4DROA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with (1r)-3-(3,4-dimethoxyphenyl)-1-phenylpropyl (2s)-1-{[(1r,2s)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidine-2-carboxylate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4droA00
1Q6HA 1R9HA 1JVWA 2FAPA 4U84A 2M2AA 1YATA 2PPNA 2VCDA 2XPBA 4DRJA 2PPOA 5HTGA 2JZVA 2F21A 3KAHA 2VN1A 2XP7A 1BKFA 2ZR6A 2KO7A 2XP8A 5BXJA 3NTPA 1J4HA 3PRDA 4LAXA 2MF9A 5D75A 1FKDA 1NSGA 1QZ2A 2XP9A 3NI6A 3O5LA 3TDBA 1W26A 5J6EA 2N87A 5DITA 3O5DA 1J4RA 3JYMA 5HUAA 3OOBA 4ITZA 4GGQA 2ZQUA 1FKIA 2F4EA 4JFMA 2ITKA 1TCOC 2MLYA 2OFNA 3IKGA 4ODKA 4IPXA 2Q5AA 2XP5A 3RFWA 5HWCA 2RQSA 1FKHA 3O5GA 1QPFA 1YW5A 2PV2A 4W9PA 3UQBA 3O5RA 3KABA 1T11A 1FD9A 2M1IA 3PRBA 4GIVA 1HXVA 1N1AA 1NMVA 2PV3A 1FKGA 3KCEA 4JFLA 1D7JA 2LGOA 1A7XA 3KAIA 3IHZA 3UQAA 3LUOA 3O5QA 1ROUA 2KR7A 3KACA 1D7HA 4TNSA 4TW8A 4DRNA 1ROTA 1FKRA 1BL4A 2ZQSA 1P5QA 4DRHA 4DRQA 1J4IA 2LJ4A 3O5FA 2LPVA 1M5YA 4MGVA 4W9QA 1FKKA 4O2TA 2KFWA 4W9OA 4C02B 5I98A 1KT0A 1PINA 2DG9A 1J6YA 4G2PA 1ZK6A 2Y78A 4FN2A 3WH0A 2DG3A 4IQ2A 2MLZA 2F2DA 4TYOA 4TX0A 3H9RB 3O5MA 4J4OA 1FAPA 2KGJA 4QIBA 3TCZA 2FKEA 1Q6IA 1L1PA 3FAPA 2PPPA 3O5KA 1FKTA 3VAWA 4DRIA 1FKLA 3O5JA 4TW7A 2MPHA 3PA7A 4DT4A 2KE0A 4DRMA 5HW8A 1JNSA 3CGNA 2XP6A 3O5EA 4R0XA 1EQ3A 2RUQA 2IF4A 4TW6A 3NRKA 4DZ3A 3UI5A 2XPAA 4NNRA 2ZR5A 1Q1CA 2K8IA 4JFIA 4DRKA 2DG4A 2ZR4A 4QT3A 1JNTA 1D6OA 2PV1A 3GPKA 3IKDA 2M08A 3KAGA 2RURA 2AWGA 4FAPA 4ODLA 2L2SA 3JYJA 1FJDA 1F8AB 4G50A 4ODRA 2ZQTA 2D9FA 4J4NA 1B6CA 1U79A 3UI4A 3UI6A 2ZQVA 3IK8A 2RUDA 2RSEA 3UQIA 1PBKA 1QPLA 2XP4A 3KZ7A 1EYMA 2UZ5A 1NMWA 2MLXA 3MDYB 3KADA 2PBCA 2MNTA 5HT1A 4ODQA 4DIPA 3UF8A 3JXVA 3O5PA 4JYSA 4LAWA 4JFJA 5B8IC 5DIUA 4ODNA 4U85A 1D7IA 3O5OA 4JFKA 4ODPA 1ZCNA 1C9HA 5HWBA 3TC5A 3O5IA 3RGCA 5HW6A 2LKNA 5GPGA 4DZ2A 5HW7A 1Y0OA 3KAFA 3I6CA 3ODKA 1FKSA 4DROA 4QT2A 4U86A 2KI3A 3B7XA 1KT1A 3EY6A 4ODOA 5DIVA 4IQCA 4DRPA 4LAVA 4LAYA 4N19A 1FKFA 4DH0A 1FKBA 4BF8A 4MSPA 1F40A 4ODMA 5HKGA 1FKJA 2XP3A 1Q6UA 3CGMA 2RUCA
chains in the Genus database with same CATH superfamily
1Q6HA 1JVWA 4U84A 2M2AA 2JZVA 2F21A 3RM9A 3WKZA 1J4HA 1FKDA 1NSGA 1JNDA 1WAWA 3CH9A 1ZL1A 3FY1A 4P8UA 2WM0A 1XRVA 1IX5A 4ITZA 4ODKA 2DT2A 2Q5AA 3WIJA 3BXWA 2EULA 3CHEA 2M1IA 1OWQA 5GPRA 1FKGA 2LGOA 3KAIA 4WIWA 4TW8A 2KR7A 3ALFA 1FKRA 3AS0A 3RM8A 3G6MA 2LJ4A 4DRQA 4Z2JA 2LPVA 3AQUA 5I98A 4IT4A 3B9EA 1NWRA 4FN2A 2DG3A 4TYOA 4J4OA 3TCZA 1FAPA 2KGJA 2FKEA 1Q6IA 4DRIA 1FKLA 4L3NA 3PA7A 4DT4A 4DRMA 1RD6A 1EQ3A 2XPAA 1OGBA 1W9UA 4JFIA 2WK2A 1HKJA 3IKDA 1LL4A 1X6LA 4HBOA 1F8AB 2DT1A 4G50A 4ODRA 3WL1A 1B6CA 2RUDA 