4DRKA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-(3,3-dimethyl-2-oxopentanoyl)piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drkA00
3O5OA 2JZVA 5BXJA 4DRPA 2Q5AA 1EQ3A 1YW5A 2XP9A 2ZR6A 2RSEA 3KABA 3O5QA 5HKGA 3GPKA 1FKTA 1YATA 3NRKA 4N19A 4DRMA 2RURA 4U85A 2LJ4A 1JVWA 3I6CA 2ZR5A 3IKDA 4G50A 1J6YA 1TCOC 2DG9A 2ZQUA 3O5LA 4LAXA 5DITA 2Y78A 1D6OA 1T11A 1Y0OA 4MSPA 2LPVA 3UI5A 3UI4A 3NI6A 3IKGA 1ZCNA 1ZK6A 3KAHA 1FJDA 4J4OA 2AWGA 1N1AA 2KR7A 2RUQA 1R9HA 4DRIA 2D9FA 1FKDA 1Q6IA 1FD9A 1ROTA 3IHZA 4U84A 4FAPA 1FKRA 3O5FA 3O5DA 2PV3A 3VAWA 2PPPA 4LAVA 3IK8A 2XP5A 1BL4A 2MLXA 1D7IA 5HW8A 4DRKA 1FKGA 2M2AA 4NNRA 4C02B 4DRHA 5HW6A 1JNSA 1L1PA 3CGNA 4DH0A 3NTPA 4LAWA 2IF4A 2KGJA 1D7HA 2PPOA 2KE0A 2N87A 2ZQTA 3KAFA 4ODRA 3PRBA 3JYJA 3B7XA 4TW8A 4ODQA 1KT1A 5HT1A 2ZQVA 4TW6A 2VN1A 3TC5A 3CGMA 2PBCA 3PA7A 4TNSA 4TW7A 3UQAA 3O5IA 2UZ5A 2KI3A 2LGOA 1NSGA 3JYMA 4FN2A 5HUAA 4DT4A 2PPNA 1J4IA 3UQIA 3O5GA 4R0XA 4BF8A 1BKFA 1ROUA 5DIVA 3UF8A 1U79A 1A7XA 2RUCA 3KCEA 1D7JA 4GGQA 4QIBA 2FAPA 2KFWA 2KO7A 4TX0A 1NMVA 4ITZA 4W9QA 5J6EA 3UQBA 4DRNA 4ODOA 4IQ2A 4ODKA 4ODMA 2F21A 2L2SA 1FKSA 4J4NA 3RFWA 4IQCA 1FKFA 3WH0A 1FKLA 5GPGA 1B6CA 3KZ7A 3O5PA 2DG4A 2K8IA 2MLYA 2XP6A 2ZR4A 3PRDA 4G2PA 4QT3A 4DIPA 2LKNA 1F40A 1QZ2A 2RQSA 3TDBA 1FKHA 1QPFA 3FAPA 1FKBA 3KAGA 2PV1A 4JFJA 2XP4A 4JFMA 4DRJA 4DROA 2XP3A 4W9OA 4JFIA 4JFLA 4JYSA 2ITKA 2XPAA 1Q6HA 3KADA 1C9HA 4DZ2A 4LAYA 4GIVA 1P5QA 4DZ3A 3KAIA 3ODKA 1J4HA 5DIUA 1Q1CA 4TYOA 4U86A 3O5KA 4MGVA 2M1IA 2M08A 3KACA 2DG3A 2MPHA 5HW7A 2OFNA 2MNTA 3MDYB 5I98A 4DRQA 1F8AB 2XPBA 2F4EA 4IPXA 1Q6UA 2ZQSA 1EYMA 5HWBA 3OOBA 1PINA 2RUDA 4ODLA 3EY6A 2MF9A 2PV2A 4W9PA 4O2TA 1FKJA 2F2DA 1W26A 1KT0A 2VCDA 1PBKA 5HWCA 1NMWA 1HXVA 1FKKA 3O5MA 1FAPA 3O5JA 1M5YA 5B8IC 1J4RA 2XP7A 5HTGA 3JXVA 2FKEA 3TCZA 2MLZA 1QPLA 3H9RB 3LUOA 3O5RA 3UI6A 1FKIA 3RGCA 1JNTA 4ODPA 5D75A 2XP8A 4JFKA 4ODNA 4QT2A 3O5EA
chains in the Genus database with same CATH superfamily
3O5OA 5BXJA 2Q5AA 1YW5A 5HKGA 1FKTA 1YATA 3NRKA 4DRMA 4U85A 2LJ4A 1E6RA 3B8SA 4LAXA 2Y78A 1D6OA 1EDQA 4P8UA 1WNOA 1ZCNA 3KAHA 2AWGA 2RUQA 1R9HA 3GU0A 2YBUA 2PPPA 4LAVA 1D7IA 1FKGA 2M2AA 1L1PA 1JNSA 3NTPA 2IF4A 2N87A 2ZQTA 3JYJA 4WKAA 2PBCA 4WKHA 1WAWA 3AQUA 1NSGA 4DT4A 2A3EA 1J4IA 3UQIA 4R0XA 5DF0A 3KCEA 1E6PA 2KO7A 3B9DA 3ARTA 3UQBA 5GPRA 4IQ2A 3CH9A 1B6CA 3PR9A 3FY1A 4G2PA 3B9EA 1QZ2A 2RQSA 3ARVA 4Z2JA 3ALFA 3ARXA 3KAGA 4DROA 1D2KA 2ITKA 1Q6HA 1C9HA 4DZ3A 1NWUA 3ODKA 2FDMA 1Q1CA 4S3KA 5HW7A 5HBFA 2MPHA 4DRQA 2WM0A 1JCHB 4L72B 1EIBA 1W9PA 2DSUA 1NMWA 3CZ8A 1HJWA 1M5YA 1E44A 3JXVA 2MLZA 5DO2A 1QPLA 