4DROA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with (1r)-3-(3,4-dimethoxyphenyl)-1-phenylpropyl (2s)-1-{[(1r,2s)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidine-2-carboxylate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4droA00
2XP9A 4C02B 4DRKA 5BXJA 3O5GA 2VN1A 1J4IA 2RSEA 2RURA 2ZR6A 4U85A 5GPGA 1FKTA 5HWBA 2LGOA 2RUCA 4O2TA 4TW6A 2KI3A 3CGNA 2RUDA 3UI5A 4DIPA 1F40A 4ODQA 1T11A 4LAYA 4W9QA 1C9HA 2DG9A 5HW6A 5I98A 1JNTA 2AWGA 3PRDA 1JNSA 4JFLA 1NMWA 2XP5A 3KABA 3OOBA 1L1PA 1FKJA 2XPAA 2PV2A 4ODOA 2XP7A 4J4NA 5D75A 4ITZA 3TC5A 3LUOA 4DRHA 4BF8A 2KO7A 5HW7A 5HUAA 1A7XA 1FKIA 2M2AA 2L2SA 3UI4A 2OFNA 4DRIA 2XP6A 2IF4A 1D6OA 2PV1A 1U79A 3PRBA 4JFJA 1B6CA 2XP3A 3O5MA 4TYOA 2MLXA 2MF9A 3TDBA 1HXVA 4ODMA 3MDYB 1ROUA 1BKFA 4GGQA 2MPHA 3B7XA 2F4EA 4FN2A 4LAWA 5DITA 5HW8A 3UF8A 3JYMA 1R9HA 1D7IA 5HT1A 4FAPA 1FKRA 2XP8A 3KCEA 3O5DA 4U86A 1W26A 3TCZA 2PV3A 2DG3A 2LJ4A 4QT2A 3NI6A 3UI6A 1FKDA 2FKEA 1FKLA 1FKKA 1NSGA 4QIBA 2KGJA 3UQIA 2VCDA 3O5RA 4DH0A 1FKHA 2M1IA 4ODRA 5B8IC 1PINA 4IQCA 1ROTA 4DRNA 4JFKA 1F8AB 3KZ7A 1JVWA 2ITKA 4W9PA 2ZR4A 4QT3A 4DT4A 4GIVA 4DRMA 4TW7A 4ODPA 5J6EA 3IKGA 3O5FA 3PA7A 3UQBA 4TNSA 3KAHA 4U84A 1BL4A 4N19A 5DIVA 4R0XA 1PBKA 1NMVA 3GPKA 3KADA 1QPLA 1Y0OA 3KAGA 4TX0A 3KAFA 2PPPA 2ZQVA 1P5QA 3O5LA 4DZ2A 3O5IA 2Q5AA 2N87A 2ZQTA 4ODKA 3EY6A 4DRJA 4JFMA 3RFWA 1N1AA 2MNTA 1FKGA 2F2DA 3JYJA 1FJDA 1FKBA 2Y78A 3NTPA 2FAPA 3ODKA 1Q6IA 1FKSA 3NRKA 5DIUA 4JFIA 4TW8A 5HTGA 3JXVA 2RQSA 4LAXA 1QPFA 4MGVA 4MSPA 1EYMA 3O5OA 1KT0A 2K8IA 4IPXA 2PPOA 4JYSA 1KT1A 1QZ2A 1ZCNA 3O5EA 4G2PA 1FD9A 2JZVA 3O5JA 2M08A 1D7JA 2ZR5A 2ZQUA 4J4OA 3IHZA 4IQ2A 3IKDA 2D9FA 3H9RB 2LPVA 1Q6UA 1YATA 1Q6HA 1TCOC 2RUQA 2XPBA 3O5KA 2ZQSA 4LAVA 3WH0A 2LKNA 4DRQA 2MLYA 2MLZA 2XP4A 3O5PA 1M5YA 4ODNA 3VAWA 1J4RA 3I6CA 4NNRA 5HKGA 2F21A 3UQAA 1J6YA 3IK8A 2KE0A 3RGCA 4DRPA 2UZ5A 4W9OA 1Q1CA 4DROA 2KFWA 3KACA 3CGMA 1YW5A 2KR7A 4G50A 1FAPA 3KAIA 4DZ3A 2PPNA 3O5QA 1D7HA 5HWCA 3FAPA 1ZK6A 2DG4A 4ODLA 1EQ3A 1FKFA 2PBCA 1J4HA
chains in the Genus database with same CATH superfamily
4C02B 1HJVA 2VN1A 2RSEA 2RURA 2ZR6A 4U85A 3ARQA 3AS3A 4L3NA 1LQ0A 1F40A 4LAYA 5HW6A 5I98A 1XRVA 1NMWA 1RD6A 4ITZA 3RM8A 4AY1A 1HJWA 2M2AA 1W9UA 2XP6A 2IF4A 3ALGA 3PRBA 1B6CA 2FDMA 3O5MA 2O9OA 3TDBA 4Q22A 5DITA 2F4EA 4LAWA 3AS2A 1R9HA 1D7IA 2WM0A 1W9PA 2M1IA 5B8IC 3B9EA 1PINA 2DSWA 4JFKA 4W9PA 1ZB5A 4QT3A 3WD4A 3IKGA 4MPKA 4P8XA 3PA7A 5DO2A 4TNSA 4KQZA 1O6IA 4Z2KA 3KAHA 3WQVA 1IX5A 2EULA 3B9DA 4Z2LA 4QZVB 3KADA 1LL4A 1ZBCA 1P5QA 3O5LA 4DZ2A 3O5IA 3ARRA 4MAVA 4DWSB 3EY6A 4JFMA 3NTPA 1ZBWA 1OGBA 1FKSA 4ZS6A 