4Z2HA 1PBKA 4Z2GA 1QPLA 2O92A 2XP4A 3KZ7A 1EYMA 2MLXA 3MDYB 1VF8A 5JH8A 4AY1A 1EDQA 1LG2A 3GU0A 5DIUA 1ZBVA 4JFKA 2B31A 1ZCNA 5HWBA 3TC5A 3O5IA 3W4RA 5HW6A 4DZ2A 1UR9A 3ODKA 1UR8A 1LQ0A 1GPFA 4QT2A 2B5UB 1FFQA 3B7XA 1KT1A 4IQCA 1ZU8A 4DH0A 1FKBA 2WLYA 3BMBA 1Q6UA 3WD2A 2WLZA 4NSBA 2PPNA 1WB0A 2VCDA 2XPBA 3AS3A 2VN1A 2ZR6A 1GOIA 2KO7A 4P8XA 5BXJA 3NTPA 4LAXA 2MF9A 5D75A 2XP9A 3WD0A 3TDBA 1W26A 3B9DA 3JYMA 5HUAA 3AROA 2OFNA 2MLYA 2DT3A 3RFWA 5HWCA 4WJXA 4MNLA 1FKHA 3ARSA 4W9PA 1OGGA 3UQBA 3O5RA 1SR0A 1FD9A 4DWSD 1XHGA 4JFLA 4PTMA 1A7XA 1EIBA 4DRNA 1P5QA 4QZVB 1J4IA 3O5FA 4MGVA 4W9QA 1M5YA 4XAKA 4O2TA 4P8WA 1KT0A 2DG9A 1E6ZA 3ALGA 4ZPVR 4DWSA 2G8ZA 4G2PA 1W9PA 2Y78A 2F2DA 1ITXA 2DSVA 4QIBA 3FAPA 2PPPA 1FKTA 2MPHA 5DEZA 2KE0A 5HBFA 1JNSA 3CGNA 2XP6A 1TFVA 3NRKA 4DZ3A 3UI5A 4NNRA 2ZR5A 2K8IA 2ZR4A 1JNTA 1ZBWA 3KAGA 2P4VA 2RURA 4FAPA 4IT6A 2L2SA 3JYJA 1H0GA 2D9FA 2ZQTA 1U79A 3UI4A 3UI6A 2ZQVA 3IK8A 1HKKA 2RSEA 3WD1A 2UZ5A 1NMWA 2ETNA 1O6IA 4ODQA 1E6RA 1HJWA 4JFJA 2DSUA 1C9HA 1NWSA 1ZB5A 5GPGA 1Y0OA 1ZBCA 4MNMA 4KQZA 3EY6A 2PN0A 4LAVA 4N19A 1FKFA 3PR9A 4MSPA 1LG1A 5HKGA 3WD4A 1W1TA 2RUCA 2A3AA 1YATA 1E6NA 4DWSB 4DRJA 3ARVA 1K9TA 2ESCA 4URIA 3WQWA 2XP8A 4UDMA 1HKMA 3PRDA 1QZ2A 4L72B 4ZPTR 5J6EA 2N87A 5DITA 2PI6A 3QOKA 1E44A 2ZQUA 4WK9A 2ITKA 4IPXA 1HJVA 2XP5A 1W1PA 3ARYA 3O5GA 1QPFA 1T11A 4GIVA 4MNKA 1N1AA 1NMVA 4KR0B 3KCEA 2G41A 4MTVA 3UQAA 3O5QA 5DO2A 1ROUA 3KACA 1D7HA 4TNSA 2DPEA 1X6NA 2DSZA 2ZQSA 4DRHA 4W9OA 2AOSA 1FKKA 3RMEA 1PINA 3RM4A 1ZK6A 3WH0A 1LJYA 4IQ2A 2MLZA 4TX0A 1HJXA 3B9AA 3ARRA 1GRJA 1NWTA 3O5JA 3CZ8A 1WNOA 4ML4A 3ARTA 4WKHA 4MPKA 1LL6A 4R0XA 4TW6A 1JCHB 4Z2LA 1E15A 1E9LA 1Q1CA 3ARPA 2DG4A 4QT3A 3EIPA 4HBEA 2PV1A 2M08A 1LL7A 2AWGA 4P8VA 4LGXA 4Q22A 4ODLA 1FJDA 4J4NA 2O9OA 1D2KA 1W1YA 4R5EA 4Z2KA 3UQIA 2PBCA 3B8SA 4DIPA 3WD3A 1KFWA 3JXVA 4JYSA 4LAWA 5B8IC 4ODNA 4U85A 4ODPA 3RGCA 5DF0A 5HW7A 1JNEA 3I6CA 4MNJA 4U86A 2KI3A 2A3BA 4DRPA 4LAYA 1F40A 1FKJA 2XP3A 2XP7A 1R9HA 2FAPA 5HTGA 2PPOA 5GQBA 3KAHA 3PRAA 1BKFA 3AS2A 3NI6A 3O5LA 1W1VA 1NH6A 2OLHA 3ARUA 4HARA 4DWSC 3O5DA 1J4RA 3OOBA 4GGQA 4JFMA 1FKIA 2F4EA 3IKGA 1TCOC 1CTNA 2YBTA 2RQSA 1YW5A 2PV2A 3KABA 3PRBA 1W9VA 1E6PA 3ARZA 2PV3A 1FFRA 1D7JA 3IHZA 3LUOA 3OA5A 1ROTA 1BL4A 4Q7NA 1HXVA 4C02B 2KFWA 2F23A 1J6YA 2A3CA 3G6LA 3ARQA 1H0IA 3H9RB 3O5MA 1ZBKA 1L1PA 4ZPWR 3VAWA 3O5KA 4TW7A 1EHNA 3CHCA 3CHDA 2DT0A 4W5UA 4WKFA 5HW8A 3O5EA 2FDMA 2IUZA 2RUQA 2IF4A 3ARXA 4DRKA 4S3JA 3GPKA 1D6OA 3GTYX 1NWUA 3FXYA 3WQVA 2YBUA 3WL0A 4WKAA 1HKIA 4Z2IA 4S3KA 3KADA 4MAVA 2MNTA 5HT1A 4NZCA 2QF8A 3UF8A 3O5PA 1D7IA 3O5OA 3CHFA 2A3EA 4ZS6A 2LKNA 3ARWA 2DSWA 3KAFA 1FKSA 4DROA 5DIVA 4ODOA 1SYTA 4BF8A 4ODMA 1GUVA 3CGMA 3AS1A