4ODPA 5D75A 1LJYA 3O5EA 2JZVA 4URIA 4L3NA 2XP9A 2B31A 2O9OA 2DT1A 3O5QA 3GPKA 3WD0A 3AROA 4N19A 3I6CA 2ZR5A 3IKDA 4G50A 1TCOC 4KR0B 1HKIA 4MPKA 4MSPA 3UI4A 1SYTA 2ETNA 3NI6A 3IKGA 5JH8A 4Z2HA 1KFWA 1IX5A 1N1AA 1LG2A 3CHFA 1FKDA 1ROTA 3IHZA 1SR0A 4U84A 3O5FA 5DEZA 3O5DA 3VAWA 2XP5A 2MLXA 4DWSC 4C02B 4DH0A 2DT2A 4LAWA 1HJVA 1H0GA 1FFRA 1LG1A 4ZS6A 3PRBA 3CGMA 3PA7A 4TW7A 4NZCA 3UQAA 2PPNA 2QF8A 1E9LA 2DT3A 4BF8A 4Z2LA 1BKFA 4DIPA 3UF8A 1U79A 1ZBWA 1NH6A 4GGQA 1D7JA 4ML4A 3ARSA 2KFWA 4ITZA 1ITXA 4WK9A 4Z2KA 4ODKA 2F21A 4J4NA 1FKLA 3O5PA 2DG4A 2K8IA 2MLYA 3ARYA 1OGBA 1W9UA 1F40A 1GPFA 3OA5A 1FKBA 1NWRA 2P4VA 4JFMA 4P8WA 4JFLA 3G6LA 4Z2GA 2WLZA 5DIUA 4MGVA 2M08A 2DG3A 4MNLA 1E15A 4IPXA 3WQVA 5HWBA 4MNKA 2RUDA 2WK2A 2MF9A 1LQ0A 2PV2A 4O2TA 4W9PA 2F2DA 1PBKA 1FKKA 3ARWA 3AS3A 5B8IC 1J4RA 4WKFA 4Q22A 4DRPA 1EQ3A 1W1YA 3KABA 1E6ZA 1JVWA 4MTVA 4R5EA 1J6YA 5DITA 1T11A 2LPVA 2DT0A 1ZK6A 1K9TA 4W5UA 1FJDA 4J4OA 2KR7A 3W4RA 1HJXA 1Q6IA 1FD9A 3GTYX 3ALGA 1GOIA 3ARQA 1OGGA 3IK8A 4MNJA 1BL4A 4DRKA 3CGNA 3G6MA 1LL4A 1D7HA 1ZL1A 2KE0A 3RM9A 4IT4A 3KAFA 4IT6A 4ZPWR 4TW8A 1KT1A 1W1VA 1GRJA 5HT1A 3TC5A 1VF8A 4S3JA 4LGXA 4DWSD 2KI3A 2LGOA 4WIWA 3JYMA 3O5GA 3WQWA 1ROUA 5HWCA 1A7XA 2RUCA 4QIBA 5J6EA 1NMVA 4ZPVR 3ARPA 1EHNA 3WD1A 4DWSB 1CTNA 4ODMA 2AOSA 1FKSA 5GQBA 3RFWA 4HARA 2XP6A 1XHGA 2ZR4A 4QT3A 2LKNA 3BXWA 2PI6A 4ZPTR 3TDBA 1FKHA 1LL7A 1OWQA 2PV1A 4JFJA 4DRJA 1JNDA 2O92A 4JFIA 4JYSA 2XPAA 4AY1A 3KADA 3PRAA 3KAIA 2IUZA 3WD3A 4TYOA 3O5KA 3AS1A 1W1TA 3KACA 5I98A 1F8AB 1W9VA 1W1PA 1Q6UA 2ZQSA 1EYMA 4ODLA 3EY6A 1FKJA 3RM8A 1WB0A 1HXVA 3ARUA 2G41A 3O5MA 2B5UB 3O5JA 1E6NA 3WD2A 4P8VA 5HTGA 2FKEA 3TCZA 3LUOA 3H9RB 3O5RA 3UI6A 1FKIA 2A3CA 3RGCA 1UR8A 2XP8A 4JFKA 4ODNA 4QT2A 1X6LA 2ZR6A 2RSEA 1FFQA 1HKKA 1ZBVA 2OLHA 2RURA 2DG9A 3CHEA 2ZQUA 3O5LA 3UI5A 1Y0OA 1UR9A 4WJXA 1TFVA 4DRIA 4P8XA 3WIJA 2D9FA 2DSZA 3WKZA 3BMBA 4FAPA 1FKRA 2A3BA 4HBEA 2PV3A 2F23A 5HW8A 4Q7NA 4NNRA 5HW6A 4DRHA 2YBTA 1ZBCA 1ZU8A 2DSWA 2KGJA 2PPOA 3ARRA 4ODRA 3B7XA 3ARZA 4ODQA 3WL1A 2ZQVA 1XRVA 2VN1A 4TW6A 4TNSA 1X6NA 3B9AA 4PTMA 1HKMA 3RM4A 3AS0A 3WL0A 3O5IA 2UZ5A 4Z2IA 4FN2A 5HUAA 4MAVA 4NSBA 3FXYA 1GUVA 5DIVA 4QZVB 4TX0A 2FAPA 4W9QA 4DWSA 3CHDA 4ODOA 3CHCA 2L2SA 4IQCA 1FKFA 3WH0A 5GPGA 3KZ7A 3PRDA 3QOKA 4MNMA 1NWSA 1QPFA 3FAPA 2XP4A 1O6IA 4XAKA 2XP3A 4W9OA 1JNEA 4HBOA 4DZ2A 1LL6A 4LAYA 4GIVA 1P5QA 2G8ZA 3EIPA 2ESCA 1RD6A 1J4HA 4DRNA 4U86A 2M1IA 2EULA 2OFNA 2MNTA 2WLYA 3MDYB 2XPBA 2F4EA 3RMEA 2DSVA 3OOBA 1PINA 1W26A 1KT0A 2VCDA 2A3AA 3AS2A 1H0IA 3WD4A 1FAPA 1NWTA 4UDMA 1HKJA 2XP7A 1ZBKA 1JNTA 1ZB5A 2DPEA 2PN0A 4KQZA