4DWSA 1EYMA 3B9AA 2K8IA 1KT1A 1ZCNA 1GUVA 3RM9A 1KFWA 3IKDA 3AS0A 2LPVA 5DF0A 3WQWA 1YATA 2OLHA 3CHCA 2A3BA 2XP4A 2MLZA 3O5PA 4ODNA 3VAWA 4WKHA 1JNDA 3I6CA 3UQAA 2F21A 3WL0A 4ML4A 4DRPA 3WL1A 1HKMA 2KR7A 1WB0A 1FAPA 3KAIA 4DZ3A 3G6MA 2PPNA 5GQBA 3FAPA 3ARUA 1EQ3A 3W4RA 2ZQSA 2PBCA 4ODKA 4ZPWR 3FY1A 3O5GA 1J4IA 2RUCA 3ARPA 3PR9A 4MNMA 4O2TA 4TW6A 4ODQA 4W9QA 1NWTA 3PRAA 2AWGA 3OA5A 3ARWA 4Z2JA 1JNSA 4URIA 4ODOA 4P8VA 3RMEA 3TC5A 3LUOA 4DRHA 1ZBVA 2KO7A 5HW7A 5HUAA 1A7XA 1LL6A 3UI4A 2OFNA 1CTNA 1E6RA 1D6OA 1H0GA 1NH6A 4JFJA 2XP3A 4TYOA 3B8SA 1WAWA 4ODMA 1ROUA 2MPHA 4Q7NA 5HW8A 3ARXA 2XP8A 4U86A 1NWUA 2LJ4A 3UI6A 1X6NA 2FKEA 1FKLA 1NSGA 2A3AA 2P4VA 3AROA 4QIBA 3UQIA 3O5RA 4DH0A 2O92A 1ROTA 1W1YA 4GIVA 4IT6A 1GOIA 3O5FA 3ALFA 4R0XA 3KAGA 4WIWA 1OGGA 2WLZA 2Q5AA 2N87A 2ZQTA 2DSVA 5JH8A 3RFWA 1N1AA 2F2DA 3BMBA 1FKBA 3ODKA 1Q6IA 3NRKA 4JFIA 3JXVA 4LAXA 4MSPA 1E6NA 4WK9A 1KT0A 4JYSA 3O5EA 1FD9A 1LG2A 2M08A 2ZQUA 3AS1A 4KR0B 1K9TA 3RM4A 2ETNA 3CHFA 1Q6UA 2AOSA 3WKZA 1TCOC 2XPBA 4LAVA 1JCHB 1E6PA 1GPFA 2LKNA 1J4RA 4NNRA 3GU0A 3IK8A 2F23A 2QF8A 3RGCA 1FFRA 4DROA 2KFWA 2WLYA 4G50A 3O5QA 4UDMA 3GTYX 4HARA 5BXJA 5HWBA 4DWSD 1FKTA 4MNKA 4P8UA 3UI5A 2DG9A 3PRDA 4JFLA 1LL7A 2XP5A 3G6LA 1L1PA 3QOKA 2XPAA 2B5UB 2XP7A 5D75A 4XAKA 2L2SA 4DRIA 3ARSA 4Z2HA 1X6LA 1LG1A 1ZU8A 2MF9A 5HBFA 3MDYB 1NWSA 1BKFA 3UF8A 2IUZA 1EDQA 1W1TA 5HT1A 1VF8A 4MTVA 4FAPA 1FKRA 3KCEA 1W26A 2DG3A 1ITXA 4QT2A 3NI6A 4WKAA 1FKKA 2KGJA 4DRNA 4IQCA 1F8AB 3KZ7A 2ITKA 2ZR4A 4TW7A 3WD2A 1W1VA 1NWRA 3UQBA 4U84A 4L72B 1BL4A 2G8ZA 5DIVA 1PBKA 1NMVA 2G41A 2DT2A 5DEZA 3KAFA 2PPPA 3WD0A 3CZ8A 3AQUA 4WJXA 4DRJA 2A3CA 3JYJA 1FKGA 1FJDA 1W9VA 2FAPA 2B31A 1UR8A 3ARZA 4TW8A 4MGVA 4ZPTR 3O5OA 2PPOA 4DT4A 1QZ2A 3O5JA 4PTMA 1D7JA 4R5EA 3ARYA 3IHZA 4WKFA 4P8WA 3H9RB 3CHEA 4DWSC 1H0IA 4S3KA 3O5KA 4MNJA 3WH0A 2DT3A 4DRQA 1M5YA 3WD3A 1J6YA 2KE0A 2UZ5A 4W9OA 3KACA 3CGMA 1XHGA 1EIBA 2WK2A 5HWCA 3WD1A 2DG4A 4ODLA 1FKFA 2DT0A 2RQSA 1J4HA 2XP9A 4DRKA 1D2KA 5GPGA 1TFVA 1HKKA 1HKIA 2LGOA 2KI3A 3CGNA 1OWQA 2RUDA 4DIPA 1T11A 1C9HA 1E44A 1JNTA 3OOBA 3KABA 1FKJA 2PV2A 4J4NA 1E6ZA 4S3JA 4MNLA 2DSUA 4BF8A 1FKIA 2ESCA 2PV1A 1U79A 4HBOA 2MLXA 1HXVA 4GGQA 3B7XA 4FN2A 3JYMA 1EHNA 1WNOA 1E9LA 3TCZA 3O5DA 3WIJA 2PV3A 3FXYA 1FKDA 1ZBKA 3EIPA 2DSZA 2VCDA 1FKHA 4ODRA 1UR9A 1JVWA 2DPEA 4Z2GA 1SYTA 4DRMA 5J6EA 2A3EA 4ODPA 2YBTA 4HBEA 2YBUA 3CH9A 2DT1A 1JNEA 4N19A 3GPKA 1W1PA 4ZPVR 1QPLA 1Y0OA 1FFQA 4LGXA 4TX0A 3ARTA 2ZQVA 2PN0A 2MNTA 1HJXA 2Y78A 5DIUA 5HTGA 1QPFA 4IPXA 4G2PA 2JZVA 4J4OA 1HKJA 4NZCA 4IQ2A 2D9FA 5GPRA 3ARVA 1Q6HA 4Z2IA 2RUQA 4NSBA 1E15A 2MLYA 2PI6A 3CHDA 5HKGA 3BXWA 1ZL1A 1SR0A 1Q1CA 4IT4A 1YW5A 1D7HA 1ZK6A 1LJYA 4W5UA 1GRJA 2ZR5A