chains in the Genus database with same CATH topology
1Q6HA 1JVWA 4U84A 2M2AA 2JZVA 2F21A 3RM9A 3WKZA 1J4HA 1FKDA 1NSGA 1JNDA 1WAWA 3CH9A 1ZL1A 3FY1A 4P8UA 2WM0A 1XRVA 1IX5A 4ITZA 4ODKA 2DT2A 2Q5AA 3WIJA 3BXWA 3CHEA 2M1IA 1OWQA 5GPRA 1FKGA 2LGOA 3KAIA 4WIWA 4TW8A 2KR7A 3ALFA 1FKRA 3AS0A 3RM8A 3G6MA 2LJ4A 4DRQA 4Z2JA 2LPVA 3AQUA 5I98A 4IT4A 3B9EA 1NWRA 4FN2A 2DG3A 4TYOA 4J4OA 3TCZA 1FAPA 2KGJA 2FKEA 1Q6IA 4DRIA 1FKLA 4L3NA 3PA7A 4DT4A 4DRMA 1RD6A 1EQ3A 2XPAA 1OGBA 1W9UA 4JFIA 2WK2A 1HKJA 3IKDA 1LL4A 1X6LA 4HBOA 1F8AB 2DT1A 4G50A 4ODRA 3WL1A 1B6CA 2RUDA 4Z2HA 1PBKA 4Z2GA 1QPLA 2O92A 2XP4A 3KZ7A 1EYMA 2MLXA 3MDYB 1VF8A 5JH8A 4AY1A 1EDQA 1LG2A 5DIUA 1ZBVA 4JFKA 2B31A 1ZCNA 5HWBA 3TC5A 3O5IA 3W4RA 5HW6A 4DZ2A 1UR9A 3ODKA 1UR8A 1LQ0A 1GPFA 4QT2A 1FFQA 3B7XA 1KT1A 4IQCA 1ZU8A 4DH0A 1FKBA 2WLYA 1Q6UA 3WD2A 2WLZA 4NSBA 2PPNA 1WB0A 2VCDA 2XPBA 3AS3A 2VN1A 2ZR6A 1GOIA 2KO7A 4P8XA 5BXJA 3NTPA 4LAXA 2MF9A 5D75A 2XP9A 3WD0A 3TDBA 1W26A 3B9DA 3JYMA 5HUAA 3AROA 2OFNA 2MLYA 2DT3A 3RFWA 5HWCA 4WJXA 4MNLA 1FKHA 3ARSA 4W9PA 1OGGA 3UQBA 3O5RA 1SR0A 1FD9A 4DWSD 1XHGA 4JFLA 4PTMA 1A7XA 1EIBA 4DRNA 1P5QA 4QZVB 1J4IA 3O5FA 4MGVA 4W9QA 1M5YA 4XAKA 4O2TA 4P8WA 1KT0A 2DG9A 1E6ZA 3ALGA 4ZPVR 4DWSA 2G8ZA 4G2PA 1W9PA 2Y78A 2F2DA 1ITXA 2DSVA 4QIBA 3FAPA 2PPPA 1FKTA 2MPHA 5DEZA 2KE0A 5HBFA 1JNSA 3CGNA 2XP6A 1TFVA 3NRKA 4DZ3A 3UI5A 4NNRA 2ZR5A 2K8IA 2ZR4A 1JNTA 1ZBWA 3KAGA 2RURA 4FAPA 4IT6A 2L2SA 3JYJA 1H0GA 2D9FA 2ZQTA 1U79A 3UI4A 3UI6A 2ZQVA 3IK8A 1HKKA 2RSEA 3WD1A 2UZ5A 1NMWA 1O6IA 4ODQA 1E6RA 1HJWA 4JFJA 2DSUA 1C9HA 1NWSA 1ZB5A 5GPGA 1Y0OA 1ZBCA 4MNMA 4KQZA 3EY6A 4LAVA 4N19A 1FKFA 3PR9A 4MSPA 1LG1A 5HKGA 3WD4A 1W1TA 2RUCA 2A3AA 1YATA 1E6NA 4DWSB 4DRJA 3ARVA 1K9TA 2ESCA 4URIA 3WQWA 2XP8A 1HKMA 3PRDA 1QZ2A 4L72B 4ZPTR 5J6EA 2N87A 5DITA 2PI6A 3QOKA 2ZQUA 4WK9A 2ITKA 4IPXA 1HJVA 2XP5A 1W1PA 3ARYA 3O5GA 1QPFA 1T11A 4GIVA 4MNKA 1N1AA 1NMVA 4KR0B 3KCEA 2G41A 4MTVA 3UQAA 3O5QA 5DO2A 1ROUA 3KACA 1D7HA 4TNSA 2DPEA 1X6NA 2DSZA 2ZQSA 4DRHA 4W9OA 2AOSA 1FKKA 3RMEA 1PINA 3RM4A 1ZK6A 3WH0A 1LJYA 4IQ2A 2MLZA 4TX0A 1HJXA 3B9AA 3ARRA 1NWTA 3O5JA 3CZ8A 1WNOA 4ML4A 3ARTA 4WKHA 4MPKA 1LL6A 4R0XA 4TW6A 4Z2LA 1E15A 1E9LA 1Q1CA 3ARPA 2DG4A 4QT3A 4HBEA 2PV1A 2M08A 1LL7A 2AWGA 4P8VA 4LGXA 4Q22A 4ODLA 1FJDA 4J4NA 2O9OA 1D2KA 1W1YA 4R5EA 4Z2KA 3UQIA 2PBCA 3B8SA 4DIPA 3WD3A 1KFWA 3JXVA 4JYSA 4LAWA 5B8IC 4ODNA 4U85A 4ODPA 3RGCA 5DF0A 5HW7A 1JNEA 3I6CA 4MNJA 4U86A 2KI3A 2A3BA 4DRPA 4LAYA 1F40A 1FKJA 2XP3A 2XP7A 1R9HA 2FAPA 5HTGA 2PPOA 5GQBA 3KAHA 3PRAA 