chains in the Genus database with same CATH topology
3O5OA 5BXJA 2Q5AA 1YW5A 5HKGA 1FKTA 1YATA 3NRKA 4DRMA 4U85A 2LJ4A 1E6RA 3B8SA 4LAXA 2Y78A 1D6OA 1EDQA 4P8UA 1WNOA 1ZCNA 3KAHA 2AWGA 2RUQA 1R9HA 2YBUA 2PPPA 4LAVA 1D7IA 1FKGA 2M2AA 1L1PA 1JNSA 3NTPA 2IF4A 2N87A 2ZQTA 3JYJA 4WKAA 2PBCA 4WKHA 1WAWA 3AQUA 1NSGA 4DT4A 2A3EA 1J4IA 3UQIA 4R0XA 5DF0A 3KCEA 1E6PA 2KO7A 3B9DA 3ARTA 3UQBA 5GPRA 4IQ2A 3CH9A 1B6CA 3PR9A 3FY1A 4G2PA 3B9EA 1QZ2A 2RQSA 3ARVA 4Z2JA 3ALFA 3ARXA 3KAGA 4DROA 1D2KA 2ITKA 1Q6HA 1C9HA 4DZ3A 1NWUA 3ODKA 2FDMA 1Q1CA 4S3KA 5HW7A 5HBFA 2MPHA 4DRQA 2WM0A 4L72B 1EIBA 1W9PA 2DSUA 1NMWA 3CZ8A 1HJWA 1M5YA 3JXVA 2MLZA 5DO2A 1QPLA 4ODPA 5D75A 3O5EA 1LJYA 2JZVA 4URIA 4L3NA 2XP9A 2B31A 2O9OA 2DT1A 3O5QA 3GPKA 3WD0A 3AROA 4N19A 3I6CA 2ZR5A 3IKDA 4G50A 1TCOC 4KR0B 1HKIA 4MPKA 4MSPA 3UI4A 1SYTA 3NI6A 3IKGA 5JH8A 4Z2HA 1KFWA 1IX5A 1N1AA 1LG2A 3CHFA 1FKDA 1ROTA 3IHZA 1SR0A 4U84A 3O5FA 5DEZA 3O5DA 3VAWA 2XP5A 2MLXA 4DWSC 4C02B 4DH0A 2DT2A 4LAWA 1HJVA 1H0GA 1FFRA 1LG1A 4ZS6A 3PRBA 3CGMA 3PA7A 4TW7A 4NZCA 3UQAA 2PPNA 2QF8A 1E9LA 2DT3A 4BF8A 4Z2LA 1BKFA 4DIPA 3UF8A 1U79A 1ZBWA 1NH6A 4GGQA 1D7JA 4ML4A 3ARSA 2KFWA 4ITZA 1ITXA 4WK9A 4Z2KA 4ODKA 2F21A 4J4NA 1FKLA 3O5PA 2DG4A 2K8IA 2MLYA 3ARYA 1OGBA 1W9UA 1F40A 1GPFA 3OA5A 1FKBA 1NWRA 4JFMA 4P8WA 4JFLA 3G6LA 4Z2GA 2WLZA 5DIUA 4MGVA 2M08A 2DG3A 4MNLA 1E15A 4IPXA 3WQVA 5HWBA 4MNKA 2RUDA 2WK2A 2MF9A 1LQ0A 2PV2A 4O2TA 4W9PA 2F2DA 1PBKA 1FKKA 3ARWA 3AS3A 5B8IC 1J4RA 4WKFA 4Q22A 4DRPA 1EQ3A 1W1YA 3KABA 1E6ZA 1JVWA 4MTVA 4R5EA 1J6YA 5DITA 1T11A 2LPVA 2DT0A 1ZK6A 1K9TA 4W5UA 1FJDA 4J4OA 2KR7A 3W4RA 1HJXA 1Q6IA 1FD9A 3ALGA 1GOIA 3ARQA 1OGGA 3IK8A 4MNJA 1BL4A 4DRKA 3CGNA 3G6MA 1LL4A 1D7HA 1ZL1A 2KE0A 3RM9A 4IT4A 3KAFA 4IT6A 4ZPWR 4TW8A 1KT1A 1W1VA 5HT1A 3TC5A 1VF8A 4S3JA 4LGXA 4DWSD 2KI3A 2LGOA 4WIWA 3JYMA 3O5GA 3WQWA 1ROUA 5HWCA 1A7XA 2RUCA 4QIBA 5J6EA 1NMVA 4ZPVR 3ARPA 1EHNA 3WD1A 4DWSB 1CTNA 4ODMA 2AOSA 1FKSA 5GQBA 3RFWA 4HARA 2XP6A 1XHGA 2ZR4A 4QT3A 2LKNA 3BXWA 2PI6A 4ZPTR 3TDBA 1FKHA 1LL7A 1OWQA 2PV1A 4JFJA 4DRJA 1JNDA 2O92A 4JFIA 4JYSA 2XPAA 4AY1A 3KADA 3PRAA 3KAIA 2IUZA 3WD3A 4TYOA 3O5KA 3AS1A 1W1TA 3KACA 5I98A 1F8AB 1W9VA 1W1PA 1Q6UA 2ZQSA 1EYMA 4ODLA 3EY6A 1FKJA 3RM8A 1WB0A 1HXVA 3ARUA 2G41A 3O5MA 3O5JA 1E6NA 3WD2A 4P8VA 5HTGA 2FKEA 3TCZA 3LUOA 3H9RB 3O5RA 3UI6A 1FKIA 2A3CA 3RGCA 1UR8A 2XP8A 4JFKA 4ODNA 4QT2A 1X6LA 2ZR6A 2RSEA 1FFQA 1HKKA 1ZBVA 2OLHA 2RURA 2DG9A 3CHEA 2ZQUA 3O5LA 3UI5A 1Y0OA 1UR9A 4WJXA 1TFVA 4DRIA 4P8XA 3WIJA 2D9FA 2DSZA 3WKZA 4FAPA 1FKRA 2A3BA 2PV3A 5HW8A 4Q7NA 4NNRA 5HW6A 4DRHA 2YBTA 1ZBCA 1ZU8A 2DSWA 2KGJA 