ A;  1OWQ A;  2KI3 A;  3ALF A;  2RQS A;  2M08 A;  4Z2H A;  4U86 A;  4MNK A;  4W5U A;  2WLY A;  5HW8 A;  4IT4 A;  2DG9 A;  2DG3 A;  2KO7 A;  2WLZ A;  4HBE A;  3O5P A;  4DRK A;  4LGX A;  4MNM A;  3ARQ A;  4W9O A;  1D6O A;  1W26 A;  3RFW A;  3WL1 A;  3W4R A;  1FKG A;  1HJX A;  1HXV A;  1QPF A;  4J4O A;  3UF8 A;  3O5L A;  2RUD A;  4AY1 A;  2WM0 A;  4ZPT R;  3O5K A;  1NWR A;  2QF8 A;  3WL0 A;  4DRQ A;  4Q7N A;  1QPL A;  2M1I A;  5DIT A;  1GPF A;  4O2T A;  1WAW A;  4MNJ A;  2DSZ A;  1R9H A;  4L72 B;  1LJY A;  1KFW A;  3B9D A;  2FKE A;  1JVW A;  3VAW A;  2F2D A;  4JYS A;  3UQB A;  2RUC A;  2DSV A;  4G50 A;  3ARX A;  4NZC A;  5HWB A;  1VF8 A;  2RSE A;  2ZR6 A;  3AQU A;  1RD6 A;  2ZR4 A;  4IPX A;  1D7I A;  2ITK A;  3OOB A;  4ODL A;  5DIU A;  3H9R B;  1FD9 A;  1ZB5 A;  1ROU A;  2F21 A;  1JNT A;  4DRI A;  2K8I A;  5B8I C;  2ZQV A;  1JND A;  4Z2G A;  4MSP A;  4WIW A;  1K9T A;  3WQW A;  3KAF A;  2RUR A;  1FKH A;  1H0G A;  4C02 B;  4GIV A;  5HKG A;  3O5F A;  4DWS D;  1D7H A;  4TYO A;  1Q6U A;  1TFV A;  4ODO A;  1NSG A;  2N87 A;  1GOI A;  2PBC A;  1UR8 A;  4WJX A;  3IK8 A;  1ZCN A;  2D9F A;  4U85 A;  1EHN A;  2PPP A;  3ARP A;  1FKB A;  1LL4 A;  2DT1 A;  4FAP A;  1FAP A;  3O5O A;  3ARO A;  4WKH A;  4TW6 A;  3JXV A;  2MNT A;  2B31 A;  3ARY A;  1WNO A;  3RGC A;  3KCE A;  3KAC A;  3LUO A;  3WIJ A;  1YAT A;  3ARS A;  3WD1 A;  3O5D A;  2IF4 A;  1QZ2 A;  3AS1 A;  2MLX A;  4IT6 A;  4W9P A;  3NTP A;  1PIN A;  4P8W A;  4DRN A;  4DIP A;  4FN2 A;  2KE0 A;  3ODK A;  3PA7 A;  3RM8 A;  4ODM A;  1ZBC A;  1GUV A;  1KT0 A;  1FKK A;  4ML4 A;  3CH9 A;  2MPH A;  1Y0O A;  4MTV A;  3ARW A;  1XHG A;  5GPG A;  1BL4 A;  5D75 A;  4R5E A;  3I6C A;  3FXY A;  3FAP A;  1PBK A;  1D2K A;  2KFW A;  3KZ7 A;  1Q6H A;  3EY6 A;  4ITZ A;  4IQ2 A;  3ARR A;  1X6L A;  1ZBV A;  2ZQU A;  4JFI A;  4Z2K A;  1T11 A;  4NNR A;  1LG2 A;  4PTM A;  2UZ5 A;  3CHF A;  4KR0 B;  3O5J A;  2XP3 A;  2M2A A;  2RUQ A;  4QT2 A;  4J4N A;  2G8Z A;  3AS3 A;  4URI A;  1J4H A;  1OGG A;  1NWS A;  1ZK6 A;  3WKZ A;  1FFR A;  1LL6 A;  1BKF A;  4ODP A;  2O9O A;  4Z2I A;  2FAP A;  4ODQ A;  4ODK A;  4JFK A;  2YBU A;  2IUZ A;  5GPR A;  4DRH A;  4JFL A;  3PR9 A;  2VN1 A;  1X6N A;  2YBT A;  3B9E A;  4ODR A;  1ZBW A;  2DT0 A;  4MPK A;  4P8U A;  4WKF A;  1IX5 A;  1SR0 A;  2LJ4 A;  4MAV A;  1NWT A;  1P5Q A;  4TX0 A;  2XP9 A;  3IKD A;  1W9U A;  3NI6 A;  3ALG A;  1E6R A;  2XP4 A;  4LAY A;  4DH0 A;  3UQI A;  4DRJ A;  3JYM A;  2MF9 A;  3RME A;  3UI4 A;  2PPO A;  1YW5 A;  2DT3 A;  4ODN A;  4L3N A;  1HKK A;  5DEZ A;  4MNL A;  4DRP A;  5I98 A;  4ZPV R;  2XP6 A;  1ITX A;  1ZBK A;  3MDY B;  1W1P A;  3KAB A;  2AWG A;  3CHD A;  2PV3 A;  4XAK A;  4Z2L A;  1F8A B;  1HJV A;  3GPK A;  1D7J A;  4DZ3 A;  3KAH A;  2PI6 A;  1L1P A;  1FKJ A;  4TW8 A;  1EYM A;  1W1Y A;  1NWU A;  2DT2 A;  4DWS B;  1J6Y A;  4JFJ A;  1U79 A;  2ZQT A;  1J4R A;  4P8X A;  1HJW A;  3TC5 A;  1WB0 A;  3FY1 A;  2DPE A;  2PV1 A;  1B6C A;  2LGO A;  3RM4 A;  4LAX A;  4ZPW R;  3RM9 A;  3KAI A;  5DIV A;  4HAR A;  1EIB A;  2A3C A;  2ESC A;  1FKS A;  3WH0 A;  1EDQ A;  5GQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...