1BKFA 3AS2A 3NI6A 3O5LA 1W1VA 1NH6A 2OLHA 3ARUA 4HARA 4DWSC 3O5DA 1J4RA 3OOBA 4GGQA 4JFMA 1FKIA 2F4EA 3IKGA 1TCOC 1CTNA 2YBTA 2RQSA 1YW5A 2PV2A 3KABA 3PRBA 1W9VA 1E6PA 3ARZA 2PV3A 1FFRA 1D7JA 3IHZA 3LUOA 3OA5A 1ROTA 1BL4A 4Q7NA 1HXVA 4C02B 2KFWA 1J6YA 2A3CA 3G6LA 3ARQA 1H0IA 3H9RB 3O5MA 1ZBKA 1L1PA 4ZPWR 3VAWA 3O5KA 4TW7A 1EHNA 3CHCA 3CHDA 2DT0A 4W5UA 4WKFA 5HW8A 3O5EA 2FDMA 2IUZA 2RUQA 2IF4A 3ARXA 4DRKA 4S3JA 3GPKA 1D6OA 1NWUA 3FXYA 3WQVA 2YBUA 3WL0A 4WKAA 1HKIA 4Z2IA 4S3KA 3KADA 4MAVA 2MNTA 5HT1A 4NZCA 2QF8A 3UF8A 3O5PA 1D7IA 3O5OA 3CHFA 2A3EA 4ZS6A 2LKNA 3ARWA 2DSWA 3KAFA 1FKSA 4DROA 5DIVA 4ODOA 1SYTA 4BF8A 4ODMA 1GUVA 3CGMA 3AS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6H A;  1R9H A;  1JVW A;  2FAP A;  4U84 A;  2M2A A;  1YAT A;  2PPN A;  2VCD A;  2XPB A;  4DRJ A;  2PPO A;  5HTG A;  2JZV A;  2F21 A;  3KAH A;  2VN1 A;  2XP7 A;  1BKF A;  2ZR6 A;  2KO7 A;  2XP8 A;  5BXJ A;  3NTP A;  1J4H A;  3PRD A;  4LAX A;  2MF9 A;  5D75 A;  1FKD A;  1NSG A;  1QZ2 A;  2XP9 A;  3NI6 A;  3O5L A;  3TDB A;  1W26 A;  5J6E A;  2N87 A;  5DIT A;  3O5D A;  1J4R A;  3JYM A;  5HUA A;  3OOB A;  4ITZ A;  4GGQ A;  2ZQU A;  1FKI A;  2F4E A;  4JFM A;  2ITK A;  1TCO C;  2MLY A;  2OFN A;  3IKG A;  4ODK A;  4IPX A;  2Q5A A;  2XP5 A;  3RFW A;  5HWC A;  2RQS A;  1FKH A;  3O5G A;  1QPF A;  1YW5 A;  2PV2 A;  4W9P A;  3UQB A;  3O5R A;  3KAB A;  1T11 A;  1FD9 A;  2M1I A;  3PRB A;  4GIV A;  1HXV A;  1N1A A;  1NMV A;  2PV3 A;  1FKG A;  3KCE A;  4JFL A;  1D7J A;  2LGO A;  1A7X A;  3KAI A;  3IHZ A;  3UQA A;  3LUO A;  3O5Q A;  1ROU A;  2KR7 A;  3KAC A;  1D7H A;  4TNS A;  4TW8 A;  4DRN A;  1ROT A;  1FKR A;  1BL4 A;  2ZQS A;  1P5Q A;  4DRH A;  4DRQ A;  1J4I A;  2LJ4 A;  3O5F A;  2LPV A;  1M5Y A;  4MGV A;  4W9Q A;  1FKK A;  4O2T A;  2KFW A;  4W9O A;  4C02 B;  5I98 A;  1KT0 A;  1PIN A;  2DG9 A;  1J6Y A;  4G2P A;  1ZK6 A;  2Y78 A;  4FN2 A;  3WH0 A;  2DG3 A;  4IQ2 A;  2MLZ A;  2F2D A;  4TYO A;  4TX0 A;  3H9R B;  3O5M A;  4J4O A;  1FAP A;  2KGJ A;  4QIB A;  3TCZ A;  2FKE A;  1Q6I A;  1L1P A;  3FAP A;  2PPP A;  3O5K A;  1FKT A;  3VAW A;  4DRI A;  1FKL A;  3O5J A;  4TW7 A;  2MPH A;  3PA7 A;  4DT4 A;  2KE0 A;  4DRM A;  5HW8 A;  1JNS A;  3CGN A;  2XP6 A;  3O5E A;  4R0X A;  1EQ3 A;  2RUQ A;  2IF4 A;  4TW6 A;  3NRK A;  4DZ3 A;  3UI5 A;  2XPA A;  4NNR A;  2ZR5 A;  1Q1C A;  2K8I A;  4JFI A;  4DRK A;  2DG4 A;  2ZR4 A;  4QT3 A;  1JNT A;  1D6O A;  2PV1 A;  3GPK A;  3IKD A;  2M08 A;  3KAG A;  2RUR A;  2AWG A;  4FAP A;  4ODL A;  2L2S A;  3JYJ A;  1FJD A;  1F8A B;  4G50 A;  4ODR A;  2ZQT A;  2D9F A;  4J4N A;  1B6C A;  1U79 A;  