2PPOA 3ARRA 4ODRA 3B7XA 3ARZA 4ODQA 3WL1A 2ZQVA 1XRVA 2VN1A 4TW6A 4TNSA 1X6NA 3B9AA 4PTMA 1HKMA 3RM4A 3AS0A 3WL0A 3O5IA 2UZ5A 4Z2IA 4FN2A 5HUAA 4MAVA 4NSBA 3FXYA 1GUVA 5DIVA 4QZVB 4TX0A 2FAPA 4W9QA 4DWSA 3CHDA 4ODOA 3CHCA 2L2SA 4IQCA 1FKFA 3WH0A 5GPGA 3KZ7A 3PRDA 3QOKA 4MNMA 1NWSA 1QPFA 3FAPA 2XP4A 1O6IA 4XAKA 2XP3A 4W9OA 1JNEA 4HBOA 4DZ2A 1LL6A 4LAYA 4GIVA 1P5QA 2G8ZA 2ESCA 1RD6A 1J4HA 4DRNA 4U86A 2M1IA 2OFNA 2MNTA 2WLYA 3MDYB 2XPBA 2F4EA 3RMEA 2DSVA 3OOBA 1PINA 1W26A 1KT0A 2VCDA 2A3AA 3AS2A 1H0IA 3WD4A 1FAPA 1NWTA 1HKJA 2XP7A 1ZBKA 1JNTA 1ZB5A 2DPEA 4HBEA 4KQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5O A;  2JZV A;  5BXJ A;  4DRP A;  2Q5A A;  1EQ3 A;  1YW5 A;  2XP9 A;  2ZR6 A;  2RSE A;  3KAB A;  3O5Q A;  5HKG A;  3GPK A;  1FKT A;  1YAT A;  3NRK A;  4N19 A;  4DRM A;  2RUR A;  4U85 A;  2LJ4 A;  1JVW A;  3I6C A;  2ZR5 A;  3IKD A;  4G50 A;  1J6Y A;  1TCO C;  2DG9 A;  2ZQU A;  3O5L A;  4LAX A;  5DIT A;  2Y78 A;  1D6O A;  1T11 A;  1Y0O A;  4MSP A;  2LPV A;  3UI5 A;  3UI4 A;  3NI6 A;  3IKG A;  1ZCN A;  1ZK6 A;  3KAH A;  1FJD A;  4J4O A;  2AWG A;  1N1A A;  2KR7 A;  2RUQ A;  1R9H A;  4DRI A;  2D9F A;  1FKD A;  1Q6I A;  1FD9 A;  1ROT A;  3IHZ A;  4U84 A;  4FAP A;  1FKR A;  3O5F A;  3O5D A;  2PV3 A;  3VAW A;  2PPP A;  4LAV A;  3IK8 A;  2XP5 A;  1BL4 A;  2MLX A;  1D7I A;  5HW8 A;  4DRK A;  1FKG A;  2M2A A;  4NNR A;  4C02 B;  4DRH A;  5HW6 A;  1JNS A;  1L1P A;  3CGN A;  4DH0 A;  3NTP A;  4LAW A;  2IF4 A;  2KGJ A;  1D7H A;  2PPO A;  2KE0 A;  2N87 A;  2ZQT A;  3KAF A;  4ODR A;  3PRB A;  3JYJ A;  3B7X A;  4TW8 A;  4ODQ A;  1KT1 A;  5HT1 A;  2ZQV A;  4TW6 A;  2VN1 A;  3TC5 A;  3CGM A;  2PBC A;  3PA7 A;  4TNS A;  4TW7 A;  3UQA A;  3O5I A;  2UZ5 A;  2KI3 A;  2LGO A;  1NSG A;  3JYM A;  4FN2 A;  5HUA A;  4DT4 A;  2PPN A;  1J4I A;  3UQI A;  3O5G A;  4R0X A;  4BF8 A;  1BKF A;  1ROU A;  5DIV A;  3UF8 A;  1U79 A;  1A7X A;  2RUC A;  3KCE A;  1D7J A;  4GGQ A;  4QIB A;  2FAP A;  2KFW A;  2KO7 A;  4TX0 A;  1NMV A;  4ITZ A;  4W9Q A;  5J6E A;  3UQB A;  4DRN A;  4ODO A;  4IQ2 A;  4ODK A;  4ODM A;  2F21 A;  2L2S A;  1FKS A;  4J4N A;  3RFW A;  4IQC A;  1FKF A;  3WH0 A;  1FKL A;  5GPG A;  1B6C A;  3KZ7 A;  3O5P A;  2DG4 A;  2K8I A;  2MLY A;  2XP6 A;  2ZR4 A;  3PRD A;  4G2P A;  4QT3 A;  4DIP A;  2LKN A;  1F40 A;  1QZ2 A;  2RQS A;  3TDB A;  1FKH A;  1QPF A;  3FAP A;  1FKB A;  3KAG A;  2PV1 A;  4JFJ A;  2XP4 A;  4JFM A;  4DRJ A;  4DRO A;  2XP3 A;  4W9O A;  4JFI A;  4JFL A;  4JYS A;  2ITK A;  2XPA A;  1Q6H A;  3KAD A;  1C9H A;  4DZ2 A;  4LAY A;  4GIV A;  1P5Q A;  4DZ3 A;  3KAI A;  