chains in the Genus database with same CATH topology
4C02B 1HJVA 2VN1A 2RSEA 2RURA 2ZR6A 4U85A 3ARQA 3AS3A 4L3NA 1LQ0A 1F40A 4LAYA 5HW6A 5I98A 1XRVA 1NMWA 1RD6A 4ITZA 3RM8A 4AY1A 1HJWA 2M2AA 1W9UA 2XP6A 2IF4A 3ALGA 3PRBA 1B6CA 2FDMA 3O5MA 2O9OA 3TDBA 4Q22A 5DITA 2F4EA 4LAWA 3AS2A 1R9HA 1D7IA 2WM0A 1W9PA 2M1IA 5B8IC 3B9EA 1PINA 2DSWA 4JFKA 4W9PA 1ZB5A 4QT3A 3WD4A 3IKGA 4MPKA 4P8XA 3PA7A 5DO2A 4TNSA 4KQZA 1O6IA 4Z2KA 3KAHA 3WQVA 1IX5A 3B9DA 4Z2LA 4QZVB 3KADA 1LL4A 1ZBCA 1P5QA 3O5LA 4DZ2A 3O5IA 3ARRA 4MAVA 4DWSB 3EY6A 4JFMA 3NTPA 1ZBWA 1OGBA 1FKSA 4ZS6A 4DWSA 1EYMA 3B9AA 2K8IA 1KT1A 1ZCNA 1GUVA 3RM9A 1KFWA 3IKDA 3AS0A 2LPVA 5DF0A 3WQWA 1YATA 2OLHA 3CHCA 2A3BA 2XP4A 2MLZA 3O5PA 4ODNA 3VAWA 4WKHA 1JNDA 3I6CA 3UQAA 2F21A 3WL0A 4ML4A 4DRPA 3WL1A 1HKMA 2KR7A 1WB0A 1FAPA 3KAIA 4DZ3A 3G6MA 2PPNA 5GQBA 3FAPA 3ARUA 1EQ3A 3W4RA 2ZQSA 2PBCA 4ODKA 4ZPWR 3FY1A 3O5GA 1J4IA 2RUCA 3ARPA 3PR9A 4MNMA 4O2TA 4TW6A 4ODQA 4W9QA 1NWTA 3PRAA 2AWGA 3OA5A 3ARWA 4Z2JA 1JNSA 4URIA 4ODOA 4P8VA 3RMEA 3TC5A 3LUOA 4DRHA 1ZBVA 2KO7A 5HW7A 5HUAA 1A7XA 1LL6A 3UI4A 2OFNA 1CTNA 1E6RA 1D6OA 1H0GA 1NH6A 4JFJA 2XP3A 4TYOA 3B8SA 1WAWA 4ODMA 1ROUA 2MPHA 4Q7NA 5HW8A 3ARXA 2XP8A 4U86A 1NWUA 2LJ4A 3UI6A 1X6NA 2FKEA 1FKLA 1NSGA 2A3AA 3AROA 4QIBA 3UQIA 3O5RA 4DH0A 2O92A 1ROTA 1W1YA 4GIVA 4IT6A 1GOIA 3O5FA 3ALFA 4R0XA 3KAGA 4WIWA 1OGGA 2WLZA 2Q5AA 2N87A 2ZQTA 2DSVA 5JH8A 3RFWA 1N1AA 2F2DA 1FKBA 3ODKA 1Q6IA 3NRKA 4JFIA 3JXVA 4LAXA 4MSPA 1E6NA 4WK9A 1KT0A 4JYSA 3O5EA 1FD9A 1LG2A 2M08A 2ZQUA 3AS1A 4KR0B 1K9TA 3RM4A 3CHFA 1Q6UA 2AOSA 3WKZA 1TCOC 2XPBA 4LAVA 1E6PA 2LKNA 1GPFA 1J4RA 4NNRA 3IK8A 2QF8A 3RGCA 1FFRA 4DROA 2KFWA 2WLYA 4G50A 3O5QA 4HARA 5BXJA 5HWBA 4DWSD 1FKTA 4MNKA 4P8UA 3UI5A 2DG9A 3PRDA 4JFLA 1LL7A 2XP5A 3G6LA 1L1PA 3QOKA 2XPAA 2XP7A 5D75A 4XAKA 2L2SA 4DRIA 3ARSA 4Z2HA 1X6LA 1LG1A 1ZU8A 2MF9A 5HBFA 3MDYB 1NWSA 1BKFA 3UF8A 2IUZA 1EDQA 1W1TA 5HT1A 1VF8A 4MTVA 4FAPA 1FKRA 3KCEA 1W26A 2DG3A 1ITXA 4QT2A 3NI6A 4WKAA 1FKKA 2KGJA 4DRNA 4IQCA 1F8AB 3KZ7A 2ITKA 2ZR4A 4TW7A 3WD2A 1W1VA 1NWRA 3UQBA 4U84A 4L72B 1BL4A 2G8ZA 5DIVA 1PBKA 1NMVA 2G41A 2DT2A 5DEZA 3KAFA 2PPPA 3WD0A 3CZ8A 3AQUA 4WJXA 4DRJA 2A3CA 3JYJA 1FKGA 1FJDA 1W9VA 2FAPA 2B31A 1UR8A 3ARZA 4TW8A 4MGVA 4ZPTR 3O5OA 2PPOA 4DT4A 1QZ2A 3O5JA 4PTMA 1D7JA 4R5EA 3ARYA 3IHZA 4WKFA 4P8WA 3H9RB 3CHEA 4DWSC 1H0IA 4S3KA 3O5KA 4MNJA 3WH0A 2DT3A 4DRQA 1M5YA 3WD3A 1J6YA 2KE0A 2UZ5A 4W9OA 3KACA 3CGMA 1XHGA 1EIBA 2WK2A 5HWCA 3WD1A 2DG4A 4ODLA 1FKFA 2DT0A 2RQSA 1J4HA 2XP9A 4DRKA 1D2KA 5GPGA 1TFVA 1HKKA 