3UI4 A;  3UI6 A;  2ZQV A;  3IK8 A;  2RUD A;  2RSE A;  3UQI A;  1PBK A;  1QPL A;  2XP4 A;  3KZ7 A;  1EYM A;  2UZ5 A;  1NMW A;  2MLX A;  3MDY B;  3KAD A;  2PBC A;  2MNT A;  5HT1 A;  4ODQ A;  4DIP A;  3UF8 A;  3JXV A;  3O5P A;  4JYS A;  4LAW A;  4JFJ A;  5B8I C;  5DIU A;  4ODN A;  4U85 A;  1D7I A;  3O5O A;  4JFK A;  4ODP A;  1ZCN A;  1C9H A;  5HWB A;  3TC5 A;  3O5I A;  3RGC A;  5HW6 A;  2LKN A;  5GPG A;  4DZ2 A;  5HW7 A;  1Y0O A;  3KAF A;  3I6C A;  3ODK A;  1FKS A;  4DRO A;  4QT2 A;  4U86 A;  2KI3 A;  3B7X A;  1KT1 A;  3EY6 A;  4ODO A;  5DIV A;  4IQC A;  4DRP A;  4LAV A;  4LAY A;  4N19 A;  1FKF A;  4DH0 A;  1FKB A;  4BF8 A;  4MSP A;  1F40 A;  4ODM A;  5HKG A;  1FKJ A;  2XP3 A;  1Q6U A;  3CGM A;  2RUC A; 
#chains in the Genus database with same CATH topology
 1Q6H A;  1JVW A;  4U84 A;  2M2A A;  2JZV A;  2F21 A;  3RM9 A;  3WKZ A;  1J4H A;  1FKD A;  1NSG A;  1JND A;  1WAW A;  3CH9 A;  1ZL1 A;  3FY1 A;  4P8U A;  2WM0 A;  1XRV A;  1IX5 A;  4ITZ A;  4ODK A;  2DT2 A;  2Q5A A;  3WIJ A;  3BXW A;  2EUL A;  3CHE A;  2M1I A;  1OWQ A;  5GPR A;  1FKG A;  2LGO A;  3KAI A;  4WIW A;  4TW8 A;  2KR7 A;  3ALF A;  1FKR A;  3AS0 A;  3RM8 A;  3G6M A;  2LJ4 A;  4DRQ A;  4Z2J A;  2LPV A;  3AQU A;  5I98 A;  4IT4 A;  3B9E A;  1NWR A;  4FN2 A;  2DG3 A;  4TYO A;  4J4O A;  3TCZ A;  1FAP A;  2KGJ A;  2FKE A;  1Q6I A;  4DRI A;  1FKL A;  4L3N A;  3PA7 A;  4DT4 A;  4DRM A;  1RD6 A;  1EQ3 A;  2XPA A;  1OGB A;  1W9U A;  4JFI A;  2WK2 A;  1HKJ A;  3IKD A;  1LL4 A;  1X6L A;  4HBO A;  1F8A B;  2DT1 A;  4G50 A;  4ODR A;  3WL1 A;  1B6C A;  2RUD A;  4Z2H A;  1PBK A;  4Z2G A;  1QPL A;  2O92 A;  2XP4 A;  3KZ7 A;  1EYM A;  2MLX A;  3MDY B;  1VF8 A;  5JH8 A;  4AY1 A;  1EDQ A;  1LG2 A;  3GU0 A;  5DIU A;  1ZBV A;  4JFK A;  2B31 A;  1ZCN A;  5HWB A;  3TC5 A;  3O5I A;  3W4R A;  5HW6 A;  4DZ2 A;  1UR9 A;  3ODK A;  1UR8 A;  1LQ0 A;  1GPF A;  4QT2 A;  2B5U B;  1FFQ A;  3B7X A;  1KT1 A;  4IQC A;  1ZU8 A;  4DH0 A;  1FKB A;  2WLY A;  3BMB A;  1Q6U A;  3WD2 A;  2WLZ A;  4NSB A;  2PPN A;  1WB0 A;  2VCD A;  2XPB A;  3AS3 A;  2VN1 A;  2ZR6 A;  1GOI A;  2KO7 A;  4P8X A;  5BXJ A;  3NTP A;  4LAX A;  2MF9 A;  5D75 A;  2XP9 A;  3WD0 A;  3TDB A;  1W26 A;  3B9D A;  3JYM A;  5HUA A;  3ARO A;  2OFN A;  2MLY A;  2DT3 A;  3RFW A;  5HWC A;  4WJX A;  4MNL A;  1FKH A;  3ARS A;  4W9P A;  1OGG A;  3UQB A;  3O5R A;  1SR0 A;  1FD9 A;  4DWS D;  1XHG A;  4JFL A;  4PTM A;  1A7X A;  1EIB A;  4DRN A;  1P5Q A;  4QZV B;  1J4I A;  3O5F A;  4MGV A;  4W9Q A;  1M5Y A;  4XAK A;  4O2T A;  4P8W A;  1KT0 A;  2DG9 A;  1E6Z A;  3ALG A;  4ZPV R;  4DWS A;  2G8Z A;  4G2P A;  