3ODK A;  1J4H A;  5DIU A;  1Q1C A;  4TYO A;  4U86 A;  3O5K A;  4MGV A;  2M1I A;  2M08 A;  3KAC A;  2DG3 A;  2MPH A;  5HW7 A;  2OFN A;  2MNT A;  3MDY B;  5I98 A;  4DRQ A;  1F8A B;  2XPB A;  2F4E A;  4IPX A;  1Q6U A;  2ZQS A;  1EYM A;  5HWB A;  3OOB A;  1PIN A;  2RUD A;  4ODL A;  3EY6 A;  2MF9 A;  2PV2 A;  4W9P A;  4O2T A;  1FKJ A;  2F2D A;  1W26 A;  1KT0 A;  2VCD A;  1PBK A;  5HWC A;  1NMW A;  1HXV A;  1FKK A;  3O5M A;  1FAP A;  3O5J A;  1M5Y A;  5B8I C;  1J4R A;  2XP7 A;  5HTG A;  3JXV A;  2FKE A;  3TCZ A;  2MLZ A;  1QPL A;  3H9R B;  3LUO A;  3O5R A;  3UI6 A;  1FKI A;  3RGC A;  1JNT A;  4ODP A;  5D75 A;  2XP8 A;  4JFK A;  4ODN A;  4QT2 A;  3O5E A; 
#chains in the Genus database with same CATH topology
 3O5O A;  5BXJ A;  2Q5A A;  1YW5 A;  5HKG A;  1FKT A;  1YAT A;  3NRK A;  4DRM A;  4U85 A;  2LJ4 A;  1E6R A;  3B8S A;  4LAX A;  2Y78 A;  1D6O A;  1EDQ A;  4P8U A;  1WNO A;  1ZCN A;  3KAH A;  2AWG A;  2RUQ A;  1R9H A;  3GU0 A;  2YBU A;  2PPP A;  4LAV A;  1D7I A;  1FKG A;  2M2A A;  1L1P A;  1JNS A;  3NTP A;  2IF4 A;  2N87 A;  2ZQT A;  3JYJ A;  4WKA A;  2PBC A;  4WKH A;  1WAW A;  3AQU A;  1NSG A;  4DT4 A;  2A3E A;  1J4I A;  3UQI A;  4R0X A;  5DF0 A;  3KCE A;  1E6P A;  2KO7 A;  3B9D A;  3ART A;  3UQB A;  5GPR A;  4IQ2 A;  3CH9 A;  1B6C A;  3PR9 A;  3FY1 A;  4G2P A;  3B9E A;  1QZ2 A;  2RQS A;  3ARV A;  4Z2J A;  3ALF A;  3ARX A;  3KAG A;  4DRO A;  1D2K A;  2ITK A;  1Q6H A;  1C9H A;  4DZ3 A;  1NWU A;  3ODK A;  2FDM A;  1Q1C A;  4S3K A;  5HW7 A;  5HBF A;  2MPH A;  4DRQ A;  2WM0 A;  1JCH B;  4L72 B;  1EIB A;  1W9P A;  2DSU A;  1NMW A;  3CZ8 A;  1HJW A;  1M5Y A;  1E44 A;  3JXV A;  2MLZ A;  5DO2 A;  1QPL A;  4ODP A;  5D75 A;  1LJY A;  3O5E A;  2JZV A;  4URI A;  4L3N A;  2XP9 A;  2B31 A;  2O9O A;  2DT1 A;  3O5Q A;  3GPK A;  3WD0 A;  3ARO A;  4N19 A;  3I6C A;  2ZR5 A;  3IKD A;  4G50 A;  1TCO C;  4KR0 B;  1HKI A;  4MPK A;  4MSP A;  3UI4 A;  1SYT A;  2ETN A;  3NI6 A;  3IKG A;  5JH8 A;  4Z2H A;  1KFW A;  1IX5 A;  1N1A A;  1LG2 A;  3CHF A;  1FKD A;  1ROT A;  3IHZ A;  1SR0 A;  4U84 A;  3O5F A;  5DEZ A;  3O5D A;  3VAW A;  2XP5 A;  2MLX A;  4DWS C;  4C02 B;  4DH0 A;  2DT2 A;  4LAW A;  1HJV A;  1H0G A;  1FFR A;  1LG1 A;  4ZS6 A;  3PRB A;  3CGM A;  3PA7 A;  4TW7 A;  4NZC A;  3UQA A;  2PPN A;  2QF8 A;  1E9L A;  2DT3 A;  4BF8 A;  4Z2L A;  1BKF A;  4DIP A;  3UF8 A;  1U79 A;  1ZBW A;  1NH6 A;  4GGQ A;  1D7J A;  4ML4 A;  3ARS A;  2KFW A;  4ITZ A;  1ITX A;  4WK9 A;  4Z2K A;  4ODK A;  2F21 A;  4J4N A;  1FKL A;  3O5P A;  2DG4 A;  2K8I A;  2MLY A;  3ARY A;  1OGB A;  1W9U A;  1F40 A;  1GPF A;  