1HKIA 2LGOA 2KI3A 3CGNA 1OWQA 2RUDA 4DIPA 1T11A 1C9HA 1JNTA 3OOBA 3KABA 1FKJA 2PV2A 4J4NA 1E6ZA 4S3JA 4MNLA 2DSUA 4BF8A 1FKIA 2ESCA 2PV1A 1U79A 4HBOA 2MLXA 1HXVA 4GGQA 3B7XA 4FN2A 3JYMA 1EHNA 1WNOA 1E9LA 3TCZA 3O5DA 3WIJA 2PV3A 3FXYA 1FKDA 1ZBKA 2DSZA 2VCDA 1FKHA 4ODRA 1UR9A 1JVWA 2DPEA 4Z2GA 1SYTA 4DRMA 5J6EA 2A3EA 4ODPA 2YBTA 4HBEA 2YBUA 3CH9A 2DT1A 1JNEA 4N19A 3GPKA 1W1PA 4ZPVR 1QPLA 1Y0OA 1FFQA 4LGXA 4TX0A 3ARTA 2ZQVA 2MNTA 1HJXA 2Y78A 5DIUA 5HTGA 1QPFA 4IPXA 4G2PA 2JZVA 4J4OA 1HKJA 4NZCA 4IQ2A 2D9FA 5GPRA 3ARVA 1Q6HA 4Z2IA 2RUQA 4NSBA 1E15A 2MLYA 2PI6A 3CHDA 5HKGA 3BXWA 1ZL1A 1SR0A 1Q1CA 4IT4A 1YW5A 1D7HA 1ZK6A 1LJYA 4W5UA 2ZR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP9 A;  4C02 B;  4DRK A;  5BXJ A;  3O5G A;  2VN1 A;  1J4I A;  2RSE A;  2RUR A;  2ZR6 A;  4U85 A;  5GPG A;  1FKT A;  5HWB A;  2LGO A;  2RUC A;  4O2T A;  4TW6 A;  2KI3 A;  3CGN A;  2RUD A;  3UI5 A;  4DIP A;  1F40 A;  4ODQ A;  1T11 A;  4LAY A;  4W9Q A;  1C9H A;  2DG9 A;  5HW6 A;  5I98 A;  1JNT A;  2AWG A;  3PRD A;  1JNS A;  4JFL A;  1NMW A;  2XP5 A;  3KAB A;  3OOB A;  1L1P A;  1FKJ A;  2XPA A;  2PV2 A;  4ODO A;  2XP7 A;  4J4N A;  5D75 A;  4ITZ A;  3TC5 A;  3LUO A;  4DRH A;  4BF8 A;  2KO7 A;  5HW7 A;  5HUA A;  1A7X A;  1FKI A;  2M2A A;  2L2S A;  3UI4 A;  2OFN A;  4DRI A;  2XP6 A;  2IF4 A;  1D6O A;  2PV1 A;  1U79 A;  3PRB A;  4JFJ A;  1B6C A;  2XP3 A;  3O5M A;  4TYO A;  2MLX A;  2MF9 A;  3TDB A;  1HXV A;  4ODM A;  3MDY B;  1ROU A;  1BKF A;  4GGQ A;  2MPH A;  3B7X A;  2F4E A;  4FN2 A;  4LAW A;  5DIT A;  5HW8 A;  3UF8 A;  3JYM A;  1R9H A;  1D7I A;  5HT1 A;  4FAP A;  1FKR A;  2XP8 A;  3KCE A;  3O5D A;  4U86 A;  1W26 A;  3TCZ A;  2PV3 A;  2DG3 A;  2LJ4 A;  4QT2 A;  3NI6 A;  3UI6 A;  1FKD A;  2FKE A;  1FKL A;  1FKK A;  1NSG A;  4QIB A;  2KGJ A;  3UQI A;  2VCD A;  3O5R A;  4DH0 A;  1FKH A;  2M1I A;  4ODR A;  5B8I C;  1PIN A;  4IQC A;  1ROT A;  4DRN A;  4JFK A;  1F8A B;  3KZ7 A;  1JVW A;  2ITK A;  4W9P A;  2ZR4 A;  4QT3 A;  4DT4 A;  4GIV A;  4DRM A;  4TW7 A;  4ODP A;  5J6E A;  3IKG A;  3O5F A;  3PA7 A;  3UQB A;  4TNS A;  3KAH A;  4U84 A;  1BL4 A;  4N19 A;  5DIV A;  4R0X A;  1PBK A;  1NMV A;  3GPK A;  3KAD A;  1QPL A;  1Y0O A;  3KAG A;  4TX0 A;  3KAF A;  2PPP A;  2ZQV A;  1P5Q A;  3O5L A;  4DZ2 A;  3O5I A;  2Q5A A;  2N87 A;  2ZQT A;  4ODK A;  3EY6 A;  4DRJ A;  4JFM A;  3RFW A;  1N1A A;  2MNT A;  1FKG A;  2F2D A;  3JYJ A;  1FJD A;  1FKB A;  2Y78 A;  3NTP A;  2FAP A;  3ODK A;  1Q6I A;  1FKS A;  3NRK A;  5DIU A;  4JFI A;  4TW8 A;  5HTG A;  3JXV A;  2RQS A;  4LAX A;  1QPF A;  4MGV A;  4MSP A;  1EYM A;  3O5O A;  