1W9P A;  2Y78 A;  2F2D A;  1ITX A;  2DSV A;  4QIB A;  3FAP A;  2PPP A;  1FKT A;  2MPH A;  5DEZ A;  2KE0 A;  5HBF A;  1JNS A;  3CGN A;  2XP6 A;  1TFV A;  3NRK A;  4DZ3 A;  3UI5 A;  4NNR A;  2ZR5 A;  2K8I A;  2ZR4 A;  1JNT A;  1ZBW A;  3KAG A;  2P4V A;  2RUR A;  4FAP A;  4IT6 A;  2L2S A;  3JYJ A;  1H0G A;  2D9F A;  2ZQT A;  1U79 A;  3UI4 A;  3UI6 A;  2ZQV A;  3IK8 A;  1HKK A;  2RSE A;  3WD1 A;  2UZ5 A;  1NMW A;  2ETN A;  1O6I A;  4ODQ A;  1E6R A;  1HJW A;  4JFJ A;  2DSU A;  1C9H A;  1NWS A;  1ZB5 A;  5GPG A;  1Y0O A;  1ZBC A;  4MNM A;  4KQZ A;  3EY6 A;  2PN0 A;  4LAV A;  4N19 A;  1FKF A;  3PR9 A;  4MSP A;  1LG1 A;  5HKG A;  3WD4 A;  1W1T A;  2RUC A;  2A3A A;  1YAT A;  1E6N A;  4DWS B;  4DRJ A;  3ARV A;  1K9T A;  2ESC A;  4URI A;  3WQW A;  2XP8 A;  4UDM A;  1HKM A;  3PRD A;  1QZ2 A;  4L72 B;  4ZPT R;  5J6E A;  2N87 A;  5DIT A;  2PI6 A;  3QOK A;  1E44 A;  2ZQU A;  4WK9 A;  2ITK A;  4IPX A;  1HJV A;  2XP5 A;  1W1P A;  3ARY A;  3O5G A;  1QPF A;  1T11 A;  4GIV A;  4MNK A;  1N1A A;  1NMV A;  4KR0 B;  3KCE A;  2G41 A;  4MTV A;  3UQA A;  3O5Q A;  5DO2 A;  1ROU A;  3KAC A;  1D7H A;  4TNS A;  2DPE A;  1X6N A;  2DSZ A;  2ZQS A;  4DRH A;  4W9O A;  2AOS A;  1FKK A;  3RME A;  1PIN A;  3RM4 A;  1ZK6 A;  3WH0 A;  1LJY A;  4IQ2 A;  2MLZ A;  4TX0 A;  1HJX A;  3B9A A;  3ARR A;  1GRJ A;  1NWT A;  3O5J A;  3CZ8 A;  1WNO A;  4ML4 A;  3ART A;  4WKH A;  4MPK A;  1LL6 A;  4R0X A;  4TW6 A;  1JCH B;  4Z2L A;  1E15 A;  1E9L A;  1Q1C A;  3ARP A;  2DG4 A;  4QT3 A;  3EIP A;  4HBE A;  2PV1 A;  2M08 A;  1LL7 A;  2AWG A;  4P8V A;  4LGX A;  4Q22 A;  4ODL A;  1FJD A;  4J4N A;  2O9O A;  1D2K A;  1W1Y A;  4R5E A;  4Z2K A;  3UQI A;  2PBC A;  3B8S A;  4DIP A;  3WD3 A;  1KFW A;  3JXV A;  4JYS A;  4LAW A;  5B8I C;  4ODN A;  4U85 A;  4ODP A;  3RGC A;  5DF0 A;  5HW7 A;  1JNE A;  3I6C A;  4MNJ A;  4U86 A;  2KI3 A;  2A3B A;  4DRP A;  4LAY A;  1F40 A;  1FKJ A;  2XP3 A;  2XP7 A;  1R9H A;  2FAP A;  5HTG A;  2PPO A;  5GQB A;  3KAH A;  3PRA A;  1BKF A;  3AS2 A;  3NI6 A;  3O5L A;  1W1V A;  1NH6 A;  2OLH A;  3ARU A;  4HAR A;  4DWS C;  3O5D A;  1J4R A;  3OOB A;  4GGQ A;  4JFM A;  1FKI A;  2F4E A;  3IKG A;  1TCO C;  1CTN A;  2YBT A;  2RQS A;  1YW5 A;  2PV2 A;  3KAB A;  3PRB A;  1W9V A;  1E6P A;  3ARZ A;  2PV3 A;  1FFR A;  1D7J A;  3IHZ A;  3LUO A;  3OA5 A;  1ROT A;  1BL4 A;  4Q7N A;  1HXV A;  4C02 B;  2KFW A;  2F23 A;  1J6Y A;  2A3C A;  3G6L A;  3ARQ A;  1H0I A;  3H9R B;  3O5M A;  1ZBK A;  1L1P A;  4ZPW R;  3VAW A;  3O5K A;  4TW7 A;  1EHN A;  3CHC A;  3CHD A;  2DT0 A;  4W5U A;  4WKF A;  5HW8 A;  3O5E A;  2FDM A;  2IUZ A;  2RUQ A;  2IF4 A;  3ARX A;  4DRK A;  4S3J A;  3GPK A;  1D6O A;  3GTY X;  1NWU A;  3FXY A;  3WQV A;  2YBU A;  3WL0 A;  4WKA A;  1HKI A;  4Z2I A;  4S3K A;  3KAD A;  4MAV A;  2MNT A;  5HT1 A;  4NZC A;  2QF8 A;  3UF8 A;  3O5P A;  1D7I A;  3O5O A;  3CHF A;  2A3E A;  4ZS6 A;  2LKN A;  3ARW A;  2DSW A;  3KAF A;  1FKS A;  4DRO A;  5DIV A;  4ODO A;  1SYT A;  4BF8 A;  4ODM A;  1GUV A;  3CGM A;  3AS1 A; 
#chains in the Genus database with same CATH homology
 1Q6H A;  1JVW A;  4U84 A;  2M2A A;  2JZV A;  2F21 A;  3RM9 A;  3WKZ A;  1J4H A;  1FKD A;  1NSG A;  1JND A;  1WAW A;  3CH9 A;  1ZL1 A;  3FY1 A;  4P8U A;  2WM0 A;  1XRV A;  1IX5 A;  4ITZ A;  4ODK A;  2DT2 A;  2Q5A A;  3WIJ A;  3BXW A;  3CHE A;  2M1I A;  1OWQ A;  5GPR A;  1FKG A;  2LGO A;  3KAI A;  4WIW A;  4TW8 A;  2KR7 A;  3ALF A;  1FKR A;  3AS0 A;  3RM8 A;  3G6M A;  2LJ4 A;  4DRQ A;  4Z2J A;  2LPV A;  3AQU A;  5I98 A;  4IT4 A;  3B9E A;  1NWR A;  4FN2 A;  2DG3 A;  4TYO A;  4J4O A;  3TCZ A;  1FAP A;  2KGJ A;  2FKE A;  1Q6I A;  4DRI A;  1FKL A;  4L3N A;  3PA7 A;  4DT4 A;  4DRM A;  1RD6 A;  1EQ3 A;  2XPA A;  1OGB A;  1W9U A;  4JFI A;  2WK2 A;  1HKJ A;  3IKD A;  1LL4 A;  1X6L A;  4HBO A;  1F8A B;  2DT1 A;  4G50 A;  4ODR A;  3WL1 A;  1B6C A;  2RUD A;  4Z2H A;  1PBK A;  4Z2G A;  1QPL A;  2O92 A;  2XP4 A;  3KZ7 A;  1EYM A;  2MLX A;  3MDY B;  1VF8 A;  5JH8 A;  4AY1 A;  1EDQ A;  1LG2 A;  5DIU A;  1ZBV A;  4JFK A;  2B31 A;  1ZCN A;  5HWB A;  3TC5 A;  3O5I A;  3W4R A;  5HW6 A;  4DZ2 A;  1UR9 A;  3ODK A;  1UR8 A;  1LQ0 A;  1GPF A;  4QT2 A;  1FFQ A;  3B7X A;  1KT1 A;  4IQC A;  1ZU8 A;  4DH0 A;  1FKB A;  2WLY A;  1Q6U A;  3WD2 A;  2WLZ A;  4NSB A;  2PPN A;  1WB0 A;  2VCD A;  2XPB A;  3AS3 A;  2VN1 A;  2ZR6 A;  1GOI A;  2KO7 A;  4P8X A;  5BXJ A;  3NTP A;  4LAX A;  2MF9 A;  5D75 A;  2XP9 A;  3WD0 A;  3TDB A;  1W26 A;  3B9D A;  3JYM A;  5HUA A;  3ARO A;  2OFN A;  2MLY A;  2DT3 A;  3RFW A;  5HWC A;  4WJX A;  4MNL A;  1FKH A;  3ARS A;  4W9P A;  1OGG A;  3UQB A;  3O5R A;  1SR0 A;  1FD9 A;  4DWS D;  1XHG A;  4JFL A;  4PTM A;  1A7X A;  1EIB A;  4DRN A;  1P5Q A;  4QZV B;  1J4I A;  3O5F A;  4MGV A;  4W9Q A;  1M5Y A;  4XAK A;  4O2T A;  4P8W A;  1KT0 A;  2DG9 A;  1E6Z A;  3ALG A;  4ZPV R;  4DWS A;  2G8Z A;  4G2P A;  1W9P A;  2Y78 A;  2F2D A;  1ITX A;  2DSV A;  4QIB A;  3FAP A;  2PPP A;  1FKT A;  2MPH A;  5DEZ A;  2KE0 A;  5HBF A;  1JNS A;  3CGN A;  2XP6 A;  1TFV A;  3NRK A;  4DZ3 A;  3UI5 A;  4NNR A;  2ZR5 A;  2K8I A;  2ZR4 A;  1JNT A;  1ZBW A;  3KAG A;  2RUR A;  4FAP A;  4IT6 A;  2L2S A;  3JYJ A;  1H0G A;  2D9F A;  2ZQT A;  1U79 A;  3UI4 A;  3UI6 A;  2ZQV A;  