3OA5 A;  1FKB A;  1NWR A;  2P4V A;  4JFM A;  4P8W A;  4JFL A;  3G6L A;  4Z2G A;  2WLZ A;  5DIU A;  4MGV A;  2M08 A;  2DG3 A;  4MNL A;  1E15 A;  4IPX A;  3WQV A;  5HWB A;  4MNK A;  2RUD A;  2WK2 A;  2MF9 A;  1LQ0 A;  2PV2 A;  4O2T A;  4W9P A;  2F2D A;  1PBK A;  1FKK A;  3ARW A;  3AS3 A;  5B8I C;  1J4R A;  4WKF A;  4Q22 A;  4DRP A;  1EQ3 A;  1W1Y A;  3KAB A;  1E6Z A;  1JVW A;  4MTV A;  4R5E A;  1J6Y A;  5DIT A;  1T11 A;  2LPV A;  2DT0 A;  1ZK6 A;  1K9T A;  4W5U A;  1FJD A;  4J4O A;  2KR7 A;  3W4R A;  1HJX A;  1Q6I A;  1FD9 A;  3GTY X;  3ALG A;  1GOI A;  3ARQ A;  1OGG A;  3IK8 A;  4MNJ A;  1BL4 A;  4DRK A;  3CGN A;  3G6M A;  1LL4 A;  1D7H A;  1ZL1 A;  2KE0 A;  3RM9 A;  4IT4 A;  3KAF A;  4IT6 A;  4ZPW R;  4TW8 A;  1KT1 A;  1W1V A;  1GRJ A;  5HT1 A;  3TC5 A;  1VF8 A;  4S3J A;  4LGX A;  4DWS D;  2KI3 A;  2LGO A;  4WIW A;  3JYM A;  3O5G A;  3WQW A;  1ROU A;  5HWC A;  1A7X A;  2RUC A;  4QIB A;  5J6E A;  1NMV A;  4ZPV R;  3ARP A;  1EHN A;  3WD1 A;  4DWS B;  1CTN A;  4ODM A;  2AOS A;  1FKS A;  5GQB A;  3RFW A;  4HAR A;  2XP6 A;  1XHG A;  2ZR4 A;  4QT3 A;  2LKN A;  3BXW A;  2PI6 A;  4ZPT R;  3TDB A;  1FKH A;  1LL7 A;  1OWQ A;  2PV1 A;  4JFJ A;  4DRJ A;  1JND A;  2O92 A;  4JFI A;  4JYS A;  2XPA A;  4AY1 A;  3KAD A;  3PRA A;  3KAI A;  2IUZ A;  3WD3 A;  4TYO A;  3O5K A;  3AS1 A;  1W1T A;  3KAC A;  5I98 A;  1F8A B;  1W9V A;  1W1P A;  1Q6U A;  2ZQS A;  1EYM A;  4ODL A;  3EY6 A;  1FKJ A;  3RM8 A;  1WB0 A;  1HXV A;  3ARU A;  2G41 A;  3O5M A;  2B5U B;  3O5J A;  1E6N A;  3WD2 A;  4P8V A;  5HTG A;  2FKE A;  3TCZ A;  3LUO A;  3H9R B;  3O5R A;  3UI6 A;  1FKI A;  2A3C A;  3RGC A;  1UR8 A;  2XP8 A;  4JFK A;  4ODN A;  4QT2 A;  1X6L A;  2ZR6 A;  2RSE A;  1FFQ A;  1HKK A;  1ZBV A;  2OLH A;  2RUR A;  2DG9 A;  3CHE A;  2ZQU A;  3O5L A;  3UI5 A;  1Y0O A;  1UR9 A;  4WJX A;  1TFV A;  4DRI A;  4P8X A;  3WIJ A;  2D9F A;  2DSZ A;  3WKZ A;  3BMB A;  4FAP A;  1FKR A;  2A3B A;  4HBE A;  2PV3 A;  2F23 A;  5HW8 A;  4Q7N A;  4NNR A;  5HW6 A;  4DRH A;  2YBT A;  1ZBC A;  1ZU8 A;  2DSW A;  2KGJ A;  2PPO A;  3ARR A;  4ODR A;  3B7X A;  3ARZ A;  4ODQ A;  3WL1 A;  2ZQV A;  1XRV A;  2VN1 A;  4TW6 A;  4TNS A;  1X6N A;  3B9A A;  4PTM A;  1HKM A;  3RM4 A;  3AS0 A;  3WL0 A;  3O5I A;  2UZ5 A;  4Z2I A;  4FN2 A;  5HUA A;  4MAV A;  4NSB A;  3FXY A;  1GUV A;  5DIV A;  4QZV B;  4TX0 A;  2FAP A;  4W9Q A;  4DWS A;  3CHD A;  4ODO A;  3CHC A;  2L2S A;  4IQC A;  1FKF A;  3WH0 A;  5GPG A;  3KZ7 A;  3PRD A;  3QOK A;  4MNM A;  1NWS A;  1QPF A;  3FAP A;  2XP4 A;  1O6I A;  4XAK A;  2XP3 A;  4W9O A;  1JNE A;  4HBO A;  4DZ2 A;  1LL6 A;  4LAY A;  4GIV A;  1P5Q A;  2G8Z A;  3EIP A;  2ESC A;  1RD6 A;  1J4H A;  4DRN A;  4U86 A;  2M1I A;  2EUL A;  2OFN A;  2MNT A;  2WLY A;  3MDY B;  2XPB A;  2F4E A;  3RME A;  2DSV A;  3OOB A;  1PIN A;  1W26 A;  1KT0 A;  2VCD A;  2A3A A;  3AS2 A;  1H0I A;  3WD4 A;  1FAP A;  1NWT A;  4UDM A;  1HKJ A;  2XP7 A;  1ZBK A;  1JNT A;  1ZB5 A;  2DPE A;  2PN0 A;  4KQZ A; 