1KT0 A;  2K8I A;  4IPX A;  2PPO A;  4JYS A;  1KT1 A;  1QZ2 A;  1ZCN A;  3O5E A;  4G2P A;  1FD9 A;  2JZV A;  3O5J A;  2M08 A;  1D7J A;  2ZR5 A;  2ZQU A;  4J4O A;  3IHZ A;  4IQ2 A;  3IKD A;  2D9F A;  3H9R B;  2LPV A;  1Q6U A;  1YAT A;  1Q6H A;  1TCO C;  2RUQ A;  2XPB A;  3O5K A;  2ZQS A;  4LAV A;  3WH0 A;  2LKN A;  4DRQ A;  2MLY A;  2MLZ A;  2XP4 A;  3O5P A;  1M5Y A;  4ODN A;  3VAW A;  1J4R A;  3I6C A;  4NNR A;  5HKG A;  2F21 A;  3UQA A;  1J6Y A;  3IK8 A;  2KE0 A;  3RGC A;  4DRP A;  2UZ5 A;  4W9O A;  1Q1C A;  4DRO A;  2KFW A;  3KAC A;  3CGM A;  1YW5 A;  2KR7 A;  4G50 A;  1FAP A;  3KAI A;  4DZ3 A;  2PPN A;  3O5Q A;  1D7H A;  5HWC A;  3FAP A;  1ZK6 A;  2DG4 A;  4ODL A;  1EQ3 A;  1FKF A;  2PBC A;  1J4H A; 
#chains in the Genus database with same CATH topology
 4C02 B;  1HJV A;  2VN1 A;  2RSE A;  2RUR A;  2ZR6 A;  4U85 A;  3ARQ A;  3AS3 A;  4L3N A;  1LQ0 A;  1F40 A;  4LAY A;  5HW6 A;  5I98 A;  1XRV A;  1NMW A;  1RD6 A;  4ITZ A;  3RM8 A;  4AY1 A;  1HJW A;  2M2A A;  1W9U A;  2XP6 A;  2IF4 A;  3ALG A;  3PRB A;  1B6C A;  2FDM A;  3O5M A;  2O9O A;  3TDB A;  4Q22 A;  5DIT A;  2F4E A;  4LAW A;  3AS2 A;  1R9H A;  1D7I A;  2WM0 A;  1W9P A;  2M1I A;  5B8I C;  3B9E A;  1PIN A;  2DSW A;  4JFK A;  4W9P A;  1ZB5 A;  4QT3 A;  3WD4 A;  3IKG A;  4MPK A;  4P8X A;  3PA7 A;  5DO2 A;  4TNS A;  4KQZ A;  1O6I A;  4Z2K A;  3KAH A;  3WQV A;  1IX5 A;  2EUL A;  3B9D A;  4Z2L A;  4QZV B;  3KAD A;  1LL4 A;  1ZBC A;  1P5Q A;  3O5L A;  4DZ2 A;  3O5I A;  3ARR A;  4MAV A;  4DWS B;  3EY6 A;  4JFM A;  3NTP A;  1ZBW A;  1OGB A;  1FKS A;  4ZS6 A;  4DWS A;  1EYM A;  3B9A A;  2K8I A;  1KT1 A;  1ZCN A;  1GUV A;  3RM9 A;  1KFW A;  3IKD A;  3AS0 A;  2LPV A;  5DF0 A;  3WQW A;  1YAT A;  2OLH A;  3CHC A;  2A3B A;  2XP4 A;  2MLZ A;  3O5P A;  4ODN A;  3VAW A;  4WKH A;  1JND A;  3I6C A;  3UQA A;  2F21 A;  3WL0 A;  4ML4 A;  4DRP A;  3WL1 A;  1HKM A;  2KR7 A;  1WB0 A;  1FAP A;  3KAI A;  4DZ3 A;  3G6M A;  2PPN A;  5GQB A;  3FAP A;  3ARU A;  1EQ3 A;  3W4R A;  2ZQS A;  2PBC A;  4ODK A;  4ZPW R;  3FY1 A;  3O5G A;  1J4I A;  2RUC A;  3ARP A;  3PR9 A;  4MNM A;  4O2T A;  4TW6 A;  4ODQ A;  4W9Q A;  1NWT A;  3PRA A;  2AWG A;  3OA5 A;  3ARW A;  4Z2J A;  1JNS A;  4URI A;  4ODO A;  4P8V A;  3RME A;  3TC5 A;  3LUO A;  4DRH A;  1ZBV A;  2KO7 A;  5HW7 A;  5HUA A;  1A7X A;  1LL6 A;  3UI4 A;  2OFN A;  1CTN A;  1E6R A;  1D6O A;  1H0G A;  1NH6 A;  4JFJ A;  2XP3 A;  4TYO A;  3B8S A;  1WAW A;  4ODM A;  1ROU A;  2MPH A;  4Q7N A;  5HW8 A;  3ARX A;  2XP8 A;  4U86 A;  1NWU A;  2LJ4 A;  3UI6 A;  1X6N A;  2FKE A;  1FKL A;  1NSG A;  2A3A A;  2P4V A;  3ARO A;  4QIB A;  3UQI A;  3O5R A;  4DH0 A;  2O92 A;  1ROT A;  1W1Y A;  4GIV A;  4IT6 A;  1GOI A;  3O5F A;  3ALF A;  4R0X A;  3KAG A;  4WIW A;  1OGG A;  2WLZ A;  2Q5A A;  2N87 A;  2ZQT A;  2DSV A;  5JH8 A;  3RFW A;  1N1A A;  2F2D A;  3BMB A;  1FKB A;  3ODK A;  1Q6I A;  3NRK A;  4JFI A;  3JXV A;  4LAX A;  4MSP A;  1E6N A;  4WK9 A;  1KT0 A;  4JYS A;  3O5E A;  1FD9 A;  1LG2 A;  2M08 A;  2ZQU A;  3AS1 A;  4KR0 B;  1K9T A;  3RM4 A;  2ETN A;  3CHF A;  1Q6U A;  2AOS A;  3WKZ A;  1TCO C;  2XPB A;  4LAV A;  1JCH B;  1E6P A;  1GPF A;  2LKN A;  1J4R A;  4NNR A;  3GU0 A;  3IK8 A;  2F23 A;  2QF8 A;  3RGC A;  1FFR A;  4DRO A;  2KFW A;  2WLY A;  4G50 A;  3O5Q A;  4UDM A;  3GTY X;  4HAR A;  5BXJ A;  5HWB A;  4DWS D;  1FKT A;  4MNK A;  4P8U A;  3UI5 A;  2DG9 A;  3PRD A;  4JFL A;  1LL7 A;  2XP5 A;  3G6L A;  1L1P A;  3QOK A;  2XPA A;  2B5U B;  2XP7 A;  5D75 A;  4XAK A;  2L2S A;  4DRI A;  3ARS A;  4Z2H A;  1X6L A;  1LG1 A;  1ZU8 A;  2MF9 A;  5HBF A;  3MDY B;  1NWS A;  1BKF A;  3UF8 A;  2IUZ A;  1EDQ A;  1W1T A;  5HT1 A;  1VF8 A;  4MTV A;  4FAP A;  1FKR A;  3KCE A;  1W26 A;  2DG3 A;  1ITX A;  4QT2 A;  3NI6 A;  4WKA A;  1FKK A;  2KGJ A;  4DRN A;  4IQC A;  1F8A B;  3KZ7 A;  2ITK A;  2ZR4 A;  4TW7 A;  3WD2 A;  1W1V A;  1NWR A;  3UQB A;  4U84 A;  4L72 B;  1BL4 A;  2G8Z A;  5DIV A;  1PBK A;  1NMV A;  2G41 A;  2DT2 A;  5DEZ A;  3KAF A;  2PPP A;  3WD0 A;  3CZ8 A;  3AQU A;  4WJX A;  4DRJ A;  2A3C A;  3JYJ A;  1FKG A;  1FJD A;  1W9V A;  2FAP A;  2B31 A;  1UR8 A;  3ARZ A;  4TW8 A;  4MGV A;  4ZPT R;  3O5O A;  2PPO A;  4DT4 A;  1QZ2 A;  3O5J A;  4PTM A;  1D7J A;  4R5E A;  3ARY A;  3IHZ A;  4WKF A;  4P8W A;  3H9R B;  3CHE A;  4DWS C;  1H0I A;  4S3K A;  3O5K A;  4MNJ A;  3WH0 A;  2DT3 A;  4DRQ A;  1M5Y A;  3WD3 A;  1J6Y A;  2KE0 A;  2UZ5 A;  4W9O A;  3KAC A;  3CGM A;  1XHG A;  1EIB A;  2WK2 A;  5HWC A;  3WD1 A;  2DG4 A;  4ODL A;  1FKF A;  2DT0 A;  2RQS A;  1J4H A;  2XP9 A;  4DRK A;  1D2K A;  5GPG A;  1TFV A;  1HKK A;  1HKI A;  2LGO A;  2KI3 A;  3CGN A;  1OWQ A;  2RUD A;  4DIP A;  1T11 A;  1C9H A;  1E44 A;  1JNT A;  3OOB A;  3KAB A;  1FKJ A;  2PV2 A;  4J4N A;  1E6Z A;  4S3J A;  4MNL A;  2DSU A;  4BF8 A;  1FKI A;  2ESC A;  2PV1 A;  1U79 A;  4HBO A;  2MLX A;  1HXV A;  4GGQ A;  3B7X A;  4FN2 A;  3JYM A;  1EHN A;  1WNO A;  1E9L A;  3TCZ A;  3O5D A;  3WIJ A;  2PV3 A;  3FXY A;  1FKD A;  1ZBK A;  3EIP A;  2DSZ A;  2VCD A;  1FKH A;  4ODR A;  1UR9 A;  1JVW A;  2DPE A;  4Z2G A;  1SYT A;  4DRM A;  5J6E A;  2A3E A;  4ODP A;  2YBT A;  4HBE A;  2YBU A;  3CH9 A;  2DT1 A;  1JNE A;  4N19 A;  3GPK A;  1W1P A;  4ZPV R;  1QPL A;  1Y0O