3IK8 A;  1HKK A;  2RSE A;  3WD1 A;  2UZ5 A;  1NMW A;  1O6I A;  4ODQ A;  1E6R A;  1HJW A;  4JFJ A;  2DSU A;  1C9H A;  1NWS A;  1ZB5 A;  5GPG A;  1Y0O A;  1ZBC A;  4MNM A;  4KQZ A;  3EY6 A;  4LAV A;  4N19 A;  1FKF A;  3PR9 A;  4MSP A;  1LG1 A;  5HKG A;  3WD4 A;  1W1T A;  2RUC A;  2A3A A;  1YAT A;  1E6N A;  4DWS B;  4DRJ A;  3ARV A;  1K9T A;  2ESC A;  4URI A;  3WQW A;  2XP8 A;  1HKM A;  3PRD A;  1QZ2 A;  4L72 B;  4ZPT R;  5J6E A;  2N87 A;  5DIT A;  2PI6 A;  3QOK A;  2ZQU A;  4WK9 A;  2ITK A;  4IPX A;  1HJV A;  2XP5 A;  1W1P A;  3ARY A;  3O5G A;  1QPF A;  1T11 A;  4GIV A;  4MNK A;  1N1A A;  1NMV A;  4KR0 B;  3KCE A;  2G41 A;  4MTV A;  3UQA A;  3O5Q A;  5DO2 A;  1ROU A;  3KAC A;  1D7H A;  4TNS A;  2DPE A;  1X6N A;  2DSZ A;  2ZQS A;  4DRH A;  4W9O A;  2AOS A;  1FKK A;  3RME A;  1PIN A;  3RM4 A;  1ZK6 A;  3WH0 A;  1LJY A;  4IQ2 A;  2MLZ A;  4TX0 A;  1HJX A;  3B9A A;  3ARR A;  1NWT A;  3O5J A;  3CZ8 A;  1WNO A;  4ML4 A;  3ART A;  4WKH A;  4MPK A;  1LL6 A;  4R0X A;  4TW6 A;  4Z2L A;  1E15 A;  1E9L A;  1Q1C A;  3ARP A;  2DG4 A;  4QT3 A;  4HBE A;  2PV1 A;  2M08 A;  1LL7 A;  2AWG A;  4P8V A;  4LGX A;  4Q22 A;  4ODL A;  1FJD A;  4J4N A;  2O9O A;  1D2K A;  1W1Y A;  4R5E A;  4Z2K A;  3UQI A;  2PBC A;  3B8S A;  4DIP A;  3WD3 A;  1KFW A;  3JXV A;  4JYS A;  4LAW A;  5B8I C;  4ODN A;  4U85 A;  4ODP A;  3RGC A;  5DF0 A;  5HW7 A;  1JNE A;  3I6C A;  4MNJ A;  4U86 A;  2KI3 A;  2A3B A;  4DRP A;  4LAY A;  1F40 A;  1FKJ A;  2XP3 A;  2XP7 A;  1R9H A;  2FAP A;  5HTG A;  2PPO A;  5GQB A;  3KAH A;  3PRA A;  1BKF A;  3AS2 A;  3NI6 A;  3O5L A;  1W1V A;  1NH6 A;  2OLH A;  3ARU A;  4HAR A;  4DWS C;  3O5D A;  1J4R A;  3OOB A;  4GGQ A;  4JFM A;  1FKI A;  2F4E A;  3IKG A;  1TCO C;  1CTN A;  2YBT A;  2RQS A;  1YW5 A;  2PV2 A;  3KAB A;  3PRB A;  1W9V A;  1E6P A;  3ARZ A;  2PV3 A;  1FFR A;  1D7J A;  3IHZ A;  3LUO A;  3OA5 A;  1ROT A;  1BL4 A;  4Q7N A;  1HXV A;  4C02 B;  2KFW A;  1J6Y A;  2A3C A;  3G6L A;  3ARQ A;  1H0I A;  3H9R B;  3O5M A;  1ZBK A;  1L1P A;  4ZPW R;  3VAW A;  3O5K A;  4TW7 A;  1EHN A;  3CHC A;  3CHD A;  2DT0 A;  4W5U A;  4WKF A;  5HW8 A;  3O5E A;  2FDM A;  2IUZ A;  2RUQ A;  2IF4 A;  3ARX A;  4DRK A;  4S3J A;  3GPK A;  1D6O A;  1NWU A;  3FXY A;  3WQV A;  2YBU A;  3WL0 A;  4WKA A;  1HKI A;  4Z2I A;  4S3K A;  3KAD A;  4MAV A;  2MNT A;  5HT1 A;  4NZC A;  2QF8 A;  3UF8 A;  3O5P A;  1D7I A;  3O5O A;  3CHF A;  2A3E A;  4ZS6 A;  2LKN A;  3ARW A;  2DSW A;  3KAF A;  1FKS A;  4DRO A;  5DIV A;  4ODO A;  1SYT A;  4BF8 A;  4ODM A;  1GUV A;  3CGM A;  3AS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...