#chains in the Genus database with same CATH homology
 3O5O A;  5BXJ A;  2Q5A A;  1YW5 A;  5HKG A;  1FKT A;  1YAT A;  3NRK A;  4DRM A;  4U85 A;  2LJ4 A;  1E6R A;  3B8S A;  4LAX A;  2Y78 A;  1D6O A;  1EDQ A;  4P8U A;  1WNO A;  1ZCN A;  3KAH A;  2AWG A;  2RUQ A;  1R9H A;  2YBU A;  2PPP A;  4LAV A;  1D7I A;  1FKG A;  2M2A A;  1L1P A;  1JNS A;  3NTP A;  2IF4 A;  2N87 A;  2ZQT A;  3JYJ A;  4WKA A;  2PBC A;  4WKH A;  1WAW A;  3AQU A;  1NSG A;  4DT4 A;  2A3E A;  1J4I A;  3UQI A;  4R0X A;  5DF0 A;  3KCE A;  1E6P A;  2KO7 A;  3B9D A;  3ART A;  3UQB A;  5GPR A;  4IQ2 A;  3CH9 A;  1B6C A;  3PR9 A;  3FY1 A;  4G2P A;  3B9E A;  1QZ2 A;  2RQS A;  3ARV A;  4Z2J A;  3ALF A;  3ARX A;  3KAG A;  4DRO A;  1D2K A;  2ITK A;  1Q6H A;  1C9H A;  4DZ3 A;  1NWU A;  3ODK A;  2FDM A;  1Q1C A;  4S3K A;  5HW7 A;  5HBF A;  2MPH A;  4DRQ A;  2WM0 A;  4L72 B;  1EIB A;  1W9P A;  2DSU A;  1NMW A;  3CZ8 A;  1HJW A;  1M5Y A;  3JXV A;  2MLZ A;  5DO2 A;  1QPL A;  4ODP A;  5D75 A;  3O5E A;  1LJY A;  2JZV A;  4URI A;  4L3N A;  2XP9 A;  2B31 A;  2O9O A;  2DT1 A;  3O5Q A;  3GPK A;  3WD0 A;  3ARO A;  4N19 A;  3I6C A;  2ZR5 A;  3IKD A;  4G50 A;  1TCO C;  4KR0 B;  1HKI A;  4MPK A;  4MSP A;  3UI4 A;  1SYT A;  3NI6 A;  3IKG A;  5JH8 A;  4Z2H A;  1KFW A;  1IX5 A;  1N1A A;  1LG2 A;  3CHF A;  1FKD A;  1ROT A;  3IHZ A;  1SR0 A;  4U84 A;  3O5F A;  5DEZ A;  3O5D A;  3VAW A;  2XP5 A;  2MLX A;  4DWS C;  4C02 B;  4DH0 A;  2DT2 A;  4LAW A;  1HJV A;  1H0G A;  1FFR A;  1LG1 A;  4ZS6 A;  3PRB A;  3CGM A;  3PA7 A;  4TW7 A;  4NZC A;  3UQA A;  2PPN A;  2QF8 A;  1E9L A;  2DT3 A;  4BF8 A;  4Z2L A;  1BKF A;  4DIP A;  3UF8 A;  1U79 A;  1ZBW A;  1NH6 A;  4GGQ A;  1D7J A;  4ML4 A;  3ARS A;  2KFW A;  4ITZ A;  1ITX A;  4WK9 A;  4Z2K A;  4ODK A;  2F21 A;  4J4N A;  1FKL A;  3O5P A;  2DG4 A;  2K8I A;  2MLY A;  3ARY A;  1OGB A;  1W9U A;  1F40 A;  1GPF A;  3OA5 A;  1FKB A;  1NWR A;  4JFM A;  4P8W A;  4JFL A;  3G6L A;  4Z2G A;  2WLZ A;  5DIU A;  4MGV A;  2M08 A;  2DG3 A;  4MNL A;  1E15 A;  4IPX A;  3WQV A;  5HWB A;  4MNK A;  2RUD A;  2WK2 A;  2MF9 A;  1LQ0 A;  2PV2 A;  4O2T A;  4W9P A;  2F2D A;  1PBK A;  1FKK A;  3ARW A;  3AS3 A;  5B8I C;  1J4R A;  4WKF A;  4Q22 A;  4DRP A;  1EQ3 