A;  1FFQ A;  4LGX A;  4TX0 A;  3ART A;  2ZQV A;  2PN0 A;  2MNT A;  1HJX A;  2Y78 A;  5DIU A;  5HTG A;  1QPF A;  4IPX A;  4G2P A;  2JZV A;  4J4O A;  1HKJ A;  4NZC A;  4IQ2 A;  2D9F A;  5GPR A;  3ARV A;  1Q6H A;  4Z2I A;  2RUQ A;  4NSB A;  1E15 A;  2MLY A;  2PI6 A;  3CHD A;  5HKG A;  3BXW A;  1ZL1 A;  1SR0 A;  1Q1C A;  4IT4 A;  1YW5 A;  1D7H A;  1ZK6 A;  1LJY A;  4W5U A;  1GRJ A;  2ZR5 A; 
#chains in the Genus database with same CATH homology
 4C02 B;  1HJV A;  2VN1 A;  2RSE A;  2RUR A;  2ZR6 A;  4U85 A;  3ARQ A;  3AS3 A;  4L3N A;  1LQ0 A;  1F40 A;  4LAY A;  5HW6 A;  5I98 A;  1XRV A;  1NMW A;  1RD6 A;  4ITZ A;  3RM8 A;  4AY1 A;  1HJW A;  2M2A A;  1W9U A;  2XP6 A;  2IF4 A;  3ALG A;  3PRB A;  1B6C A;  2FDM A;  3O5M A;  2O9O A;  3TDB A;  4Q22 A;  5DIT A;  2F4E A;  4LAW A;  3AS2 A;  1R9H A;  1D7I A;  2WM0 A;  1W9P A;  2M1I A;  5B8I C;  3B9E A;  1PIN A;  2DSW A;  4JFK A;  4W9P A;  1ZB5 A;  4QT3 A;  3WD4 A;  3IKG A;  4MPK A;  4P8X A;  3PA7 A;  5DO2 A;  4TNS A;  4KQZ A;  1O6I A;  4Z2K A;  3KAH A;  3WQV A;  1IX5 A;  3B9D A;  4Z2L A;  4QZV B;  3KAD A;  1LL4 A;  1ZBC A;  1P5Q A;  3O5L A;  4DZ2 A;  3O5I A;  3ARR A;  4MAV A;  4DWS B;  3EY6 A;  4JFM A;  3NTP A;  1ZBW A;  1OGB A;  1FKS A;  4ZS6 A;  4DWS A;  1EYM A;  3B9A A;  2K8I A;  1KT1 A;  1ZCN A;  1GUV A;  3RM9 A;  1KFW A;  3IKD A;  3AS0 A;  2LPV A;  5DF0 A;  3WQW A;  1YAT A;  2OLH A;  3CHC A;  2A3B A;  2XP4 A;  2MLZ A;  3O5P A;  4ODN A;  3VAW A;  4WKH A;  1JND A;  3I6C A;  3UQA A;  2F21 A;  3WL0 A;  4ML4 A;  4DRP A;  3WL1 A;  1HKM A;  2KR7 A;  1WB0 A;  1FAP A;  3KAI A;  4DZ3 A;  3G6M A;  2PPN A;  5GQB A;  3FAP A;  3ARU A;  1EQ3 A;  3W4R A;  2ZQS A;  2PBC A;  4ODK A;  4ZPW R;  3FY1 A;  3O5G A;  1J4I A;  2RUC A;  3ARP A;  3PR9 A;  4MNM A;  4O2T A;  4TW6 A;  4ODQ A;  4W9Q A;  1NWT A;  3PRA A;  2AWG A;  3OA5 A;  3ARW A;  4Z2J A;  1JNS A;  4URI A;  4ODO A;  4P8V A;  3RME A;  3TC5 A;  3LUO A;  4DRH A;  1ZBV A;  2KO7 A;  5HW7 A;  5HUA A;  1A7X A;  1LL6 A;  3UI4 A;  2OFN A;  1CTN A;  1E6R A;  1D6O A;  1H0G A;  1NH6 A;  4JFJ A;  2XP3 A;  4TYO A;  3B8S A;  1WAW A;  4ODM A;  1ROU A;  2MPH A;  4Q7N A;  5HW8 A;  3ARX A;  2XP8 A;  4U86 A;  1NWU A;  2LJ4 A;  3UI6 A;  1X6N A;  2FKE A;  1FKL A;  1NSG A;  2A3A A;  3ARO A;  4QIB A;  3UQI A;  3O5R A;  4DH0 A;  2O92 A;  1ROT A;  1W1Y A;  4GIV A;  4IT6 A;  1GOI A;  3O5F A;  3ALF A;  4R0X A;  3KAG A;  4WIW A;  1OGG A;  2WLZ A;  2Q5A A;  2N87 A;  2ZQT A;  2DSV A;  5JH8 A;  3RFW A;  1N1A A;  2F2D A;  1FKB A;  3ODK A;  1Q6I A;  3NRK A;  4JFI A;  3JXV A;  4LAX A;  4MSP A;  1E6N A;  4WK9 A;  1KT0 A;  4JYS A;  3O5E A;  1FD9 A;  1LG2 A;  2M08 A;  2ZQU A;  3AS1 A;  4KR0 B;  1K9T A;  3RM4 A;  3CHF A;  1Q6U A;  2AOS A;  3WKZ A;  1TCO C;  2XPB A;  4LAV A;  1E6P A;  2LKN A;  1GPF A;  1J4R A;  4NNR A;  3IK8 A;  2QF8 A;  3RGC A;  1FFR A;  4DRO A;  2KFW A;  2WLY A;  4G50 A;  3O5Q A;  4HAR A;  5BXJ A;  5HWB A;  4DWS D;  1FKT A;  4MNK A;  4P8U A;  3UI5 A;  2DG9 A;  3PRD A;  4JFL A;  1LL7 A;  2XP5 A;  3G6L A;  1L1P A;  3QOK A;  2XPA A;  2XP7 A;  5D75 A;  4XAK A;  2L2S A;  4DRI A;  3ARS A;  4Z2H A;  1X6L A;  1LG1 A;  1ZU8 A;  2MF9 A;  5HBF A;  3MDY B;  1NWS A;  1BKF A;  3UF8 A;  2IUZ A;  1EDQ A;  1W1T A;  5HT1 A;  1VF8 A;  4MTV A;  4FAP A;  1FKR A;  3KCE A;  1W26 A;  2DG3 A;  1ITX A;  4QT2 A;  3NI6 A;  4WKA A;  1FKK A;  2KGJ A;  4DRN A;  4IQC A;  1F8A B;  3KZ7 A;  2ITK A;  2ZR4 A;  4TW7 A;  3WD2 A;  1W1V A;  1NWR A;  3UQB A;  4U84 A;  4L72 B;  1BL4 A;  2G8Z A;  5DIV A;  1PBK A;  1NMV A;  2G41 A;  2DT2 A;  5DEZ A;  3KAF A;  2PPP A;  3WD0 A;  3CZ8 A;  3AQU A;  4WJX A;  4DRJ A;  2A3C A;  3JYJ A;  1FKG A;  1FJD A;  1W9V A;  2FAP A;  2B31 A;  1UR8 A;  3ARZ A;  4TW8 A;  4MGV A;  4ZPT R;  3O5O A;  2PPO A;  4DT4 A;  1QZ2 A;  3O5J A;  4PTM A;  1D7J A;  4R5E A;  3ARY A;  3IHZ A;  4WKF A;  4P8W A;  3H9R B;  3CHE A;  4DWS C;  1H0I A;  4S3K A;  3O5K A;  4MNJ A;  3WH0 A;  2DT3 A;  4DRQ A;  1M5Y A;  3WD3 A;  1J6Y A;  2KE0 A;  2UZ5 A;  4W9O A;  3KAC A;  3CGM A;  1XHG A;  1EIB A;  2WK2 A;  5HWC A;  3WD1 A;  2DG4 A;  4ODL A;  1FKF A;  2DT0 A;  2RQS A;  1J4H A;  2XP9 A;  4DRK A;  1D2K A;  5GPG A;  1TFV A;  1HKK A;  1HKI A;  2LGO A;  2KI3 A;  3CGN A;  1OWQ A;  2RUD A;  4DIP A;  1T11 A;  1C9H A;  1JNT A;  3OOB A;  3KAB A;  1FKJ A;  2PV2 A;  4J4N A;  1E6Z A;  4S3J A;  4MNL A;  2DSU A;  4BF8 A;  1FKI A;  2ESC A;  2PV1 A;  1U79 A;  4HBO A;  2MLX A;  1HXV A;  4GGQ A;  3B7X A;  4FN2 A;  3JYM A;  1EHN A;  1WNO A;  1E9L A;  3TCZ A;  3O5D A;  3WIJ A;  2PV3 A;  3FXY A;  1FKD A;  1ZBK A;  2DSZ A;  2VCD A;  1FKH A;  4ODR A;  1UR9 A;  1JVW A;  2DPE A;  4Z2G A;  1SYT A;  4DRM A;  5J6E A;  2A3E A;  4ODP A;  2YBT A;  4HBE A;  2YBU A;  3CH9 A;  2DT1 A;  1JNE A;  4N19 A;  3GPK A;  1W1P A;  4ZPV R;  1QPL A;  1Y0O A;  1FFQ A;  4LGX A;  4TX0 A;  3ART A;  2ZQV A;  2MNT A;  1HJX A;  2Y78 A;  5DIU A;  5HTG A;  1QPF A;  4IPX A;  4G2P A;  2JZV A;  4J4O A;  1HKJ A;  4NZC A;  4IQ2 A;  2D9F A;  5GPR A;  3ARV A;  1Q6H A;  4Z2I A;  2RUQ A;  4NSB A;  1E15 A;  2MLY A;  2PI6 A;  3CHD A;  5HKG A;  3BXW A;  1ZL1 A;  1SR0 A;  1Q1C A;  4IT4 A;  1YW5 A;  1D7H A;  1ZK6 A;  1LJY A;  4W5U A;  2ZR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...