A;  1W1Y A;  3KAB A;  1E6Z A;  1JVW A;  4MTV A;  4R5E A;  1J6Y A;  5DIT A;  1T11 A;  2LPV A;  2DT0 A;  1ZK6 A;  1K9T A;  4W5U A;  1FJD A;  4J4O A;  2KR7 A;  3W4R A;  1HJX A;  1Q6I A;  1FD9 A;  3ALG A;  1GOI A;  3ARQ A;  1OGG A;  3IK8 A;  4MNJ A;  1BL4 A;  4DRK A;  3CGN A;  3G6M A;  1LL4 A;  1D7H A;  1ZL1 A;  2KE0 A;  3RM9 A;  4IT4 A;  3KAF A;  4IT6 A;  4ZPW R;  4TW8 A;  1KT1 A;  1W1V A;  5HT1 A;  3TC5 A;  1VF8 A;  4S3J A;  4LGX A;  4DWS D;  2KI3 A;  2LGO A;  4WIW A;  3JYM A;  3O5G A;  3WQW A;  1ROU A;  5HWC A;  1A7X A;  2RUC A;  4QIB A;  5J6E A;  1NMV A;  4ZPV R;  3ARP A;  1EHN A;  3WD1 A;  4DWS B;  1CTN A;  4ODM A;  2AOS A;  1FKS A;  5GQB A;  3RFW A;  4HAR A;  2XP6 A;  1XHG A;  2ZR4 A;  4QT3 A;  2LKN A;  3BXW A;  2PI6 A;  4ZPT R;  3TDB A;  1FKH A;  1LL7 A;  1OWQ A;  2PV1 A;  4JFJ A;  4DRJ A;  1JND A;  2O92 A;  4JFI A;  4JYS A;  2XPA A;  4AY1 A;  3KAD A;  3PRA A;  3KAI A;  2IUZ A;  3WD3 A;  4TYO A;  3O5K A;  3AS1 A;  1W1T A;  3KAC A;  5I98 A;  1F8A B;  1W9V A;  1W1P A;  1Q6U A;  2ZQS A;  1EYM A;  4ODL A;  3EY6 A;  1FKJ A;  3RM8 A;  1WB0 A;  1HXV A;  3ARU A;  2G41 A;  3O5M A;  3O5J A;  1E6N A;  3WD2 A;  4P8V A;  5HTG A;  2FKE A;  3TCZ A;  3LUO A;  3H9R B;  3O5R A;  3UI6 A;  1FKI A;  2A3C A;  3RGC A;  1UR8 A;  2XP8 A;  4JFK A;  4ODN A;  4QT2 A;  1X6L A;  2ZR6 A;  2RSE A;  1FFQ A;  1HKK A;  1ZBV A;  2OLH A;  2RUR A;  2DG9 A;  3CHE A;  2ZQU A;  3O5L A;  3UI5 A;  1Y0O A;  1UR9 A;  4WJX A;  1TFV A;  4DRI A;  4P8X A;  3WIJ A;  2D9F A;  2DSZ A;  3WKZ A;  4FAP A;  1FKR A;  2A3B A;  2PV3 A;  5HW8 A;  4Q7N A;  4NNR A;  5HW6 A;  4DRH A;  2YBT A;  1ZBC A;  1ZU8 A;  2DSW A;  2KGJ A;  2PPO A;  3ARR A;  4ODR A;  3B7X A;  3ARZ A;  4ODQ A;  3WL1 A;  2ZQV A;  1XRV A;  2VN1 A;  4TW6 A;  4TNS A;  1X6N A;  3B9A A;  4PTM A;  1HKM A;  3RM4 A;  3AS0 A;  3WL0 A;  3O5I A;  2UZ5 A;  4Z2I A;  4FN2 A;  5HUA A;  4MAV A;  4NSB A;  3FXY A;  1GUV A;  5DIV A;  4QZV B;  4TX0 A;  2FAP A;  4W9Q A;  4DWS A;  3CHD A;  4ODO A;  3CHC A;  2L2S A;  4IQC A;  1FKF A;  3WH0 A;  5GPG A;  3KZ7 A;  3PRD A;  3QOK A;  4MNM A;  1NWS A;  1QPF A;  3FAP A;  2XP4 A;  1O6I A;  4XAK A;  2XP3 A;  4W9O A;  1JNE A;  4HBO A;  4DZ2 A;  1LL6 A;  4LAY A;  4GIV A;  1P5Q A;  2G8Z A;  2ESC A;  1RD6 A;  1J4H A;  4DRN A;  4U86 A;  2M1I A;  2OFN A;  2MNT A;  2WLY A;  3MDY B;  2XPB A;  2F4E A;  3RME A;  2DSV A;  3OOB A;  1PIN A;  1W26 A;  1KT0 A;  2VCD A;  2A3A A;  3AS2 A;  1H0I A;  3WD4 A;  1FAP A;  1NWT A;  1HKJ A;  2XP7 A;  1ZBK A;  1JNT A;  1ZB5 A;  2DPE A;  4HBE A;  4KQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...